Селективный бифункциональный препарат на основе фрагментов одноцепочечных антител верблюжьих, нацеленный на опухолевые рецепторы cd47/erbb2, предназначенный для терапии злокачественных новообразований



Владельцы патента RU 2648164:

Федеральное государственное учреждение науки Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук (ИБХ РАН) (RU)

Изобретение относится к области биотехнологии, в частности к терапевтическому бифункциональному агенту, подавляющему рост раковых стволовых клеток за счёт блокады опухолевых рецепторов CD47 и ERBB2. Указанный агент состоит из двух фрагментов VHH верблюжьих антител, первый из которых способен распознавать и избирательно связываться с CD47, а второй – с ERBB2. При этом фрагменты соединены между собой с помощью полипептидного линкера (Gly4Ser)4 или иного линкера, позволяющего разнести в пространстве VHH-фрагменты таким образом, чтобы обеспечить беспрепятственное связывание каждого из них со своим белком-мишенью. Настоящее изобретение позволяет повысить специфичность, биодоступность, эффективность и избирательность антител, подавляющих рост раковых стволовых клеток, снизив при этом воздействие на нормальные клетки организма пациента. 2 з.п. ф-лы, 2 пр.

 

Изобретение относится к области биотехнологии и медицины и может быть использовано для элиминации раковых стволовых клеток и предотвращения рецидивов опухолей.

Основной причиной смертности больных с онкопатологией в настоящее время является развитие рецидивов заболевания после удаления первичной опухоли, в том числе устойчивых к химио- и радиотерапии. В общем случае это связано с тем, что в организме пациента остается некоторое количество опухолевых клеток, способных к неограниченной пролиферации и формированию новой опухоли. А происходящая в ходе химио- и радиотерапии селекция способствует выживанию резистентных клеток. Долгое время считалось, что причиной возникновения злокачественных новообразований служит накопление генетических повреждений в клетках ткани того или иного органа, что при неблагоприятных обстоятельствах приводит к спонтанному выходу поврежденной клетки из-под контроля антипролиферативных стимулов и началу неконтролируемого деления. Достоверность такого сценария подтверждалась тем, что раковые клетки в рамках одной опухоли, не смотря на определенную гетерогенность, имеют явно выраженное клональное происхождение, т.е. происходят от общего предшественника. Не так давно в экспериментах с раковыми клетками, полученными от больных острым миелоидным лейкозом, было показано наличие обособленной группы раковых клеток, обладающих способностью вызывать развитие болезни при трансплантации иммунодефицитным мышам. Анализ опухолей различных этиологий подтвердил, что практически в каждом случае в опухоли присутствует клеточная популяция, для которой характерна туморогенность, в то время как большая часть опухолевых клеток не способна давать начало развитию новой опухоли. Такая находка привела к возникновению новой теории опухолеобразования. Согласно ей, большинство опухолей возникает не вследствие накопления мутаций в соматических клетках органа, а в результате «поломки» систем регуляции в клетках-предшествениках, т.е. стволовых клетках. Таким образом, развитие опухоли частично копирует развитие органа, в той части, что в составе опухоли также есть четкая иерархическая организация клеток, на вершине которой находятся раковые стволовые клетки (РСК) - относительно малочисленная популяция, способная к неограниченной пролиферации, симметричным и асимметричным делениям и обладающая туморогенностью. Важным следствием такой теории является объяснение частоты возникновения рецидивов опухолей за счет неодинаковой чувствительности простых и стволовых опухолевых клеток к противораковой терапии. Была показана резистентность раковых стволовых клеток к многим распространенным химиотерапевтическим препаратам, радиотерапии, а особенности антигенного состава поверхности таких клеток позволяют им избегать воздействия иммунотерапевтических агентов. В ходе проведения комплексной терапии онкопатологии, в результате которой оказывается удалена или погибает основная масса опухолевых клеток, раковые стволовые клетки претерпевают селекцию и дают начало новой опухоли, обладающей повышенной устойчивостью к терапии. Более того, для раковых стволовых клеток характерна способность к неприкрепленному росту, что указывает на них как на основную причину образования вторичных опухолевых очагов (метастазов). Все вышеперечисленное указывает на то, что раковые стволовые клетки должны служить приоритетной мишенью для разработки терапевтических средств, направленных на предотвращение развития рецидивов злокачественных новообразований.

Для раковых стволовых клеток различной этиологии характерен различный фенотип, при этом существуют поверхностные маркеры, свойственные раковым стволовым клеткам, происходящим из определенного органа. В качестве маркеров, характерных для РСК были определены CD44, CD47, CD123, CD133, CD326, IGFR1, а также некоторые белки сигнального пути Notch/Wnt (С.Naujokat, Targeting Human Cancer Stem Cells with Monoclonal Antibodies Clinical & Cellular Immunology, 2012, S5-007). Многие из этих молекул также экспрессируются и на поверхности обычных раковых клеток и уже становились мишенями для поиска новых противораковых терапевтических средств. За счет представленности на всех раковых клетках, а также на некоторых нормальных клектах организма, введенное пациенту терапевтическое моноклональное антитело против ракового рецептора оказывается в значительной степени «оттитровано» на простые раковые клетки, что снижает его терапевтический потенциал в отношении РСК. Вместе с тем, в опытах на клеточных культурах была показана эффективность действия таких антител (анти-CD133, анти-CD44) также и в отношении раковых стволовых клеток.

Например, известен способ приготовления лекарственного средства для уничтожения раковых стволовых клеток, основанный на использовании анти-CD44 антитела, (Fab')2, Fab, Fab' фрагментов, IgG или его изотипа IgM (патент ЕР 1692183 (В1), опубл. 2010-09-08).

Описан подход к лечению рака груди, основанный на использовании моноклонального антитела к CD47, известного маркера стволовых клеток лейкозов и солидных опухолей (международная заявка на изобретение WO 2013119714 A1, опубл. 15.08.2013).

Существующие подходы к противораковой терапии с использованием моноклональных антител обладают рядом недостатков. К ним можно отнести высокую стоимость производства рекомбинантных антител, которое осуществляется с использованием эукариотических линий-продуцентов, низкую эффективность получения работающих клонов антител, связанную с необходимостью скринирования сотен и тысяч клонов гибридом или, в случае использования механизмов отбора, например, фагового дисплея, необходимости получения обширных библиотек scFv-фрагментов слитых вариабельных участков легкой (VI) и тяжелой (Vh) цепей иммуноглобулинов, с последующей селекцией вариантов, обладающих необходимой аффинностью и специфичностью. Помимо перечисленных недостатков, рекомбинантные антитела обладают большим размером, ограничивающим их способность проникать в различные ткани, что понижает эффективность их действия в отношении РСК.

Для повышения специфичности действия терапевтического агента на основе моноклональных антител именно в отношении РСК исследователями предпринимались попытки создания комбинированного препарата - бифункционального антитела, эффективно связывающегося с двумя рецепторами, характерными для РСК. За счет такой двойной специфичности, терапевтический агент адресно связывается с РСК, при этом минимально воздействуя на клеточные популяции, экспрессирующие только один из рецепторов, что приведет к отсутствию эффекта «оттитровывания» и, в результате, к элиминации малочисленной популяции РСК. Ключевыми требованими к такому биспецифичному агенту является редкость сочетания РСК-ассоциированных рецепторов на нормальных клетках и не-РСК клетках опухоли, прямое ингибирующее действие терапевтических антител на пролиферацию РСК, связанное с активацией или ингибированием прохождения сигналов через связываемые поверхностные рецепторы, и высокая биодоступность препарата в различных тканях. Последнее требование обусловлено наличием «нишевого» окружения РСК, которое формируется из более дифференцированных раковых клеток или клеток иммунной системы организма. Находясь в сформированном окружении, в ряде случаев вдали от первичного опухолевого очага, РСК могут оказаться защищены от терапевтических агентов - крупных макромолекул, таких как полноразмерные рекомбинантные антитела.

Чтобы удовлетворить первое требование к РСК-направленным биспецифичным терапевтическим агентам, необходимо произвести выбор оптимального сочетания маркеров-мишеней. Из уровня техники известны попытки такого рода.

Известен агент, способный связываться с опухолевой клеткой, убивать ее или ингибировать ее пролиферацию, содержащий два функциональных элемента, связанных линкером на основе человеческого сывороточного альбумина (HSA), где первый функциональный элемент специфически связывает ERBB3, а второй функциональный элемент специфически связывает ERBB2 (патент EA 22201 В1).

В качестве ближайшего аналога может быть указаны двухвалентные биспецифические антитела, содержащие первый полипептид, содержащий первый фрагмент Fc и первый однодоменный антиген-связывающий (VHH) фрагмент, и второй полипептид, содержащий второй Fc-фрагмент, и второй однодоменный антиген-связывающий (VFIH) фрагмент, в котором первый фрагмент VHH имеет специфичность по отношению к опухолевой клетке или микроорганизму, а второй VHH фрагмент имеет специфичность по отношению к иммунной клетке и в котором первый фрагмент является N-концевым ко второму фрагменту. Первый фрагмент VHH имеет специфичность по отношению к опухолевым антигенам, выбранным из группы: CD20, CD30, CD33, CD47, CD52, CD133, СЕА, ERBB2, ERBB3, MET, IGF1 R, ЕРНА3, TRAILR1, TRAILR2 и др., а второй VHH фрагмент имеет специфичность к антигену, выбранному из группы CD3, CD16, CD19, CD28 и CD64 (заявка на изобретение WO 2015095412 (А1)).

Описание изобретения

Настоящее изобретение представляет собой бифункциональный агент, состоящий из двух фрагментов вариабельных частей VHH-антител верблюжьих, которые способны распознавать и избирательно связываться с клеточными рецепторами CD47 и ERBB2. VHH-фрагменты соединяются в единую полипептидную цепь при помощи полипептидного линкера, вида (Gly4Ser)4 либо иного линкера позволяющего разнести в пространстве VHH-фрагменты таким образом, чтобы обеспечить беспрепятственное связывание каждого из них со своим белком-мишенью. Бифункциональный агент может иметь вид VHHCD47-linker-VHHERBB2 либо VHHERBB2-linker-VHHCD47.

Техническим результатом изобретения является терапевтический агент на основе нового перспективного класса одноцепочечных миниантител, обладающий повышенной специфичностью, биодоступностью, высокоэффективно и избирательно поражающий раковые стволовые клетки, оказывая при этом минимальное воздействие на нормальные клетки организма пациента, а также более дешевый в производстве, по сравнению с традиционными моноклональными антителами.

В качестве первой мишени используют поверхностный рецептор CD47. CD47, он же IAP (integrin-associated protein, интегрин-ассоциированный белок) - поверхностный белок, представленный на нормальных клетках организма, однако гораздо в большей степени распространенный на различных опухолевых клетках, что делает его выгодной противораковой мишенью. Этот рецептор способен связываться с несколькими лигандами, в частности, тромбоспондином и рецепторами семейства SIRP. Взаимодействуя с тромбоспондином-1 (TSP-1) и интегринами, CD47 участвует в регуляции клеточной адгезии и транс-эпителиальной миграции нейтрофилов. Связывание же с рецепторами семейства SIRP обуславливает влияние CD47 на компоненты иммунной системы. Один из представителей семейства SIRP, SIRPa, который обладает наибольшим сродством к CD47, экспрессирован на клетках иммунной системы, макрофагах и дендритных клетках (DC). Связывание SIRPa с CD47 приводит к негативной регуляции функций иммунной клетки, в частности, подавлению фагоцитоза. Считается, что CD47 выступает в роли своеобразного «пропуска», который сигнализирует макрофагам и дендритным клеткам о том, что несущая его клетка является «своей» и не должна быть атакована. В частности, такой механизм используется организмом для выведения из кровотока выработавших свой срок эритроцитов - по мере старения, на поверхности эритроцитов снижается количество CD47, а имеющиеся молекулы агрегируют и утрачивают способность связываться с SIRPa. В конечном счете постаревший эритроцит становится мишенью для макрофагов. Этот биологический механизм активно используется раковыми клетками для защиты от иммунной системы хозяина. У большого процента опухолевых клеток, особенно при развитии неоплазий кроветворной системы, опухолей яичников, толстой кишки или груди обнаруживаются чрезвычайно высокие (в 10-50 раз выше, чем у нормальной ткани) уровни экспрессии CD47. Данные исследований показывают, что для CD47, эксрпессированного на поверхности опухолевых клеток, в наименьшей мере характерно агрегирование в комплексы, т.е. он сохраняет функциональную активность в отношении SIRPa и приводит к подавлению способности иммунной системы атаковать опухолевые клетки как за счет фагоцитоза, так и за счет сниженной представленности опухолевых антигенов на комплексах МНСII дендритных клеток. В свою очередь это приводит к подавлению образования противоопухолевых CD4+ хелперных лимфоцитов, необходимых для формирования комплексного иммунного ответа. Такие свойства CD47 используют при разработке новых экспериментальных подходов к противоопухолевой терапии - моноклональные антитела, блокирующие взаимодействие CD47 и SIRPa, показали высокую эффективность в качестве компонента адьювантной терапии опухолей в опытах на животной модели с ксенотрансплантированными опухолями. Отдельно стоит отметить, что взаимодействие с разными лигандами - TSP1 и SIRPa - происходит за счет связывания с разными участками внеклеточного домена CD47. Испытание различных вариантов антител на внеклеточный домен CD47, в частности, блокирующих и активирующих TSP-1-зависимую передачу сигнала показали, что в некоторых линиях опухолевых клеток, в частности, слабодифференцированных клетках неоплазий кроветворной системы, TSP-1-активирующие антитела приводили к подавлению клеточной пролиферации и апоптозу. Такой эффект был специфичен для опухолевых клеток и не затрагивал нормальные.

Имеющиеся данные свидетельствуют в пользу того, что CD47 наиболее часто бывает гиперэкспрессирован на поверхности раковых стволовых клеток, участвуя в формировании клеточного окружения, необходимого для существования РСК, и защищая ее от атак иммунной системы.

ERBB2 относится к семейству рецепторов эпидермального ростового фактора, в опухолях молочной железы, относящихся к ERBB2-положительному субтипу, этот рецептор используется для проведения полиферативных сигналов, поддерживающих рост опухоли.

В качестве приоритетной мишени для тестирования настоящего изобретения используют опухоли молочной железы. Среди всех онкопатологий рак молочной железы является одним из самых распространенных - он составляет более 11% от всех злокачественных новообразований и является ведущей (более 20%) онкологической патологией у женщин. Для рака молочной железы характерна достаточно высокая частота рецидивов - в среднем, без учета стадии, на которой он был обнаружен, частота рецидивов составляет 11% в течение 5 лет после прохождения лечения и 20% в течение 10 лет.

В настоящем изобретении используют альтернативный подход, основанный на применении особого класса антител - мини-антител, лишенных легкой цепи, т.н. VHH (variable heavy-heavy) - антител, встречающихся у млекопитающих семейства верблюжьих. За счет наличия единственного вариабельного домена, в составе тяжелой цепи иммуноглобулина, обладающего большей протяженностью, чем у обычных антител, VHH-антитела отличаются высокой аффинностью к своим лигандам, а также весьма просты в плане создания иммунных библиотек вариабельных фрагментов, для последующего отбора высокоспецифичных вариантов антител при помощи фагового или рибосомального дисплея. Вариабельные домены (VI) VHH-антител достаточно миниатюрны для того, чтобы проникать в большинство тканей, и настолько стабильны, что в некоторых случаях могут даже эффективно усваиваться из кишечника. При этом, scFv-фрагменты VHH-антител могут быть эффективно экспрессированы в бактериальных клетках-продуцентах, что позволяет существенно снизить стоимость производства терапевтического препарата на их основе. Благодаря миниатюрным размерам каждого фрагмента бифункциональный агент к CD47/ERBB2 обладает меньшим размером, а значит большей биодоступностью, чем моноклональное антитело против одной мишени, большей специфичностью действия при меньшей стоимости производства.

VHH-CD47 представляет собой VHH-фрагмент, способный избирательно и с высокой аффинностью связываться с поверхностным клеточным рецептором CD47 и блокировать его взаимодействие с естественным лигандом SIRPa - рецептором фагоцитов. Такая блокада позволяет предотвратить передачу фагоцитам сигнала, супрессирующего процесс фагоцитоза опухолевой клетки.

VHH-ERBB2 представляет собой VHH-фрагмент, способный избирательно и с высокой аффинностью связываться с поверхностным клеточным рецептором ERBB2 и блокировать его гомо- и гетеродимеризацию с EGFR.

Бифункциональный агент, содержит VHH-фрагменты, подавляющие CD47 и ERBB2, способен предпочтительно связываться с клетками, экспрессирующими оба рецептора одновременно. В ERBB2-положительных опухолях молочной железы, избирательное подавление субпопуляции, экспрессирующей высокие уровни CD47 приводит к преимущественному подавлению раковых стволовых клеток, для которых характерна гиперэкспрессия CD47. Присутствующий в составе бифункционального агента VHH-ERBB2 позволяет обеспечить минимальное воздействие агента на не-опухолевые клетки, а также усилить терапевтический эффект за счет снижения пролиферативной активности опухолевых клеток.

SEQIDNO: 1 VHHCD47:

MQVQLVESGGGLVQAGGSLRLSCKVSGNNFRRVNMGWYRQAPGKQRDLVAWISND GGTYYDRSLKGRFTISRDNTKNTMFLQMDSLKPEDTAVYYCNSRPSSIFGSWGQGTQVTV SSEPKTPKPQPDPHHHHHHHHHH

SEQ ID NO: 2-VHHERBB2:

MQVQLVESGGGLVQAGGSLRLSCKVSGNNFRRVNMGWYRQAPGKQRDLVAWISND GGTYYDRSLKGRFTISRDNTKNTMFLQMDSLKPEDTAVYYCNSRPSSIFGSWGQGTQVTV SSEPKTPKPQP

Для получения бифункционального агента была проведена троекратная иммунизация альпак рекомбинантными антигенами CD47, ERBB2, проведен забор генетического материала иммунизированных животных, из которого затем получены библиотеки фрагментов вариабельных частей одноцепочечных антител. Из этих библиотек затем приготовлены фаговая и РНК-библиотеки для проведения селекции аффинных фрагментов антител. Оба метода были использованы для проведения раундов селекции, в ходе которых были отобраны фрагменты, проявляющие наибольшую аффинность в отношении целевых антигенов. Для отбора блокирующих антител против CD47 был применен метод конкурентной элюции, позволивший отобрать варианты антител, сочетающие высокую аффинность и блокирующее действие в отношении лиганда рецептора. Для каждого целевого антигена в ходе селекции было отобрано по 5 вариантов антител, характеризующихся наибольшей аффинностью и специфичностью, которые были затем экспрессированы в виде растворимых форм, подвергнуты очистке и протестированы на способность связываться с мишенью in vitro и in vivo - на панели клеточных линий рака молочной железы.

Пример 1

Для проверки эффективности онкосупрессорного действия полученных фрагментов антител в отношении субпопуляции РСК опухолей молочной железы из клеточной линии MDA-MB-231 были выделены фракции клеток, которые были протестированы на уровень туморогенности на бестимусных мышах (образовывали опухоли при инъекции от 1×104 клеток). Полученные фрагменты вариабельных частей антител были протестированы на способность подавлять рост РСК in vitro, и показано их супрессирующие действие в отношении НЕR2-положительных РСК (полученных из линии SKBR-3).

Пример 2

Тестирование активности биспецифического агента также было проведено in vivo на бестимусных мышах, в результате которого он показал высокую степень опухолевой специфичности и способность значительно снижать рост опухоли молочной железы.

Настоящий бифункциональный агент может стать основой нового класса противораковых терапевтических средств, нацеленных на избирательное уничтожение раковых стволовых клеток - популяции опухолевых клеток, отвечающих за возникновение рецидивов, отдаленных метастазов и развитие химио- и радиорезистентности опухоли после проведения традиционной терапии. Медицинское применение его в сочетании с традиционными терапевтическими подходами позволит существенно улучшить средний прогноз пяти- и дестятилетней выживаемости пациентов, перенесших рак молочной железы, и, в конечном счете, снизить уровни смертности населения от одного из самых распространенных видов рака. За счет использования одновременного нацеливания на два поверхностных рецептора, чья экспрессия в сочетании характерна исключительно для РСК, будет достигнута высокая специфичность действия препарата, что приведет к возрастанию избирательности действия на РСК даже в условиях наличия в организме пациента большой массы опухолевых клеток, экспрессирующих один из опухолевых маркеров. Использование поверхностных рецепторов CD47 и ERBB2, чье блокирование или активация само по себе приводит к подавлению пролиферативной активности РСК, ее терминальной дифференцировке, апоптозу, а в случае CD47 активному уничтожению РСК средствами иммунной системы пациента, обеспечивает высокое прямое противоопухолевое действие полученных препаратов. Созданный биспецифичный противоопухолевый агент предназначен для проведения адъювантной терапии после проведения резекции опухоли молочной железы или для проведения конкурентной терапии вместе с химио- или радиотерапевтическим лечением таких опухолей.

1. Селективный бифункциональный агент, подавляющий рост раковых стволовых клеток за счет блокады опухолевых рецепторов CD47 и ERBB2, состоящий из двух фрагментов вариабельных частей VHH-антител верблюжьих, один из которых способен распознавать и избирательно связываться с клеточным рецептором CD47 и имеет аминокислотную последовательность SEQ ID №1, а другой - с ERBB2 и имеет аминокислотную последовательность SEQ ID №2, где фрагменты соединяются в единую полипептидную цепь при помощи полипептидного линкера вида (Gly4Ser)4 либо иного линкера, позволяющего разнести в пространстве VHH-фрагменты таким образом, чтобы обеспечить беспрепятственное связывание каждого из них со своим белком-мишенью.

2. Бифункциональный агент по п. 1, характеризующийся тем, что может вызывать апоптоз раковых стволовых клеток

3. Бифункциональный агент по п. 1, характеризующийся тем, что может иметь вид SEQ ID №1 - линкер - SEQ ID №2 либо SEQ ID №2 - линкер - SEQ ID №1.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к антителу или его связывающему фрагменту, которые специфически связываются с белком CAPRIN-1 и обладают иммунологической реактивностью в отношении частичного полипептида CAPRIN-1.

Группа изобретений относится к области биотехнологии. Предложен полипептид, обладающий цитотоксической активностью, содержащий Fc-область IgG, которая состоит из гетеродимера, содержащего первый полипептид и второй полипептид, в аминокислотных последовательностях которых произведены серии мутаций.

Изобретение относится к области иммунологии. Предложено антитело, которое связывается с рецептором эпидермального фактора роста HER2/CD340.

Изобретение относится к биохимии и медицине. Предложена фармацевтическая композиция для лечения и/или предотвращения рака печени, экспрессирующего на поверхности белок CAPRIN-1, которая содержит антитело против белка CAPRIN-1.

Изобретение относится к области иммунологии. Предложено гуманизированное антитело, специфичное к STEAP-1, и его антигенсвязывающий фрагмент.

Изобретение относится к биохимии. Описано мутантное полностью человеческое антитело против HER2, при этом аминокислотная последовательность вариабельной области тяжелой цепи и аминокислотная последовательность вариабельной области легкой цепи антитела представляют собой SEQ ID NO: 10 и SEQ ID NO: 2; SEQ ID NO: 11 и SEQ ID NO: 2; или SEQ ID NO: 12 и SEQ ID NO: 2, соответственно.

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с белком CAPRIN-1, а также к конъюгату для лечения или профилактики CAPRIN-1 экспрессирующего рака, его содержащему.

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с белком CAPRIN-1, а также к конъюгату для лечения или профилактики CAPRIN-1 экспрессирующего рака, его содержащему.

Изобретение относится к области биотехнологии, конкретно к применению выделенного антитела к CXCR4 в диагностике рака, что может быть использовано в медицине. В частности, раскрыты способы диагностики и/или прогнозирования онкогенного расстройства, связанного с экспрессией CXCR4, определения, является ли указанное расстройство или пациент, страдающий им восприимчивым к лечению анти-CXCR4 антителом, способы определения эффективной схемы лечения и наборы для лечения указанных заболеваний.

Изобретение относится к области биохимии, в частности к антителу для специфического связывания с белком CAPRIN-1, а также к конъюгату, фармацевтической композиции и комбинированному лекарственному средству, его содержащим.

Изобретение относится к области биохимии. Описана группа изобретений, включающая антитело, направленное на две мишени, которое специфически связывается с VEGF и DLL4, полинуклеотид, кодирующий вышеуказанное антитело, экспрессионный вектор, включающий полинуклеотид, трансформированную клетку СНО для экспрессии вышеуказанного антитела, способ получения вышеуказанного антитела, фармацевтическую композицию для лечения рака, содержащую терапевтическое эффективное количество антитела, композицию для диагностики рака, способ диагностирования рака и способ лечения рака, включающий этап введения вышеуказанного антитела.

Настоящее изобретение относится к биотехнологии и фармацевтике, в частности к фармацевтической композиции для применения в ингибировании роста опухоли, резистентной к анти-VEGF-средствам.

Изобретение относится к области биотехнологии, конкретно к слитым белкам домена CD95, и может быть использовано для ингибирования сигнального пути CD95. Получен химерный белок, содержащий функциональный фрагмент укороченного по N-концу внеклеточного домена CD95, непосредственно сшитого с Fc-доменом, где функциональный фрагмент укороченного по N-концу внеклеточного домена CD95 расположен на N-конце Fc-домена или его функционального фрагмента, и где химерный белок лишен дополнительной N-концевой последовательности.

Представленные изобретения касаются варианта исходного антитела против TNF-α или исходного связывающего фрагмента антитела против TNF-α, молекулы нуклеиновой кислоты, клетки-хозяина, фармацевтической композиции и способа лечения.

Изобретение относится к биохимии. Предложен способ получения мультиспецифической связывающей молекулы, содержащей по меньшей мере две связывающих группировки, такой как антитело, где способ включает культивирование клетки, содержащей нуклеиновую кислоту, кодирующую растворимую сортазу А из S.

Изобретение относится к области биотехнологии, конкретно предложен высокостабильный Т-клеточный рецептор, что может быть использовано в медицине. Полученный Т-клеточный рецептор, имеющий мутации в своем гидрофобном коровом домене, используют в составе фармацевтической композиции для лечения опухоли.

Представлены полинуклеотидная библиотека для получения спаренных последовательностей антител, способ получения представляющего интерес полинуклеотида и способ анализа и использования данных секвенирования.

Настоящее изобретение относится к хроматографическим матрицам, включающим лиганды на основе одного или нескольких доменов связывающихся с иммуноглобулином белков, таких как белок A (SpA) Staphylococcus aureus, а также способам их применения.

Изобретение относится к области биотехнологии, конкретно к иммуноцитокинам, и может быть использовано в медицине для лечения рака. Получают иммуноцитокин, содержащий: конъюгат интерлейкина 15 и домена sushi IL-15Rα, ковалентно связанный с антителом или его фрагмент, направленным против антигена, имеющего отношение к неоваскуляризации опухоли или к внеклеточному матриксу опухоли, или опухолевого антигена.

Изобретение относится к биотехнологии. Представлено одноцепочечное антитело для лечения или диагностики, содержащее один полипептид, содержащий следующие домены, расположенные относительно друг друга в направлении от N-конца к С-концу следующим образом: VL1-CL1-CLH линкер1-VH1-CH11-шарнир1-CH21-CH31-HD линкер-VL2-CL2-CLH линкер2-VH2-CH12-шарнир2-CH22-CH32, где каждый из CLH линкера1, CLH линкера2 и HD линкера содержит аминокислотную последовательность, расщепляемую эндопептидазой на N- и C-концах.

Настоящее изобретение относится к биотехнологии и фармацевтике, в частности к фармацевтической композиции для применения в ингибировании роста опухоли, резистентной к анти-VEGF-средствам.

Изобретение относится к области биотехнологии, в частности к терапевтическому бифункциональному агенту, подавляющему рост раковых стволовых клеток за счёт блокады опухолевых рецепторов CD47 и ERBB2. Указанный агент состоит из двух фрагментов VHH верблюжьих антител, первый из которых способен распознавать и избирательно связываться с CD47, а второй – с ERBB2. При этом фрагменты соединены между собой с помощью полипептидного линкера 4 или иного линкера, позволяющего разнести в пространстве VHH-фрагменты таким образом, чтобы обеспечить беспрепятственное связывание каждого из них со своим белком-мишенью. Настоящее изобретение позволяет повысить специфичность, биодоступность, эффективность и избирательность антител, подавляющих рост раковых стволовых клеток, снизив при этом воздействие на нормальные клетки организма пациента. 2 з.п. ф-лы, 2 пр.

Наверх