Вакцины против hpv



Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
Вакцины против hpv
C12N2710/20022 - Микроорганизмы или ферменты; их композиции (биоциды, репелленты или аттрактанты или регуляторы роста растений, содержащие микроорганизмы, вирусы, микробные грибки, ферменты, агенты брожения или вещества, получаемые или экстрагируемые из микроорганизмов или из материала животного происхождения A01N 63/00; пищевые составы A21,A23; лекарственные препараты A61K; химические аспекты или использование материалов для бандажей, перевязочных средств, впитывающих подкладок или хирургических приспособлений A61L; удобрения C05); размножение, консервирование или сохранение микроорганизмов (консервирование живых тканей или органов людей или животных A01N 1/02); мутации или генная инженерия; питательные среды (среды для микробиологических испытаний C12Q)
C07K2317/526 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2644201:

ВЭКСИБОДИ АС (NO)

Изобретения касаются молекулы нуклеиновой кислоты, кодирующей гомодимерный белок, гомодимерного белка, аминокислотной цепи, способной формировать гомодимерный белок, их применения для получения лекарственного средства, клетки-хозяина, фармацевтической и вакцинной композиций, способа получения гомодимерного белка или аминокислотной цепи и способа получения вакцины. Представленная молекула нуклеиновой кислоты кодирует гомодимерный белок из двух идентичных аминокислотных цепей, каждая из которых включает: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу. Указанная направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1. Указанная антигенная единица включает аминокислотную последовательность, полученную из ранних белков Е6 папилломавируса человека (HPV16) и/или HPV18, и аминокислотную последовательность, полученную из раннего белка Е7 из HPV16 и/или HPV18. Представленные изобретения позволяют индуцировать специфичный и сильный иммунный ответ к HPV посредством презентации АПК клетками иммуногенных эпитопов продуктов генов HPV и могут быть использованы в качестве терапевтических соединений при лечении различных заболеваний, вызванных HPV, таких как раковые опухоли и инфекционные заболевания. 9 н. и 16 з.п. ф-лы, 6 ил., 4 пр.

 

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к терапевтическим соединениям, таким как вакцины против папилломавируса человека (HPV) и, в частности, к ДНК вакцинам против HPV16 и/или HPV18. Изобретение также относится к белковой конструкции, кодирующей гомодимерные пептиды, которые могут высвобождаться из ДНК вакцины или использоваться отдельно. Также описаны фармацевтические композиции, клетки-хозяева и способы получения вакцин, а также способы лечения различных заболеваний, вызванных HPV, таких как раковые опухоли и инфекционные заболевания, согласно применению.

УРОВЕНЬ ТЕХНИКИ

На настоящий момент хорошо известно, что папилломавирус человека (HPV) является причиной рака шейки матки и других HPV-ассоциированных злокачественных новообразований, таких как аногентальные (анальные, вульварные, вагинальные и пенильные) раковые опухоли и подгруппа раковых образований головы и шеи. В частности, HPV16 и HPV18 ответственны за приблизительно 70% всех раковых образований шейки матки во всем мире.

На сегодняшний день на рынке присутствуют две профилактических HPV вакцины (Гардасил и Церварикс). Цель профилактических вакцин состоит в том, чтобы вызывать гуморальные иммунные ответы при стимуляции продукции нейтрализующих антител, специфичных к вирусным капсидным белкам HPV - L1 и L2. Хотя профилактические вакцины являются важной вехой в борьбе с вызванным HPV раком шейки матки и, вероятно, другими HPV-ассоциированными злокачественными новообразованиями, эффект этих вакцин не будет существенно проявляться в течение 20-40 лет (Ma B et al., Current Cancer Therapy Reviews, 2010). Кроме того, поскольку охват массовой вакцинации с применением профилактических вакцин до настоящего времени ограничен, в дополнение к существенному проценту населения во всем мире, которые уже инфицированы HPV, HPV-ассоциированный злокачественные новообразования продолжат прогрессировать. Таким образом, будет важно разработать HPV-специфичные терапевтические вакцины для снижения смертности и распространенности HPV-ассоциированных злокачественных новообразований и предшествующих им повреждений (Ma B et al., Current Cancer Therapy Reviews, 2010).

Разработка различных противораковых вакцин и стратегий иммунотерапии рака в течение двух последних десятилетий расширилась. Впрочем, только одна терапевтическая противораковая вакцина, названная Провендж (Provenge, Dendreon INC), была пока одобрена для применения в качестве стандартной терапии рака предстательной железы. В частности, вследствие этических причин большинство терапевтических противораковых вакцин тестируют на группе больных, имеющих поздние стадии опухоли. Данная группа больных имеет в значительной степени ослабленный иммунитет, подразумевая, что клетки опухоли долгое время избегали воздействия иммунной системы и способствовали развитию иммунологической толерантности к опухоли в процессе канцерогенеза. В дополнение, выбор антигенов (опухолеспецифичных или опухолеассоциированных) применяют, поскольку вакцины крайне важны для индукции опухолеспецифичных иммунных ответов и предотвращения гибели здоровых клеток у пациентов, что может приводить к тяжелым нежелательным проявлениям. Таким образом, главные вызовы в иммунотерапии рака заключаются в устранении иммунологической толерантности и активации опухолеспецифических эффекторных функций, чтобы распознавать и убивать опухолевые клетки. Хотя некоторые клинические случаи демонстрируют клинический ответ на терапевтические противораковые вакцины у пациентов с опухолями поздних стадий, наиболее распространенный основной конечный результат состоит в наблюдении воздействия на общую выживаемость по сравнению с обычной терапией (хирургия, химиотерапия и лучевая терапия). Однако большинство исследований либо не являются заключительными, либо им не удается полностью показать это. Одна из причин получения отрицательных результатов состоит в том, что группа пациентов имеет опухоли конечной стадии, которые было сложно лечить изначально. Возможной стратегией может стать включение в испытания терапевтических вакцин пациентов с опухолями ранних стадий.

Одна из стратегий состоит в направленном воздействии на предраковые поражения. Основные сложности для этой стратегии представляет главным образом нехватка надежных биомаркеров, которые специфически экспрессируются в предраковых поражениях во многих тканях, и плохой медицинский скрининг (который либо не существует, либо существующий метод обеспечивает недостаточную чувствительность). В порядке исключения, в случае HPV-индуцированных злокачественных новообразований дело обстоит иначе. Например, большинство западных стран имеют хорошие программы скрининга дисплазии шейки матки и рака шейки матки, который проводят с помощью теста Папаниколау (мазок Папаниколау). Если мазок Папаниколау дает неясные или аномальные результаты, то проводят кольпоскопию (Национальная Коалиция по Раку шейки матки (NCCC)). HPV-анализ также можно рекомендовать некоторым пациентам для обнаружения присутствия HPV высокого онкогенного риска в предраковом поражении. Таким образом, HPV представляет собой потенциальный биомаркер для HPV-ассоциированных предраковых поражений, в частности внутриэпителиальной дисплазии шейки матки (CIN).

ДНК-вакцины показали растущий потенциал для лечения заболеваний человека, в частности рака. ДНК-вакцины индуцируют сильные антигенспецифичные иммунные ответы, при этом их можно вводить многократно для поддержания мишеньспецифичных иммунных ответов. Такие вакцины, как полагают, являются безопасными, а также простыми и дешевыми в крупномасштабном производстве по сравнению с другими форматами противораковых терапевтических средств. Многочисленные иммунотерапевтические вмешательства не способны индуцировать иммунологическую память. В порядке исключения, ДНК вакцинация гарантирует длительное высвобождение вакцинного продукта in vivo, что усиливает антигенспецифичную иммунологическую память. Прямая доставка антигенов в специализированные антигенпрезентирующие клетки (АПК) стимулирует и CD4+, и CD8+ T-клеточные иммунные ответы in vivo. Такие сильные клеточные иммунные ответы, как было продемонстрировано, специфично распознают и эффективно убивают антигенположительные злокачественные клетки in vitro и in vivo.

В уровне техники сохраняется потребность в улучшенных вакцинах для индукции сильных и специфичных иммунных ответов против HPV, который является причиной как инфекционных заболеваний, так и раковых опухолей.

ЦЕЛЬ ИЗОБРЕТЕНИЯ

Целью вариантов осуществления изобретения является предоставление специфичных и высокоэффективных терапевтических соединений, таких как ДНК-вакцины, против заболеваний и состояний, вызванных HPV.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Авторы настоящего изобретения обнаружили, что при комбинировании антигенов продуктов ранних генов E6 и E7 из HPV, например из HPV16 и/или HPV18 с направляющим модулем hMIP-1α, могут быть получены терапевтические вакцины, в которых сильные иммуногенные эпитопы продуктов генов HPV с высокой эффективностью презентируются АПК клеткам, с индукцией специфичного и сильного иммунного ответа. Продукты согласно настоящему изобретению, прежде всего, предполагаются в качестве терапевтических вакцин на основе нуклеиновых кислот, например ДНК-вакцин, в которых конструкция нуклеиновой кислоты, кодирующая Vaccibody конструкцию, используется в качестве терапевтического соединения, ведущего к in vivo продукции белкового продукта в организме лица, получающего вакцину. Впрочем, в качестве альтернативы, сам белковый продукт может быть включен в композицию и использован непосредственно в вакцине.

Таким образом, в первом аспекте настоящее изобретение относится к гомодимерному белку из двух идентичных аминокислотных цепей, при этом каждая аминокислотная цепь включает: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив, и (4) антигенную единицу, где указанная направляющая единица включает аминокислотную последовательность, обладающую по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO:1, и антигенная единица включает аминокислотную последовательность папилломавируса человека (HPV), например, антигенная единица включает аминокислотную последовательность HPV16 и/или HPV18, например, антигенная единица получена из ранних белков E6 и/или E7 HPV16 и/или HPV18.

Во втором аспекте настоящее изобретение относится к аминокислотной цепи, включающей: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, где указанная направляющая единица включает аминокислотную последовательность, обладающую по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO:1, и антигенная единица включает аминокислотную последовательность папилломавируса человека (HPV), например, антигенная единица включает аминокислотную последовательность HPV16 и/или HPV18, например, антигенная единица получена из ранних белков E6 и/или E7 HPV16 и/или HPV18, где указанная аминокислотная цепь способна формировать гомодимерный белок согласно изобретению.

В третьем аспекте настоящее изобретение относится к молекуле нуклеиновой кислоты, такой как ДНК, кодирующей аминокислотную цепь, включающую: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, где указанная направляющая единица включает аминокислотную последовательность, обладающую по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO:1, и антигенная единица включает аминокислотную последовательность папилломавируса человека (HPV), например, антигенная единица включает аминокислотную последовательность HPV16 и/или HPV18, например, антигенная единица получена из ранних белков E6 и/или E7 HPV16 и/или HPV18, где указанная аминокислотная цепь способна формировать гомодимерный белок согласно изобретению.

В другом аспекте настоящее изобретение относится к гомодимерному белку согласно изобретению или аминокислотной цепи согласно изобретению, или молекуле нуклеиновой кислоты согласно изобретению для применения в качестве лекарственного средства.

В другом аспекте настоящее изобретение относится к фармацевтической композиции, включающей гомодимерный белок согласно изобретению или аминокислотную цепь согласно изобретению, или молекулу нуклеиновой кислоты согласно изобретению.

В другом аспекте настоящее изобретение относится к клетке-хозяину, включающей молекулу нуклеиновой кислоты согласно изобретению.

В другом аспекте настоящее изобретение относится к способу получения гомодимерного белка согласно изобретению или аминокислотной цепи согласно изобретению, где способ включает: a) трансфекцию молекулы нуклеиновой кислоты согласно изобретению в популяцию клеток; b) культивирование популяции клеток; c) сбор и очистку гомодимерного белка или аминокислотной цепи, экспрессируемой популяцией клеток.

В другом аспекте настоящее изобретение относится к способу получения вакцины, такой как ДНК-вакцина, включающей иммунологически эффективное количество молекулы нуклеиновой кислоты согласно изобретению, где способ включает: a) получение молекулы нуклеиновой кислоты согласно изобретению; b) растворение молекулы нуклеиновой кислоты, полученной в этапе a) в фармацевтически приемлемом носителе, растворителе или буфере.

В другом аспекте настоящее изобретение относится к вакцине против HPV, включающей иммунологически эффективное количество гомодимерного белка согласно изобретению или аминокислотной цепи согласно изобретению, или молекуле нуклеиновой кислоты, такой как ДНК, согласно изобретению, где указанная вакцина способна индуцировать и T-клеточный, и B-клеточный иммунный ответ.

В другом аспекте настоящее изобретение относится к способу лечения или предотвращения вызванного HPV заболевания или состояния, такого как рак или инфекционное заболевание, вызванное HPV у пациента, где способ включает введение пациенту, нуждающемуся в этом, гомодимерного белка согласно изобретению, или аминокислотной цепи согласно изобретению, или молекулы нуклеиновой кислоты, такой как ДНК, согласно изобретению.

ОБОЗНАЧЕНИЯ НА ФИГУРАХ

Фиг. 1: Общая структура vaccibody вакцин со слитым антигеном E7/E6. Показаны и ДНК, и белковый форматы. Vaccibody состоит из трех функциональных модулей; хемокин человека MIP-1α (LD78β) в направляющем модуле, шарнирная и CH3 последовательности из IgG3 человека в димеризационном модуле и слитая конструкция полноразмерного E7 и/или E6 в вакцинном модуле.

Фиг. 2: Предполагаемый механизм действия Vaccibody ДНК вакцины против вызванных HPV злокачественных новообразований. Оголенную ДНК-плазмиду, кодирующую vaccibody, вводят внутрикожно с последующей электропорацией. Плазмида поглощается локальными клетками и белки vaccibody продуцируются и секретируются. хемотаксические направляющие модули привлекают CCR1- и CCR5-экспрессирующие антигенпрезентирующие клетки (АПК) и обеспечивают связывание и захват дендритными клетками (ДК). ДК презентируют антигенные пептиды CD4+ и CD8+ T-клеткам, и CD8+ T-клетки убивают HPV инфицированные и трансформированные клетки в шейке матки.

Фиг. 3: Результаты ELISPOT, показывающие количество E7 и E6 специфичных T-клеточных ответов в зависимости от различных вводимых количеств вакцины. Мышам C57BL/6 вводили в/к оголенные ДНК-плазмиды, кодирующие VB1009 и VB1016, и соответствующий контроль с последующей электропорацией (Cellectis, France) в день 0 и день 7. Спленоциты собирали в день 21 и стимулировали MHC класса I рестриктированным пептидом E7 или E6 в течение 24 ч. Количество IFNγ-секретирующих спленоцитов вычисляли с помощью ELISPOT. (A) E7-специфичные ответы после в/к вакцинации 25 мкг VB1009, контроля 1 (только антиген) и pUMVC4a (пустой вектор). (B) E7-специфичные ответы после в/к вакцинации 12,5 и 1,4 мкг VB1016, контроля 2 (только антиген) и pUMVC4a (пустой вектор). (C) E6-специфичные ответы после в/к вакцинации 12,5 и 1,4 мкг VB1016, контроля 2 (только антиген) и pUMVC4a (пустой вектор).

Фиг. 4: Терапевтический эффект VB1016, показанный путем измерения объема опухоли. Мышам C57BL/6 п/к вводили 5×105 клеток TC-1 в день 0. В день 3 и день 10 мышам в/к вводили 12,5 мкг оголенной ДНК-плазмиды, кодирующей VB1016, контроля 2 или пустого вектора, с последующей электропорацией (Cellectis, France). Размеры опухоли измеряли с помощью штангенциркуля два-три раза в неделю и вычисляли объем опухоли.

Фиг. 5: Терапевтический эффект VB1016, показанный по измеренному объему опухоли. Мышам C57BL/6 вводили п/к в области шеи 5×104 клеток TC-1 в день 0. В день 3, 7 и день 10 мышам в/к вводили 20 мкг или 2 мкг оголенных ДНК-плазмид, кодирующих VB1016, контроля 2 или пустого вектора, с последующей электропорацией (Cellectis, France). Размеры опухоли измеряли штангенциркулем два-три раза в неделю и вычисляли объем опухоли.

Фиг. 6: Терапевтический эффект VB1020 и VB1021, показанный по измеренному объему опухоли. Мышам C57BL/6 вводили п/к в бедро 5×104 клеток TC-1 в день 0. В день 3 и день 10 мышам в/к вводили 10 мкг оголенных ДНК-плазмид, кодирующих VB1016, VB1020, VB1021 или пустой вектор, с последующей электропорацией (Cellectis, France). Размеры опухоли измеряли штангенциркулем два-три раза в неделю и вычисляли объем опухоли.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Конструкции и технология ДНК-вакцин, описанные в настоящей заявке авторами настоящего изобретения (также называемые "vaccibody" (или вакцитело) молекулы/вакцины/конструкции) представляют собой новую вакцинную стратегию, позволяющую индуцировать сильные и специфичные иммунные ответы, как против инфекционных заболеваний, так и против рака. HPV E6/E7, например HPV16 или HPV18 E6/E7 вакцину, описанную в настоящей заявке, можно вводить как ДНК-вакцину с помощью внутрикожной инъекции, предпочтительно сопровождаемой электропорацией. Такие результаты при поглощении конструкции ДНК, кодирующей vaccibody-HPV16 и/или HPV18 E6/E7 вакцину в клетках на участке инъекции (кожи), включающем дендритные клетки (клетки Лангерганса), ведут к in vivo продукции vaccibody-E6/E7 молекулы.

Продукты ранних генов, E6 и E7, типов HPV "высокого риска", таких как HPV16 и 18, могут быть ответственны за перерождение клеток основного эпителия и индукцию предраковых поражений. Оба белка состоят из высокоиммуногенных эпитопов и, как показано в настоящем описании, индуцируют сильные иммунные ответы, ведущие к специфичной ликвидации представляющих высокий риск HPV-положительных опухолевых клеток in vitro и in vivo.

Молекула vaccibody (или вакцитела), описанная в настоящей заявке, представляет собой гомодимер, состоящий из трех модулей: направляющего модуля, димеризационного модуля и вакцинного модуля (Фиг. 1). Гены, кодирующие три указанных модуля, подвергнуты генно-инженерной манипуляции для того, чтобы они экспрессировались в виде одного гена. При экспрессии in vivo, молекула вакцитела направленно взаимодействует с антигенпрезентирующими клетками (АПК), что приводит к повышенной эффективности вакцины по сравнению с идентичными, не направленными антигенами. In vivo экспрессия хемокина, человеческого макрофагального воспалительного белка 1 альфа (hMIP-1α/LD78β), приводит к привлечению ДК, нейтрофилов и других иммунных клеток, несущих рецепторы CCR1 и CCR5, к участку экспрессии. Таким образом, молекула вакцитела, состоящая из hMIP-1α в качестве направляющего модуля, будет не только направлять антигены к специфическим клеткам, но при этом также обеспечивать эффект усиления ответа (адъювантный эффект) посредством рекрутинга специфических иммунных клеток в участок инъекции. Этот уникальный механизм может иметь колоссальное значение в клинических условиях, когда пациенты могут получать вакцину без каких-либо дополнительных адъювантов, поскольку вакцина сама обеспечивает адъювантный эффект.

Авторами настоящего изобретения в настоящей заявке описаны вакцинные конструкции, в которых антигенный модуль состоит из полноразмерной генетической последовательности E7, слитой с полноразмерной последовательностью E6, происходящей из подтипа HPV16 ИЛИ HPV18. Преимущество данного формата состоит в том, что и E6, и E7 будут присутствовать в одной конструкции и смогут, таким образом, одинаково экспрессироваться in vivo. Следовательно, одна молекула вакцитела, состоящая из мультиантигенной единицы, может предоставлять иммунной системе равные уровни E6 и E7. Продукты генов HPV16, E6 и E7, в своей естественной форме являются онкогенными. Для нейтрализации их онкогенных свойств, на определенных участках в генетическую последовательность E6 и E7 могут быть введены мутации.

Мутации, включая делеции, могут быть введены в определенные участки, мутации в которых, как известно, ингибируют онкогенные свойства E6 и E7, например, в любые участки, описанные в любом из следующих источников: Dalal S et al., J Virol, 1996; Münger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Münger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gov/COMPENDIUM_PDF/97PDF/3/E7.pdf); Nguyen, M et al., J Virol, 2002; Nomine Y et a., Molecular Cell, 2006; Moody C et al., Nat Rev Cancer, 2010, Polakova I et al., Vaccine, 2010; Xie Q, Virologica Sinica, 2011; Mesplede T et al., J Virol, 2012; US 2008/0102084 и US 6306397, которые настоящим включены посредством отсылки. Таким образом, в некоторых аспектах изобретения, конструкции согласно настоящему изобретению содержат HPV16 E6, E7 или HPV16 E6/E7 химерные конструкции с одной или более мутациями в HPV16 E6 и/или E7, в положении, мутация в котором, как известно, ингибирует онкогенные свойства, как описано в Dalal S et al., J Virol, 1996; Münger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Münger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gOv/COMPENDIUM_PDF/97PDF/3/E7.pdf); Nguyen, M et al., J Virol, 2002; Nomine Y et a., Molecular Cell, 2006; Moody C et al., Nat Rev Cancer, 2010, Polakova I et al., Vaccine, 2010; Xie Q, Virologica Sinica, 2011; Mesplede T et al., J Virol, 2012; US 2008/0102084 или US6306397. В других аспектах изобретения, конструкции согласно настоящему изобретению содержат HPV18 E6, E7 или HPV18 E6/E7 химерные конструкции с одной или более мутациями в HPV18 E6 и/или E7, в положении, мутация в котором, как известно, ингибирует онкогенные свойства, как описано в Dalal S et al., J Virol, 1996; Münger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Münger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gov/COMPENDIUM_PDF/97PDF/3/E7.pdf); Moody C et al., Nat Rev Cancer, 2010, US 2008/0102084 и US6306397.

Существует возможность, что молекула вакцитела (направляющий и димеризационный модули) может ликвидировать онкогенные свойства белков E6 и E7 дикого типа в конечном слитом белке. Таким образом, в еще одном аспекте изобретения предложено применение полноразмерных последовательностей E6 и/или E7 дикого типа в конструировании вакцитела.

В изобретении описано несколько вариантов Vaccibody HPV терапевтических ДНК-вакцин, которые основаны на общем формате, описанном на Фиг. 1, терапевтические vaccibody-HPV ДНК-вакцины кодируют гены, которые естественно экспрессируются у человека; гены направляющего модуля кодируют хемокин hMIP-1α, который связывается со своими когнатными рецепторами, CCR1 и CCR5, экспрессируемыми на поверхности клеток АПК. Гены димеризационного модуля могут кодировать шарнирные области и константную область 3 тяжелой цепи, например из IgG3 человека, которые соединяют два мономера вакцитела с формированием гомодимерной молекулы. Гены, кодирующие вакцинный модуль для текущей стратегии, состоят из антигенов HPV, такого как HPV16 и/или HPV18, E7 и E6, таких как полноразмерные антигены HPV16 E7 и E6, необязательно включающих одну или более мутаций с целью ингибировать онкогенные свойства. После введения in vivo с помощью в/к инъекции, сопровождаемой электропорацией, клетки кожи, принимающие вакцинную конструкцию, будут экспрессировать vaccibody-HPV молекулу. Продуцируемые in vivo vaccibody-вакцины направленно взаимодействуют с CCR1 и CCR5, экспрессируемыми на поверхности АПК в коже, в частности ДК. Связывание молекулы вакцитела со своими когатными рецепторами приводит к интернализации комплекса в АПК, деградации белков с образованием малых пептидов, которые загружаются на молекулы MHC и презентируются CD4+ и CD8+ T-клеткам, индуцируя HPV16 E6 и E7 специфичные иммунные ответы. После стимуляции и при посредстве активированных CD4+ T-клеток, CD8+ T-клетки будут направляться и убивать клетки, экспрессирующие E6 и E7 HPV16 (Фиг. 2). Такие усиленные иммунные ответы на вакцину с "встроенным" адъювантным эффектом потенциально могут преодолеть ускользание опухоли (ускользание опухоли от воздействия иммунной системы) в результате устранения иммунологической толерантности и обеспечить эффективный цитолиз злокачественных клеток. Направляющая единица hMIP-1α может быть связана через димеризационный мотив, такой как шарнирная область, с антигенной единицей, причем связывание происходит либо по COOH-концу, либо по NH2-концу. Настоящее изобретение относится не только к последовательности ДНК, кодирующей данный рекомбинантный белок, но также и к векторам экспрессии, включающим указанные последовательности ДНК, линиям клеток, включающим указанные векторы экспрессии, к лечению млекопитающих, предпочтительно с помощью иммунизации посредством ДНК Vaccibody, РНК Vaccibody, или белка Vaccibody, и, наконец, к фармацевтическим препаратам и набору, включающему указанные молекулы.

Димеризационный мотив в белках согласно настоящему изобретению может быть сконструирован таким образом, что он включает шарнирную область и домен иммуноглобулина (например, домен Cγ3), например, C-концевой C домен (домен CH3), или последовательность, которая по существу идентична указанному C домену. Шарнирная область может быть получена из Ig и способствует димеризации в результате формирования межцепочечной ковалентной связи(ей), например дисульфидного мостика(ов). В дополнение, он функционирует как гибкий спейсер между доменами, позволяя двум направляющим единицам одновременно связываться с двумя молекулами-мишенями на АПК, экспрессируемыми на различных расстояниях. Домены иммуноглобулина вносят вклад в гомодимеризацию посредством нековалентных взаимодействий, например гидрофобных взаимодействий. В предпочтительном варианте осуществления домен CH3 получен из IgG. Такие димеризационные мотивы могут быть заменены другими мультимеризационными молекулами (например, из Ig других изотипов/подклассов). Предпочтительно димеризационный мотив получен из нативных человеческих белков, таких как IgG человека.

Следует понимать, что димеризационный мотив может иметь любую ориентацию относительно антигенной единицы и направляющей единицы. В одном варианте осуществления антигенная единица находится на COOH-конце димеризационного мотива, при этом направляющая единица находится на N-конце димеризационного мотива. В другом варианте осуществления антигенная единица находится на N-конце димеризационного мотива, а направляющая единица - на COOH-конце димеризационного мотива.

В международной заявке WO 2004/076489, которая настоящим включена посредством отсылки, раскрыты последовательности нуклеиновых кислот и векторы, которые могут применяться согласно настоящему изобретению.

Белки согласно настоящему изобретению включают антигенную единицу, полученную из HPV, такую как антигены E7 и E6 HPV16, такие как полноразмерные антигены E7 и E6 HPV16, а также их иммуногенные фрагменты или варианты. Антигенная последовательность должна иметь достаточную длину. Минимальная длина такой антигенной единицы может составлять приблизительно 9 аминокислот. Таким образом, в некоторых вариантах осуществления, антигенная единица, полученная из HPV, включает аминокислотную последовательность длиной по меньшей мере 9 аминокислот, соответствующих по меньшей мере приблизительно 27 нуклеотидам в последовательности нуклеиновых кислот, кодирующей такую антигенную единицу. Предпочтительно антигенная единица, полученная из HPV, значительно более длинная, например, является такой как полноразмерные антигены E7 и E6 HPV16. Разнообразие возникает в пределах данного генотипа HPV в результате ограниченных нуклеотидных изменений в кодирующих (с частотой <2%) и некодирующих (с частотой <5%) областях (Bernard, HU et al., Int J Cancer, 2006). Такие варианты филогенетически расщепляются на основе их географического происхождения и поэтому их обозначают как Европейский, Африканский, Азиатский, Американо-азиатский и Северо-американский. Вставка таких последовательностей в формат Vaccibody может приводить к активации обоих механизмов иммунного ответа.

Способы иммунизации посредством белка Vaccibody, ДНК Vaccibody или РНК Vaccibody, причем две последние выполняют, например, путем внутримышечной или внутрикожной инъекции, с или без последующей электропорации, являются целесообразными способами согласно настоящему изобретению.

Как обсуждается выше, настоящее изобретение относится к вакцинной композиции против рака или инфекционных заболеваний, вызванных HPV, вакцинная композиция включает иммунологически эффективное количество нуклеиновой кислоты, кодирующей молекулу изобретения или соответствующие вырожденные варианты. Вакцина может быть способна индуцировать как T-клеточный, так и B-клеточный иммунный ответ. Настоящее изобретение также относится к набору, включающему Vaccibody ДНК, РНК или белок в диагностических, медицинских или научных целях.

Изобретение также относится к способу получения рекомбинантной молекулы изобретения, включающему трансфекцию вектора, включающего молекулу изобретения, в популяцию клеток; культивирование популяции клеток; сбор рекомбинантного белка, экспрессированного популяцией клеток; и очистку экспрессированного белка.

Описанные выше нуклеотидные последовательности могут быть встроены в вектор, подходящий для генной терапии, например, под контролем определенного промотора, и введены в клетки. В некоторых вариантах осуществления вектор, включающий указанную последовательность ДНК, является вирусом, например аденовирусом, вирусом осповакцины или аденоассоциированным вирусом. В некоторых вариантах осуществления в качестве вектора используются ретровирусы. Примерами подходящих ретровирусов являются, например, MoMuLV или HaMuSV. В целях генной терапии, последовательности ДНК/РНК согласно изобретению также могут транспортироваться в клетки-мишени в форме коллоидной дисперсии. Они включают, например, липосомы или липоплексы.

Настоящее изобретение охватывает применение направляющей единицы, а также антигенной единицы, имеющей минимальную степень идентичности последовательности или гомологии последовательности с аминокислотной последовательностью(ями), определенными в настоящем описании, или с полипептидом, обладающим определенными свойствами, которые определены в настоящем описании. Настоящее изобретение охватывает, в частности, применение пептидных вариантов или пептидных единиц, используемых в конструкциях согласно настоящему изобретению, обладающих некоторой степенью идентичности последовательности с любой из SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34. В данном случае, термин "вариант" означает единицу, обладающую некоторой степенью идентичности последовательности с рассматриваемыми аминокислотными последовательностями или рассматриваемыми нуклеотидными последовательностями, где рассматриваемая аминокислотная последовательность предпочтительно представляет собой SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33 или SEQ ID NO:34.

В одном аспекте, вариант или фрагмент аминокислотной последовательности и/или нуклеотидной последовательности должны обеспечивать и/или кодировать полипептид, который сохраняет функциональную активность и/или повышает активность полипептида SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34.

В настоящем контексте считается, что вариант последовательности включает аминокислотную последовательность, которая может быть по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 96%, по меньшей мере на 97%, по меньшей мере на 98% или по меньшей мере на 99% идентична рассматриваемой последовательности. Как правило, варианты, используемые согласно настоящему изобретению, будут включать те же активные сайты и т.д., что и рассматриваемая аминокислотная последовательность. Хотя гомологию также можно рассматривать в значении подобия (то есть аминокислотные остатки, обладающие аналогичными химическими свойствами/функциями), в рамках настоящего изобретения предпочтительно выражать гомологию в значении идентичности последовательности.

Сравнения идентичности последовательности могут проводить визуально или, еще чаще, при помощи общедоступных компьютерных программ для сравнения последовательностей. В таких коммерчески доступных компьютерных программах используются сложные алгоритмы сравнения для выравнивания двух или более последовательностей, которые лучше всего отражают эволюционные события, которые, возможно, привели к появлению различия(й) между этими двумя или более последовательностями. Таким образом, указанные алгоритмы работают с системой оценки, поощряющей выравнивание идентичных или подобных аминокислот и штрафующей вставки пропусков, продолжение пропуска и выравнивание несовпадающих аминокислот. Система оценки алгоритмов сравнения включает:

i) присвоение штрафной оценки при каждом включении пропуска (штрафа за пропуск),

ii) присвоение штрафной оценки при каждом продолжении существующего пропуска на дополнительное положение (штраф за продолжение пропуска),

iii) присвоение высоких оценок при выравнивании идентичных аминокислот, и

iv) присвоение переменных оценок при выравнивании неидентичных аминокислот.

Большинство программ выравнивания позволяет изменять штрафы за пропуски. Впрочем, при использовании таких программ для сравнений последовательностей предпочтительно использовать значения по умолчанию.

Оценки, которые даются за выравнивание неидентичных аминокислот, присваивают согласно оценочной матрице, также называемой матрицей замен. Оценки, получаемые в таких матрицах замен, отражают тот факт, что подобие одной аминокислоты, заменяемой другой аминокислотой в ходе развития, изменяется и зависит от физической/химической природы заменяемой аминокислоты. Например, вероятность замены полярной аминокислоты другой полярной аминокислотой выше, нежели вероятность ее замены гидрофобной аминокислотой. Таким образом, оценочная матрица присваивает наивысшую оценку за идентичную аминокислоту, более низкую оценку за неидентичную, но подобную аминокислоту, и еще более низкую оценку за неидентичные неподобные аминокислоты. Наиболее часто используются такие оценочные матрицы, как матрицы PAM (Dayhoff et al. (1978), Jones et al. (1992)), матрицы BLOSUM (Henikoff and Henikoff (1992)) и матрица Gonnet (Gonnet et al. (1992)).

Подходящие компьютерные программы для выполнения такого выравнивания включают, без ограничения, Vector NTI (Invitrogen Corp.), а также программы ClustalV, ClustalW и ClustalW2 (Higgins DG & Sharp PM (1988), Higgins et al. (1992), Thompson et al. (1994), Larkin et al. (2007)). Выбор других инструментов выравнивания доступен с сервера ExPASy Proteomics по адресу www.expasy.org. Другим примером программы, которая может выполнять выравнивание последовательностей, является BLAST (Basic Local Alignment Search Tool), который доступен со страницы Национального Центра Биотехнологической Информации (NCBI), которую в настоящее время можно найти по адресу http://www.ncbi.nlm.nih.gov/, и который впервые был описан в статье Altschul et al. (1990) J. Mol. Biol. 215; 403-410.

После построения выравнивания программой может быть вычислен % подобия и % идентичности последовательности. Программное обеспечение обычно выполняет это как часть сравнения последовательности и производит числовой результат.

В одном варианте осуществления для выполнения выравниваний последовательностей предпочтительно использовать программное обеспечение ClustalW. Предпочтительно, выравнивание с помощью ClustalW выполняют со следующими параметрами для парного выравнивания:

Матрица замен Gonnet 250
Штраф за введение пропуска 20
Штраф за продолжение пропуска 0,2
Штраф за окончание пропуска нет

ClustalW2 доступна, например, в Интернете на сайте Европейского Института Биоинформатики на странице EMBL-EBI www.ebi.ac.uk по вкладке tools - sequence analysis - ClustalW2. В настоящее время точный адрес инструмента ClustalW2 - www.ebi.ac.uk/Tools/clustalw2.

В другом варианте осуществления для выполнения выравнивания последовательностей предпочтительно использовать программу Align X в Vector NTI (Invitrogen). В одном варианте осуществления Exp10 может использоваться с параметрами настройки по умолчанию:

Штраф за введение пропуска: 10

Штраф за продолжение пропуска: 0,05

Диапазон штрафа за разделение пропуска: 8

Матрица оценок: blosum62mt2

Таким образом, настоящее изобретение также охватывает применение вариантов, фрагментов и производных любой аминокислотной последовательности белка, полипептида, мотива или домена, как определено в настоящей заявке, в особенности таковые из SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34.

Последовательности, в особенности последовательности вариантов, фрагментов и производных SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34, также могут иметь делеции, вставки или замены аминокислотных остатков, которые производят молчащее изменение и приводят к функционально эквивалентному веществу. Преднамеренные аминокислотные замены могут быть сделаны на основе подобия по полярности, заряду, растворимости, гидрофобности, гидрофильности и/или амфифильной природе остатков, при условии сохранения вторичной связывающей активности вещества. Например, отрицательно заряженные аминокислоты включают аспарагиновую кислоту и глутаминовую кислоту; положительно заряженные аминокислоты включают лизин и аргинин; и аминокислоты с незаряженными полярными концевыми группами, имеющими сходные значения гидрофильности, включают лейцин, изолейцин, валин, глицин, аланин, аспарагин, глутамин, серин, треонин, фенилаланин и тирозин.

Настоящее изобретение также охватывает консервативную замену (замена и замещение используются в настоящем описании для обозначения обмена присутствующего аминокислотного остатка на альтернативный остаток), которая может произойти, то есть замену подобного подобным, такую как основный на основный, кислотный на кислотный, полярный на полярный и т.д. Также может происходить неконсервативная замена, то есть замена остатка одного класса остатком другого класса или, альтернативно, она может включать введение неприродных аминокислот, таких как орнитин (в дальнейшем обозначаемый как Z), диаминомасляная кислота орнитин (в дальнейшем обозначаемый как B), норлейцин орнитин (в дальнейшем обозначаемый как O), пириилаланин, тиенилаланин, нафтилаланин и фенилглицин.

Консервативные замены, которые могут быть сделаны, производят, например, в рамках групп основных аминокислот (аргинин, лизин и гистидин), кислотных аминокислот (глутаминовая кислота и аспарагиновая кислота), алифатических аминокислот (аланин, валин, лейцин, изолейцин), полярных аминокислот (глутамин, аспарагин, серин, треонин), ароматических аминокислот (фенилаланин, триптофан и тирозин), гидроксиаминокислот (серин, треонин), крупных аминокислот (фенилаланин и триптофан) и малых аминокислот (глицин, аланин).

Замены также могут быть сделаны неприродными аминокислотами и включают; альфа* и альфа-дизамещенные* аминокислоты, N-алкиламинокислоты*, молочную кислоту*, галогенпроизводные природных аминокислот, такие как трифтортирозин*, п-Cl-фенилаланин*, п-Br-фенилаланин*, п-I-фенилаланин*, L-аллил-глицин*, β-аланин*, L-α-аминомасляную кислоту*, L-γ-аминомасляную кислоту*, L-α-аминоизомасляную кислоту*, L-ε-аминокапроновую кислоту#, 7-аминогептановую кислоту*, L-метионин-сульфон#*, L-норлейцин*, L-норвалин*, п-нитро-L- фенилаланин*, L-гидроксипролин#, L-тиопролин*, метильные производные фенилаланина (Рhе), такие как 4-метил-Рhе*, пентаметил-Phe*, L-Рhе (4-амино)#, L-Tyr (метил)*, L-Phe (4-изопропил)*, L-Tic (1,2,3,4-тетрагидроизохинолин-3-карбоновая кислота)*, L-диаминопропионовую кислоту* и L-Phe (4-бензил)*. Обозначение * использовано в рамках представленного выше обсуждения (относительно гомологичной и неконсервативной замены) для указания гидрофобной природы производного, тогда как обозначение # использовано для указания гидрофильной природы производного, #* указывает на амфипатические характеристики.

Вариант аминокислотных последовательностей может включать подходящие спейсерные группы, которые можно встраивать между любыми двумя аминокислотными остатками последовательности, в том числе алкильные группы, такие как метильную, этильную или пропильную группы, в дополнение к аминокислотным спейсерам, таким как остатки глицина или β-аланина. Другая форма вариации, которая включает присутствие одного или большего количества аминокислотных остатков в пептоидной форме, хорошо известна специалистам в данной области. Во избежание сомнений "пептоидная форма" используется для обозначения варианта аминокислотных остатков, где группа-заместитель α-атома углерода находится на атоме азота данного остатка, а не на α-атоме углероде. Способы получения пептидов в пептоидной форме известны в уровне техники (например, Simon RJ et al. (1992), Horwell DC. (1995)).

В одном варианте осуществления вариант направляющей единицы, используемой в гомодимерном белке согласно настоящему изобретению, представляет собой вариант, имеющий последовательность аминокислот, которая обладает по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 96%, по меньшей мере 97%, по меньшей мере 98% или по меньшей мере 99% идентичности аминокислотной последовательности с ними.

В одном аспекте, белок или последовательность, используемые в настоящем изобретении, предпочтительно находятся в очищенной форме. Термин "очищенный" означает, что данный компонент присутствует на высоком уровне. Компонент желательно является преобладающим активным компонентом, присутствующим в композиции.

"Вариант" или "варианты" относятся к белкам, полипептидам, единицам, мотивам, доменам или нуклеиновым кислотам. Термин "вариант" может использоваться попеременно с термином "мутант". Варианты включают вставки, замены, трансверсии, усечения и/или инверсии в одном или более положениях аминокислотной или нуклеотидной последовательности, соответственно. Фразы "вариант полипептида", "полипептид", "вариант" и "вариант фермента" означают полипептид/белок, который имеет аминокислотную последовательность, которая была изменена с аминокислотной последовательности SEQ ID NO:1. Варианты полипептидов включают полипептид, имеющий некоторый процент, например, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%, идентичности последовательности с аминокислотной последовательностью SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34.

"Варианты нуклеиновых кислот" могут включать последовательности, которые комплементарны последовательностям, способным к гибридизации с нуклеотидными последовательностями, представленными в настоящем описании. Например, вариант последовательности комплементарен последовательностям, способным к гибридизации в строгих условиях, например, 50°C и 0,2×SSC (1×SSC=0,15М NaCl, 0,015М цитрат натрия, pH 7,0), с нуклеотидными последовательностями, представленными в настоящем описании. Более конкретно, термин вариант охватывает последовательности, которые комплементарны последовательностям, способным к гибридизации в очень строгих условиях, например, 65°C и 0,1×SSC, с нуклеотидными последовательностями, представленными в настоящем описании. Точка плавления (Тп) варианта нуклеиновой кислоты может быть приблизительно на 1, 2 или 3°C ниже, чем Тп нуклеиновой кислоты дикого типа. Варианты нуклеиновых кислот включают полинуклеотид, имеющий некоторый процент, например, 80%, 85%, 90%, 95% или 99%, идентичности последовательности с нуклеиновой кислотой SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32 или SEQ ID NO:34, кодирующей мономерный белок, который может формировать гомодимерный белок согласно изобретению.

Определенной категорией мутаций являются мутации в E6 и E7

Белок E6 можно детоксифицировать, делая невозможным связывание p53. Пять положений в полноразмерном белке E6 HPV16 являются сайтами мутаций для инактивации функциональных свойств E6, F47, L50, C63, C106 и I128. Любая аминокислотная замена в этих положениях может приводить к инактивации E6 и вызывает супрессию опухоли. Потенциально могут использоваться замены в любом из указанных положений на любую другую аминокислоту. Сайты потенциальных мутаций показаны в SEQ ID NO:22.

В белке E7 присутствуют консервативные области, связанные с онкогенными свойствами (см. Phelps et al J. Virol. April 1992, vol.66, no. 42418-242; Gulliver et al J Virol.1997, August; 71(8)), в том числе N-концевой мотив Rb (ретинобластома-связывающий белок) связывающего сайта (LXCXE) и две консервативные области 3 (3ʹ и 5ʹ) с цинк-связывающим мотивом (CXXC). Предпочтительными сайтами мутаций в LXCXE-мотиве являются C24 и E26. Предпочтительными сайтами в двух мотивах CXXC являются C58, C61, C91 и C94. Впрочем, любые мутации в этих областях могут быть предусмотрены для замены с целью снижения связывающих функций и, таким образом, устранения онкогенных эффектов E7. Сайты потенциальных мутаций показаны в SEQ ID NO:23.

Сигнальный пептид:

Сигнальный пептид на N-конце синтезируемого полипептида направляет молекулу в ЭР перед транспортом в комплекс Гольджи. Сигнальный пептид отщепляется под действием сигнальной пептидазы после выполнения своей функции, состоящей в направлении и импорте белка в ЭР. Указанные сигнальные пептиды обычно имеют длину 15-30 аминокислот, но могут содержать более 50 остатков (Martoglio, B. et al., Trends in Cell Biology, 1998, Knappskog, S. et al., J Biotechnol, 2007). Нативный сигнальный пептид может быть заменен сигнальными пептидами из любого млекопитающего, прокариотического или морского организма. Обычно используются сигнальные пептиды, например, IL-2 человека и альбумина человека из-за их природной способности секретировать большие количества белка. Выбор сигнального пептида может оказывать значительное влияние на количество синтезируемого и секретируемого белка.

В некоторых вариантах осуществления, сигнальный пептид, используемый в конструкции белка согласно настоящему изобретению, получен из белкового хемокина, как, например, сигнальная последовательность LD78beta.

В некоторых вариантах осуществления сигнальный пептид не получен из pLNOH2 (B1-8 лидерная последовательность вариабельной области иммуноглобулина), раскрытого в международной заявке PCT/EP2011/060628.

В некоторых вариантах осуществления сигнальный пептид получен не из гена иммуноглобулина.

Термин "гомодимерный белок", при использовании в настоящем описании, относится к белку, включающему две отдельные идентичные аминокислотные цепи, или субъединицы, соединенные вместе в один димерный белок водородными связями, ионными взаимодействиями (заряженных групп), фактическим ковалентным дисульфидным мостиком или некоторой комбинацией перечисленных взаимодействий.

Термин "димеризационный мотив", при использовании в настоящем описании, относится к последовательности аминокислот между антигенной единицей и направляющей единицей и включает шарнирную область и необязательный второй домен, который может участвовать в димеризации. Указанный второй домен может быть доменом иммуноглобулина, при этом, необязательно, шарнирная область и второй домен связаны через линкер. Таким образом, димеризационный мотив служит для соединения антигенной единицы и направляющей единицы, но также содержит шарнирную область, которая способствует димеризации двух мономерных белков в гомодимерный белок согласно изобретению.

Термин "направляющая единица", при использовании в настоящем описании, относится к единице, которая доставляет белок с его антигеном в мышиные или человеческие АПК для MHC класса-II рестриктированной презентации CD4+ T-клеткам или для обеспечения перекрестной презентации CD8+ T-клеткам при MHC класса-I рестрикции. Направляющая единица, применяемая в конструкциях согласно настоящему изобретению, получена из, или идентична, зрелому LD78-бета.

Термин "антигенная единица", при использовании в настоящем описании, относится к любой молекуле, такой как пептид, который может специфично распознаваться антителом или другим компонентом иммунной системы, таким как поверхностный рецептор на T-клетках. В рамки данного определения также входят иммуногены, которые способны вызывать иммунный ответ. Термины "эпитоп" или "антигенный эпитоп" используются для обозначения определенной молекулярной поверхности, такой как молекулярная поверхность, сформированная короткой пептидной последовательностью в пределах антигенной единицы. В некоторых вариантах осуществления антигенная единица включает два или более антигенных эпитопов. Антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из, или идентична продуктам ранних генов E6 и E7 из HPV, такого как HPV16 или HPV18.

Термин "шарнирная область" относится к пептидной последовательности гомодимерного белка, которая облегчает димеризацию, например, посредством формирования межцепочечной ковалентной связи(ей), например дисульфидного мостика(ов). Шарнирная область может быть получена из Ig, например, из экзонов шарнирной области h1+h4 Ig, такого как IgG3.

Определенные варианты осуществления изобретения

Как описано выше, настоящее изобретение относится к гомодимерному белку из двух идентичных аминокислотных цепей, каждая из которых включает: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, где указанная направляющая единица включает аминокислотную последовательность, обладающую по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO:1, и антигенная единица включает аминокислотную последовательность папилломавируса человека (HPV), например, антигенная единица включает аминокислотную последовательность HPV16 и/или HPV18, например, антигенная единица получена из ранних белков E6 и/или E7 HPV16 и/или HPV18. В некоторых вариантах осуществления согласно настоящему изобретению, направляющая единица, димеризационный мотив и антигенная единица в аминокислотной цепи расположены в порядке от N-конца к C-концу, в последовательности направляющая единица, димеризационный мотив и антигенная единица.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из HPV16, например, из ранних белков E6 и/или E7.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из E6 HPV16.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из E7 HPV16.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из HPV18, например, из ранних белков E6 и/или E7.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из E6 HPV18.

В некоторых вариантах осуществления антигенная единица, применяемая в конструкциях согласно настоящему изобретению, получена из E7 HPV18.

В некоторых вариантах осуществления согласно настоящему изобретению, сигнальный пептид состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 1-23 из SEQ ID NO:1.

В некоторых вариантах осуществления согласно настоящему изобретению, сигнальный пептид состоит из аминокислотной последовательности, обладающей по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99%, например, 100% идентичностью последовательности с аминокислотной последовательностью 1-23 из SEQ ID NO:1.

В некоторых вариантах осуществления согласно настоящему изобретению, направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO:1.

В некоторых вариантах осуществления согласно настоящему изобретению, димеризационный мотив включает шарнирную область и, необязательно, другой домен, который способствует димеризации, такой как домен иммуноглобулина, необязательно связанный через линкер.

В некоторых вариантах осуществления согласно настоящему изобретению, шарнирная область получена из Ig, например, получена из IgG3.

В некоторых вариантах осуществления согласно настоящему изобретению, шарнирная область имеет способность формировать одну, две или несколько ковалентных связей. В некоторых вариантах осуществления согласно настоящему изобретению, ковалентная связь представляет собой дисульфидный мостик.

В некоторых вариантах осуществления согласно настоящему изобретению, домен иммуноглобулина димеризационного мотива является C-концевым доменом или последовательностью, которая по существу идентична C-домену или его варианту.

В некоторых вариантах осуществления согласно настоящему изобретению, C-концевой домен получен из IgG.

В некоторых вариантах осуществления согласно настоящему изобретению, домен иммуноглобулина димеризационного мотива имеет способность к гомодимеризации.

В некоторых вариантах осуществления согласно настоящему изобретению, домен иммуноглобулина имеет способность к гомодимеризации посредством нековалентных взаимодействий. В некоторых вариантах осуществления согласно настоящему изобретению, нековалентные взаимодействия являются гидрофобными взаимодействиями.

В некоторых вариантах осуществления согласно настоящему изобретению, димеризационный домен не содержит CH2 домен.

В некоторых вариантах осуществления согласно настоящему изобретению, димеризационный мотив состоит из экзонов шарнирной области h1 и h4, соединенных через линкер с CH3 доменом IgG3 человека.

В некоторых вариантах осуществления согласно настоящему изобретению, димеризационный мотив состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 94-237 из SEQ ID NO:3.

В некоторых вариантах осуществления согласно настоящему изобретению, линкер является линкером G3S2G3SG.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица и димеризационный мотив связаны через линкер, такой как линкер GLGGL или линкер GLSGL.

В некоторых вариантах осуществления согласно настоящему изобретению, направляющая единица состоит из аминокислот 24-93 из SEQ ID NO:1, или ее варианта.

В некоторых вариантах осуществления согласно настоящему изобретению, гомодимерный белок обладает повышенной аффинностью к любому хемокиновому рецептору, выбранному из CCR1, CCR3 и CCR5, по сравнению с аффинностью того же гомодимерного белка с направляющей единицей, состоящей из аминокислот 24-93 из SEQ ID NO:1, или ее варианта.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность, обладающую по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-293 из SEQ ID NO:3.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-293 из SEQ ID NO:3.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает одну или более аминокислотных замен в положении, выбранном из списка, состоящего из F47, L50, C63, C106 и I128 из SEQ ID NO:22, или делецию, включающую одну или более аминокислот, выбранных из списка, состоящего из Y43-L50 SEQ ID NO:22.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает не более чем 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 или 20 аминокислотных замен и/или делеций по сравнению с SEQ ID NO:22.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность 243-293 из SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7 или SEQ ID NO:9, или их вариант или антигенный фрагмент.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности 243-293 из SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7 или SEQ ID NO:9, или их варианта или антигенного фрагмента.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность, обладающую по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-340 из SEQ ID NO:11.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-340 из SEQ ID NO:11.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает одну или более аминокислотных замен в положении, выбранном из списка, состоящего из C24, E26, C58, C61, C91 и C94 SEQ ID NO:23, или делецию, включающую одну или более аминокислот, выбранных из списка, состоящего из L22-E26 и/или C58-C61, и/или C91-S95 SEQ ID NO:23.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает не более чем 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 или 20 аминокислотных замен и/или делеций по сравнению с SEQ ID NO:23.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность 243-340 из SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15 или SEQ ID NO:17, или их вариант или антигенный фрагмент.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности 243-340 из SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15 или SEQ ID NO:17, или их варианта или антигенного фрагмента.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность, обладающую по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-501 из SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32 или SEQ ID NO:34.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с аминокислотной последовательностью 243-501 из SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32 или SEQ ID NO:34.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица, включающая аминокислотную последовательность папилломавируса человека 16 (HPV16), получена из ранних белков E6 и E7.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица, включающая аминокислотную последовательность папилломавируса человека 18 (HPV18), получена из ранних белков E6 и E7.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает одну или более аминокислотных замен в положении, выбранном из списка, состоящего из F47, L50G, C63, C106, I128T в SEQ ID NO:22 и C24, E26, C58, C61, C91, C94 в SEQ ID NO:23.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает не более чем 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 или 20 аминокислотных замен и/или делеций по сравнению с SEQ ID NO:22 и SEQ ID NO:23.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности 243-501 из SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32 или SEQ ID NO:34, или их варианта или антигенного фрагмента.

В некоторых вариантах осуществления согласно настоящему изобретению, аминокислотная цепь состоит из аминокислотной последовательности, выбранной из списка, состоящего из SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32 и SEQ ID NO:34, или их варианта или антигенного фрагмента.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица включает аминокислотную последовательность, обладающую по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с любой аминокислотной последовательностью, выбранной из SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24 и SEQ ID NO:25.

В некоторых вариантах осуществления согласно настоящему изобретению, антигенная единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80%, например, по меньшей мере 81%, например, по меньшей мере 82%, например, по меньшей мере 83%, например, по меньшей мере 84%, например, по меньшей мере 85%, например, по меньшей мере 86%, например, по меньшей мере 87%, например, по меньшей мере 88%, например, по меньшей мере 89%, например, по меньшей мере 90%, например, по меньшей мере 91%, например, по меньшей мере 92%, например, по меньшей мере 93%, например, по меньшей мере 94%, например, по меньшей мере 95%, например, по меньшей мере 96%, например, по меньшей мере 97%, например, по меньшей мере 98%, например, по меньшей мере 99% идентичностью последовательности с любой аминокислотной последовательностью, выбранной из SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24 и SEQ ID NO:25.

В некоторых вариантах осуществления гомодимерный белок согласно настоящему изобретению находится в своей зрелой форме без какой-либо сигнальной пептидной последовательности.

В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно настоящему изобретению оптимизирована по кодонам человека.

Следует понимать, что оптимизированная по кодонам человека молекула нуклеиновой кислоты согласно настоящему изобретению включает одну или более замен нуклеиновых кислот по сравнению с последовательностью дикого типа, где указанная замена вводит кодон с более высокой частотой использования в кодирующих областях человека. Частоту использования кодонов у Homo sapiens можно найти по адресу http://biowiki.edu-wiki.org/en/codon_table

В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно настоящему изобретению включает любую из нуклеотидных последовательностей, выбранных из списка, состоящего из SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:31 и SEQ ID NO:33, или их вариант.

В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно настоящему изобретению представлена вектором.

В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно настоящему изобретению подготовлена для введения пациенту с целью индукции синтеза гомодимерного белка у указанного пациента.

В некоторых вариантах осуществления вакцина согласно настоящему изобретению дополнительно включает фармацевтически приемлемый носитель и/или адъювант.

В некоторых вариантах осуществления, способ лечения или предотвращения вызванного HPV заболевания или состояния, такого как рак, или инфекционного заболевания, вызванного HPV у пациента, согласно настоящему изобретению включает введение пациенту, нуждающемуся в этом, молекулы нуклеиновой кислоты, такой как ДНК согласно настоящему изобретению, с последующим этапом электропорации. В некоторых вариантах осуществления введение производят внутрикожно или внутримышечно.

ПРИМЕР 1

Конструирование и экспрессия вакцин

Последовательности генов создавали согласно следующей структуре: 1: нативная лидерная последовательность человеческого LD78b, 2: полноразмерная последовательность LD78b. 3: Человеческая шарнирная область 1 из IgG3. 4: Человеческая шарнирная область 4 из IgG3. 5: Глицин-сериновый линкер. 6: Человеческий домен CH3 из IgG3. 7: Глицин-лейциновый линкер. 8: Онкогены E6, E7 дикого и мутантного папилломовирусов человека и слитые белки E6 и E7, разделенные глицин-сериновым линкером. Конструкции обозначили согласно их E6 и/или E7 составу следующим образом:

VB1001: Вакцитело-E6 дикого типа;

VB1005: Вакцитело-E7 дикого типа;

Мутанты обозначили согласно аминокислотному положению в соответствующей нативной последовательности E6 или E7.

VB1002: Вакцитело-E6 C63R;

VB1003: Вакцитело-E6 C106R;

VB1004: Вакцитело-E6 F47R, C63R, C106R;

VB1006: Вакцитело-E7 C24G, E26G;

VB1007: Вакцитело-E7 C24G, E26G, C58G, C61G;

VB1008: Вакцитело-E7 C24G, E26G, C91G, C94G;

VB1009: Вакцитело-E7 C24G, E26G/E6 F47R, C63R, C106R;

VB1016: Вакцитело-E7 C24G, E26G/E6 C63R, C106R;

VB1020: Вакцитело-E7 C24G, E26G/E6 F47R, C63R, C106R оптимизированный по кодонам человека;

VB1021: Вакцитело-E7 C24G, E26G/E6 F47R, L50G, C106R, I128T оптимизированный по кодонам человека.

Были включены контрольные вакцины, состоящие только из антигенов:

Контроль 1: E7 C24G, E26G/E6 F47R, C63R, C106R;

Контроль 2: E7 C24G, E26G/E6 C63R, C106R.

Все последовательности генов заказывали в Aldevron (Fargo ND, USA) или Eurofins MWG GmbH и клонировали в вектор экспрессии pUMVC4a.

Все конструкции трансфицировали в клетки 293E и экспрессию интактных белков вакцител подтверждали с помощью дот-блота и ELISA (данные не показаны). Все аминокислотные последовательности, за исключением Контролей 1 и 2, показаны как SEQ ID.

ПРИМЕР 2

Исследования иммунного ответа

VB 1009, VB1016, VB1020 и VB1021 отбирали в качестве кандидатных вакцин с их соответствующими Контролями 1 и 2, соответственно. В качестве отрицательного контроля использовали пустой вектор pUMVC4a.

25, 12,5 и 1,4 мкг плазмидной ДНК каждой кандидатной вакцины вводили внутрикожно в нижний отдел спины мышей C57BI/6 с последующей электропорацией, Dermavax, Cellectis (Paris, France). Через 7 дней мышам делали бустер-инъекцию подобных количеств вакцин и контрольных плазмид. В день 21 мышей умертвляли и забирали селезенку.

T-клеточные ответы вычисляли с помощью ELISPOT (Фигуры 3 a, b и c).

ПРИМЕР 3

Терапевтический эффект

VB1016, VB1020 и VB1021 с соответствующими контролями 1 и 2 отбирали в качестве кандидатной вакцины для терапевтических исследований вакцины.

5×104 или 5×105 клеток TC-1 (Johns Hopkins University, Baltimore, USA, Lin KY et al., Cancer Res, 1996) вводили в область шеи или бедра мышей C57BI/6. После дней 3 и 10, или дня 3, 7 и 10, мышей вакцинировали 2 мкг, 10 мкг, 12,5 мкг или 20 мкг плазмидной ДНК с последующей электропорацией, Dermavax, Cellectis France. Размер опухоли измеряли два-три раза в неделю до дня 49 после инъекции клеток TC-1 (Фиг. 4, 5 и 6)

ПРИМЕР 4

Используемая терапевтическая ДНК вакцина может быть изготовлена согласно стандарту производства GMP плазмидной вакцины в соответствии с руководством контролирующих органов, включая хранение клеток GMP, производство GMP лекарственных веществ и лекарственных продуктов, исследования стабильности ICH и полного цикла производства ДНК вакцины. ДНК вакцина может быть изготовлена путем растворения в солевом растворе, таком как 10 нМ Трис, 1 мМ ЭДТА при концентрации 2-5 мг/мл. Вакцину можно вводить внутрикожно или внутримышечно, с или без последующей электропорации.

ПОСЛЕДОВАТЕЛЬНОСТИ:

C-C мотив хемокин-3-подобного 1 предшественника, включая сигнальный пептид (ак 1-23 выделены жирным шрифтом) и зрелый пептид (LD78-бета), ак 24-93 (SEQ ID NO:1):

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Специфическая ДНК и соответствующие аминокислотные последовательности конструкций вакцитела HPV:

одиночные конструкции E6 или E7:

Исключительно в целях иллюстрации, различные домены конструкций разделены "|", домены расположены в следующем порядке: Сигнальный пептид | MIP-1α человека | Шарнирная область h1 | Шарнирная область h4 | линкер Gly-Ser или линкер Gly-Leu | hCH3 IgG3 | линкер Gly-Ser или линкер Gly-Leu | дикий или мутантный полноразмерный E6 или E7. Аминокислоты или нуклеотиды, выделенные жирным шрифтом, показывают участки мутаций.

Последовательность ДНК VB1001 (SEQ ID NO:2):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1001 (Гомодимерная конструкция согласно изобретению с E6, SEQ ID NO:3): аминокислотная последовательность 393 аминокислоты.

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQER

PRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGN

PYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQK

PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*

Последовательность ДНК VB1002 (SEQ ID NO:4):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1002 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:5): аминокислотная последовательность, 393 аминокислоты.

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQER

PRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGN

PYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQK

PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*

Последовательность ДНК VB 1003 (SEQ ID NO:6):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1003 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:7): аминокислотная последовательность, 393 аминокислоты.

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQER

PRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGN

PYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINRQK

PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*

Последовательность ДНК VB1004 (SEQ ID NO:8):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTCGACGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1004 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:9): аминокислотная последовательность, 393 аминокислоты.

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG

DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMFQDPQER

PRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLCIVYRDGN

PYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINRQK

PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*

Последовательность ДНК VB1005 (SEQ ID NO:10):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCATAA

Последовательность белка VB1005 (Гомодимерная конструкция согласно изобретению с E7, SEQ ID NO:11): аминокислотная последовательность, 340 аминокислот.

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTPTL

HEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP*

Последовательность ДНК VB1006 (SEQ ID NO:12):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCATAA

Последовательность белка VB1006 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:13): аминокислотная последовательность, 340 аминокислот.

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG

DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP*

Последовательность ДНК VB1007 (SEQ ID NO:14):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTGGATGCAAGGGAGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCATAA

Последовательность белка VB1007 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:15): аминокислотная последовательность, 340 аминокислот.

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG

DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFG

CKGDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP*

Последовательность ДНК VB1008 (SEQ ID NO:16):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGGGACCCATCGGATCTCAGAAACCATAA

Последовательность белка VB1008 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:17): аминокислотная последовательность, 340 аминокислот.

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG

DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVGPIGSQKP*

Конструкции с E6 и E7

Исключительно в целях иллюстрации, различные домены конструкций отделены "|", домены расположены в следующем порядке: Сигнальный пептид | MIP-Iα человека | Шарнирная область h1 | Шарнирная область h4 | линкер Gly-Ser или линкер Gly-Leu | hCH3 IgG3 | линкер Gly-Ser или линкер Gly-Leu | мутант E7 | линкер Gly-Ser или линкер Gly-Leu | мутант E6. Аминокислоты или нуклеотиды, выделенные жирным шрифтом, показывают участки мутаций.

Последовательность ДНК VB1009 (SEQ ID NO:18):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTCGACGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1009 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:19): Аминокислотная последовательность, 501 аминокислота.

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGSG|

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDL

CIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL

IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQ

L*

Последовательность ДНК VB1016 (SEQ ID NO:20):

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACACA|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA

Последовательность белка VB1016 (Гомодимерная конструкция согласно изобретению, SEQ ID NO:21): Аминокислотная последовательность, 501 аминокислота.

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG

DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGSSGGGSG

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL

CIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL

IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQ

L*

SEQ ID NO:22:

>tr|Q778I6|Q778I6_HPV16 E6 белок OS=Папилломавирус человека тип 16 GN=E6 PE=4 SV=1; (Подчеркнутые аминокислоты обозначают аминокислоты, которые могут быть удалены; Потенциальные аминокислоты, которые могут быть подвергнуты мутации, выделены жирным шрифтом),

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

SEQ ID NO:23:

>sp|P03129|VE7_HPV16 белок E7 OS=Папилломавирус человека тип 16 GN=E7 PE=1 SV=1; (Подчеркнутые аминокислоты обозначают аминокислоты, которые могут быть удалены; Потенциальные аминокислоты, которые могут быть подвергнуты мутации, выделены жирным шрифтом),

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

SEQ ID NO:24:

>sp|P06463|VE6_HPV18 белок E6 OS=Папилломавирус человека тип 18 GN=E6 PE=1 SV=1

MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSI

PHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRH

LNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV

SEQ ID NO:25:

>sp|P06788|VE7_HPV18 белок E7 OS=Папилломавирус человека тип 18 GN=E7 PE=3 SV=2

MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHT

MLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ

SEQ ID NO:26:

Шарнирные области (Шарнирная область UH IgG3), 12 аминокислот: ELKTPLGDTTHT

SEQ ID NO:27:

Шарнирная область (Шарнирная область MH IgG3, 15 аминокислот): EPKSCDTPPPCPRCP

SEQ ID NO:28:

Линкер Gly-Ser: GGGSSGGGSG

SEQ ID NO:29: hCH3 IgG3:

GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK

SEQ ID NO:30: Линкер: GLGGL

SEQ ID NO:31: последовательность ДНК VB1020:

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTG

CAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGC

TTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGA

GACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGC

CGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTG

ACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC

A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGT

GGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTAC

ACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT

GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAG

CGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGAC

GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGC

AGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTC

ACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA|GGCCTCGGTGGCCTG/ATG

CATGGCGATACCCCAACACTCCATGAGTACATGCTGGACCTTCAGCCCGAGA

CTACGGATCTGTATGGCTATGGGCAGTTGAATGACTCATCTGAGGAGGAGGA

CGAAATAGACGGCCCAGCTGGTCAAGCCGAACCGGATAGAGCCCACTACAA

CATTGTGACCTTTTGCTGTAAGTGTGACAGCACTCTGAGACTGTGTGTTCAGT

CCACTCATGTCGACATACGCACATTGGAGGATCTCCTGATGGGAACACTGGG

AATTGTGTGTCCCATCTGTTCCCAAAAGCCT/GGAGGTGGAAGCAGTGGAGGC

GGTTCAGGC/ATGTTCCAAGATCCTCAAGAACGTCCTCGTAAGCTGCCACAGC

TGTGTACCGAGCTTCAGACCACCATTCACGACATCATCCTGGAGTGCGTCTAT

TGCAAACAGCAGCTCCTTAGAAGGGAAGTGTACGATTTTGCACGGAGGGACC

TCTGCATCGTGTATCGGGACGGCAATCCCTATGCGGTACGGGATAAATGCCT

GAAGTTCTACAGCAAAATCTCCGAGTACCGGCACTACTGCTACTCTCTCTATG

GGACGACTCTGGAACAGCAGTACAACAAGCCCTTGTGCGATCTGCTGATTCG

CTGCATTAATCGCCAGAAACCTCTGTGCCCAGAAGAGAAGCAAAGACACCTG

GACAAGAAACAGCGATTCCACAACATCCGAGGGAGATGGACAGGGAGGTGT

ATGAGCTGCTGTCGGAGTTCTAGGACAAGGCGCGAAACCCAGCTTTGA

SEQ ID NO:32: Последовательность белка VB1020 (Гомодимерная конструкция согласно изобретению. Аминокислотная последовательность, 501 аминокислота):

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGSG|

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDL

CIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL

IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQ

L*

SEQ ID NO:33: последовательность ДНК VB1021:

ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTG

CAACCAGGTCCTCTCT|GCACCACTTGCTGCTGACACGCCGACCGCCTGCTGC

TTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGA

GACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGC

CGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTG

ACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC

A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGT

GGAAGCAGCGGAGGTGGAAGTGGA|GGACAGCCCCGAGAACCACAGGTGTAC

ACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT

GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAG

CGGGCAGCCGGAGAACAACTACAACACCACGCCTCCCATGCTGGACTCCGAC

GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGC

AGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTC

ACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA/GGCCTCGGTGGCCTG/ATG

CATGGTGACACACCAACCCTGCACGAATACATGCTCGATCTGCAGCCAGAGA

CTACCGACCTTTACGGCTATGGGCAGTTGAACGACAGCTCTGAGGAGGAGGA

CGAGATCGATGGTCCTGCTGGACAAGCAGAACCAGACAGAGCCCACTACAA

CATCGTAACCTTTTGCTGCAAGTGTGACAGTACCCTTCGTTTGTGCGTTCAGA

GCACGCATGTCGACATTCGGACACTGGAGGATCTGCTCATGGGGACTCTGGG

GATTGTGTGTCCTATTTGCAGCCAGAAACCA/GGCGGAGGATCTTCAGGAGGC

GGGAGTGGC/ATGTTCCAAGACCCTCAGGAACGCCCTCGGAAACTGCCCCAA

TTGTGTACTGAGCTCCAGACAACGATACACGACATAATCCTGGAGTGCGTGT

ATTGCAAGCAGCAGCTTCTGAGGAGGGAAGTGTACGATTTTGCCAGGAGAGA

TGGCTGCATTGTCTACCGAGATGGCAATCCCTATGCGGTGTGTGATAAGTGTC

TGAAGTTCTATTCCAAAATCAGCGAATATCGGCATTATTGCTACTCACTGTAC

GGAACTACCCTCGAACAGCAGTACAACAAACCGCTCTGTGATCTGCTGATCA

GATGCATCAATCGGCAGAAACCCCTTTGTCCCGAAGAGAAGCAAAGACAC

CTGGACAAGAAGCAGAGGTTCCACAATACCCGAGGTCGTTGGACTGGGCGCT

GCATGTCCTGTTGTCGCTCCTCTCGCACAAGGAGAGAGACACAACTGTGA

SEQ ID NO:34: Последовательность белка VB1021 (Гомодимерная конструкция согласно изобретению. Аминокислотная последовательность, 501 аминокислота):

MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD

YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG

DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL

TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTPTL

HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC

CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGSG|

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDG

CIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL

IRCINRQKPLCPEEKQRHLDKKQRFHNTRGRWTGRCMSCCRSSRTRRETQ

L*

1. Молекула нуклеиновой кислоты, кодирующая гомодимерный белок из двух идентичных аминокислотных цепей, каждая из которых включает: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, указанная направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1, и указанная антигенная единица включает аминокислотную последовательность, полученную из ранних белков Е6 папилломавируса человека (HPV16) и/или HPV18, и аминокислотную последовательность, полученную из раннего белка Е7 из HPV16 и/или HPV18, где указанный гомодимерный белок может быть использован в качестве HPV вакцины.

2. Молекула нуклеиновой кислоты по п. 1, где указанный сигнальный пептид состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 1-23 из SEQ ID NO: 1.

3. Молекула нуклеиновой кислоты по п. 1 или 2, содержащая антигенную единицу, полученную из Е6 и Е7 HPV16.

4. Молекула нуклеиновой кислоты по п. 1 или 2, где указанная антигенная единица содержит мутации для нейтрализации ее онкогенных свойств.

5. Молекула нуклеиновой кислоты по п. 4, где указанная антигенная единица включает одну или более аминокислотных замен в положениях, выбранных из перечня, состоящего из F47, L50, C63, С106 и l128 SEQ ID NO: 22 и/или C24, E26, C58, C61, C91, C94 SEQ ID NO: 23.

6. Молекула нуклеиновой кислоты по любому из пп. 1, 2 или 5, где указанный димеризационный мотив состоит из экзонов шарнирной области h1 и h4, соединенных через линкер с CH3 доменом IgG3 человека.

7. Молекула нуклеиновой кислоты по любому из предыдущих пунктов формулы, кодирующая аминокислотную цепь, содержащую (1) сигнальный пептид, состоящий из аминокислотной последовательности, обладающей по меньшей мере 85%, по меньшей мере 86%, по меньшей мере 87%, по меньшей мере 88%, по меньшей мере 89%, по меньшей мере 90%, по меньшей мере 91%, по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, по меньшей мере 95%, по меньшей мере 96%, по меньшей мере 97%, по меньшей мере 98%, по меньшей мере 99% или 100% идентичностью последовательности с аминокислотной последовательностью 1-23 из SEQ ID NO: 1; (2) направляющую единицу, состоящую из аминокислотной последовательности, обладающей по меньшей мере 85%, по меньшей мере 86%, по меньшей мере 87%, по меньшей мере 88%, по меньшей мере 89%, по меньшей мере 90%, по меньшей мере 91%, по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, по меньшей мере 95%, по меньшей мере 96%, по меньшей мере 97%, по меньшей мере 98%, по меньшей мере 99% или 100% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1; (3) димеризационный мотив, который состоит из экзонов шарнирной области h1 и h4, соединенных через линкер с CH3 доменом IgG3 человека; и (4) антигенную единицу, полученную из Е6 и Е7 HPV16, которая содержит мутации для нейтрализации ее онкогенных свойств.

8. Молекула нуклеиновой кислоты по любому из предыдущих пунктов формулы, где указанная молекула нуклеиновой кислоты оптимизирована по кодонам человека.

9. Молекула нуклеиновой кислоты по любому из предыдущих пунктов формулы, которая представляет собой ДНК.

10. Молекула нуклеиновой кислоты по любому из предыдущих пунктов формулы, включающая любую из нуклеотидных последовательностей, выбранных из перечня, состоящего из SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 31 и SEQ ID NO: 33, или их вариант.

11. Молекула нуклеиновой кислоты по любому из предыдущих пунктов формулы в составе вектора.

12. Гомодимерный белок из двух идентичных аминокислотных цепей, каждая из которых включает: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, указанная направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1, и указанная антигенная единица включает аминокислотную последовательность, полученную из ранних белков Е6 HPV16 и/или HPV18, и аминокислотную последовательность, полученную из раннего белка Е7 из HPV16 и/или HPV18, где указанный гомодимерный белок может быть использован в качестве HPV вакцины.

13. Гомодимерный белок по п. 12, где указанный сигнальный пептид состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 1-23 из SEQ ID NO: 1.

14. Гомодимерный белок по п. 12 или 13, содержащий антигенную единицу, полученную из Е6 и Е7 HPV16.

15. Гомодимерный белок по п. 12 или 13, где указанная антигенная единица содержит мутации для нейтрализации ее онкогенных свойств.

16. Гомодимерный белок по п. 15, где указанная антигенная единица включает одну или более аминокислотных замен в положениях, выбранных из перечня, состоящего из F47, L50, С63, С106 и l128 SEQ ID NO: 22 и/или С24, Е26, С58, С61, С91, С94 SEQ ID NO: 23, или делецию, включающую одну или более аминокислот, выбранных из перечня, состоящего из Y43-L50 SEQ ID NO: 22, и/или L22-E26, и/или С58-С61, и/или C91-S95 SEQ ID NO: 23.

17. Гомодимерный белок по любому из пп. 12, 13 или 16, где указанный димеризационный мотив состоит из экзонов шарнирной области h1 и h4, соединенных через линкер с CH3 доменом IgG3 человека.

18. Гомодимерный белок по любому из пп. 12, 13 или 16 в своей зрелой форме без какой-либо последовательности сигнального пептида.

19. Аминокислотная цепь, включающая: (1) сигнальный пептид, (2) направляющую единицу, (3) димеризационный мотив и (4) антигенную единицу, указанная направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80% идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1, и указанная антигенная единица включает аминокислотную последовательность, полученную из ранних белков Е6 HPV16 и/или HPV18, и аминокислотную последовательность, полученную из раннего белка Е7 из HPV16 и/или HPV18, где указанная аминокислотная цепь способна формировать гомодимерный белок согласно любому из пп. 12-18, где указанный гомодимерный белок может быть использован в качестве HPV вакцины.

20. Применение гомодимерного белка по любому из пп. 12-18, или аминокислотной цепи по п. 19, или молекулы нуклеиновой кислоты по любому из пп. 8-13 для получения лекарственного средства против HPV.

21. Фармацевтическая композиция против HPV, включающая гомодимерный белок по любому из пп. 12-18, или аминокислотную цепь по п. 19, или молекулу нуклеиновой кислоты по любому из пп. 1-11.

22. Клетка-хозяин для экспрессии гомодимерного белка по любому из пп. 12-18, включающая молекулу нуклеиновой кислоты по любому из пп. 1-11.

23. Способ получения гомодимерного белка по любому из пп. 12-18 или аминокислотной цепи по п. 19, включающий:

a) трансфекцию молекулы нуклеиновой кислоты по любому из пп. 1-11 в популяцию клеток;

b) культивирование популяции клеток;

c) сбор и очистку гомодимерного белка или аминокислотной цепи, экспрессированных популяцией клеток.

24. Способ получения вакцины против HPV, включающей иммунологически эффективное количество молекулы нуклеиновой кислоты по любому из пп. 1-11, где способ включает:

a) получение молекулы нуклеиновой кислоты по любому из пп. 1-11;

b) растворение молекулы нуклеиновой кислоты, полученной на стадии а), в фармацевтически приемлемом носителе, растворителе или буфере.

25. Вакцина против HPV, включающая иммунологически эффективное количество гомодимерного белка по любому из пп. 12-18, или аминокислотной цепи по п. 19, или молекулы нуклеиновой кислоты по любому из пп. 1-11.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к бис-Met-гистонам, и может быть использовано в медицине. Молекула нуклеиновой кислоты кодирует полипептид, состоящий из двух остатков метионина в качестве первого и второго N-концевых аминокислотных остатков, соединенных через пептидную связь со зрелым эукариотическим гистоном H1.

Изобретения касаются пептида, синтезированного химическим способом или способом генной инженерии, композиции, включающей такой пептид, ДНК, кодирующей полипептид, вектора, включающего такую ДНК, клетки-хозяина для экспрессии представленного пептида, набора для скрининга пептида, способного подавлять инфекцию респираторного вируса, и способа скрининга пептида, способного подавлять инфекцию респираторного вируса.

Изобретение относится к области иммунологии. Предложено гуманизированное антитело, специфичное к STEAP-1, и его антигенсвязывающий фрагмент.

Настоящее изобретение относится к иммунологии. Предложены антитело и его фрагмент, которые связываются с фосфо-эпитопом на белке Тау, а также кодирующие их полинуклеотиды; линии клеток, продуцирующие антитела; вектор, содержащая его клетка-хозяин и способ получения антитела и его функционального фрагмента.

Изобретение относится к области биотехнологии, конкретно к аналогам фактора комплемента B, и может быть использовано в медицине для лечения заболевания, опосредованного активацией альтернативного пути комплемента.

Настоящее изобретение относится к области генной инженерии, конкретно к клеточным культуральным средам без глутамина, дополненным аспарагином, и может быть использовано для получения полипептида, выбранного из антител, фрагментов антител и иммуноадгезинов, в клетке-хозяине млекопитающего.

Группа изобретений относится к области биотехнологии, а именно биохимии и медицине, и касается антител для лечения онкологических заболеваний. Антитела по изобретению специфически связывают и блокируют рецептор 1 типа фактора роста фибробластов (FGFR1) и характеризуются аминокислотными последовательностями H-CDR1, H-CDR2, H-CDR3, L-CDR1, L-CDR2 и L-CDR3.

Изобретение относится к области биохимии, а именно представлен полинуклеотид, который кодирует белок, обладающий активностью переноса сахара на гидроксильную группу в 4ʹ-положении флавона.

Данное изобретение относится к области биохимии и биотехнологии, а именно к растительной клетке, которая экспрессирует рекомбинантный белок, способу ее получения и способу получения рекомбинантного белка.

Настоящее изобретение относится к иммунологии. Предложено выделенное человеческое моноклональное антитело и его антигенсвязывающий фрагмент, которые связываются с MASP-2 человека.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к способу получения белка с помощью микроорганизма. Настоящий способ включает введение экспрессионной конструкции в микроорганизм, которая содержит промотор и нуклеиновую кислоту, кодирующую белок, и экспрессию белка в микроорганизме.

Настоящее изобретение относится к новым ДНК-аптамерам, способным прочно и специфически связываться с гельзолином. Кроме того, изобретение относится к применению этих аптамеров для оценки уровня гельзолина в данном образце и для очистки немеченного гельзолина и его аналогов в большом объёме.

Настоящее изобретение относится к биохимии и генетической инженерии, в частности к рекомбинантному штамму Escherichia coli BL21(DE3; pQE-Nit2). Указанный штамм получен путём трансформации штамма Escherichia coli BL21(DE3) плазмидной конструкцией pQE-Nit2, которая находится под контролем промотора фага Т5, и предназначен для получения ω-амидазы человека (Nit2) при культивировании на питательных средах на основе пептона, дрожжевого экстракта и глюкозы.

Предложенное изобретение относится к области биотехнологии. Предложен рекомбинантный аденовирус для обнаружения раковых клеток или диагностики рака, содержащий репликативную кассету, маркерную кассету, ген, который кодирует связывающий CD46 фибриллярный белок.

Изобретения касаются безбелковой среды и способа ее использования. Охарактеризована безбелковая среда для культивирования клеток СНО.

Изобретение относится к области медицины, биотехнологии и генной инженерии. Предложен рекомбинантный химерный полипептид-иммуноген, включающий консервативные Т- и В-клеточные эпитопы вируса ВИЧ-1 и последовательно расположенные пептидные фрагменты белков р24, gp41, gp120, узнаваемые широконейтрализующими антителами 10e8, 2F5, VRC01.

Предложенная группа изобретений относится к области медицины. Предложены cпособ выявления ингибиторов супрессии супрессора опухолевого роста Pdcd4 в опухолевых клетках и генетическая конструкция pLucPdcd4, представляющая собой плазмиду, кодирующую репортерный белок, представляющий собой химеру люциферазы светлячка с белком Pdcd4 человека.

Изобретение относится к области ветеринарной вирусологии и биотехнологии и касается нового штамма вируса ящура Aphtae epizooticae типа А сем. Picornaviridae, рода Aphtovirus.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к способу создания живой вакцины на основе биологически активного штамма Еnterococcus faecium L3 за счет включения в структуру его пилей антигена клинически актуального патогенного микроорганизма.

Предложенная группа изобретений относится к области медицины. Предложены фармацевтическая композиция для предупреждения или лечения бокового амиотрофического склероза, содержащая изоформы фактора роста гепатоцитов (HGF) или полинуклеотид, кодирующий изоформы, и способ предупреждения или лечения бокового амиотрофического склероза, включающий введение млекопитающему указанной композиции.

Изобретение относится к области биотехнологии, конкретно к бис-Met-гистонам, и может быть использовано в медицине. Молекула нуклеиновой кислоты кодирует полипептид, состоящий из двух остатков метионина в качестве первого и второго N-концевых аминокислотных остатков, соединенных через пептидную связь со зрелым эукариотическим гистоном H1.

Изобретения касаются молекулы нуклеиновой кислоты, кодирующей гомодимерный белок, гомодимерного белка, аминокислотной цепи, способной формировать гомодимерный белок, их применения для получения лекарственного средства, клетки-хозяина, фармацевтической и вакцинной композиций, способа получения гомодимерного белка или аминокислотной цепи и способа получения вакцины. Представленная молекула нуклеиновой кислоты кодирует гомодимерный белок из двух идентичных аминокислотных цепей, каждая из которых включает: сигнальный пептид, направляющую единицу, димеризационный мотив и антигенную единицу. Указанная направляющая единица состоит из аминокислотной последовательности, обладающей по меньшей мере 80 идентичностью последовательности с аминокислотной последовательностью 24-93 из SEQ ID NO: 1. Указанная антигенная единица включает аминокислотную последовательность, полученную из ранних белков Е6 папилломавируса человека иили HPV18, и аминокислотную последовательность, полученную из раннего белка Е7 из HPV16 иили HPV18. Представленные изобретения позволяют индуцировать специфичный и сильный иммунный ответ к HPV посредством презентации АПК клетками иммуногенных эпитопов продуктов генов HPV и могут быть использованы в качестве терапевтических соединений при лечении различных заболеваний, вызванных HPV, таких как раковые опухоли и инфекционные заболевания. 9 н. и 16 з.п. ф-лы, 6 ил., 4 пр.

Наверх