Пептид из состава тяжелой цепи иммуноглобулина человека, пригодный для лечения рассеянного склероза

Изобретение относится к медицине и касается пептида с последовательностью Abu-Ser-Ser-Val-Lys-Val-Ser-Abu (Abu – α-аминомасляная кислота), соответствующего консервативному участку домена VH тяжелой цепи иммуноглобулинов человека, предназначенного для лечения рассеянного склероза у человека. Изобретение обеспечивает подавление пролиферативной активности лимфоцитов. 1 пр., 3 ил., 1 табл.

 

Область техники, к которой относится изобретение

Изобретение относится к области фармацевтики, в частности к разработке метода медикаментозного лечения различных форм рассеянного склероза у человека.

Несмотря на активные исследования, до настоящего времени не предложено надежного этиотропного метода лечения рассеянного склероза. Механизм возникновения рассеянного склероза экспериментально не доказан. Основными патентообладателями средств терапии этого заболевания традиционно используется следующее описание этого процесса:

1. Причиной нарушения двигательных функций организма больного является разрушение миелиновых оболочек центральной нервной системы. На основании анализа клинической картины РС можно подразделить на четыре категории: RRMS – ремиттирующая форма (85% случаев в мире), PPMS (10% случаев) – первичная прогрессирующая форма, SPMS – вторичная прогрессирующая форма (как правило, развивается при прогрессии заболевания у пациентов с RRMS), PRMS - возвратно-прогрессирующая (5% случаев).

2. Разрушение миелиновых оболочек, состоящих из белков: ОБМ (MBP), основной белок миелина; ПЛП (PLP), протеолипидный протеин; МАГ (MAG) миелин-ассоциированный гликопротеин; МОГ (MOG), миелин-олигодендроцитарный гликопротеин; носит аутоиммунный характер, причем основной вклад в патологию вносят не Т, а В-лимфоциты.

3. В популяции В-лимфоцитов имеется субпопуляция клеток, продуцирующих ростовой лимфокин GM-CSF (гранулоцитарно-макрофагальный колониестимулирующий фактор). Активность этой популяции приводит к снижению уровня продукции тормозного медиатора иммунной системы IL-10. Подавление продукции GM-CSF или инактивация продуцирующих его клеток приводит к облегчению симптомов рассеянного склероза.

4. Т-лимфоциты, специфично распознающие антигены белков миелиновой оболочки: ОБМ, ПЛП, МАГ и МОГ, способны подавлять активность B-лимфоцитов, направленную на разрушение миелиновых оболочек. Поэтому стимуляция Т-клеточного ответа при рассеянном склерозе положительно сказывается на состоянии больных.

5. Под влиянием интерферонов, особенно интерферона β, происходит подавление активности B-лимфоцитов при одновременной стимуляции Т-лимфоцитов, благодаря чему происходит улучшение состояния пациентов с РС.

6. Снижение активности иммунной системы в целом или отдельных ее частей приводит к симптоматическому облегчению течения рассеянного склероза. Поэтому для лечения этого заболевания используются все основные классы иммунодепрессантов различной степени специфичности: неспецифические цитостатики и иммунодепрессанты, блокаторы проникновения лимфоцитов в ткани (антагонисты рецептора адгезии на эндотелии сосудов интегрина 4α), антитела, распознающие поверхностные рецепторы В-лимфоцитов (CD20, рецептор IL2), блокаторы S1P-рецепторов лимфоцитов, в частности финголимод. Эти соединения блокируют сфингозин-1-фосфатные рецепторы (S1P-рецепторы).

Анализ патентной литературы, а также публикаций и материалов маркетингового характера, позволяет предложить следующую классификацию типов лекарственных средств для терапии рассеянного склероза:

1. Неспецифические цитостатики, аналогичные применяемым для лечения онкологических заболеваний, и иммунодепрессанты кортикостероидной природы и на основе адренокортикотропного гормона;

2. Препараты интерферонов, в том числе интерферонов β-1a, β-1b и γ, включая их химически модифицированные формы;

3. Модуляторы S1P-рецепторов – 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол (финголимод) и другие;

4. Т-клеточные вакцины, направленные на активацию или подавления антиген-зависимого распознавания белков миелина;

5. Блокаторы рецепторов на поверхности В-лимфоцитов: CD20 и субъединицы рецептора IL-2, рецептор Fcγ;

6. Антитела против лимфокина GM-CSF;

7. Пептиды, имитирующие ОБМ или другие антигены миелиновой оболочки;

8. Композиции известных субстанций, включая перечисленные выше;

9. Физиотерапевтические способы воздействия лечения и их комбинации с перечисленными медикаментозными средствами.

Уровень техники

Анализ научно-технической литературы в области разработки средств лечения рассеянного склероза позволил выявить следующие характеристики технического уровня и тенденций развития методов медикаментозного лечения рассеянного склероза.

Рассеянный склероз (РС) - англ. Multiple sclerosis (MS) представляет собой воспалительное заболевание, проявляющееся в нарушении миелиновой оболочки центральной нервной системы. РС широко распространен во всем мире. Например, в США в настоящее время зарегистрировано свыше 300 000 пациентов с РС. Заболевание как правило начинается в достаточно молодом возрасте: у 70-80% пациентов первые симптомы РС проявились в возрасте от 20 до 40 лет (Anderson et al. Ann Neurology 31(3):333-6 (1992); Noonan et al. Neurology 58:136-8 (2002)). Диагностика РС основана на клиническом осмотре невропатологом, магнитно-резонансном исследовании ЦНС (МРТ), гистологическом анализе материалов биопсии и аутопсии (Lucchinetti et al. Ann Neurol 47:707-17 (2000)). Болезнь имеет множество различающихся клинических проявлений, затрагивающих функции спинного мозга, головного мозга, черепных нервов, мозжечка, когнитивные функции. Большинство пациентов с РС полностью утрачивают подвижность через 25 лет после появления первых симптомов заболевания. Более половины пациентов с РС через 15 лет после начала болезни могут передвигаться только на костылях. РС является самой распространенной в мире неврологической патологией у пациентов молодого возраста. До настоящего времени для лечения этой болезни не предложено эффективного этиотропного средства. Диагностика РС затруднена чрезвычайным многообразием клинических проявлений. При этом не выработано универсального метода клинической диагностики, позволяющего однозначно оценивать тяжесть заболевания. Использование МРТ, электроэнцефалографии и биохимический анализ пунктатов спинно-мозговой жидкости, хотя и дают ценные сведения о состоянии больного, не всегда могут быть интерпретированы однозначно. Многие частные проявления РС могут быть вызваны не связанными с ним причинами: инфекционными заболеваниями, сосудистыми патологиями, аутоиммунными заболеваниями различной природы (McDonald et al. Ann Neurol 50:121-7 (2001)). РС может быть подразделен на четыре формы: возвратно-ремиттирующую (приступообразную) RRMS - 80%-85% всех регистрируемых случаев, первичную прогрессирующую - PPMS (10-15% случаев), возвратно-прогрессирующую - PRMS (5% случаев) и вторично-прогрессирующую - SPMS (Kremenchutzky et al. Brain 122 (Pt 10):1941-50 (1999); Confavreux et al. N Engl J Med 343(20):1430-8 (2000)). Около 50% пациентов с RRMS приобретают симптомы SPMS через 10 лет после начала заболевания. Свыше 90% пациентов с RRMS в конечном итоге приобретают симптоматику SPMS (Weinshenker et al. Brain 112 (Pt 1):133-46 (1989)).

Иллюстрируя различия в особенностях течения различных форм РС, необходимо отметить, что в 2010 г. в США было допущено к применению шесть препаратов для лечения RRMS, но ни один из них не был разрешен для лечения PPMS. Для лечения RRMS допущены препараты:

1) Класс интерферонов: ИФН-β-1a (REBIF® и AVONEX®); ИФН-β-1b (BETASERON®);

2) Ацетат глатирамера (COPAXONE®), полипептид со случайной последовательностью;

3) Натализумаб (TYSABRI®) - гуманизированное моноклональное антитело против α4-интегрина;

4) Митоксантрон (NOVANTRONE®), блокатор топоизомеразы II, цитостатик.

В ходе испытаний с различной степенью успеха использовались другие препараты: иммунодепрессанты-кортикостероиды, цитостатики метатрексат, циклофосфамид, азатиоприн, внутривенные инъекции нормального иммуноглобулина. По данным метаанализа публикаций, существующие методы лечения позволяют добиться улучшения у ~30% пациентов с RRMS, проявляющиеся в сокращении частоты и силы приступов (Filippini et al. Lancet 361:545-52 (2003)).

Использование для лечения РС других иммуномодулирующих препаратов, в частности антител к TNF((Infliximab) не только не облегчало, но и усугубляло течение РС (Lenercept Multiple Sclerosis Study Group and the University of British Columbia MS/MRI Neurology 53:457-65 (1999); Bielekova et al. Nat Med 6:1167-75 (2000), erratum appears in Nat Med 6:1412 (2000)).

В литературе господствует мнение, что патофизиология РС обусловлена воспалительной реакцией, регулируемой Т-лимфоцитами CD4+Th1-типа. Терапия препаратами ИФН-(и ацетата глатирамера, хотя и не приводят к стойкому излечению, позволяют купировать приступы болезни и замедлить инвалидизацию.

В последние десятилетия при исследовании спинно-мозговой жидкости пациентов с РС удалось убедительно доказать существование специфических для этого заболевания олигоклональных антител класса IgG, которые используются в диагностике РС (Siden A. J Neurol 221:39-51 (1979); McDonald et al. Ann Neurol 50:121-7 (2001); Andersson et al. Eur J Neurol 9:243-51 (2002); O'Connor, P. Neurology 59:S1-33 (2002)). Наличие таких олигоклональных антител, свободных легких цепей иммуноглобулинов, повышение уровня IgM в спинно-мозговой жидкости является признаком, усугубляющим прогноз течения РС у конкретного пациента (Rudick et al. Mult Scler 1:150-5 (1995); Zeman et al. Acta Cytol 45:51-9 (2001); Izquierdo et al. Acta Neurol Scand 105:158-63 (2002); Wolinsky J. J Neurol Sci 206:145-52 (2003); Villar et al. Ann Neurol 53:222-6 (2003)).

Антитела к белкам миелина: ОБМ и МОГ могут служить маркером тяжести РС (Reindl et al. Brain 122:2047-56 (1999); Egg et al. Mult Scler 7(5):285-9 (2001)). Особенно заметно накопление таких антител в спинно-мозговом ликворе пациентов с РС (Reindl et al. Brain 122:2047-56 (1999); Egg et al. Mult Scler 7(5):285-9 (2001); Andersson et al. Eur J Neurol 9:243-51 (2002)). Кроме этого, у пациентов с РС отмечается появление антител к ганглиозидам и нейрофиламентам (Mata et al. Mult Scler 5:379-88 (1999); Sadatipour et al. Ann Neurol 44:980-3 (1998)). По последним данным уровень антител к ОБМ и МОГ позволяет оценивать степень демиелинизации ЦНС у пациентов с RRMS (Berger et al. N Engl J Med 349:139-45 (2003)). Наличие антител к обоим указанным белкам миелина позволило предсказать скорое начало приступа у 76,5% наблюдавшихся пациентов, тогда как наличие антител только к MOG позволило выявить только 31,6% таких пациентов.

Многие специалисты в области РС считают, что наличие в ликворе плазматических клеток, продуцирующих антитела, является значимым фактором образования очагов демиелинизации при РС (Prineas and Wright, Lab Invest 38:409-21 (1978); Esiri M. Neuropathol Appl Neurobiol 6:9-21 (1980); Genain et al. Nat Med 5:170-5 (1999); Lucchinetti et al. Ann Neurol 47:707-17 (2000); Wingerchuk et al. Lab Invest 81:263-81 (2001)). Высокая концентрация B-лимфоцитов в ликворе является значимым отрицательным прогностическим признаком при РС (Cepok et al. Brain 124 (Pt 11):2169-76 (2001)).

У пациентов с RRMS, как и у больных с опсо-миоклональным синдромом, удается добиться стойкого улучшения состояния за счет внутривенного введения Ритуксимаба – гуманизированных моноклональных антител к CD20, основному поверхностному маркеру B-лимфоцитов (Pranzatelli et al. Neurology 60(Suppl1) PO5.128:A395 (2003); Cross et al. “Preliminary Results from a Phase II Trial of Rituximab in MS” (abstract) Eighth Annual Meeting of the Americas Committees for Research and Treatment in Multiple Sclerosis ACTRIMS 20-1 (2003)). See also Cree et al. “Tolerability and Effects of Rituximab “Anti-CD20 Antibody” in Neuromyelitis Optica and Rapidly Worsening Multiple Sclerosis” Meeting of the Am. Acad. Neurol. (2004).

Поверхностный антиген В-лимфоцитов CD20, известный также, как антиген дифференцировки B-лимфоцитов Bp35, представляет собой гидрофобный трансмембранный белок массой ~35 кДа, имеющийся как у зрелых B-лимфоцитов, так и у их предшественников (Valentine et al. J. Biol. Chem. 264(19):11282-11287 (1989); and Einfeld et al. EMBO J. 7(3):711-717 (1988)). Этот антиген часто (более чем в 90% случаев) обнаруживается на поверхности клеток неходжкинских лимфом (Anderson et al. Blood 63(6):1424-1433 (1984)). Однако CD20 отсутствует на поверхности стволовых кроветворных клеток, плазматических клеток и других нормальных тканей человека (Tedder et al. J. Immunol. 135(2):973-979 (1985)). CD20 regulates an early step(s) in the activation process for cell cycle initiation and differentiation (Tedder et al., J. Immunol. 135(2): 973-979 (1985)). Высказывались предположения, что CD20 представляет собой кальциевый канал (Tedder et al. J. Cell. Biochem. 14D:195 (1990)).

С учетом высокой избирательности экспрессии CD20 на поверхности В-лимфоцитов и В-клеточных лимфом его традиционно используют в качестве мишени для адресации терапевтических агентов в этот тип опухолей. Именно с этой целью компанией Genetech из США был разработан препарат гуманизированных моноклональных антител Ритуксимаб (Rituximab) (RITUXAN®) (U.S. Pat. No. 5,736,137). В настоящее время он нашел широкое применение и для лечения РС, особенно RRMS.

Известен и ряд других препаратов гуманизированных моноклональных антител против CD20 человека и их конъюгатов с цитотоксическими агентами, предназначенных для внутривенного введения людям. В это число входят:

1. Ibritumomab Tiuxetan (ZEVALIN®) – конъюгированное с Иттрием-90 производное гуманизированных мышиных моноклональных антител 2B8 (Y2B8)” производства IDEC Pharmaceuticals, Inc. (U.S. Pat. No. 5,736,137). Клон 2B8 депонирован в ATCC под номером доступа HB11388 в июне 1993);

2. Tositumomab (BEXXAR™) – мышиные моноклональные антитела класса IgG2a меченные 131I производства Corixa (U.S. Pat. No. 5,595,721);

3. 1F5 - Мышиные моноклональные антитела и их гуманизированное производное (Press et al. Blood 69(2):584-591 (1987); WO03/002607, Leung, S.) Клон депонирован в ATCC под номером HB-96450;

4. huMax-CD20 - Мышиные моноклональные антитела 2H7 и их гуманизированное производное 2H7 (U.S. Pat. No. 5,677,180; WO2004/035607) производства Genmab, Дания;

5. AME-133 - гуманизированное производное мышиного моноклонального антитела производства Applied Molecular Evolution;

6. IMMU-106 - гуманизированное производное мышиного моноклонального антитела А20 (US 2003/0219433, Immunomedics) и его искусственные производные с удаленным остатком Leu16 в антиген-связывающем центре, с двойной специфичностью связывания CD22/CD20, а также его конъюгат с IL-2 (US 2005/0069545A1; WO 2005/16969; Carr et al.);

7. hLL2xhA20 – моноклональные антитела с двойной специфичностью (WO2005/14618, Chang et al.);

8. Моноклональные антитела L27, G28-2, 93-1B3, B-C1 и NU-B2, распространяемые группой International Leukocyte Typing Workshop (Valentine et al., In: Leukocyte Typing III (McMichael, Ed., p.440, Oxford University Press (1987));

9. Конъюгат моноклональных антител 1H4 с ауристатином Е производства Seattle Genetics;

10. Конъюгаты моноклональных антител против CD20 с IL2 производства EMD/Biovation/City of Hope;

11. Моноклональные антитела против CD20 производства EpiCyte;

12. Моноклональные антитела TRU 015 против CD20 производства Trubion.

Еще одним коммерчески доступным препаратом, активно применяемым для лечения РС путем воздействия на популяцию лимфоцитов, является Даклизумаб, рекомбинантное гуманизированное антитело класса IgG1, направленное против α-субъединицы (Тас) рецептора IL-2. Этот препарат обладает мощными иммуносупрессорными свойствами. Связываясь с субъединицей Тас высокоаффинного рецептора IL−2, экспрессирующегося на активированных Т-клетках, Даклизумаб специфично подавляет передачу сигнала через этот рецептор, угнетает опосредованную IL−2 активацию лимфоцитов, тормозит иммунную реакцию отторжения трансплантата.

Основное назначение даклизумаба - предотвращение острого отторжения почечного аллотрансплантата после пересадки. После 6-месячного применения и последующей отмены даклизумаба частота отторжения остается приемлемой. Увеличивает 6- и 12-месячную выживаемость больных после трансплантации. Антитела к даклизумабу обнаруживаются у 9% больных, но они не изменяют его сывороточные концентрации, эффективность и безопасность.

Мутагенной и канцерогенной активности не обнаружено. Многократное введение яванским макакам доз 1,5; 5,0 и 15 мг/кг/сут в течение 28 дней и однократное введение мышам доз 125 мг/кг не сопровождалось проявлениями токсичности.

Cmax у больных, перенесших аллогенную пересадку почки, после однократного введения дозы 1 мг/кг составляет 21±14 мкг/мл, после 5 инфузий (доза 1 мг/кг) каждые 14 дней - 32±22 мкг/мл. Полное насыщение рецепторов к IL−2 происходит при сывороточных концентрациях 0,5-0,9 мкг/мл, подавление опосредованной IL−2 биологической активности - при уровне в плазме 5-10 мкг/мл. Соблюдение режима дозирования позволяет поддерживать достаточные сывороточные концентрации на протяжении более 90 дней после трансплантации.

Еще одним препаратом, активно используемым для лечения РС, является иммунодепрессант финголимод. Механизм его действия заключается в том, что, проникая в лимфоциты, он метаболизируется сфингозинкиназой до активного метаболита финголимода фосфата. В низких наномолярных концентрациях финголимода фосфат связывается с S1P-рецепторами лимфоцитов 1, 3, и 4 типов и быстро проникает в центральную нервную систему (ЦНС) через гематоэнцефалический барьер, связываясь с S1P-рецепторами нервных клеток 1, 3, и 5 типов. Связывая S1P-рецепторы лимфоцитов, финголимода фосфат блокирует способность лимфоцитов покидать лимфатические узлы, что приводит к перераспределению лимфоцитов в организме. При этом не происходит уменьшения общего количества лимфоцитов в организме. Перераспределение лимфоцитов приводит к снижению лимфоцитарной инфильтрации ЦНС, уменьшению выраженности воспаления и степени повреждения нервной ткани. В течение 4-6 часов после однократного приема препарата в дозе 0,5 мг число лимфоцитов крови снижается приблизительно до 75% от исходного значения. При длительном ежедневном применении препарата число лимфоцитов продолжает снижаться в течение 2-х недель, достигая минимального показателя 500 клеток/мкл или приблизительно 30% от исходного уровня. У 18% больных отмечалось (по крайней мере, однократное) снижение числа лимфоцитов ниже 200 клеток/мкл. При регулярном приеме препарата снижение числа лимфоцитов сохранялось. Поскольку большинство Т- и В-лимфоцитов постоянно проходят через лимфоидные органы, влияние финголимода на эти клетки выражено в наибольшей степени. Однако около 15-20% Т-лимфоцитов, являющихся эффекторными клетками памяти и играющими важную роль в периферическом иммунном контроле, не проходят через лимфоидные органы и не подвержены воздействию финголимода. В течение нескольких дней после прекращения приема препарата в крови отмечается повышение числа лимфоцитов. Нормализация количества лимфоцитов происходит через 1-2 месяца после прекращения лечения. Постоянный прием финголимода приводит к небольшому снижению числа нейтрофилов приблизительно до 80% от исходного показателя. Моноциты не подвержены воздействию финголимода. При применении у пациентов с ремиттирующим РС (средний балл по шкале инвалидности, EDSS, 2,0) финголимод в дозе 0,5 мг снижает частоту клинических обострений болезни на 54%. При приеме препарата у 70 % отмечалась стабильная ремиссия в течение 2-х лет (по сравнению с 45,6% в группе плацебо). Финголимод достоверно снижал риск прогрессирования нетрудоспособности. При применении препарата достоверно увеличивалось время до наступления 3-месячного и 6-месячного периода подтвержденного прогрессирования нетрудоспособности (оцениваемого как повышение оценки по шкале EDSS от исходных показателей) по сравнению с плацебо. Результаты магнитно-резонансной томографии (МРТ) головного мозга больных ремиттирующим РС, на фоне лечения финголимодом подтверждают значительное снижение активности течения заболевания (интенсивности воспалительного процесса в ЦНС, размеров и количества очагов демиелинизации).

Результаты выполненного патентного поиска показывают, что в области патентования исследуемой темы явных лидеров не существует, тем не менее, основными патентодержателями являются американские компании Genetech и Novartis, университет Южной Калифорнии, университет Альберты (Канада), а также израильская компания Teva Pharmaceutical Industries Ltd. В целом, количество патентов по данной тематике достаточно велико, что свидетельствует о перспективности данного направления и патентоемкости рынка.

Для анализа и обобщения сведений, полученных из описаний изобретений, их можно сгруппировать по следующим направлениям.

1. Неспецифические цитостатики и иммунодепрессанты;

2. Препараты интерферонов, включая их химически модифицированные формы;

3. Блокаторы рецептора SlP;

4. Т-клеточные вакцины;

5. Блокаторы рецепторов на поверхности В-лимфоцитов;

6. Пептиды, имитирующие антигены миелиновой оболочки;

7. Блокаторы GM-CSF;

8. Композиции известных субстанций, включая перечисленные выше;

9. Физиотерапевтические способы воздействия лечения и их комбинации с перечисленными медикаментозными средствами.

Анализ отобранной информации свидетельствует, что организации и фирмы многих развитых стран мира проявляют интерес к проблеме лечения РС. Особенно интенсивно исследования проводятся в США.

Патенты по использованию пептидов предлагаемой нами последовательности для лечения РС нами не обнаружены, хотя имеется ряд патентов по использованию в этом качестве фрагментов ОБМ и других антигенов миелина.

В патенте РФ 2471482 «Композиция для лечения рассеянного склероза (варианты)», автора Фазылова М.Ф., патентообладателя «Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU)», дата подачи заявки (приоритет) 27.10.2011, опубликованном 10.01.2013, раскрывается изобретение, относящееся к области фармацевтики. Изобретение представляет собой фармацевтическую композицию для лечения РС, включающую терифлуномид в качестве активного начала и вспомогательные вещества при следующем соотношении компонентов, мас.%: терифлуномид - 3,0-13,5; лактоза и/или лудипресс LCE -48,5-65,0; крахмал - 7,0-16,0; микрокристаллическая целлюлоза и/или гипромеллоза - 20,0-30,0; коллидон VA-64 - 3,5-4,5; стеарат магния - 0,8-1,2; аэросил - 0,8-1,2; бенецел МР-824 - 13,5-15,5.

В патенте РФ 2492234 «Композиции для лечения рассеянного склероза (варианты)», автора Фусса А. (FR), патентообладателя «ТИксСЕЛЛ (FR)», дата подачи заявки (приоритет) 17.10.2008, опубликованного 10.09.2013, раскрывается изобретение, относящееся к получению популяции регуляторных Т-клеток (Tr1-клеток), направленных против антигена, ассоциированного с РС, и может быть использовано для восстановления нарушенной толерантности к белкам миелина. Выделяют популяцию Tr1-клеток, направленных против антигена, ассоциированного с РС, и имеющих в покое фенотип CD4+CD25-FoxP3-. Полученную популяцию Tr1-клеток в комбинации с одним или несколькими фармацевтически приемлемыми носителями либо в комбинации с одним или более фармацевтическим средством, применяемым для лечения РС, выбираемым из группы, включающей интерферон-β, глатимера ацетат, митоксантрон, циклофосфамид, метотрексат, азиатропин или натализумаб, используют в составе фармацевтических композиций для лечения РС.

В патенте РФ 2199339 «Способ лечения рассеянного склероза», авторов Барбас И.М., Тотолян Н.А., Скоромец А.А., Смирнов М.Н., Животовская М.Л., Яковлева В.С., патентообладателя «Общество с ограниченной ответственностью "БИОТЕХ"», дата подачи заявки (приоритет) 23.02.2001, опубликованном 27.02.2003, раскрывается метод лечения больных РС. Больным в стадии обострения вводят внутривенно капельно препарат интерлейкина-2 человека (IL-2), например Ронколейкин, в дозе не менее 1 млн. ME 1 раз в 7 дней. Способ позволяет значительно сократить сроки лечения больных РС с выраженным иммунодефицитом, добиться упреждения рецидивов RRMS, продлить период трудоспособности пациентов.

В патенте РФ 2130308 «Применение замещенных производных аденина для лечения рассеянного склероза», автора Беутлер Э.(US), патентообладатель «The Scripps Research Institute (US)», дата подачи заявки (приоритет) 18.02.1993, опубликовано 20.05.1999, МПК А61К 31/70 (1995.01) описывается новый способ лечения пациентов, страдающих РС, с помощью терапевтических средств, содержащих производные аденина, такие как 2-хлор-2-дезоксиаденозин. Препарат значительно улучшает состояние больного, не дает технических побочных эффектов в виде тошноты, рвоты, кожной сыпи, почечные или печеночные нарушения.

В патенте РФ 2137131 «Гибридная клеточная линия (варианты), препарат антител (варианты), способ диагностики рассеянного склероза у человека (варианты), способ лечения человека, полипептид», авторов Клайн Э.Л. (US), Зиммерман Д.Х. (US), патентообладатель «Molecular RX Inc. (US), CellMed Inc. (US)», дата подачи заявки (приоритет) 17.12.1993, опубликовано 10.09.1999, МПК G01N 33/53 (1995.01), C12N 5/08 (1995.01), C12N 15/06 (1995.01), A61K 38/17 (1995.01), A61K 39/00 (1995.01), C07K 14/435 (1995.01) описан метод выявления антигенов, ассоциированных с РС. Также предметом изобретения является метод получения гибридов, которые продуцируют моноклональные антитела, специфичные в отношении антигенов, ассоциированных с РС. Возможности применения изобретения заключается в диагностике РС и в текущем диспансерном наблюдении за больными РС с точки зрения развития болезни либо реакции на терапию. Техническим результатом изобретения является возможность диагностики и лечения РС и других демиелинизирующих заболеваний.

В патенте РФ 2563521 «Способы и композиции для диагностики и лечения аутоиммунной болезни, возникающей вследствие рассеянного склероза», Коуолз А.Дж. (GB), Джоунз Д.Л. (GB), Компстон А. (GB), патентообладатель «КЕМБРИДЖ ЭНТЕРПРАЙЗ ЛИМИТЕД (GB)», дата подачи заявки (приоритет) 08.10.2009, опубликовано 20.09.2015, Бюл. №26, МПК C12Q 1/68 (2006.01) описаны способы диагностики пациентов с PC. Способы предусматривают идентификацию пациентов с РС, имеющих повышенный риск развития рецидива аутоиммунного заболевания после курса истощения популяции лимфоцитов с применением гуманизированного моноклонального антитела против маркера В-лимфоцитов CD52. Также предусматриваются способы выбора схемы лечения для пациентов с PC и реагентов, пригодных для использования в вышеописанных способах.

В патенте РФ 2140247 «Способ лечения рассеянного склероза и дегенераций нервной системы», авторов Казанцева Н.В., Гусев Е.И., Макарова Л.Д., Тимофеев В.Т., патентообладатель Казанцева Наталья Вениаминовна, дата подачи заявки (приоритет) 30.12.1998, опубликовано 27.10.1999, МПК A61G 10/02 (1995.01), A61K 31/47 (1995.01), A61K 31/525 (1995.01), A61K 31/19 (1995.01) описан метод лечения РС с применением оксидантов. Больному назначают ежедневный прием препаратов, усиливающих митохондриальное окисление в терапевтических дозах. Помещают больного в лечебную барокамеру. Проводят компрессию до достижения избыточного давления 0,03 - 0,1 атм. Через 10 - 20 мин завершают сеанс, проводя декомпрессию. Ежедневно повторяют воздействие до 4 - 10 сеансов. Выбор параметров лечебного режима и количества сеансов проводится индивидуально в зависимости от тяжести и характера заболевания под контролем динамики неврологического статуса, капнограммы и/или КЩС, проводят повторные курсы лечения 2 раза в год, а при ухудшении состояния и чаще, под контролем ПОЛ, иммунного статуса, вызванных потенциалов мозга и ЭЭГ. В остром периоде аутоиммунного воспаления метод сочетают с гормонами, цитостатиками и иммуномодуляторами в меньшей, чем принято, дозе, под контролем иммунного статуса. Способ позволяет снижать содержание продуктов перекисного окисления липидов в плазме крови и повышать уровень естественной защиты организма.

В патенте РФ 2509573 «Лекарственное средство для лечения рассеянного склероза и способ лечения рассеянного склероза», автора Эпштейн О.И., патентообладатель Эпштейн О.И., дата подачи заявки (приоритет) 27.07.2010, опубликовано 20.03.2014, Бюл. №8, МПК A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан способ лечения рассеянного склероза с применением гомеопатических доз («активированная-потенцированная форма») антител к гамма-интерферону человека (ИФН-() и антител к мозгоспецифическому белку S-100.

В патенте РФ 2539034 «Лечение рассеянного склероза», авторов Штайдль С. (DE), Дюрр, М. (DE), Томассен-Вольф Э. (DE), Даунхэм М. (IT), Фрайзен Р. (NL), патентообладатель «МорфоСис АГ (DE)», дата подачи заявки (приоритет) 04.05.2010, опубликовано 10.01.2015, Бюл. №1, МПК C07K 16/22 (2006.01), C07K 16/24 (2006.01), C12N 15/13 (2006.01), A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан метод получения гуманизированных моноклональных антител, нейтрализующих активность гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF) и применения этих антител для лечения или профилактики пациентов с РС.

В патенте РФ 2384345 «Способ лечения рассеянного склероза» автора Фрона П.А. (US), патентообладатель, Genentech Inc. (US)», дата подачи заявки (приоритет) 02.06.2005, опубликованном 20.03.2010, Бюл. №8, МПК A61K 39/395 (2006.01) описана группа изобретений, включающая способ и изделие, предназначенные для лечения РС. Способ заключается во введении пациентам с ремиттирующей формой РС моноклональных гуманизированных антител против поверхностного рецептора В-лимфоцитов CD20 в количестве 0,5-4,0 г. Через 16-60 недель повторяют введение. Проводится до 4 и более воздействий антитела. Каждое из воздействий - в виде одной или двух доз антитела. Антитело может вводиться внутривенно, подкожно или эпидурально. При этом может использоваться второе лекарственное средство.

В патенте РФ 2390334 «Способ лечения рассеянного склероза», авторов Евдошенко Е.П., Маслянский А.Л., Заславский Л.Г., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Санкт-Петербургский государственный медицинский университет имени академика И.П. Павлова Федерального агентства по здравоохранению и социальному развитию", дата подачи заявки (приоритет) 17.12.2008, опубликовано 27.05.2010, Бюл. №15, МПК A61K 31/137 (2006.01), A61K 39/39 (2006.01), A61P 25/28 (2006.01) описан метод лечения больных РС, заключающийся в инфузии ритуксимаба в дозе 1 г с последующим введением митоксантрона в дозе 20 мг и повторной инфузии ритуксимаба в дозе 1 г через 13-15 дней. Перед инфузией ретуксимаба проводят премедикацию по описанному ранее методу. Способ позволяет достичь быстрого терапевтического эффекта и длительной ремиссии при всех формах РС без сопутствующей терапии, в т.ч. химиотерапии.

В патенте РФ 2208443 «Способ лечения рассеянного склероза» авторов Луцевич Э.В., Праздников Э.Н., Стулин И.Д., Самохин Г.Г., Савин А.А., Ушаков С.О., Вельшер Л.З., Золотовская И.К., патентообладатель Самохин Г.Г., дата подачи заявки (приоритет) 20.02.2001, опубликованном 10.03.2003, Бюл. №7, МПК A61K 35/39 (2000.01), A61K 31/197 (2000.01), A61K 31/44 (2000.01), A61K 31/375 (2000.01), A61K 31/395 (2000.01) описан способ лечения больных демиелинизирующими заболеваниями, в частности РС. Способ включает введение ингибитора протеолиза и водорастворимого антиоксиданта в разные поверхностные паховые лимфатические узлы в разовых дозах на порядок меньше среднетерапевтических со скоростью 0,4 мл/мин ежедневно в течение 20 суток.

В патенте РФ 2523058 «Способ терапии ремиттирующего рассеянного склероза», авторов Завалишин И.А., Елисеева Д.Д., Быковская С.Н., патентообладатель Общество с ограниченной ответственностью "Регенекс" (RU), дата подачи заявки (приоритет) 29.06.2012, опубликованном 20.07.2014, Бюл №20, МПК A61K 35/14 (2006.01), A61P 25/28 (2006.01) описан способ лечения ремиттирующего РС. Для этого больному в стадии ремиссии ремиттирующего РС вводят выращенные ex vivo аутологичные регуляторные Т-клетки CD4+CD25+Foxp3+(супрессоры аутоиммунного ответа) из расчета 4,5-5,5 млн клеток на 1 кг веса пациента. Использование данного способа приводит к повышению уровня CD4+CD25+Foxp3+регуляторных Т-клеток в 2 и более раза и поддержанию на уровне нормы, что позволяет пролонгировать состояние ремиссии заболевания до 12 месяцев.

В патенте РФ 2393861 «Композиция для лечения рассеянного склероза», авторов Страдомский Б.В., Вилков Г.А., патентообладатель Аверин К.М., Солодунов Ю.Ю., Страдомский Б.В., Вилков Г.А., дата подачи заявки (приоритет) 15.01.2009, опубликованном 10.07.2010, Бюл. №19, МПК A61K 31/4184 (2006.01), A61K 31/14 (2006.01), A61K 47/32 (2006.01), A61K 9/08 (2006.01), A61K 9/20 (2006.01), A61K 9/48 (2006.01), A61P 25/28 (2006.01) описана композиция (твердая или жидкая форма) для лечения РС, содержащая цитостатик трийодид 1,3-диэтилбензимидазолия в качестве активного начала, поливинилпирролидон низкомолекулярный медицинский, являющийся солюбилизатором и стабилизатором активного начала, и дополнительно в жидкой форме - спирт этиловый в качестве растворителя.

В патенте РФ 2414899 «Средства для лечения рассеянного склероза» авторов Страдомский Б.В., Вилков Г.А., патентообладатель Аверин К.М., Вилков Г.А., Страдомский Б.В., Солодунов Ю.Ю., дата подачи заявки (приоритет) 29.12.2009, опубликованном 27.03.2011, Бюл. №9, МПК A61K 31/4184 (2006.01), A61K 31/14 (2006.01), A61P 25/28 (2006.01) описана композиция (твердая или жидкая форма) для лечения РС на основе трийодида 1,3-диэтилбензимидазолия в качестве активного начала, поливинилпирролидона низкомолекулярного медицинского, являющегося солюбилизатором и стабилизатором активного начала, и дополнительно, в жидкой форме - спирт этиловый в качестве растворителя.

В патенте РФ 2278687 «Способ лечения ремиттирующего рассеянного склероза», авторов Гуфранова Р.Г., Новикова Л.Б., Сперанский В.В., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Башкирский государственный медицинский университет Федерального агентства по здравоохранению и социальному развитию" (ГОУ ВПО БГМУ РОСЗДРАВА РОССИИ) (RU), дата подачи заявки (приоритет) 16.06.2005, опубликованном 27.06.2006, Бюл. №18, МПК A61K 38/08 (2006.01), A61K 38/43 (2006.01), A61K 38/01 (2006.01), A61P 25/28 (2006.01), A61P 37/00 (2006.01) описан способ лечения РС. Комплексная терапия включает плазмаферез, интерферонотерапию, введение копаксона, цитостатиков, симптоматических и общеукрепляющих средств, циклоспорина А. При этом исключают введение стероидов и дополнительно в течение 10 дней вводят препараты: церулоплазмин внутривенно капельно по 100 мг и церебролизат внутримышечно по 10 мл. Способ обеспечивает достижение устойчивой ремиссии - до 12 месяцев - у 89,2% больных, снижение степени инвалидизации за счет восстановления регуляторных взаимоотношений нервной и иммунной систем.

В патенте РФ 2493845 «Композиция для лечения рассеянного склероза», автора Фазылов М.Ф., патентообладатель Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU), дата подачи заявки (приоритет) 07.06.2012, опубликованном 27.09.2013, Бюл. №27, МПК A61K 31/277 (2006.01), A61K 9/20 (2006.01), A61K 47/26 (2006.01), A61K 47/38 (2006.01), A61P 25/28 (2006.01) описано средство для лечения РС: композиция (твердая оральная дозированная форма) пригодна для сублингвальной, буккальной доставки или доставки через слизистую десны (Z)-2-циано-3-гидрокси-бут-2-эноик кислоты-(4′-трифторметилфенил)-амид (Терифлуномида) в качестве активного начала.

В патенте РФ 2471482 «Композиция для лечения рассеянного склероза», автора Фазылов М.Ф., патентообладатель Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU), дата подачи заявки (приоритет) 27.10.2011, опубликованном 10.01.2013, Бюл. №1, МПК A61K 31/277 (2006.01), A61P 25/02 (2006.01), A61P 25/28 (2006.01) описана фармацевтическая композиция для лечения РС, включающая терифлуномид в качестве активного начала и вспомогательные вещества при следующем соотношении компонентов, мас.%: терифлуномид - 3,0-13,5; лактоза и/или лудипресс LCE -48,5-65,0; крахмал - 7,0-16,0; микрокристаллическая целлюлоза и/или гипромеллоза - 20,0-30,0; коллидон VA-64 - 3,5-4,5; стеарат магния - 0,8-1,2; аэросил - 0,8-1,2; бенецел МР-824 - 13,5-15,5.

В патенте РФ 2257915 «Способ лечения обострений рассеянного склероза», авторов Лиждвой В.Ю., Котов С. В., Сидорова О.П., патентообладатель Государственное учреждение Московский областной научно-исследовательский институт им. М.Ф. Владимирского (МОНИКИ им. М.Ф. Владимирского) (RU), дата подачи заявки (приоритет) 17.10.2003, опубликованном 10.08.2005, Бюл. №22, МПК A61K 39/395 (2000.01), A61K 31/185 (2000.01), A61B 5/107 (2000.01), A61P 25/28 (2000.01) описан способ включает определения интерферонового статуса у пациентов с РС с последующей лекарственной терапией. При этом дополнительно определяют площадь тела больного и при зарегистрированной I степени угнетения системы интерферонов в качестве лекарственной терапии назначают препарат «Антилимфолин Кз» в/в капельно в курсовой дозе (0,5-0,6)г×S, где S - площадь тела больного, через день, и тиоктацид в дозе 300-600 мг в/в капельно ежедневно курсом 6-8 дней. При II и III степени угнетения системы интерферонов назначают «Антилимфолин Кз» в курсовой дозе 0,4-0,5 г/м2 и 0,3-0,4 г/м2, а тиоктацид в дозе 600-900 мг и 900-1200 мг соответственно. Способ позволяет эффективно избирательно воздействовать на иммунную систему за счет совместного назначения иммуномодулятора и средства, ускоряющего его введение при подавлении активности провоспалительных цитокинов, что удлиняет ремиссию заболевания, предупреждая прогрессирование иммунологических нарушений.

В патенте РФ 2562571 «Педиатрические композиции для лечения рассеянного склероза» Коварик Д. (CH), Шмоудер Р. (US), Бастьен М.-К. (US), Давид О. (CH), Карлссон Г. (CH), Буйон Т. (CH), патентообладатель «НОВАРТИС АГ (CH)», дата подачи заявки (приоритет) 19.06.2009, конвенционный приоритет 20.06.2008 US 61/132,621, опубликованном 10.09.2015, Бюл. №25, МПК A61K 31/137 (2006.01), A61P 37/00 (2006.01), A61K 38/00 (2006.01), A61K 38/21 (2006.01), A61K 39/00 (2006.01), A61K 45/00 (2006.01) предложены: фармацевтическая композиция указанного назначения для детей, содержащая 0,25 мг и менее 2-амино-2-[2-(4-С220-алкилфенил)этил]пропан-1,3-диола или его фармацевтически приемлемой соли для введения 1 раз в день, применение указанного соединения (FTY720) по 0,25 мг и менее для изготовления лекарственного средства для лечения, предупреждения или замедления развития РС у пациента педиатрического возраста для введения 1 раз в день и соответствующий способ лечения, предупреждения или замедления развития РС у пациента педиатрического возраста.

В патенте РФ 2522251 «Вещества и способы лечения рассеянного склероза, опосредованного B клетками», авторов Букель П. (DE), Уве Я. (DE), патентообладатель ЗУППРЕМОЛЬ ГМБХ (DE), дата подачи заявки (приоритет) 02.09.2009, опубликованном 10.07.2014, Бюл. №19, МПК A61K 38/17 (2006.01), A61P 37/00 (2006.01) описан способ применения рекомбинантного растворимого Fc( рецептора человека (Fc-гамма рецептор) при лечении РС, где РС представляет собой форму РС, опосредованную B клетками, и/или запускаемую аутоантителами форму РС. Изобретение относится к фармацевтической композиции, содержащей Fc( рецептор для применения при лечении РС, где РС представляет собой форму РС, опосредованную B клетками, и/или запускаемую аутоантителами форму РС.

В патенте РФ 2438133 «Способ прогнозирования эффективности лечения рассеянного склероза глюкокортикоидами», авторов Вострякова С.А., Алифирова В.М., патентообладатель Вострякова С.А., Алифирова В.М., дата подачи заявки (приоритет) 11.01.2011, опубликованном 27.12.2011, Бюл. №36, МПК G01N 33/53 (2006.01) описан способ прогнозирования эффективности лечения РС глюкокортикоидами путем исследования крови, где определяют содержание в крови абсолютного количества лимфоцитов с признаками апоптоза, вычисляют индекс реализации запрограммированной клеточной смерти ИРА (%) до лечения, во время терапии и после лечения по формуле. При нарастании величины ИРА после лечения глюкокортикоидами по отношению к первоначальным его значениям оценивают лечение как эффективное, а при отсутствии динамики прогнозируют отрицательный эффект от использования гормональной терапии. Данное изобретение обеспечивает более точное определение эффективности лечения РС лабораторным методом.

В патенте РФ 2353367 «Способ лечения клинических проявлений рассеянного склероза», автора Соков Е.Л., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Российский университет дружбы народов" (РУДН) (RU), дата подачи заявки (приоритет) 17.05.2007, опубликованном 27.04.2009, Бюл. №12. МПК A61K 31/573 (2006.01), A61K 31/167 (2006.01), A61K 33/14 (2006.01), A61K 35/14 (2006.01), A61P 25/28 (2006.01), A61P 23/02 (2006.01) описан способ лечения клинических проявлений РС. В шприц, предварительно наполненный 0,25-0,5 мл дексаметазона и 8-10 мл 1%-ного раствора лидокаина, осуществляют забор 2-4 мл аутокрови. При этом забор аутокрови производят из спонгиозной ткани ости лопатки или остистого отростка 4-го грудного позвонка. Введение смеси осуществляют внутрикостно в место забора аутокрови или в спонгиозную ткань другой кости. Способ обеспечивает повышение эффективности лечения клинических проявлений РС за счет активации метаболизма костной ткани и стимуляции иммунопоэза.

В патенте РФ 2569732 «Модуляторы рецептора S1P для лечения рассеянного склероза», авторов Хиштанд П. С.(CH), Шнелль К. (FR), патентообладатель НОВАРТИС АГ (CH), дата подачи заявки (приоритет) 25.06.2007, конвенционный приоритет 27.06.2006, GB 061272.1, опубликованном 27.04.2009, Бюл. №12, МПК A61K 31/137 (2006.01), A61P 37/02 (2006.01), A61P 25/28 (2006.01) описан способ лечения рецидивно-ремиттирующего РС (RRMS). Пациенту, нуждающемуся в таком лечении, вводят модулятор рецептора S1P перорально в суточной дозе 0,5 мг. Модулятор рецептора S1P представляет собой 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол или его фармацевтически приемлемую соль, например гидрохлорид. Изобретение позволяет замедлить прогрессирование рецидивно-ремиттирующего РС.

В патенте РФ 2495664 «Модуляторы рецептора S1P для лечения рассеянного склероза», авторов Хиштанд П.С.(CH), Шнелль К. (FR), патентообладатель НОВАРТИС АГ (CH), дата подачи заявки (приоритет) 25.06.2007, конвенционный приоритет 27.06.2006 GB 061272.1, опубликованном 20.10.2013, Бюл. №29, МПК A61K 31/137 (2006.01), A61K 31/397 (2006.01), A61K 45/06 (2006.01), A61P 25/28 (2006.01), A61P 43/00 (2006.01) описан способ лечения РС, состоящий в пероральном введении модулятора рецептора S1P - 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол или его фармацевтически приемлемую соль, в суточной дозе 0,5 мг. Метод обеспечивает профилактику или снижение интенсивности рецидивов рецидивно-ремиттирующего РС.

В патенте РФ 2209633 «Т-клеточная вакцина для лечения рассеянного склероза», авторов Вейнер Л. П. (US), Корреалле Х. Д. (AR), патентообладатель University of Southern Califormia (US), дата подачи заявки (приоритет) 18.09.1998, конвенционный приоритет 19.09.1997 US 60/059,534, опубликованном 10.08.2003, Бюл. №22, МПК A61K 39/00 (2000.01), A61K 35/14 (2000.01), C12N 5/08 (2000.01) описана вакцина, предназначенная для замедления развития РС. Вакцина содержит аттенуированные Т-клетки, выращенные в присутствии миелиновых белков, в частности в присутствии бычьих миелиновых белков. В предпочтительном варианте изобретения вакцина содержит аттенуированные Т-клетки, полученные выращиванием аутологичных циркулирующих мононуклеарных клеток в присутствии бычьих тотальных белков миелина, отбором и размножением Т-клеток с иммунной реакцией на миелиновые белки и аттенуацией клеток облучением. Преимущество изобретения в создании эффективного нетоксичного средства для лечения первичного или вторичного РС.

В патенте РФ 2121850 «Фармацевтическая композиция и способ лечения рассеянного склероза», авторов Кеннет У.Г. (CA), Кац И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 15.10.1992, конвенционный приоритет 22.10.1991 CA 2.053.799, опубликованном 20.11.1998, МПК A61K 38/10 (1995.01), A61K 38/16 (1995.01) описаны полипептиды и способ их использования для нейтрализации аутоантител против человеческого ОБМ. Фармацевтическая композиция в качестве, активного ингредиента включает пептид с длиной 8-25 а.о. Пептид способен нейтрализовать антитела к основному белку миелина. Доза введения пептида составляет 1- 10 мг/кг веса тела.

В патенте РФ 2561582 «Инъекционная лекарственная форма олигопептидного препарата для лечения рассеянного склероза и способ ее получения» авторов Автушенко С.С., Сурков К.Г., Романов В.Д., Генкин Д.Д., Габибов А.Г., Белогуров А.А., Пономаренко Н.А., патентообладатель Российская Федерация в лице Министерства промышленности и торговли Российской Федерации (RU), Открытое Акционерное Общество "Фармсинтез" (RU), дата подачи заявки (приоритет) 19.11.2010, опубликованном 27.08.2015, Бюл. №24, МПК A61K 38/16 (2006.01), A61K 9/127 (2006.01), A61P 25/28 (2006.01) описана новая инъекционная лекарственная форма известных олигопептидов для лечения РС. Препарат содержит олигопептиды:

GGDRGAPKRGSGKDSHH;

GFGYGGRASDYKSAHK;

QGTLSKIFKLGGRDSRSGSPMARR,

заключенные в липосомы, состоящие из смеси маннозиалированого дипальмитоилфосфатидилэтаноламина, 2,3-Дипальмитоил-sn- глицеро- 1-фосфатидилхолина, а также лактозы в качестве криопротектора и α-токоферола в качестве антиокислителя. Описан способ приготовления препарата.

В патенте РФ 2418582 «1,3-диалкилбензимидазолия галогениды - средства для лечения рассеянного склероза», автор Страдомский Б.В., патентообладатель Аверин К.М., Страдомский Б.В., Солодунов Ю. Ю. (RU), дата подачи заявки (приоритет) 08.04.2010, опубликованном 20.05.2011, Бюл. №14, МПК A61K 31/14 (2006.01), A61K 31/4184 (2006.01), A61P 25/28 (2006.01) описан способ лечения с помощью цитостатика галогенида 1,3-диалкилбензимизадолия.

В патенте РФ 2519196 «Лекарственное средство для лечения патологического синдрома и способ лечения рассеянного склероза» автор Эпштейн О.И., патентообладатель Эпштейн О.И., дата подачи заявки (приоритет) 01.07.2011, опубликованном 10.06.2014, Бюл. №16, МПК A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан способ лечения патологического синдрома, характерного для РС с помощью гомеопатических доз («активированная - потенцированная форма») антител к гамма-интерферону человека (ИФН-γ) и мозгоспецифическому белку S-100.

В патенте РФ 2448685 «Липосомы, содержащие олигопептиды - фрагменты основного белка миелина, фармацевтическая композиция и способ лечения рассеянного склероза», авторов Автушенко С.С., Сурков К.Г., Романов В.Д., Генкин Д.Д., Габибов А.Г., Белогуров А.А., Пономаренко Н.А., патентообладатель Российская Федерация в лице Министерства промышленности и торговли Российской Федерации (RU) и Открытое акционерное общество "Фармсинтез" (RU), дата подачи заявки (приоритет) 30.11.2009, опубликованном 27.04.2012, Бюл. №12, МПК A61K 9/127 (2006.01), A61K 38/02 (2006.01), A61K 38/17 (2006.01), C07K 14/47 (2006.01). A61P 37/00 (2006.01) описан способ получения липосом, содержащих олигопептиды - фрагменты основного белка миелина, фармацевтической композиции и способа лечения РС. Описан способ изготовления моноламеллярных липосом размером 100-200 нм, состоящих из смеси, содержащей 1 мас. часть тетраманнозил-три-L-лизин-диолеоил глицерола и 99 мас. частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина, и содержащих три олигопептида, последовательность которых соответствует последовательностям фрагментов: 46-62, 124-139 и 147-170 основного белка миелина. В качестве средства для лечения РС предложена фармацевтическая композиция, содержащая в качестве активного компонента моноламмелярные липосомы, а также способ лечения РС, включающий введение пациенту указанной фармацевтической композиции.

Описано также получение липосом, содержащих интегрированные (неконъюгированные ковалентно) олигопептиды, и их использования в качестве активного компонента в фармацевтических композициях, а также способ использования этих фармацевтических композиций для лечения РС. Авторы указывают, что использованные ими олигопептиды и их смеси, представляющие собой по химической структуре фрагменты ОБМ человека ранее описаны в патентах и публикациях. Такие олигопептиды обозначаются соответственно порядковому номеру первой и последней аминокислоты, считая от С-конца полной аминокислотной цепочки ОБМ. Например, ОБМ 18-32, то есть ASTMDHARHGFLPR, или, например ОБМ 75-98, то есть AGAPVVHPPLAIVTPAT. Известно, что часть пролиферирующих Т-клеток у больных РС направлена против ОБМ (Allegretta et al. Science. 247: 718-21 (1990)). Эти Т-клетки человека могут узнавать множественные эпитопы на молекуле ОБМ (Richer, I et al. J. Neuroimmun. 23:55-66 (1989)). ОБМ, по-видимому, также способен к активации некоторых Т-клеток без вовлечения антиген-презентирующих клеток (Altman, DM et al. Eur. J. Immunol. 17:1635-40 (1987)). Возможно, что небольшие олигопептиды - фрагменты ОБМ могут распознаваться Т-клетками без внутриклеточного процессинга просто за счет их способности связывать антигены основного комплекса гистосовместимости класса II на поверхности антиген-презентирующих клеток. Известны и хорошо изучены эпитопы (участки) ОБМ, ответственные за «узнавание» теми или иными специфическими Т-клетками, выделенными из крови больных PC и обеспечивающими иммунологическую «атаку» на ОБМ, а также В-клетками, которые вырабатывают аутоантитела, направленные против ОБМ. В связи с обнаружением таких эпитопов предпринимались и предпринимаются попытки с помощью коротких синтетических пептидов (олигопептидов), имеющих последовательность, гомологичную такому эпитопу ОБМ, вызвать состояние иммунологической толерантности или заблокировать (связать) аутоантитела против ОМБ. Признанной моделью РС человека у животных служит экспериментальный аутоиммунный энцефаломиелит (ЭАЭ), представляющий собой демиелинизирующий процесс, опосредованный Т-клетками. Течение ЭАЭ может быть приостановлено путем введения мышам синтетических пептидов, содержащих участки, гомологичные иммунодоминантным эпитопам ОБМ (Gaur, A. et al. Science. 258: 1491-94 (1992)). Более того, введение высоких доз ОБМ снижало количество аутореактивных Т-клеток и уменьшало клинические и патологические симптомы ЭАЭ у мышей (Gritchfield, J.M. et al. Science. 263: 1139-43 (1994)). Даже оральное введение ОБМ модулировало течение ЭАЭ за счет индукции периферической толерантности (Chen, W. et al. Science. 265:1237-40 (1994)). Было высказано предположение, что толерантность может быть индуцирована у больных PC с помощью перорального введения миелиновых антигенов (Weiner, H.L. et al. Science. 259:1321-24 (1993)). Комбинация миелиновых антигенов и синтетических пептидов указанных антигенов, введенная пероральным, и/или внутривенным, и/или эпидуральным путем, возможно, необходима для модулирования Т-клеток, В-клеток и макрофагов, участвующих в деструкции миелина у больных PC. Так, например, известны олигопептиды: ОБМ 75-98 (имеющий формулу AGAPVVHPPLAIVTPAT) [Заявка US 2005209156]; ОБМ 83-98 (имеющий формулу ENPVVHFFKNIVTPRT); ОБМ 146-160 (имеющий формулу AQGTLSKIFKLGGRD). Последние два были выбраны как носители эпитопов иммунодоминантных Т-клеток (Патент США №5858980). В публикации Warren, K.G. et al. Ann. Neurol. 35:280-289 (1994)) в качестве средства для лечения PC предложены олигопептидные фрагменты ОБМ, нейтрализующие или снижающие продукцию антител против ОБМ у пациентов, страдающих PC. Олигопептид ОБМ 84-102 был испытан в клиническом исследовании фазы I при лечении вторичного прогрессирующего PC. Дальнейшая разработка препарата была прекращена, поскольку не было выявлено влияния препарата на важнейшие показатели клинического течения PC (Goodkin, D.E. et al. Neurology. 54:1414-20 (2000)): неврологическая дисфункция и и скорость появления новых очагов демиелинизации в ЦНС. Также описан способ направленного подавления определенного клона Т-клеток, ответственного за развитие ЭАЭ у животных, и несущего интерферон-индуцибельный маркер CXCR3, с помощью ДНК-плазмиды, инкапсулированной в липосомы (Chen, W. et al. J Autoimmun. 28(1):30-40 (2007)). Также известно, что путь введения играет важную роль в осуществлении биологического (лечебного) эффекта олигопептидов - фрагментов ОБМ. Так, ингаляционное, но не пероральное введение энцефалитогенных пептидов - фрагментов ОБМ, несущих Т-клеточные доминантные эпитопы, приводило к уменьшению симптомов индуцированного у животных (Metzler, В et al. Int Immunol. (9):1159-65 (1993)). Хотя известно, что в случае использования липосомальных вакцин иммунный ответ усиливается вследствие того, что антигены, ассоциированные с липосомами, попадают непосредственно в антигенпрезентирующие клетки (Gluck, R. (1995) In Vaccine Design: The Submit and Adjuvant Approch (Powell M.F., Newman M.J., eds)., Plenum Press. P.325-345), в случае олигопептидов - фрагментов ОМБ не является очевидным, что их введение в организм в составе тех или иных частиц приведет к появлению или усилению позитивного клинического эффекта. Описано, что олигопептиды - фрагменты ОБМ (в частности, ОБМ 68-86 и ОБМ 87-99, но не ОБМ 110-128) оказывают синергидный лечебный эффект на течение ЭАЭ, когда вводятся совместно. При этом также использование интраназального пути введения приводило к большему эффекту, чем подкожное введение смеси этих олигопептидов в полном адъюванте Фрейнда (Liu, J.Q. et al. Int Immunol. 10(8):1139-48 (1998)). Также предпринимались попытки усилить лечебное действие олигопептида - фрагмента ОБМ (а именно ОБМ 113-122) при ЭАЭ путем предварительной липофилизации олигопептида и внедрения в липосомы перед введением. Однако такая «липосомальная» адъюванитизация не приводила к усилению эффекта при подкожном введении (Avrilionis K and Boggs JM. J Neuroimmunol. 35(1-3):201-10 (1991)). Нельзя также не упомянуть глатирамера ацетат (ГА), представляющий собой сложную смесь полипептидов, полученных путем полимеризации четырех аминокислот: глутамата, лизина, аланина и тирозина (CAS No. 147245-92-9), который имеет следующую условную структурную формулу: (Glu, Ala, Lys, Туr), ХСН3СООН). Способность ГА предотвращать ЭАЭ у животных была обнаружена случайно, и хотя к настоящему моменту препарат проявил свою эффективность у десятков тысяч пациентов PC, окончательной и однозначной теории механизма его действия не предложено. Как считается, иммуноспецифические эффекты ГА включают в себя: вытеснение ОБМ из связи с белками основного комплекса гистосовместимости; ингибирующее влияние на Т-клеточные рецепторы миелин-специфичных лимфоцитов; индукция клона ГА-специфичных Т-лимфоцитов 2 типа, подавляющих иммунный ответ в очагах демиелинизации благодаря выбросу противовоспалительных цитокинов IL-4 и IL-10 и др. Таким образом, проблема эффективного лечения (или профилактики обострений) РС путем введения в организм пациента тех или иных коротких пептидов - фрагментов ОБМ и их сочетаний с помощью того или иного носителя и/или того или иного пути введения остается до конца нерешенной в клинической практике. Наиболее близким к настоящему изобретению является фармацевтическая композиция и способ лечения РС, описанные в патенте RU 2198893, выбранные в качестве прототипа. Однако в известном способе в качестве фрагмента ОБМ используют один пептид ОБМ (82-98) DENPVVHFFKNIVTPRT, что является недостаточным для индукции иммунологических реакций в отношении нескольких клональных пулов Т (или В) - лимфоцитов, обладающих активностью против нескольких эпитопов ОБМ. При этом именно постулируемая низкая антигенность этого короткого пептида указывается в качестве его преимущества. Кроме того, применение этого олигопептида у больных РС в клинике оказалось неэффективным. Задачей этого изобретения являлось создание средства (фармацевтической композиции), обладающего иммунокорригирующими свойствами, не вызывающего аллергических реакций и обладающего высокой активностью как в отношении экспериментальных моделей РС (в частности ЭAЭ), так и в отношении течения РС у больных этим заболеванием. Поставленная задача решена путем использования в качестве активного компонента средства для лечения РС смеси (1:1:1 по массе) трех олигопептидов - фрагментов ОБМ следующей структуры:

Олигопептиды - фрагменты ОБМ
Формула/структура Соответствие положению последовательности аминокислот в ОБМ человека
1 GGDRGAPKRGSGKDSHH 46-62
2 GFGYGGRASDYKSAHK 124-139
3 QGTLSKIFKLGGRDSRSGSPMARR 147-170

причем указанная смесь заключена в моноламеллярные липосомы размером от 100 до 200 нм следующего состава: 1 мас. часть тетраманнозил-три-L-лизин-диолеоил глицерол и 99 мас. частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина. Как было выявлено в процессе работы над изобретением (исследовали вариации различных размеров и состава липосом), наибольшую способность снижать степень выраженности ЭАЭ у животных проявляла смесь вышеуказанных олигопептидов, в которой их соотношение в смеси составляло 1:1:1 по молярной массе, а состав липидов моноламеллярных липосом был: 1 часть по массе тетраманнозил-три-L-лизин-диолеоил глицерол и 99 частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина. Таким образом, согласно изобретению предложены моноламелллярные липосомы размером от 100 до 200 нм, содержащие смесь олигопептидов GGDRGAPKRGSGKDSHH; GFGYGGRASDYKSAHK; QGTLSKIFKLGGRDSRSGSPMARR, молярное соотношение между которыми составляет 1:1:1, при этом массовое соотношение смеси олигопептидов и липидного компонента липосом составляет 1:50, а липиды липосом представляют собой смесь тетраманнозил-три-L-лизин-диолеоил глицерола - 1 часть и 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина - 99 частей по массе.

В патенте РФ 2157815 «Пептидная специфичность антител к MBP (основному белку миелина), содержащая его фармацевтическая композиция и способ лечения рассеянного склероза», авторы Кеннет У. (CA), Кэтз И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 20.10.1995, конвенционный приоритет 21.10.1994 US 08/327.357, опубликованном 20.10.2000, Бюл. №29, МПК C07K 7/06 (2000.01), A61K 38/08 (2000.01), A61P 25/24 (2000.01) описывается новый пептид, способный нейтрализовать или модулировать образование антител к миелиновому основному белку, имеющий формулу I R1-Val-His-Phe-Phe-Lys-Asn-Ile-R2, где R1 выбрано из группы, включающей Asn-Pro-Val-; Pro-Val-; Val-; Lys-Ser-His-Gly-Arg-Thr-Gln-Asp-Glu-Asn-Pro-Val-; Thr-Gln-Asp-Glu-Asn-Pro-Val-; водород и гидрокси; R2 выбрано из группы, включающей -Val; -Val-Thr; -Val-Thr-Pro; -Val-Thr-Pro-Arg-, водород и гидрокси, при условии, что R1 и R2 одновременно не являются водородом или гидроксилом, при этом данный пептид содержит замещения, добавления или делеции. Описывается также фармацевтическая композиция на основе соединения общей формулы (I) и способ лечения РС. Технический результат - повышение эффективности при лечении РС.

В патенте РФ 2198893 «Пептидные фрагменты основного белка миелина, фармацевтические композиции на их основе и применение данных композиций для лечения рассеянного склероза», авторов Кеннет У. (CA), Кэтз И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 03.04.1998, конвенционный приоритет 04.04.1997 CA 2.201.841, опубликованном 20.02.2003. Бюл. №5. МПК C07K 7/08 (2000.01). C07K 14/435 (2000.01). A61K 38/04 (2000.01), A61K 38/17 (2000.01), A61P 25/00 (2000.01) описан полипептид формулы Asp-Glu-Asn-Pro-Val-Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr, способный нейтрализовать антитела к основному белку миелина. Пептид может использоваться для лечения РС и обладает большей активностью по сравнению с ОБМ. Пептид не является токсичным и не проявляет себя в качестве иммуногенов. Описана также фармацевтическая композиция, содержащая пептид, а также способ лечения РС с его применением.

В патенте РФ 2138512 «Вакцина для профилактики или лечения опосредованной Т-клетками патологии или нерегулируемой репликации Т-клеток, способ получения вакцины, способ диагностики или прогнозирования восприимчивости к ревматоидному артриту или рассеянному склерозу, способ профилактики или лечения ревматоидного артрита или РС и содержащий пептид с последовательностью SGDQGGNE, являющийся агентом для обнаружения, профилактики или лечения рассеянного склероза», авторов Хауэл М. (US), Бростофф С.(US), Карло Д. (US), дата подачи заявки (приоритет) 21.03.1990, конвенционный приоритет 21.03.1989 US 326314, 18.07.1989 US 382085, 18.07.1989 US 382086, опубликовано 27.09.1999, МПК C07K 7/06 (1995.01), A61K 39/44 (1995.01), G01N 33/564 (1995.01), G01N 33/68 (1995.01) предложенная вакцина для профилактики или лечения опосредованной Т-клетками патологии или нерегулируемой репликации клонами Т-клеток в млекопитающих содержит активное вещество и фармацевтически переносимую среду, при этом в качестве активного вещества она содержит рецептор Т-клеток или его фрагмент, соответствующий рецептору Т-клеток, находящемуся на поверхности опосредующих данную патологию Т-клеток, или антиидиотипические антитела, являющиеся внутренним изображением данного рецептора или его упомянутого фрагмента, причем активное вещество взято в количестве, обеспечивающем иммунизацию. Ее готовят путем получения клонов Т-клеток, вызывающих опосредованную Т-клетками патологию, определения последовательности аминокислот рецепторов Т-клеток клонов Т-клеток, связанных с данной патологией, отбора сегментов данных рецепторов Т-клеток, характерных для упомянутых рецепторов Т-клеток, а не для рецепторов Т-клеток, не связанных с данной патологией, и отбора из упомянутых последовательностей тех, которые способны к индукции иммуногенной реакции относительно упомянутого рецептора Т-клеток, таким образом отбирая вакцину. Также предложены способ диагностирования или прогнозирования восприимчивости индивидуума к ревматоидному артриту, который заключается в том, что он включает обнаружение Т-клеток, содержащих вариабельный β-структурированный участок MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS или его фрагмент, индивидуально определяемый для каждого пациента, причем анормальная экспрессия Т-клеток, содержащих такой участок, указывает на наличие ревматоидного артрита или восприимчивость к ревматоидному артриту, а также способ профилактики или лечения ревматоидного артрита, который заключается в том, что он включает предотвращение связывания рецептора Т-клеток, содержащего последовательность MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS, или рецептора Т-клеток, содержащего в основном последовательность SGDQGGNE, с его партнером, и способ профилактики или лечения ревматоидного артрита в индивидууме, который заключается в том, что он включает цитотоксическую или цитостатическую обработку Т-клеток, MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS, или Т-клеток, содержащих в основном последовательность SGDQGGNE в индивидууме.

Заявка на изобретение на патент РФ 2012157310 «Твердая пероральная фармацевтическая композиция агониста SlP или его фармацевтически приемлемой соли, способ ее получения и способ лечения и снижения частоты клинических обострений рассеянного склероза», автор Хрусталева А.О. (RU), заявитель Закрытое Акционерное Общество "БИОКАД" (ЗАО "БИОКАД") (RU), дата подачи заявки (приоритет) 27.12.2012, опубликованно 10.07.2014, Бюл. №19, МПК A61K 31/00 (2006.01) описывает способ получения твердой фармацевтической композиции перорального применения для лечения рецидивно-ремиттирующего РС и для уменьшения частоты клинических обострений заболевания и снижения риска прогрессирования инвалидности при рецидивно-ремиттирующем рассеянном склерозе, пригодная для перорального введения, включающая терапевтически эффективное количество агониста рецептора S1P (сфингозин-1-фосфата) и фармацевтически приемлемый носитель, отличающаяся тем, что фармацевтически приемлемый носитель не содержит микрокристаллической целлюлозы, сахарного спирта и кроскармеллозы (карбоксиметилцеллюлозы) или фармацевтически приемлемых производных кроскармеллозы.

Патент РФ 97 108 405 «Композиция (варианты), пептид (варианты) и способ для лечения рассеянного склероза (варианты)», авторов Гефтэр М. (US), Дивокс Б. (US), Пэйлиард К. (US), Розбард Д. (US), Смайлек Д. (US), Сэмсан М. (US), Фрэнзен Г. (US), Сю Д.-Х. (US), Ши Д.-Д. (US) заявитель «Имьюлоджик Фамэсьютикэл Копэрейшн (US)», дата подачи заявки (приоритет) 26.05.1997, опубликованный 10.05.1999, содержит описание средства лечения РС на основе пептидов из состава белков миелиновой оболочки.

Раскрытие изобретения

Известна публикация Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906–913, описывающая синтез декапептида с последовательностью VKKPGSSVKV, соответствующего участку последовательности 11–20 тяжелой цепи IgG1, а также любых других типов тяжелых цепей иммуноглобулинов. Пептид соответствует области наибольшей гомологии с фрагментом адренокортикотропного гормона (АКТГ, кортикотропин) 13–22: VGKKRRPVKV. Авторы присвоили пептиду название Иммунокортин. Проведенное в дальнейшем исследование активности Иммунокортина показало, что в диапазоне концентраций 10–6–10–9 M он оказывает иммуносупрессорное действие in vitro: подавляет бласт-трансформацию тимоцитов (Navolotskaya, E.V., Zargarova, T.A., Lepikhova, T.N., Nurieva, R.I., Lipkin, V.M., and Zav’yalov, V.P. (2000) Immunol. Lett., 72, 93–99) и фагоцитарную активность перитонеальных макрофагов мыши (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906–913). Наряду с иммуносупрессорной Иммунокортин проявил нейротропную активность: при внутримозговых инъекциях крысам в дозах 5–50 мкг/животное пептид снижал анальгезию, индуцированную β-эндорфином или стрессом, в то же время усиливал болеутоляющее действие тафцина. Внутримозговое введение 5–10 мкг пептида кролику приводило к увеличению нормальной температуры тела животного на 0,7–1,3°С (Наволоцкая Е.В. Вторая жизнь антител Биохимия. 2014. Т. 79. №1. С.5-12). Изучение связывания [3H]-иммунокортина с тимоцитами и перитонеальными макрофагами мыши показало, что эти клетки способны специфически и с высоким сродством (Kd комплекса пептид–рецептор составляла ~10–8–10–9М) связывать меченый пептид (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Завьялов В.П., Липкин В.М. (2000) Биоорган. химия, 26, 31–38). Известно, что в молекуле кортикотропина связывание с рецептором обеспечивает фрагмент 13–24 (Gispen, W.H. (1982) Acta Biol. Med. Ger., 41, 279–288). Было показано, что немеченый фрагмент АКТГ (13–24) на 100% ингибирует специфическое связывание меченого Иммунокортина как с тимоцитами, так и с макрофагами. В свою очередь, немеченый иммунокортин вытеснял меченный 125I фрагмент АКТГ (13–24) из комплекса с рецептором на мембранах головного мозга и коры надпочечников (Наволоцкая Е.В., Ванина В.И., Заргарова Т.А., Гочаренко Е.Н., Кудряшова Н.Ю., Алахая М.Я., Садовников В.Б., Семушина С.Г., Колобов А.А., Кампе-Немм Е.А., Юровский В.В., Липкин В.М. (2004) Биоорган. химия, 30, 350–355) крысы, а также на клетках T-лимфобластной линии MT-4 (Lepikhova, T.N., Navolotskaya, E.V., Zargarova, T.A., Nurieva, R.I., Lipkin, V.M., and Zav’yalov, V.P. (2000) Peptides, 21, 353–357). На основании этих результатов был сделан вывод о том, что Иммунокортин связывается с рецепторами к АКТГ на клетках иммунной, нервной и эндокринной систем. Известно, что взаимодействие кортикотропина с рецептором приводит к активации аденилатциклазы (Kapas, S., Cammas, F.M., Hinson, J.P., and Clark, A.J. (1996) Endocrinology, 137, 3291–3294). Иммунокортин активировал аденилатциклазу плазматических мембран тимоцитов и перитонеальных макрофагов мыши и увеличивал содержание cAMP в этих клетках (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906–913). Аденилатциклазная система играет важную роль в регуляции функциональной активности мононуклеарных фагоцитов. Увеличение синтеза cAMP в перитонеальных макрофагах приводит к ингибированию продукции активных форм кислорода, а также к уменьшению синтеза и секреции простагландинов (Bromberg, Y., and Pick, E. (1981) Cell. Immunol., 61, 90–103). Все эти события на клеточном уровне проявляются как снижение активности макрофагов. В настоящее время нет данных о факте образования Иммунокортина или близких к нему пептидов в организме, а тем более, их концентрациях. Однако вполне вероятно, что такие пептиды действительно образуются в физиологических условиях в результате расщепления иммуноглобулинов различных классов в составе комплекса антиген–антитело в фагоцитах. Известно, что наиболее интенсивный процессинг Fc-субъединиц происходит в кислой среде фаголизосом (Tischenko, V.M., Zav’yalov, V.P., Medgyesi, G.A., Potekhin, S.A., and Privalov, P.L. (1982) Eur. J. Biochem., 126, 517–521). Образующиеся под действием кислых гидролаз пептиды посредством секреции или в результате гибели фагоцитов могут попадать в окружающую очаг воспаления среду и служить своеобразными «сигналами бедствия», вовлекающими клетки иммунной и других систем организма в процесс элиминации антигена. Напротив, Fab-фрагменты, из которых может образовываться Иммунокортин, в кислой среде имеют наболее кооперативную, устойчивую к протеолизу структуру (Schneider, I.I., De Dwe, C., and Trowet, D. (1982) J. Cell Biol., 88, 380–387). Однако в среде, близкой к нейтральной, кооперативность укладки вариабельных (VH) частей уменьшается, и они расщепляются под действием протеаз. При этом VH-домены могут явиться источником пептидов с АКТГ-подобной структурой. Поскольку расщепление Fab-фрагментов иммуноглобулинов в фаголизосомах происходит в незначительной степени, а Иммунокортин составляет лишь часть от общей массы иммуноглобулина, биологически значимые концентрации АКТГ-подобного пептида могут достигаться только при высокой скорости протеолитического процессинга. Исходя из этого, вероятной функцией таких пептидов может быть выполнение ими роли сигнала обратной связи в процессах, связанных с регуляцией иммунного ответа на уровне связывания и деградации антител с различными типами клеток. Таким образом, в результате ферментативного расщепления иммуноглобулинов в составе комплекса антиген–антитело в фагоцитах образуются пептиды, модулирующие функции иммунной, нервной, эндокринной и других систем организма. Эти пептиды играют роль сигнальных молекул активации (тафтсин, ригин, иммунорфин, p24 и его фрагменты) и подавления (Иммунокортин) иммунного ответа.

С учетом изложенного, в основу изобретения была положена гипотеза о том, что иммуносупрессорная активность Иммунокортина может быть использована для лечения РС путем подавления пролиферации популяций лимфоцитов, участвующих в аутоиммунном разрушении миелина, а возможно, и других компонентов нейрональной ткани. В качестве аргумента в пользу вероятной эффективности и безопасности этого пептида выдвинут тезис об эндогенном происхождении этого пептида (вероятно, он образуется в естественных условиях за счет деградации иммуноглобулинов). Таким образом, он может проявить лучшее соотношение специфической и иммуносупрессорной активности побочных эффектов (снижение иммунной защиты и неспецифическая токсичность) по сравнению с известными средствами лечения РС. Таким образом, прототипом нашего изобретения является работа Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906–913. Для практического использования пептида при лечении РС, аналогичного Иммунокортину, необходимо было решить две задачи:

1. Ограничить его паракринную АКТГ-подобную активность на кору надпочечников и ЦНС, сохранив иммуносупрессорый потенциал (способность подавлять пролиферацию лимфоцитов). За счет этого возможно добиться использования пептида в более широком интервале концентраций, добиваясь наилучшего лечебного эффекта без побочных явлений.

2. Повысить эффективность синтеза пептида и его устойчивость в кровяном русле человека (животного), сократив длину пептида и минимизировав содержание в нем тандемно расположенных пар катионных аминокислот (Lys и Arg), которые входят в сайты распознавания наиболее активных протеаз крови (плазмин, фурин, ренин и другие), карбоксипептидаз типа А, В и Kex, аминопептидаз, а также внутриклеточных протеаз макрофагов (катепсин D и других).

В порядке решения поставленных задач предложена последовательность пептида Abu-SSVKVS-Abu (Abu – α-аминомасляная кислота), которая отличается от прототипной тремя признаками:

1) Отсутствуют остатки VKKPG, соответствующие позициям 11-15 тяжелой цепи иммуноглобулина, и располагающиеся на N-конце Иммунокортина;

2) На C-конце присутствует дополнительный остаток Ser, отсутствующий в Иммунокортине, соответствующий позиции 21 тяжелой цепи иммуноглобулина;

3) На N- и C-концах пептида добавлены остатки α-аминомасляная кислоты, присутствующей в организме человека, но не входящей в состав белков.

На основании сравнения последовательности Иммунокортина и АКТГ предполагается, что перечисленные признаки способны обеспечить избирательность связывания предложенного пептида Abu-SSVKVS-Abu с рецепторами на поверхности лимфоцитов, но предотвратят его связывание с рецепторами коры надпочечников. Кроме того, достигается упрощение синтеза пептида Abu-SSVKVS-Abu по сравнению с прототипом за счет сокращения его длины, и повышается стабильность в кровяном русле за счет экранирования концов пептида остатками Abu на фоне удаления пары Lys-Lys, создающей сайт для наиболее активных эндопептидаз плазмы крови.

В процессе осуществления изобретения проводят следующие экспериментальные процедуры:

1. Твердофазный синтез, очистка и характеристика чистоты пептида Abu-SSVKVS-Abu;

2. Биологические испытания пептида Abu-SSVKVS-Abu in vivo по способности купировать симптоматику РС на модели экспериментального аутоиммунного энцефаломиелита у крыс (ЭАЭ), оценка биологической безопасности пептида;

3. Исследования общей иммуносупрессорной активности пептида Abu-SSVKVS-Abu in vitro по способности подавлять пролиферацию лимфоцитов крысы, запускаемую активацией конканавалином А.

Краткое описание графических изображений

Фиг.1. Схема твердофазного синтеза пептида Abu-SSVKVS-Abu-NH2 c применением Boc/Bzl- методологии.

Полимерная подложка с MBHA-линкером обозначена в виде закрашенного круга. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показана с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидил-полимера. (1), (3), (5), (7), (11), (13): Boc-Xaa-OH (3 экв.), TBTU (2.7 экв.), HOBt (3 экв.), NMM (3 экв.), DMF.; (2), (4), (6), (8), (10), (12), (14), (16): 1) TFA/DCM 50/50 2) DIPEA; (9), (15): Boc-Xaa-OH (6 экв.), DCC (3 экв.); (17) HF, «ловушка» (скэвенджер) карбокатионов.

Фиг.2. Биологические испытания терапевтической эффективности пептида Abu-SSVKVS-Abu in vivo на модели ЭАЭ у крыс. По оси абсцисс отложено время с момента иммунизации животных миелином. По оси ординат отложен индекс тяжести клинических проявлений ЭАЭ в баллах. Стандартная ошибка измерения показана вертикальной чертой возле каждой экспериментальной точки. Кривая 1 (квадраты) – контрольная группа крыс с ЭАЭ, получавшая плацебо, n=10; кривая 2 (кружки) – экспериментальная крыс с ЭАЭ ежедневно получавшая пептида Abu-SSVKVS-Abu в дозе 400 мкг/кг, n=10.

Фиг.3. Результаты теста на подавление пептидом Abu-SSVKVS-Abu пролиферации лимфоцитов крысы в культуре, вызванной митогенным лектином Конканавалин А (ConA). Скорость пролиферации оценивают по дыхательной активности, измеряемой с помощью alamarBlue, по величине флуоресценции флуорогенного субстрата. ConА в концентрации 2 мкг/мл и пептид Abu-SSVKVS-Abu-NH2 в концентрации от 10-4 до 10-8 М (всего 8 разведений) добавляют в среду культивирования в иммунологических планшетах и инкубируют в СО2-инкубаторе при содержании СО2 5% в течение 48 часов. Дыхательную активность измеряют с помощью планшетного флуориметра FLUOstar Omega (BMG LABTECH), выражая ее в % от контроля (клетки, стимулированные ConА в концентрации 2 мкг/мл без добавления пептида Abu-SSVKVS-Abu-NH2).

Осуществление изобретения

Разработка нового способа лечения РС включает в себя анализ имеющихся данных об этиологии РС.

Выбор именно методологии на основе Boc/Bzl-производных аминокислот в качестве отправной точки поиска эффективного метода синтеза целевого пептида обусловлен тем, что она более подробно описана в литературе, нежели методология на основе Fmoc/tBu-производных аминокислот. Кроме того, защищенные производные аминокислот для Boc/Bzl ТФПС имеют более низкую стоимость. В Boc/Bzl методологии ТФПС стандартными защитными группами боковых цепей Ser и Thr является бензильная (в виде бензилового эфира), а Arg - тозильная. Комбинация этих защитных групп и линкера требует удаления пептида с полимерной подложки и депротекции с помощью наиболее сильных кислот.Для осуществления этих двух превращений используют безводную фтористоводородную кислоту.

Аминокислоты переводят в форму активированых бензотриазолиловых эфиров с помощью TBTU, а Na-Boc группы удаляют 50% раствором трифторуксусной кислоты в дихлорметане.

Образование амидных связей Val с другими аминокислотами пептидной последовательности Abu-SSVKVS-Abu-NH2 (как с N-конца, так и с C-конца) c помощью TBTU проходит не до конца. Эту проблему решают с помощью процедуры получения симметричных ангидридов. Реакции ацилирования со смешанными ангидридами проходили практически до достижения 100% конверсии (Табл. 1). В своем окончательном виде разработанная схема синтеза представлена на Фиг.1.

Таблица 1

Результаты реакции пептидил-полимера Abu-SSVKVS-Abu-NH-MBHA-PS с HF

Условия:
Время выдержки, ч Скэвенджер Выход (ВЭЖХ), %а MALDI MSb
1 2 3 4
1 м-крезол 38 775.47 (цел.прод.); примеси 676.40 (ΔVal), 688.43 ΔSer), 865.51 (+Bzl), 943.47 (+2-ClZ), 955.56 (+2 Bzl), 1033.51 (+Bzl+2-ClZ), 1045.61 (+3 Bzl), 1123.55 (+2Bzl+2-ClZ)
1 гептилмеркаптан 33 775.45 (цел.прод.); примеси 676.40 (ΔVal),
688.43 (ΔSer), 865.52 (+Bzl), 943.46 (+2-ClZ), 955.54 (+2 Bzl), 1033.52 (+Bzl+2-ClZ), 1045.60 (+3 Bzl), 1123.56 (+2Bzl+2-ClZ)
1 этандитиол 34 775.44 (цел.прод.); примеси 676.41 (ΔVal),
688.42 (ΔSer), 865.52 (+Bzl), 943.43 (+2-ClZ), 955.54 (+2 Bzl), 1045.62 (+3 Bzl)
3 м-крезол 29 775.47 (цел. прод.); примеси 676.40 (ΔVal),
688.43 (ΔSer), 757.46 (Ser ->Δ2;3Abu)
3 гептилмеркаптан 23 775.46 (цел. прод.); 676.40 (ΔVal), 688.43
(ΔSer), 757.47 (Ser ->Δ 2;3 Abu), 586.33
(Pyr-VKVS-Abu)
3 этандитиол 22 775.46 (цел. прод.); 676.40 (ΔVal), 688.43
(ΔSer), 757.48 (Ser ->Δ2;3Abu), 586.34 (Pyr-VKVS-Abu-a)
2 м-крезол 34 75.47 (цел. прод.); примеси 676.40 (ΔVal),
688.43 (ΔSer), 757.46 (Ser ->Δ2;3Abu), 865.51 (+Bzl), 943.47 (+2-ClZ)

а) Оценочная величина, основанная на интегрировании пиков хроматограммы неочищенной реакционной смеси;

b) Идентифицированные пики в масс-спектрах образцов неочищенной реакционной смеси.

В результате испытаний устанавливают, что наилучший результат достигается при времени реакции 1 час с добавкой м-крезола в качестве ловушки катионов. Органические соединения серы несколько уступают с точки зрения химического выхода (по ВЭЖХ). Масс-спектрометрически идентифицируют продукты с неудаленными защитными группами. Увеличение времени реакции позволяет довести конверсию реакций депротекции до максимума, повысив выход продукта. Однако увеличение продолжительности времени реакции до 3 часов приводит к накоплению продуктов побочной реакции дегидратации серина. Интересно, что в присутствии сульфидных скэвенджеров происходит тиолиз продукта дегидратации серина с образованием производного пировиноградной кислоты с молекулярной массой 586,34 Да. Снятие пептида с полимерной подложки с промежуточным временем реакции (2 ч) не приводит к повышению химического выхода продукта.

Химически гомогенный образец пептида выделяют с помощью препаративной ВЭЖХ с выходом 19%. Таким образом, в результате работы по синтезу пептида амидной формы пептида Abu-SSVKVS-Abu с помощью Boc/Bzl-методологии получают гомогенный образец целевого продукта.

Тестирование способности пептида Abu-SSVKVS-Abu подавлять развитие экспериментального аутоиммунного энцефаломиелита (ЭАЭ) проводят на крысах линии DA, которые генетически предрасположены к развитию симптоматики аутоиммунных заболеваний, в том числе демиелинизации в результате воспалительной реакции иммунной системы как следствие сенсибилизации организма аутологичным миелин содержащим препаратом. В данной системе возможно определение диапазона активных концентраций препарата и эффективности его действия в плане предотвращения или замедления прогресса процесса демиелинизации. Модель предполагает возможность статистической обработки и анализа результатов экспериментов в полном соответствии с требованиями, предъявляемыми к современному фармацевтическому производству.

Гомогенат спинного мозга беспородных крыс готовят по методике [Christine Beeton, Adriana Garcia, K. George ChandyJ Vis Exp.2007; (5): 224]. Экспериментальной группе из 10 крыс линии DA массой 220–250 г и аналогичной группе контроля в подушечки каждой из двух задних лап вводят гомогенат спинного мозга, смешанный с неполным адъювантом Фрейнда в пропорции 1:1, в суммарном объеме 100 мкл в каждую лапу. На следующий день после иммунизации каждому животному экспериментальной группы внутрибрюшинно вводят пептид Abu-SSVKVS-Abu в дозировке 400 мкг/кг массы тела в объеме 100 мкл стерильного апирогенного физиологического раствора. Животным контрольной группы вводят 100 мкл физиологического раствора. Далее животным в течение 18 следующих суток ежедневно вводят аналогичную дозу испытуемого препарата или плацебо. Крыс ежедневно взвешивают и фиксируют в баллах индекс тяжести клинических проявлений ЭАЭ по следующей шкале: 0 – нет симптомов, 1 – снижение тонуса хвоста, 2 – нарушение установочного рефлекса, 3- частичный паралич, 4 – полный паралич, 5 – животные погибли или умирают. В сомнительных случаях индекс фиксируют с занижением. Явные признаки ЭАЭ у животных контрольной группы фиксировались с 8 по 14 день с начала эксперимента (Фиг.2). Пик заболевания длился 2-3 дня и приходился на 11-14 сутки с начала эксперимента. На графике хорошо видно, что у животных экспериментальной группы заболевание начинается в среднем на 1 сутки позже, чем у контрольной. На восходящем участке кривой (11-14 сутки) тяжесть симптомов в экспериментальной группе оказывается среднем на два балла ниже, чем в контрольной. Далее, на стадии ремиссии различия в течении заболевания между группами сглаживаются. Последнее обстоятельство не может быть экстраполировано на течение РС у человека, так как, в отличие от ЭАЭ у крыс, оно не имеет спонтанной ремиссии.

Для проведения эксперимента по исследованию способности пептида Abu-SSVKVS-Abu подавлять пролиферацию клеток иммунной системы используют крыс линии DA. Четыре крысы подвергаются легкому эфирному наркозу и забиваются, после чего у них отбирают популяцию лимфоцитов из региональных лимфоузлов по следующей методике.

Лимфоузлы измельчают с помощью ручного гомогенизатора Поттера, продавливают через капроновое сито и гомогенат наносят на градиент фиколла (d=1,077 г/мл, БиолоТ, С.-Петербург). После центрифугирования при 400 g в течение 40 мин при комнатной температуре (бакет-ротор S40 центрифуги BR4 (Jouan, France)) отбирают фракцию лимфоцитов, промывают ее раствором Хенкса и проводят подсчет клеток с помощью гемоцитометра, окрашивая мазки Трипановым синим. Клетки помещают в среду DMEM с добавлением 10% эмбриональной телячьей сыворотки (HyClone), 2 мM глутамина, 2 мM пирувата Na, 2×10-5 M β-меркаптоэтанола и 40 мкг/мл гентамицина. Используют реактивы производства Sigma-Aldrich (США).

Полученную таким образом культуру иммунных клеток крыс с ЭАЭ используют для проведения теста на подавление ConA-зависимой пролиферации. В лунки 96-луночного культурального планшета Costar, содержащих по 5×104 клеток (100 мкл) добавляют 100 мкл среды DMEM с добавлением 10% эмбриональной телячьей сыворотки, 2 мкг/мл ConA и пептида Abu-SSVKVS-Abu в понижающейся концентрации от 10-4 до 10-8 М с шагом 4 раза. Планшет инкубируют при 37°С в CO2-инкубаторе при 5% содержании CO2 в течение 24 часов. Определение эффективности пролиферации (жизнеспособности) проводят измеряя дыхательную активность с помощью аlamarBlue (Thermo Fisher Scientific, США) по методике производителя. Флуоресценцию измеряют с помощью планшетного флуориметра и выражают в процентах относительно контроля: клеточная культура, подвергнутая стимуляции ConA в отсутствие пептида Abu-SSVKVS-Abu.

Усреднение результатов трех независимых экспериментов (Фиг.3) позволяет заключить, что препарат пептида Abu-SSVKVS-Abu подавляет пролиферативную активность лимфоцитов, причем этот эффект зависит от дозы пептида в диапазоне от 10-4 до 10-6 М. Снижение скорости пролиферации лимфоцитов в два раза по сравнению с исходным уровнем (IC50) достигается при концентрации 11,8±2,1 мкМ.

Список используемых в тексте сокращений и терминов

АКТГ – адренокортикотропный гормон (кортикотропин);

ИФН – интерферон;

МАГ – миелин-ассоциированный гликопротеин;

МОГ – миелин-олигодендроцитарный гликопротеин;

ОБМ – основной белок миелина;

ПЛП – протеолипидный протеин;

РС – рассеянный склероз;

ТФПС – твердофазный пептидный синтез;

ЦНС – центральная нервная система;

ЭАЭ – экспериментальный аутоиммунный энцефаломиелит (животная модель рассеянного склероза);

ConA – конканавалин А;

Ig – иммуноглобулин;

IL – интерлейкин;

GM-CSF – гранулоцитарно-макрофагальный колониестимулирующий фактор;

RRMS – ремиттирующая форма РС;

PPMS– первичная прогрессирующая форма РС;

SPMS – вторичная прогрессирующая форма РС.

Пептид с последовательностью Abu-Ser-Ser-Val-Lys-Val-Ser-Abu (Abu – α-аминомасляная кислота), соответствующий консервативному участку домена VH тяжелой цепи иммуноглобулинов человека, предназначенный для лечения рассеянного склероза у человека.



 

Похожие патенты:
Настоящее изобретение относится к порошку для растворения перед применением для препаратов для инъекций, содержащему мелатонин, по меньшей мере один водорастворимый эксципиент и по меньшей мере один водорастворимый сурфактант, для лечения неонатального церебрального инфаркта.

Изобретение относится к области фармацевтики и медицины и касается способа введения полипептида, содержащего подобный эпидермальному фактору роста (EGF-подобный) домен, млекопитающему, где указанный способ включает: введение полипептида после неврологического повреждения у указанного млекопитающего и начало введения в пределах подострого окна после неврологического повреждения.

Настоящее изобретение относится к твердой фармацевтической дисперсии, содержащей 3-(4-бензилоксифенил)-изоксазол-5-илметиловый эфир карбаминовой кислоты в качестве активного ингредиента, растворимый в воде полимер, имеющий температуру перехода в стеклообразное состояние ниже точки плавления активного ингредиента, в качестве носителя и смягчитель.

Настоящее изобретение относится к иммунологии. Предложено антитело к молекуле отталкивающего направляющего сигнала а (RGMa).

Данное изобретение относится к области иммунологии. Предложено изолированное антитело, которое обладает способностью специфично связываться с амилоидом бета (Аβ), а также антигенные циклические пептиды, способные вызывать специфический иммунный ответ против олигомерного Аβ.

Изобретение относится к новому соединению формулы 1, обладающему свойствами ингибиторов Янус киназы (JAK). Соединения могут найти применение для лечения заболеваний, выбранных из группы, включающей рассеянный склероз, ревматоидный артрит, ювенильный артрит, псориатический артрит, диабет типа I, волчанку, псориаз, воспалительное заболевание кишечника, язвенный колит, болезнь Крона, миастению, нефропатию иммуноглобулинов, аутоиммунные заболевания щитовидной железы.

Изобретение относится к новому соединение, а именно 1,3-бис(4-метоксибензоил)пиримидин-2,4(1H,3H)-диону, соответствующему структурной формуле (I), указанной ниже. Соединения обладают разрывающей поперечные сшивки гликированных белков активностью и могут найти применение при лечении диабета и болезней, связанным со старением и нейродегенеративной амилоидной болезнью, такой как болезнь Альцгеймера.
Изобретение относится к фармацевтической промышленности, а именно к средству для коррекции психоэмоционального статуса организма, обладающее антистрессорным, антидепрессивным, анксиолитическим и ноотропным действием.

Изобретение относится к области органической химии, а именно к гидроксипроизводному хинолина формулы (I) или к его фармацевтически приемлемой соли, (I) где R1 представляет собой водород, (С1-С3)алкил, (С1)алкилен(С3)циклоалкил, (С1)галоалкил или (С1)алкилен(С6)арил; R2 представляет собой водород или галоген; R3 представляет собой водород, галоген, (С1)алкил или (С1)алкокси; R4 представляет собой водород, галоген, (С1)алкил, (С1)алкокси или (С1)галоалкил; R5 и R6 представляют собой водород; и R7 представляет собой (С9-С15)алканол, (С1)алкиленпиперазинил(С1-С2)алканол, (С1-С8)алкиленпиперазинил(С1-С2)алкил, (С10-С13)алкиленОСОСН3, (С1)алкилен(С1)алкиламино(С3)алкинил, (С1)алкиленамино(С8)алканол или (С1)алкиленамино(С6)алканол(С1)алкилен(8-метоксихинолин-2-ил); или (II), где R1, R2, R3, R4 и R6 каждый является таким, как описано в (I) выше; R5 представляет собой (С11-С12)алканол, и R7 представляет собой водород.

Изобретение относится к медицине и предназначено для лечения рассеянного склероза. Используют пробиотический штамм Enterococcus faecium L-3.
Изобретение относится к медицине, а именно к наркологии, анестезиологии и психотерапии, и может быть использовано для лечения метадоновой зависимости. Для этого проводят премедикацию, анестезию, детоксикацию и введение антагониста наркотика.

Изобретение относится к ветеринарной медицине и может быть использовано для профилактики технологического стресса у овец при стрижке. Для этого до стрижки осуществляют транскраниальную электростимуляцию (ТЭС).

Изобретение относится к применению соединения с химической формулой Tyr-dAla-Phe-Gly-Phe-Leu-NH2 в качестве средства, увеличивающего устойчивость сердца к реперфузионному повреждению, например, для уменьшения повреждения миокарда при ишемии/реперфузии у пациентов с острым инфарктом миокарда, в ходе кардиохирургических вмешательств с использованием искусственного кровообращения и при трансплантации сердца.

Группа изобретений относится к области фармацевтики и медицины и касается пептида, содержащего последовательность глицин-аргинин-глицин-цистеиновая кислота-треонин-пролин, который ингибирует клеточную адгезию к RGD-сайтам связывания.

Группа изобретений относится к медицине, а именно к токсикологии, и может быть использована для гепатопротективного воздействия при токсическом гепатите. Предложено применение пептида формулы Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанк) в качестве гепатопротекторного средства.

Изобретение относится к экспериментальной медицине и может найти применение в космонавтике для поддержания на высоком уровне операторской деятельности космонавтов в условиях не прогнозированного воздействия радиации, а также реабилитации пациентов после протонной терапии опухолей головного мозга.

Группа изобретений относится к области медицины, а именно для регуляции гемостаза и заживления ран. Группа изобретений включает гемостатический материал, содержащий пептид, имеющий последовательность SEQ ID NO: 1 или его последовательность аналогов аминокислот, и каркас, в котором упомянутый каркас представляет собой натуральный полимер желатин, где желатин содержит абсорбируемую гемостатическую порошкообразную матрицу, губкообразную матрицу, пастообразную матрицу, гелеобразную матрицу или их комбинации, и указанный желатин является сшитым и находится в форме частиц с жидким носителем, а также материал для заживления тканей аналогичного состава и способ обеспечения кровоостанавливающего лечения или заживления тканей в месте раны, включающий формирование гемостатического материала или материала для заживления тканей аналогичного состава и нанесение гемостатического материала или материала для заживления тканей на место раны.

Изобретение относится к медицине, а именно к офтальмологии, и может быть использовано для комплексного лечения эндогенного увеита, сопровождающегося макулярным отеком.

Предложенная группа изобретений относится к области медицины. Предложена лекарственная композиция для лечения нарушений массы тела, содержащая по меньшей мере 90% микрочастиц пептида Ac-Arg-c(Cys-D-Ala-His-D-Phe-Arg-Trp-Cys)-NH2 или его фармацевтически приемлемой соли в качестве активного вещества и биосовместимого водорастворимого полимера, выбранного из гиалуроновой кислоты или ее соли.

Изобретение относится к выделенным пептидам, способным вызывать антигенспецифический Т-клеточный ответ на человеческий циклин A1 (CCNA1). Предложены композиции и способы для индукции антигенспецифических Т-клеточных ответов против человеческого циклина A1 (CCNA1), который в данном документе определяется как антиген, ассоциированный с лейкемией, на основании его сверхэкспрессии при остром миелоидном лейкозе (AML), в том числе в лейкемических стволовых клетках (LSC) и в иммунологически привилегированных клетках семенника, но не в других нормальных типах клеток.

Изобретение относится к медицине и касается короткого пептида с цитотоксической активностью общей формулы R3-Phe-D-Trp-Lys(R1)-Thr-R2, где R1 представляет собой Н, трет-бутилоксикарбонил; R2 представляет собой гидрокси, метокси, амино, гидроксиамино, аминобензильную, 1-аминонафтильную группу; R3 - трет-бутилоксикарбонил-Cys(R4) или 3-R5-тиазолидин-4-карбонил, где R4 - Н или трет-бутилоксикарбонил, ацетамидометил; R5 - Н или трет-бутилоксикарбонил. Изобретение обеспечивает высокую цитотоксическую активность и устойчивость к ферментативному разложению, что дает возможность орального введения в организм, дополнительно к парентеральному, осуществляемому подкожно, внутривенно, внутримышечно и внутрибрюшинно. 2 табл., 19 пр.

Изобретение относится к медицине и касается пептида с последовательностью Abu-Ser-Ser-Val-Lys-Val-Ser-Abu, соответствующего консервативному участку домена VH тяжелой цепи иммуноглобулинов человека, предназначенного для лечения рассеянного склероза у человека. Изобретение обеспечивает подавление пролиферативной активности лимфоцитов. 1 пр., 3 ил., 1 табл.

Наверх