Композиции и способы применения для определения не4а

Изобретение относится к области биохимии, в частности к антителу, которое специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а, а также к набору, его содержащему. Также раскрыт способ скрининга наличия рака яичников у субъекта или диагностики у субъекта рака яичников с использованием антитела, которое специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а. Изобретение позволяет эффективно осуществлять диагностику рака яичников у субъекта. 3 н. и 7 з.п. ф-лы, 12 ил., 3 табл., 7 пр.

 

[0001] Изобретение включает композиции и способы для определения, диагностики, определения тяжести, определения стадии, получения прогноза и предсказания и мониторинга восприимчивости к лечению у субъектов, у которых подозревают наличие и/или которые имеют рак яичников. Также предложены варианты иммуноанализа, связывающие агенты, антитела и способы для определения рака яичников путем определения присутствия полноразмерного НЕ4а в образцах, полученных от пациентов.

УРОВЕНЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

[0002] Продукт гена WFDC2 (НЕ4/НЕ4а) является членом семейства стабильных белков, содержащих 4 дисульфидные связи в коровой части. НЕ4 представляет собой секретируемый гликозилированный белок, который впервые был обнаружен в ткани эпидидимиса человека (белок 4 эпидидимиса человека; НЕ4); его сверхэкспрессия наблюдается при некоторых видах рака, включая рак яичников. Характеристика белков и нуклеиновых кислот НЕ4/НЕ4а представлена, например, в работах Kirchhoff C, Habben I, Ivell R, Krull N (Mar 1992). "A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors". Biol Reprod 45 (2): 350-7 Schummer M, Ng WV, Bumgamer RE, Nelson PS, Schummer B, Bednarski DW, Hassell L, Baldwin RL, Karlan BY, Hood L (Dec 1999). "Comparative hybridization of an array of 21,500 ovarian cDNAs for the discovery of genes overexpressed in ovarian carcinomas". Gene 238 (2): 375-85; Kirchhoff С (1998). "Molecular characterization ofepididymal proteins." Rev. Reprod. 3 (2): 86-95.; Kirchhoff С, OsterhoffC, Habben I, et al. (1990). "Cloning and analysis ofmRNAs expressed specifically in the human epididymis." Int. J. Androl. 13 (2): 155-67; Hellstrom I, et al; Cancer Res. 2003 Jul 1:63(13):3695-700. Сверхэкспрессия НЕ4/НЕ4а в раковых клетках указывает на то, что этот белок и его различные изоформы могут использоваться в качестве биомаркера для определения рака и для идентификации пациентов с повышенной вероятностью рака. О способах и композициях, относящихся к применению молекулярных маркеров, таких как НЕ4/НЕ4а, сообщалось ранее, включая заявки US 7270960; US 20100311099; US 20080020473; US 20070286865; US 20100047818; US 20090104684 и US 20030108965, содержание которых полностью включено в настоящую заявку.

[0003] Ссообщалось, что белки НЕ4/НЕ4а имеют различные изоформы в результате альтернативного сплайсинга, а также различные гликоформы как результат различных паттернов гликозилирования. В свете вышеизложенного, в данной области техники существует потребность в композициях и связывающих агентах (например, антителах), способных к определению сверхэкспрессии биомаркеров, таких как НЕ4а, и их вариантов, сплайс-изоформ и гликоформ, для диагностики рака.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

[0004] Настоящее изобретение включает композиции и способы диагностики рака яичников у субъекта и определения субъектов с повышенной вероятностью рака яичников. Композиции включают моноклональные антитела, их варианты и фрагменты, специфично связывающиеся с растворимыми и находящимися на клеточной поверхности формами НЕ4/НЕ4а, которые сверхэкспрессируются при карциноме яичников. Также предложены моноклональные антитела, имеющие связывающие характеристики раскрытого антитела против НЕ4а. Также предложены клеточные линии гибридомы, продуцирующие моноклональное антитело к НЕ4/НЕ4а. Композиции согласно настоящему изобретению имеют применение в способах диагностики, а также в способах скрининга для определения субъектов с повышенной вероятностью рака яичников. В частности, способы диагностики могут включать иммуногистохимический (ИГХ) анализ или анализ методом двойного непрямого («сэндвич») твердофазного иммуноферментного анализа (ELISA). Также предложены наборы, включающие одно или более из раскрытых моноклональных антител к НЕ4а для практической реализации способов согласно настоящему изобретению. Также раскрыты полипептиды, содержащие аминокислотную последовательность эпитопа НЕ4а, и способы применения этих полипептидов в получении антител.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

[0005] На Фигуре 1 показан пример реализации слитого белка НЕ4а, содержащего домен НЕ4а и IgG человека/мыши.

[0006] На Фигуре 2 показаны некоторые особенности связывания вариантов моноклональных антител (антитела 12А2 и 14Е2) с полноразмерным НЕ4а, доменами НЕ4а-V4 и HE4a-V2 в НЕ4а. В данном примере MAT 12A2 и 14Е2 связываются с вариантом НЕ4а-V4 и полноразмерным НЕ4а, но не связываются с доменом HE4a-V2. Это указывает на то, что MAT 12A2 и 14Е2 связываются с доменом N-WFDC в НЕ4а.

[0007] На Фигуре 3 показаны особенности связывания моноклональных антител сравнения (антител 2Н5 и 3D8) со слитыми белками. В данном примере MAT сравнения связываются с доменом HE4a-V2 и полноразмерным НЕ4а, но не связываются с доменом HE4a-V4, что указывает на то, что они распознают эпитопы в домене C-WFDC в НЕ4а.

[0008] На Фигуре 4 показана нуклеотидная (SEQ ID NO:6) и пептидная (SEQ ID NO:1) последовательности НЕ4а, включая домены N-WFDC и C-WFDC в НЕ4а.

[0009] На Фигуре 5 показано связывающее взаимодействие типичных моноклональных антител (12A2) с N-WFDC и C-WFDC. В данном примере специфичность связывания 12A2 демонстрируют, используя формат фагового анализа ELISA, где MAT реагирует только со слитым белком N-WFDC НЕ4а и фагового белка pVIII.

[0010] На Фигуре 6 показана способность MAT 14E2 реагировать с денатурированным и восстановленным слитым белком HE4a-hIg. Связывание с денатурированным и восстановленным слитым белком HE4a-hIg указывает на то, что MAT 14E2 распознает линейный эпитоп белка НЕ4а.

[ООН] На Фигуре 7 показана кривая доза-эффект иммуноанализа «сэндвич» с использованием 14E2 в качестве иммобилизованного MAT и MAT 3D8 или 12A2 в качестве детектирующего МАТ. Результат для комбинации MAT 14E2 и 12A2 указывает на то, что они способны связываться одновременно и, таким образом, детектировать независимые эпитопы домена N-WFDC в НЕ4а.

[0012] На Фигуре 8 показан пример иммуноанализа в модификации «сэндвич» и связывание MAT 12A2 и 14E2 в комбинации с MAT 2H5. В данном примере MAT 12A2 и 14E2 реагируют только с полноразмерным НЕ4а, тогда как комбинация MAT 3D8 и 2H5 реагирует как с полноразмерным НЕ4а (FL НЕ4а), так и с вариантом HE4a-V2. Этот результат дополнительно указывает на то, что MAT 12A2 и 14E2 распознают эпитоп, экспонированный на домене N-WFDC в НЕ4а.

[0013] На Фигуре 9 показана кривая доза-эффект ферментативного иммуноанализа (EIA) полноразмерного НЕ4а. В основе данного анализа лежало использование MAT 2H5 в качестве иммобилизованного антитела и MAT 12A2, конъюгированного с пероксидазой хрена, в качестве детектирующего МАТ. Процедуру проводили, как описано в Примере 3.

[0014] На Фигуре 10 показаны уровни НЕ4а у здоровых объектов, пациентов с доброкачественными гинекологическими заболеваниями и с раком яичников, определенные методом EIA на FL НЕ4а, как описано в Примере 3.

[0015] На Фигуре 11 показан пример иммуноанализа полноразмерного НЕ4а для мониторинга клинического течения болезни рака яичников. (СЗ = Стабильное заболевание; ПЛ = поддается лечению; ПЗ = прогрессирующее заболевание). В данном примере полноразмерный НЕ4а демонстрировал, что полноразмерный НЕ4а можно применять для отслеживания клинического течения болезни у пациентов с диагнозом рак яичников.

[0016] На Фигуре 12 показана ИГХ доброкачественных и злокачественных тканей яичников, с использованием примера MAT, специфичного к домену N-WFDC в НЕ4а. В данном примере типичное MAT 12A2 связывается строго с раковыми клетками при раке яичников, но не связывается с клетками доброкачественных опухолей. А: Серозная аденокарцинома; В: Серозная адено карцинома; С: Эндометроидная карцинома яичников; D: Серозная аденокарцинома; Е: Фиброма; F: Фибротекома.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[0017] Предложены различные композиции и способы диагностики рака яичников у субъекта и определения субъектов с повышенной вероятностью рака яичников. Композиции включают моноклональные антитела, способные связываться с НЕ4/НЕ4а - белком, который, как было показано, сверхэкспрессируется в клетках рака яичников. Композиции включают моноклональные антитела и их варианты и фрагменты, специфично связывающиеся с растворимыми и находящимися на клеточной поверхности формами НЕ4/НЕ4а, которые сверхэкспрессируются при карциноме яичников. Также предложены моноклональные антитела, обладающие характеристиками связывания антитела против НЕ4а согласно настоящему изобретению. Также предложены клеточные линии гибридомы, продуцирующие моноклональные антитела согласно настоящему изобретению. В частности, предложены клеточные линии гибридомы, продуцирующие моноклональные антитела, связывающиеся с доменом N-WFDC в НЕ4а. Также предложены наборы, включающие описанные моноклональные антитела. Изобретение также включает полипептиды, содержащие аминокислотную последовательность эпитопа НЕ4а, и способы применения этих полипептидов в продукции антител. Композиции находят практическое применение в «сэндвич» вариантах ELISA или ИГХ для диагностики рака яичников у субъекта и в методах скрининга для определения объектов с повышенной вероятностью наличия рака яичников.

[0018] В одном аспекте настоящего изобретения предложено моноклональное антитело, способное специфично связываться с НЕ4а. В одном варианте реализации моноклональное антитело продуцируется линией клеток гибридомы 12А2, депонированной в ЕСАСС, депозитарный №10091401. В другом варианте реализации моноклональное антитело продуцируется линией клеток гибридомы 14Е2, депонированной в ЕСАСС, депозитарный №11022202. В другом варианте реализации моноклональное антитело связывается с аминокислотной последовательностью SEQ ID NO:17 НЕ4а N-WFDC (EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPND).

[0019] В другом аспекте настоящее изобретение обеспепечивает набор для диагностики рака яичников, включающий моноклональное антитело, связывающееся с аминокислотной последовательностью SEQ ID NO:17 НЕ4а N-WFDC, и дополнительное моноклональное антитело, связывающееся с аминокислотной последовательностью SEQ ID NO:19 НЕ4а C-WFDC. (KEGSCPQVNINFPQLGLCRDQCQVDS QCPGQMKCCRNGCGKVSCVTPNF). Также предложен набор для диагностики рака яичников у пациента, включающий: захватывающее антитело, иммобилизованное на твердой подложке, причем захватывающее антитело представляет собой первое антитело к НЕ4а, и меченое антитело, причем меченое антитело представляет собой второе антитело к НЕ4а, меченое детектируемым веществом; где указанное первое или указанное второе антитело к НЕ4а представляет собой моноклональное антитело, при этом моноклональное антитело продуцируется линией клеток гибридомы 14Е2, депонированной в ЕСАСС под депозитарным №11022202, и/или связывается с аминокислотной последовательностью SEQ ID NO:17 НЕ4а N-WFDC (EKTGVCPELQADQN CTQECVSDSECADNLKCCSAGCATFCSLPND).

[0020] Согласно настоящему изобретению также предложен способ получения моноклональных антител к НЕ4а, включающий: иммунизацию животного полипептидом в условиях, в которых возникает иммунный ответ, причем полипептид содержит аминокислотную последовательность, представленную как SEQ ID NO:1, 3 и 5 (НЕ4а; НЕ4а V2; HE4a-V4), и ее варианты; выделение продуцирующих антитело клеток из животного, гибридизацию продуцирующих антитело клеток с иммортализованными клетками в культуре с образованием продуцирующих антитело клеток гибридомы; культивирование клеток гибридомы; и выделение моноклональных антител из культуры.

[0021] Согласно настоящему изобретению также предложен агент, связывающийся с НЕ4а, который связывает: (а) домен N-WFDC в НЕ4а; (b) аминокислотную последовательность, кодируемую SEQ ID NO:1 НЕ4а. В одном варианте реализации связывающий агент представляет собой анти-НЕ4а антитело или антиген НЕ4а-связывающий фрагмент. В другом варианте реализации связывающий агент селективно связывается с N-WFDC в НЕ4а (SEQ ID NO:17). В еще одном варианте реализации связывающий агент представляет собой поликлональное, моноклональное, биспецифичное, химерное или гуманизированное антитело или их антиген-связывающий фрагмент. В другом варианте реализации связывающий агент представляет собой агент, меченный с помощью детектируемого маркера.

[0022] Настоящее изобретение также включает очищенную аминокислотную последовательность по меньшей мере на 90% идентичную аминокислотной последовательности моноклонального антитела, продуцируемого линией клеток гибридомы 12А2, депонированной в ЕСАСС под депозитарным номером 10091401.

[0023] В другом аспекте предложена очищенная аминокислотная последовательность, причем последовательность имеет по меньшей мере 90% идентичность с аминокислотной последовательностью моноклонального антитела, продуцируемого линией клеток гибридомы 14Е2, депонированной в ЕСАСС, депозитарный №11022202.

[0024] Настоящее изобретение также включает способ получения последовательности нуклеиновой кислоты, кодирующей полипептид НЕ4а, включающий: а) амплификацию нуклеиновой кислоты из образца с набором праймеров, включающим прямой и обратный праймеры, причем набор праймеров выбирают из группы, состоящей из SEQ ID NO:21 V4 F и SEQ ID NO:23_V4 R, SEQ ID NO:25 V2F и SEQ ID NO:27 V2R; b) выделение амплифицированной нуклеиновой кислоты.

[0025] Настоящее изобретение также включает изолированную молекулу нуклеиновой кислоты, кодирующую связывающий белок, который связывается с последовательностью SEQ ID NO 17 НЕ4а N-WFDC, причем аминокислотная последовательность связывающего белка имеет по меньшей мере 90% идентичность с аминокислотной последовательностью моноклонального антитела, продуцируемого гибридомой 12А2, депонированной в ЕСАСС, депозитарный №10091401, или клеточной линией 14Е2, депонированной в ЕСАСС, депозитарный №11022202, и/или связывается с аминокислотной последовательностью, изложенной в SEQ ID NO:17 НЕ4а N-WFDC (EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPND).

[0026] В другом аспекте предложены векторы и клетки-хозяева, содержащие изолированную молекулу нуклеиновой кислоты, кодирующую связывающий белок, который связывается с последовательностью SEQ ID NO:17 НЕ4а N-WFDC.

[0027] Согласно настоящему изобретению также предложен изолированный слитый белок, включающий гетерологичный полипептид НЕ4а, соединенный с полипептидом Fc-рецептора, включающий аминокислотную последовательность SEQ ID NO:17 НЕ4а N-WFDC. В одном варианте реализации изолированный слитый белок получают путем амплификации нуклеиновой кислоты с использованием праймеров, кодируемых последовательностями SEQ ID NO:29 W1F; SEQ ID NO:31 W1R; SEQ ID NO:33 W2F, SEQ ID NO:35 W2R. В другом варианте реализации слитый белок включает гетерологичный антигенный полипептид НЕ4а, который представляет собой сплайс-вариант.

[0028] Изобретение также включает способ скрининга наличия рака яичников у субъекта, включающий: контактирование биологического образца от субъекта с по меньшей мере одним антителом, специфичным к антигенному полипептиду НЕ4а, с определением присутствия в биологическом образце молекулы, в норме присутствующей в образце в растворимой форме и содержащей антигенную детерминанту, взаимодействующую с по меньшей мере одним антителом, в условиях и в течение времени, достаточных для определения связывания антитела с антигенной детерминантой, с последующим определением наличия рака яичников. В одном варианте реализации биологический образец выбирают из группы, состоящей из крови, сыворотки, серозной жидкости, плазмы, лимфы, мочи, спинномозговой жидкости, слюны, секрета слизистых, вагинального секрета, жидкости брюшной полости, плевральной жидкости, перикардиальной жидкости, перитонеальной жидкости, абдоминальной жидкости, культуральной среды, кондиционированной культуральной среды и лаважной жидкости.

[0029] Согласно настоящему изобретению также предложен способ скрининга наличия рака яичников у субъекта, включающий: контактирование биологического образца, содержащего клетку от субъекта, с по меньшей мере одним антителом, специфичным к антигенному полипептиду НЕ4а, с определением присутствия в биологическом образце молекулы клеточной поверхности, содержащей антигенную детерминанту, взаимодействующую с по меньшей мере одним антителом, в условиях и в течение времени, достаточных для определения связывания антитела с антигенной детерминантой, и, соответственно, определения наличия рака яичников. В одном варианте реализации антитело снабжено детектируемой меткой. В другом варианте реализации антитело не снабжено детектируемой меткой, и определение связывания антитела с антигенной детерминантой является непрямым (опосредованным).

[0029а] Настоящее изобретение также включает моноклональные антитела, которые распознают эпитопы в домене C-WFDC НЕ4а, продуцируемые клеточной линией гибридомы 2Н5, депонированной в ЕСАСС, депозитарный №13070301, и клеточной линией гибридомы 3D8, депонированной в ЕСАСС, депозитарный №13070304.

[0030] Настоящее изобретение также включает способ скрининга наличия рака яичников у субъекта, включающий: контактирование биологического образца от субъекта с по меньшей мере одним иммобилизованным первым антителом, специфичным к антигенному полипептиду НЕ4а, с определением присутствия молекулы в образце, в условиях и в течение времени, достаточных для специфичного связывания первого антитела с антигенным полипептидом НЕ4а с образованием иммунного комплекса; удаление компонентов образца, которые не связались специфично с первым антителом; и контактирование иммунного комплекса с по меньшей мере одним вторым антителом, специфичным к антигенному полипептиду НЕ4а, где антигенсвязывающий сайт второго антитела не ингибирует конкурентно антигенсвязывающий сайт иммобилизованного первого антитела, в условиях и в течение времени, достаточных для определения специфичного связывания второго антитела с антигенным полипептидом НЕ4а, и, соответственно, определение наличия рака яичников. В одном варианте реализации первое иммобилизованное антитело выбирают из группы, состоящей из 12А2, 14Е2, 2Н5 и 3D8. В одном варианте реализации второе антитело выбирают из группы, состоящей из 12А2, 14Е2, 2Н5 и 3D8. В другом варианте реализации первое иммобилизованное антитело представляет собой 14Е2. В еще одном варианте реализации второе антитело представляет собой 12А2.

[0031] Также раскрыт способ диагностики у субъекта рака яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с антителом, имеющим антигенсвязывающий домен, который связывается с N-WFDC в НЕ4а, в течение времени и в условиях, достаточных для образования комплексов антитело/антиген; и определение присутствия комплексов на дисплее, причем присутствие комплексов, свидетельствующее о присутствии НЕ4а в исследуемом образце, коррелирует с наличием рака яичников. В одном варианте реализации антитело включает антигенсвязывающий домен, который связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, в ЕСАСС депозитарный №10091401.

[0032] Настоящее изобретение также включает способ диагностики у субъекта рака яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с первым антителом, содержащим антигенсвязывающий домен, связывающийся с аминокислотами N-WFDC в НЕ4а, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген; добавление конъюгата к комплексам первое антитело/антиген, где конъюгат включает второе антитело, связанное с генерирующим сигнал соединением, способным генерировать детектируемый сигнал, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген/второе антитело; и определение присутствия сигнала, образуемого генерирующим сигнал соединением, на дисплее, причем наличие сигнала, свидетельствующее о присутствии антигена НЕ4а в исследуемом образце, коррелирует с наличием рака яичников. В одном варианте реализации антитело содержит антигенсвязывающий домен, который связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, депонированной в ЕСАСС под депозитарным номером 10091401.

[0033] Настоящее изобретение также включает способ получения прогноза для субъекта с раком яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с антителом, содержащим антигенсвязывающий домен, связывающийся с аминокислотами N-WFDC в НЕ4а, в течение времени и в условиях, достаточных для образования комплексов антитело/антиген; и определение присутствия комплексов на дисплее, причем присутствие комплексов, свидетельствующее о присутствии антигена НЕ4а в исследуемом образце, коррелирует со стадиями рака яичников. В одном варианте реализации антитело включает антигенсвязывающий домен, который связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, депонированной в ЕСАСС под депозитарным номером 10091401.

[0034] Настоящее изобретение также включает способ получения прогноза для субъекта с раком яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с первым антителом, содержащим антигенсвязывающий домен, связывающийся с аминокислотами N-WFDC в НЕ4а, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген; добавление конъюгата к комплексам первое антитело/антиген, где конъюгат включает второе антитело, связанное с генерирующим сигнал соединением, способным генерировать детектируемый сигнал, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген/второе антитело; и определение наличия сигнала, образуемого генерирующим сигнал соединением, на дисплее, причем наличие сигнала, свидетельствующее о присутствии антигена НЕ4а в исследуемом образце, коррелирует со стадиями рака яичников. В одном варианте реализации антитело включает антигенсвязывающий домен, который связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, имеющей ЕСАСС депозитарный №10091401.

[0035] Также раскрывается способ мониторинга субъекта, проходящего лечение от рака яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с антителом, содержащим антигенсвязывающий домен, связывающийся с N-WFDC в НЕ4а в течение времени и в условиях, достаточных для образования комплексов антитело/антиген; и определение присутствия комплексов на дисплее, причем присутствие комплексов, свидетельствующее о присутствии антигена НЕ4а в исследуемом образце, коррелирует с восприимчивостью к лечению. В одном варианте реализации антитело включает антигенсвязывающий домен, который связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, имеющей ЕСАСС депозитарный №10091401.

[0036] Согласно настоящему изобретению также предложен способ мониторинга субъекта, проходящего лечение от рака яичников, включающий: определение антигена НЕ4а в исследуемом образце, полученном от субъекта; контактирование исследуемого образца с первым антителом, имеющим антигенсвязывающий домен, связывающийся с аминокислотами N-WFDC в НЕ4а, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген; добавление конъюгата к комплексам первое антитело/антиген, где конъюгат включает второе антитело, связанное с генерирующим сигнал соединением, способным генерировать детектируемый сигнал, в течение времени и в условиях, достаточных для образования комплексов первое антитело/антиген/второе антитело; и определение наличия сигнала, образуемого генерирующим сигнал соединением, на дисплее, причем наличие сигнала, свидетельствующее о присутствии антигена НЕ4а в исследуемом образце, коррелирует с восприимчивостью к лечению. В одном варианте реализации антитело включает антигенсвязывающий домен, которые связывается с аминокислотами N-WFDC в НЕ4а. В другом варианте реализации антитело представляет собой моноклональное антитело, продуцируемое линией клеток гибридомы, имеющей ЕСАСС депозитарный №10091401.

[0037] Настоящее изобретение также предлагает способ определения наличия или отсутствия рака яичников у пациента, включающий: контактирование исследуемого образца ткани яичников, полученной от субъекта, с антителом, специфично связывающимся с полипептидом, представленным в любой из SEQ ID NOs:1, 3, 5, 7, 9, 11, 13 или 15 (НЕ4); определение количества антител, которое связывается с полипептидом в исследуемом образце ткани яичников; и сравнение количества антител, которое связывается с полипептидом в исследуемом образце ткани яичников, с установленным ранее граничным значением, где исследуемый образец ткани яичников является положительным по раку яичников, если количество антител, которое связывается с полипептидом в исследуемом образце ткани яичников больше, чем установленное ранее граничное значение, и, соответственно, определение наличия или отсутствия рака яичников у субъекта. В одном варианте осуществления количество антител, связывающиеся с полипептидом в исследуемом образце ткани яичников, определяют иммуногистохимическими методами.

[0038] Способы, раскрытые в настоящей заявке, имеют отношение к НЕ4/НЕ4а, члену семейства белков, «содержащих 4 дисульфидные связи в коровой части», как было описано. Семейство белков, «содержащих 4 дисульфидные связи в коровой части», включает гетерогенную группу небольших молекул, устойчивых к кислоте и нагреванию, с разнообразными функциями, которые включают эпидидимальный белок человека, содержащий 4 дисульфидные связи в коровой части, или «НЕ4» (Kirchhoff et al., 1991 Biol. Reprod. 45:350-357; Wang et al., 1999 Gene 229:101; Schummer et al., 1999 Gene 238:375). кДНК НЕ4 была впервые изолирована из эпидидимиса человека (Kirchhoff et al., 1991 Biol. Reprod. 45:350-357), и позже кДНК НЕ4 была определена с высокой частотой в библиотеках кДНК, сконструированных из карциномы яичников (Wang et al., 1999 Gene 229:101; Schummer et al., 1999 Gene 238:375). Откорректированная последовательность НЕ4а была раскрыта в Hellstrom et al., 2003, Cane. Res. 63:3695-3700 и в патенте США 7,270,960. НЕ4а имеет аминокислотную последовательность, которая является высоко подобной, но отличной, от расшифрованной последовательности молекулы, которую в ранних публикациях именовали как НЕ4.

[0039] Сообщалось о ряде изоформ белка НЕ4, которые приведены в Таблице 1 ниже. Специалисты в данной области техники понимают, что моноклональное антитело к НЕ4/НЕ4а согласно настоящему изобретению может связываться с более чем одной изоформой НЕ4, поскольку каждая изоформа включает соответствующую последовательность эпитопа для конкретного антитела к НЕ4/НЕ4а.

ТАБЛИЦА 1:
ИЗОФОРМЫ НЕ4
Изоформа НЕ4 Учетный №. Идентификатор последовательности
1 NP_006094 SEQ ID NO:1
2 AAL37488 SEQ ID NO:3
3 AAL37487 SEQ ID NO:5
4 AAL37486 SEQ ID NO:7
5 AAL37485 SEQ ID NO:9
6 ААН46106 SEQ ID NO:11
7 AAO52683 SEQIDNO:13
8 САА44869 SEQ ID NO:15

[0040] В настоящей заявке термин «субъект» относится к животному, которое представляет собой объект лечения, наблюдения или эксперимента. «Животное» включает холодно- и теплокровных позвоночных, таких как рыбы, моллюски, рептилии и, в частности, млекопитающие. «Млекопитающие» включают, без ограничений, мышей, крыс, кроликов, морских свинок, собак, кошек, овец, коз, коров, лошадей, приматов, таких как макаки, шимпанзе и обезьяны, и человека.

[0041] Способы, раскрытые в настоящей заявке, также включают композиции и способы определения находящихся на клеточной поверхности и/или растворимых форм НЕ4а, которые в норме присутствуют у субъекта, включая повышенные уровни этих полипептидов у объектов, имеющих определенные виды рака. Соответственно, в настоящем раскрытии предложены полезные композиции и способы для определения и диагностики злокачественного заболевания (например, рака яичников) у субъекта путем специфичного определения таких полипептидов НЕ4а, находящихся на клеточной поверхности и/или растворимых.

[0042] Также предложен способ иммуноанализа и получения моноклональных антител для определения полноразмерного антигена НЕ4а, и применение способов иммуноанализа и моноклональных антител для серологической диагностики рака яичников, мониторинга клинического течения заболевания и диагноза рака яичников путем анализа НЕ4а в тканях. Создание новых моноклональных антител к эпитопов, специфичных домену N-WFDC в НЕ4а, и комбинирование этих антител с антителами против домена C-WFDC в НЕ4а, обеспечивает возможность разработки процедуры специфичных способов иммуноанализа для определения полноразмерного НЕ4а.

[0043] В соответствии со способами, раскрытыми в настоящей заявке, антигенный полипептид НЕ4а человека (или полипептид НЕ4а) может быть определен в биологическом образце, полученном от субъекта или из биологического источника. Биологические образцы могут быть получены путем отбора образцов крови, биопсийных проб, эксплантатов ткани, культур органов, биологических жидкостей или любых других препаратов из объекта или биологического источника. Объект или биологический источник может представлять собой человека или животное, не являющееся человеком, первичную клеточную культуру или культуру адаптированной клеточной линии, включая, но не ограничиваясь перечисленными: созданные методами генной инженерии клеточные линии, которые могут содержать интегрированные в хромосомы или эписомные рекомбинантные последовательности нуклеиновой кислоты, иммортализованные или способные к иммортализации клеточные линии, гибридные клеточные линии соматических клеток, дифференцированные или способные к дифференцировке клеточные линии, трансформированные клеточные линии и тому подобное. В некоторых вариантах реализации способов, раскрытых в настоящей заявке у субъекта или биологического источника могут подозревать наличие рака яичников или риск наличия рака яичников.

[0044] В некоторых вариантах реализации биологический образец включает по меньшей мере одну клетку от субъекта или биологического источника, и в других вариантах реализации биологический образец представляет собой биологическую жидкость, включающую другой маркер опухоли. Биологические жидкости обычно представляют собой жидкости при физиологических температурах и могут включать существующие в природе жидкости, присутствующие в, отобранные от, экспрессированные или каким-либо иным способом выделенные из объекта или биологического источника. Некоторые биологические жидкости, происходящие от некоторых тканей, органов или локализированных областей, и некоторые другие биологические жидкости могут быть расположены внутри субъекта или биологического источника более глобально или системно. Не ограничивающие примеры биологических жидкостей включают кровь, сыворотку и серозные жидкости, плазму, лимфу, мочу, спинномозговую жидкость, слюну, серозные жидкости, плазму, лимфу, секрет слизистых секреторных тканей и органов, вагинальный секрет, женское молоко, слезы, также подходят асцитные жидкости, такие как ассоциированные с не солидными опухолями. Дополнительные примеры включают жидкости плевральной, перикардиальной, перитонеальной, абдоминальной и других полостей тела и тому подобное. Биологические жидкости могут также включать жидкие растворы, контактировавшие с объектом или биологическим источником, например, клеточную или органную культуральную среду, включая клеточную или органную кондиционную среду, лаважные жидкости и тому подобное. В других вариантах реализации биологический образец представляет собой свободный от клеток жидкий раствор, например, сыворотку крови, плазму или супернатант центрифугированной мочи.

[0045] В некоторых других вариантах реализации биологический образец включает интактные клетки, и в некоторых других предпочтительных вариантах реализации биологический образец включает клеточный экстракт, содержащий последовательность нуклеиновой кислоты, кодирующей антигенный полипептид НЕ4а или его фрагмент, или его вариант. В других вариантах реализации способов, раскрытых в настоящей заявке, желательно, чтобы эти клетки были разрушены физическими или химическими методами или лизированы перед проведением анализа для предоставления клеточного содержимого для анализа.

[0046] В настоящей заявке «молекула, присутствующая в норме в растворимой форме» в образце, может быть растворимым белком, полипептидом, пептидом, аминокислотой или их производным, липидом, жирной кислотой или подобным соединение, или их производным, углеводом, сахаридом или подобным соединение, или их производным, нуклеиновой кислотой, нуклеотидом, нуклеозидом, пурином, пиримидином или родственной молекулой, или их производным, или подобным соединение; или любой их комбинацией, такой как, например, гликопротеин, гликолипид, липопротеин, протеолипид, или любой другой биологической молекулой, которая представляет собой растворимый или свободный от клетки компонент биологического образца, как предложено в настоящей заявке. «Молекула, существующая (присутствующая) в норме в растворимой форме», также относится к молекуле, которая находится в растворе или присутствует в биологическом образце, включая биологическую жидкость, как предложено в настоящей заявке, и которая не присоединена к поверхности интактной клетки. Например, молекула, существующая в норме в растворимой форме, может включать, с необходимостью ограничения раствором: компонент макромолекулярного комплекса, материал, который получен, секретирован или экспортирован из клетки, коллоид, микрочастицу или наночастицу, или другую соответствующую суспензионную частицу; или тому подобное.

[0047] Наличие злокачественного заболевания (например, рака яичников) у субъекта относится к присутствию диспластических, раковых и/или трансформированных клеток у субъекта, включая, например, новообразование, опухоль, не подавляемые контактом или онкогенно трансформированные клетки или подобных образований. В качестве иллюстрации, но не ограничения, в контексте раскрытых в настоящей заявке способов, злокачественные заболевания могут относиться также к присутствию в организме субъекта раковых клеток, которые способны секретировать, выделять, экспортировать или высвобождать антигенный полипептид НЕ4а (или полипептид НЕ4а), в результате чего повышенные уровни этого полипептида возможно обнаружить в биологическом образце, полученном от субъекта. В некоторых вариантах реализации например, эти опухолевые клетки представляют собой опухолевые эпителиальные клетки, такие как клетки карциномы, и в некоторых вариантах реализации такие раковые клетки представляют собой опухолевые клетки мезотелиомы, которые являются трансформированными вариантами сквамозной клетки эпителия или мезотелия, которые образуют, например, выстилку плевральной, перикардиальной, перитонеальной, абдоминальной и других полостей тела.

[0048] В одном варианте реализации опухолевые клетки яичников, наличие которых означает наличие рака яичников, могут включать первичные и метастатирующие раковые клетки яичников. Критерии для классификации злокачественных образований хорошо известны в данной области техники, также как и образование и характеристики линий карциномы яичников человека из первичных и метастатирующих опухолей. В других вариантах реализации настоящее раскрытие также предполагает, что злокачественное заболевание может представлять собой мезотелиому, карциному поджелудочной железы, немелкоклеточную карциному легких или другую форму рака, включая любую из различных карцином, каких как карциномы сквамозных клеток и аденокарциномы, а также включая карциномы и гематологические злокачественные образования (например, лейкемии, лимфомы, миеломы и т.д.). Классификация этих и других злокачественных состояний известна специалистам в данной области техники, и настоящее описание изобретения предлагает определение наличия полипептида НЕ4а в таком злокачественном состоянии без чрезмерных экспериментов.

[0049] Эталонные значения приведены в примерах, содержащихся в настоящей заявке. Эти значения подходят для практического применения способов, раскрытых в настоящей заявке. Однако следует отметить, что применение способов, раскрытых в настоящей заявке, не ограничивается этими эталонными значениями или этими данными. Специалисты в данной области техники могут получить эталонные значения для своих практических потребностей. Эти эталонные значения могут быть получены путем анализа экспрессии НЕ4а у пациентов, которые подвергаются процедуре биопсии тканей рака яичников, которые, предположительно, являются злокачественными. Способы получения таких эталонных значений представлены в примерах. В дополнение, другие эталонные значения могут быть получены для применения в определенных категориях пациентов пациентов. Можно предвидеть, что такие категории могут включать возраст, наследственность, риск развития рака, медицинскую историю, группу крови, физические характеристики, такие как масса тела, и другие категории.

[0050] Как предложено в настоящей заявке, в способе скрининга наличия злокачественного заболевания у субъекта может использоваться антитело, специфичное к антигенному полипептиду НЕ4а, или антитело, специфичное к полипептиду НЕ4а. Антитела, специфичные к антигенному полипептиду НЕ4а (или полипептиду НЕ4а), уже созданы в виде моноклональных антител или поликлональной антисыворотки, или могут быть получены в виде генно-инженерных иммуноглобулинов (Ig), которые разработаны с целью получения необходимых свойств с использованием методов, хорошо известных в данной области техники. Например, в качестве иллюстрации, но не ограничения, антитела могут включать рекомбинантные IgG, химерные гибридные белки, содержащие происходящую из иммуноглобулина последовательность, или «гуманизированные антитела» (см., например, Патенты США №№5,693,762; 5,585,089; 4,816,567; 5,225,539; 5,530,101), которые могут быть все использованы для определения полипептида НЕ4а человека в соответствии со способами, раскрытыми в настоящей заявке. Такие антитела могут быть созданы, как предложено в настоящей заявке, включая создание с помощью иммунизации полипептидом НЕ4а, как описано ниже. Например, раскрыты последовательности нуклеиновой кислоты, кодирующие полипептиды НЕ4а, благодаря чему специалисты в данной области техники могут обычным способом получить эти полипептиды для использования в качестве иммуногенов. Например, моноклональные антитела, такие как 12А2, 14Е2, 2Н5, и 3D8, которые подробно описаны ниже, могут быть использованы для применения на практике некоторых способов в соответствии со способами, раскрытыми в настоящей заявке.

[0051] Термин «антитела» включает поликлональные антитела, моноклональные антитела, их фрагменты, такие как F(ab')2, и Fab фрагменты, также как любые существующие в природе или полученные рекомбинантным способом связывающие партнеры, которые представляют собой молекулы, которые специфично связываются с полипептидом НЕ4а. Антитела определяются как «иммуноспецифичные» или специфично связывающиеся, если они связывают полипептид НЕ4а с Ka, большей или равной около 104 М-1, предпочтительно большей или равной около 105 М-1, более предпочтительно большей или равной около 106 М-1 и еще более предпочтительно большей или равной около 107 M-1. Аффинность партнеров по связыванию или антител может быть без труда определена, используя соответствующие методики. Определение других белков как связывающих партнеров полипептида НЕ4а можно осуществить, используя любой из многочисленных известных методов идентификации и получения белков, которые специфично взаимодействуют с другими белками или полипептидами, например, дрожжевую двухгибридную систему скрининга, такую, как описано, например, в патенте США 5,283,173 и в патенте США 5,468,614. Способы, раскрытые в настоящей заявке, также включают применение полипептида НЕ4а и пептидов, основанных на аминокислотной последовательности полипептида НЕ4а, для приготовления связывающих партнеров и антител, которые специфично связываются с полипептидом НЕ4а.

[0052] Антитела обычно могут быть приготовлены с помощью любой из множества методик, известных специалисту в данной области. В одном варианте такой методики, иммуноген, содержащий полипептид НЕ4а, например, клетку, несущую полипептид НЕ4а на поверхности, или изолированный полипептид НЕ4а, первоначально вводят соответствующему животному (например, мышам, крысам, кроликам, овцам и козам), предпочтительно, в соответствии с предварительно определенной схемой, включающей одну вторичную инъекцию антигена или более, и проводят периодический забор крови у животных. Поликлональные антитела, специфичные к полипептиду НЕ4а, затем могут быть очищены из такой антисыворотки путем, например, аффинной хроматографии с использованием полипептида, объединенного с соответствующей твердой подложкой.

[0053] Моноклональные антитела, специфичные к полипептидам НЕ4а или их вариантам, могут быть получены с помощью любой методики, известной специалистам в данной области техники. Например, эти способы могут включать получение иммортализованных клеточных линий, способных продуцировать антитела, имеющие желаемую специфичность. Такие клеточные линии могут быть получены, например, из клеток селезенки, полученных от животного, иммунизированного, как описано выше. Клетки селезенки затем иммортализуют путем, например, слияния с клетками миеломы в качестве партнера слияния, например, сингенными иммунизированному животному. Например, клетки селезенки и клетки миеломы могут быть объединены на несколько минут вместе с мембранным агентом, обеспечивающим слияние, таким как полиэтиленгликоль или неионный детергент, а затем их высевают в низкой плотности на селективную среду, которая поддерживает рост гибридных клеток, но не поддерживает рост клеток миеломы. В одном из примеров методики селекции используют селекцию с помощью HAT (гипоксантин, аминоптерин, тимидин). После достаточного периода времени, обычно через 1-2 недели, наблюдают колонии гибридов. Единичные колонии отбирают и изучают на связывающую активность по отношению к полипептиду. Гибридомы, имеющие высокую реактивность и специфичность, являются предпочтительными. Гибридомы, которые продуцируют моноклональные антитела, которые специфично связываются с полипептидами НЕ4а, получают способами, раскрытыми в настоящей заявке.

[0054] Моноклональные антитела могут быть изолированы из супернатантов растущих колоний гибридомы. В дополнение, могут быть использованы разные методики для повышения выхода, такие как инъекции линии клеток гибридомы в перитонеальную полость соответствующего хозяина-позвоночного, такого как мышь или другой подходящий хозяин. Моноклональные антитела могут затем быть собраны из асцитной жидкости или крови. Загрязнители могут быть удалены из антител с помощью соответствующих методик, таких как хроматография, гель-фильтрация, преципитация и экстракция. Например, антитела могут быть очищены путем хроматографии на иммобилизованном белке G или белке А, применяя стандартные методики.

[0055] В рамках некоторых вариантов реализации могут применяться антигенсвязывающие фрагменты антител. Такие фрагменты включают Fab-фрагменты, которые могут быть получены, применяя стандартные методики (например, расщепление папаином для получения Fab- и Fc-фрагментов). Fab- и Fc-фрагменты могут быть разделены аффинной хроматографией (например, на колонках с иммобилизованным белком А), применяя стандартные методики. Такие методики хорошо известны в данной области техники, см., например, Weir, D. M., Handbook of Experimental Immunology, 1986, Blackwell Scientific, Boston.

[0056] В некоторых аспектах предложены слитые белки НЕ4. Многофункциональные слитые белки, обладающие специфичной аффинностью связывания с предварительно выбранными антигенами благодаря наличию доменов V-области иммуноглобулина, кодируемых последовательностями ДНК, связанными в рамке считывания с последовательностями, кодирующими различные эффекторные белки, известны в данной области техники, например, как раскрыто в Евразийском Патенте ЕР-В1-0318554, Патенте США 5,132,405, Патенте США 5,091,513 и Патенте США 5,476,786. Такие эффекторные белки включают полипептидные домены, которые могут быть использованы для определения связывания слитого белка с помощью любой из множества методик, с которыми знакомы специалисты в данной области техники, включая, но не ограничиваясь перечисленными: последовательность миметика биотина, прямую ковалентную модификацию с детектируемой функциональной группой-меткой, нековалентное связывание со специфично меченной репортерной молекулой, ферментативную модификацию детектируемого субстрата или иммобилизацию (ковалентную или нековалентную) на твердой подложке.

[0057] Одноцепочечные антитела для применения в способах, раскрытых в настоящей заявке, могут быть получены и отобраны методом, например, фагового дисплея (см., например, Патент США 5,223,409). Вкратце, в данном методе последовательность ДНК может быть вставлена в ген III или VIII нитчатого фага, например, М13. Некоторые векторы с мультиклонирующими сайтами были разработаны для вставки (McLafferty, M.A., Kent, K.A., Ladner, R.С. & Markland, W. Gene 128, 29-36 (1993); Scott JK, Smith GP. Searching for peptide ligands with an epitope library. Science. 1990 Jul 27; 249(4967):386-390; Smith G P, Scott J K. Libraries of peptides and proteins displayed on filamentous phage. Methods Enzymol. 1993; 217:228-257). Последовательности ДНК для встраивания могут быть генерированы случайным образом или могут представлять собой варианты известных связывающих доменов для связывания полипептида НЕ4а. Пептид, кодируемый встраиваемой последовательностью, экспонируется на поверхности бактериофага. Бактериофаг, экспрессирующий связывающий домен для полипептида НЕ4а, отбирают по связыванию с иммобилизованным полипептидом НЕ4а, например, рекомбинантным полипептидом, полученным с использованием методов, хорошо известных в данной области техники, и кодирующей последовательности нуклеиновой кислоты, раскрытой в настоящей заявке. Несвязавшийся фаг удаляют с помощью промывки, обычно содержащей 10 мМ Трис, 1 мМ ЭДТА, не содержащей соли, или с небольшой концентрацией соли. Связавшийся фаг элюируют солевым буфером, например, ступенчато возрастающими концентрациями NaCl, до тех пор, пока весь фаг не будет элюирован. Обычно фаг, связавшийся с большей аффинностью, будет элюироваться при большей концентрации соли. Элюированный фаг размножают в бактериальном хозяине. Могут быть проведены дополнительные этапы селекции для выбора нескольких фагов, связывающихся с наибольшей аффинностью. Затем определяют последовательность ДНК-вставки в связывающемся фаге. Поскольку прогнозируемая аминокислотная последовательность связывающего пептида известна, желаемый пептид для использования в рамках настоящей заявки в качестве антитела, специфичного к полипептиду НЕ4а, может быть создан либо рекомбинантным способом, либо путем синтеза. Рекомбинантные способы применяют, когда антитело продуцируется в виде слитого белка. Пептид также может быть получен в виде тандемного повтора двух или более подобных или различающихся пептидов, с целью увеличения аффинности или связывания.

[0058] В настоящем описании изобретения предлагаются различные форматы анализа. Для определения антигенной детерминанты, реактивной к антителу, специфичному к полипептиду НЕ4а, детектирующий реагент обычно представляет собой антитело, которое может быть получено, как описано в настоящей заявке, или с помощью разнообразных методов, известных в данной области техники. Существует множество форматов анализа, известных специалисту в данной области техники, с применением антитела для определения полипептида в образце, включая, но не ограничиваясь ими: твердофазный иммуноферментный анализ (ELISA), радиоиммунный анализ (РИА), иммунофлюориметрию, иммунопреципитацию, равновесный диализ, иммунодиффузию и другие методики. См., например, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988; Weir, D.M., Handbook of Experimental Immunology, 1986, Blackwell Scientific, Boston. Например, анализ может быть осуществлен в формате Вестерн блота, где препарат белка из биологического образца подвергают гель-электрофорезу, переносят на подходящую мембрану, и выдерживают для прохождения реакции с антителом. Наличие антител на мембране можно затем определить с использованием подходящего детектирующего реагента, как хорошо известно в данной области техники и описано ниже.

[0059] В другом варианте реализации анализ включает применение антитела, иммобилизованного на твердом носителе, для связывания с целевым полипептидом НЕ4а и удаления его из остатка образца. Связанный полипептид НЕ4а можно затем определить, используя второе антитело, взаимодействующее с конкретной антигенной детерминантой полипептида НЕ4а, например, реагентом, который содержит детектируемую функциональную группу-репортер. В качестве неограничивающего примера, в соответствии с данным вариантом реализации, иммобилизованное антитело и второе антитело, которые распознают конкретные антигенные детерминанты, могут представлять собой два типичных моноклональных антитела 2Н5 и 3D8. Кроме того, может быть применен соответствующий вариант анализа, в котором полипептид НЕ4а мечен детектируемой функциональной группой-репортером, и связывается с иммобилизованным антителом, специфичным к полипептиду НЕ4а, после инкубации иммобилизованного антитела с образцом. Степень, в которой компоненты образца ингибируют связывание меченого полипептида с антителом, является индикатором способности образца взаимодействовать с иммобилизованным антителом и, в результате, индикатором уровня НЕ4а в образце.

[0060] Твердая подложка может представлять собой любой материал, известный специалистам в данной области техники, к которому может быть присоединено антитело, такой как исследуемая лунка в планшете для микротитрования, нитроцеллюлозный фильтр или другая подходящая мембрана. Кроме того, подложка может представлять собой шар или диск, например, из стекла, стекловолокна, латекса или пластика, такого как полистерол или поливинилхлорид. Антитело может быть иммобилизовано на твердой подложке с использованием различных методик, известных в данной области техники, которые широко описаны в патентной и научной литературе.

[0061] В некоторых вариантах реализации анализ для определения антигена НЕ4а в образце представляет собой вариант анализа «сэндвич» с использованием двух антител. Этот анализ может быть осуществлен осуществления вначале контакта специфичного к полипептиду НЕ4а антитела (например, моноклонального антитела, такого как 12А2, 14Е2, 2Н5 и 3D8), которое иммобилизовано на твердой подложке, обычно в лунке планшета для микротитрования, с биологическим образцом, в результате чего молекула, присутствующая в норме в растворимой форме в образце и содержащая антигенную детерминанту, взаимодействующую с антителом, имеет возможность связаться с иммобилизованным антителом (например, 30-минутного инкубационного времени при комнатной температуре обычно бывает достаточно) с образованием комплексов антиген-антитело, или иммунных комплексов. Несвязавшиеся компоненты образца затем отделяют от иммобилизованных иммунных комплексов. Затем добавляют второе антитело, специфичное к антигенному полипептиду НЕ4а, где антигенсвязывающий сайт второго антитела не ингибирует конкурентно антигенсвязывающий сайт связывания с полипептидом НЕ4а иммобилизованного первого антитела (например, моноклональное антитело, такое как 2Н5 или 3D8, которое отличается от моноклонального антитела, иммобилизованного на твердой подложке). Второе антитело может быть снабжено детектируемой меткой, как предложено в настоящей заявке, что обеспечивает возможность прямого определения. Кроме того, второе антитело может быть определено непрямым способом с использованием меченого детектируемой меткой вторичного антитела к антителу (или антитела «второй стадии»), или с использованием специфичного реагента определения, как предложено в настоящей заявке. Способы, раскрытые в настоящей заявке, не ограничиваются любой конкретной процедурой определения, и для специалистов по иммуноанализу очевидно, что существует множество реагентов и конфигураций для иммунологического определения конкретного антигена в «сэндвич»-варианте иммуноанализа с двумя антителами.

[0062] В некоторых вариантах реализации способов, раскрытых в настоящей заявке, при применении иммуноанализа в модификации «сэндвич» с двумя антителами, описанного выше, первое, иммобилизованное антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой поликлональное антитело, и второе антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой поликлональное антитело. Любая комбинация не конкурентных антител к НЕ4а может быть использована в рамках способов, раскрытых в настоящей заявке, включая моноклональные антитела, поликлональные антитела и их комбинации. В некоторых других вариантах реализации способов, раскрытых в настоящей заявке, первое иммобилизованное антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой моноклональное антитело, а второе антитело специфичное к антигенному полипептиду НЕ4а, представляет собой поликлональное антитело. В некоторых других вариантах реализации способов, раскрытых в настоящей заявке, первое иммобилизованное антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой поликлональное антитело, а второе антитело специфичное к антигенному полипептиду НЕ4а, представляет собой моноклональное антитело. В некоторых других, очень предпочтительных вариантах реализации способов, раскрытых в настоящей заявке, первое иммобилизованное антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой моноклональное антитело, и второе антитело, специфичное к антигенному полипептиду НЕ4а, представляет собой моноклональное антитело. Например, в этих вариантах реализации нужно отметить, что моноклональные антитела 12А2, 14Е2, 2Н5 и 3D8, как предложено в настоящей заявке, распознают конкретные неконкурирующие антигенные детерминанты (например, эпитопы) в полипептидах НЕ4а, соответственно, любые парные комбинации этих моноклональных антител могут быть применены. В частности, некоторые комбинации пригодны для определения специфичных полноразмерных вариантов НЕ4 или сплайс-вариантов. В других вариантах реализации способов, раскрытых в настоящей заявке, первое, иммобилизованное антитело, специфичное к антигенному полипептиду НЕ4а, и/или второе антитело, специфичное к антигенному полипептиду НЕ4а, может представлять собой любое из типов антител, известных в данной области техники и упоминаемых в настоящей заявке, например, в качестве иллюстрации, но не ограничения, Fab фрагменты, F(ab')2 фрагменты, слитые с V-областью иммуноглобулина белки или одноцепочечные антитела. Специалисты в данной области техники понимают, что способы, раскрытые в настоящей заявке, включают применение других форм антител, фрагментов, производных и тому подобного в способах, раскрытых и заявленных в настоящей заявке.

[0063] В некоторых вариантах реализации второе антитело может содержать детектируемую функциональную группу-репортер или метку, такую как фермент, краситель, радионуклид, люминесцентную группу, флуоресцентную группу или биотин, или подобную группу. Любые функциональные группы-репортеры или метки могут быть использованы в способах, раскрытых в настоящей заявке, при условии, что сигнал от них напрямую связан или пропорционален количеству антител, остающемуся на подложке после промывки. Количество вторых антител, которые остаются связанными с твердой подложкой, затем определяют, применяя способ, подходящий для специфичного определения функциональной группы-репортера или метки. Для радиоактивных групп обычно являются подходящими методы подсчета сцинтилляции или авторадиографические методы. Конъюгаты антитело-фермент могут быть созданы с использованием разнообразные методики объединения (в качестве примера, см. Scouten, W.Н. (1987) A survey of enzyme coupling techniques. Methods in. Enzymology 135, 30-65). Спектроскопический метод может быть использован для определения красителя (включая, например, колориметрические продукты ферментативных реакций), люминесцентных групп и флуоресцентных групп. Биотин можно детектировать, используя авидин или стрептавидин, связанные с различными репортерными группами (обычно радиоактивной или флуоресцентной группой или ферментом). Ферментативные репортерные группы могут обычно быть определены путем добавления субстрата (обычно на определенный период времени) с последующим спектроскопическим, спектрофотометрическим или другим анализом продуктов реакции. Стандарты и стандартные добавки могут быть использованы для определения уровня антигена в образце, используя широко известные методики.

[0064] В других вариантах реализации способы, раскрытые в настоящей заявке, предполагают применение антигенного полипептида НЕ4а, как предложено в настоящей заявке, для скрининга наличия рака яичников путем определения иммуноспецифичных реактивных антител в биологическом образце от биологического источника или объекта. В соответствии с этим вариантом реализации антигенный полипептид НЕ4а (или его фрагмент, или вариант, включая усеченный антигенный полипептид НЕ4а, как предложено в настоящей заявке) связывают с детектируемой меткой и приводят в контакт с биологическим образцом для определения связывания с антигенным полипептидом НЕ4а антитела, в норме присутствующего в образце в растворенной форме. Например, антигенный полипептид НЕ4а может быть связан с меткой биосинтетическим путем с использованием последовательностей, раскрытых в настоящей заявке, а также широко известных методов, таких как встраивание в процессе трансляции in vitro легко детектируемой (например, радиоактивно меченной) аминокислоты или использование другой детектируемой функциональной группы-репортера, такой, как группы, описанные в настоящей заявке. Специалист в данной области техники понимает, что этот вариант реализации способов предполагает, что определенные полипептиды НЕ4а, такие как гибридизованные полипептиды НЕ4а, раскрытые в настоящей заявке, могут представлять собой чрезвычайно иммуногенные пептиды, и, соответственно, вызывают увеличение количества специфических детектируемых антител. Например, в соответствии с этой теорией, определенные слитые полипептиды НЕ4а могут представлять «не собственные» антигены, что провоцирует авидный иммунный ответ, тогда как полипептиды НЕ4а, лишенные доменов слияния, могут рассматриваться иммунной системой как более напоминающие «собственные» антигены, и не вызывают незамедлительного гуморального или клеточного иммунного ответа.

[0065] Способ скрининга наличия злокачественного заболевания в соответствии со способами, раскрытыми в настоящей заявке, может быть также усовершенствован с помощью определения более, чем одного маркера, ассоциированного с опухолью, в биологическом образце, полученном от субъекта. Соответственно, способы, раскрытые в настоящей заявке, предлагают вариант скрининга, который, в дополнение к определению реактивности существующего в норме компонента к антителу, специфичному к антигенному полипептиду НЕ4а, также включает определение по меньшей мере одного дополнительного растворимого маркера злокачественного заболевания, используя разработанные методы, известные в данной области техники, а также раскрытые в настоящей заявке. Как было отмечено выше, в настоящий момент существует ряд растворимых антигенов, ассоциированных с опухолями, которые являются детектируемыми в образцах легко получаемых биологических жидкостей.

[0066] Примеры способов скрининга для идентификации пациентов с повышенной вероятностью рака яичников обычно включают определение в образце, полученном из тела пациента, экспрессии множества биомаркеров, которые селективно сверхэкспрессируются при раке яичников. Сверхэкспрессия биомаркеров свидетельствует о повышенной вероятности того, что у пациента рак яичников. Способы согласно настоящему изобретению могут включать, например, «двухэтапный» анализ, когда первый этап анализа осуществляют для определения экспрессии первого биомаркера (например, НЕ4/НЕ4а) или панели биомаркеров. Если выявляют сверхэкспрессию первого биомаркера или панели биомаркеров, осуществляют второй этап анализа для определения экспрессии второго биомаркера или панели биомаркеров. Сверхэкспрессия первого и второго биомаркеров или панелей биомаркеров является свидетельством повышенной вероятности того, что у пациента рак яичников.

[0067] В качестве альтернативы, может быть определена последовательность нуклеиновой кислоты, кодирующей полипептиды НЕ4а, с использованием стандартных методики гибридизации и/или полимеразной цепной реакции (ПЦР). Соответствующие зонды и праймеры могут быть созданы специалистами с обычными знаниями в данной области техники, на основании на последовательностях кДНК НЕ4а, представленных в настоящей заявке. Анализ можно в общем виде осуществлять, используя любые из множества образцов, полученных из биологического источника, такие как эукариотические клетки, бактерии, вирусы, экстракты, приготовленные из таких организмов, и жидкости, присутствующие в живых организмах.

[0068] Стандартные технологии рекомбинантной ДНК и молекулярного клонирования, использованные в примерах, хорошо известны в данной области техники.

[0069] Исходя из физико-химических и иммунохимических свойств полипептидов НЕ4а, раскрытых в настоящей заявке, и используя раскрытую здесь же последовательность нуклеиновой кислоты, кодирующую НЕ4а, лицо, обладающее обычным уровнем знаний в данной области техники, также может получить рекомбинантный полипептид НЕ4а, который можно использовать для получения и исследования специфичных антител с помощью хорошо известных методик. Полипептиды НЕ4а могут быть экспрессированы в клетках млекопитающих, дрожжей, бактерий или в других клетках под контролем соответствующих промоторов. Системы бесклеточной трансляции также могут быть применены для получения таких белков с использованием РНК, происходящей из областей ДНК, кодирующих полипептид НЕ4а, раскрытый в настоящей заявке. Подходящие клонирующие и экспрессионные векторы для использования в прокариотических и эукариотических хозяевах были описаны ранее и хорошо известны специалистам в данной области техники. В предпочтительных вариантах реализации настоящего изобретения полипептиды НЕ4а экспрессируют в эукариотических клетках.

[0070] Соответственно, настоящее изобретение обеспечивает изолированную молекулу нуклеиновой кислоты, которая кодирует антигенный полипептид НЕ4а, или молекулу нуклеиновой кислоты, способную гибридизироваться с такой нуклеиновой кислотой, кодирующей НЕ4а полипептид, или молекулу нуклеиновой кислоты, имеющую последовательность, комплементарную ей.

[0071] Предпочтительные варианты демонстрируют по меньшей мере более 70% идентичности, более предпочтительно по меньшей мере более 80%-85% идентичности и, наиболее предпочтительно, по меньшей мере более 90%, 92%, 94%, 95%, 96%, 97%, 98% или 99% идентичности полинуклеотидной последовательности, которая кодирует нативный антигенный полипептид НЕ4а или его часть. Процент идентичности может быть легко определен путем сравнения последовательностей с использованием компьютерных алгоритмов, хорошо известных специалистам в данной области техники, таких как алгоритмы Align или BLAST (Altschul S.F. (1991) Amino acid substitution matrices from an information theoretic perspective. Journal of Molecular Biology 219: 555-565; Henikoff S, Henikoff JG. Amino acid substitution matrices from protein blocks. Proc Nati Acad Sci USA. 1992 Nov 15; 89(22): 10915-9, которые доступны на веб-сайте NCBI (http://www/ncbi.nlm.nih.gov/cgi-bin/BLAST).

[0072] Некоторые варианты по существу гомологичны нативному гену. Такие варианты полинуклеотидов способны гибридизироваться в умеренно жестких условиях с природными последовательностями ДНК или РНК, кодирующими нативный антиген НЕ4а (или с комплементарной последовательностью). Подходящие умеренно жесткие условия включают, например, следующие этапы или их эквивалент: предварительную промывку в растворе 5×SSC, 0,5% SDS, 1,0 мМ ЭДТА (рН 8,0); гибридизацию при 50°С-65°С, 5×SSC, в течение ночи; с последующей промывкой дважды при 65°С в течение 20 минут с использованием 2×, 0,5× и 0,2×SSC, содержащего 0,1% SDS. Для дополнительной жесткости условия могут включать, например, промывку в 0,1×SSC и 0,1% SDS при 60°С в течение 15 минут, или эквивалент. Лицо, обладающее обычным уровнем знаний в данной области техники, сможет легко оценить параметры, которые могут быть рутинным образом изменены для создания условий гибридизации необходимой жесткости, которые являются в некоторой степени селективными для конкретной целевой нуклеиновой кислоты, а также понимает, что такие условия могут быть обусловлены конкретными последовательностями нуклеиновой кислоты, участвующими в гибридизации.

[0073] Нуклеиновые кислоты, кодирующие полипептиды НЕ4а или любые другие полипептиды НЕ4а, для применения в соответствии с настоящим изобретением, могут включать, но не но не ограничиваются перечисленными: только кодирующую последовательность полипептида НЕ4а, кодирующую последовательность полипептида НЕ4а и дополнительную кодирующую последовательность; кодирующую последовательность полипептида НЕ4а (и в некоторых случаях дополнительную кодирующую последовательность) и некодирующую последовательность, такую как интроны или некодирующие последовательности 5'- и/или 3'- конца кодирующей последовательности полипептида НЕ4а, которая, например, может также включать одну или более регуляторную последовательность нуклеиновой кислоты, которая может представлять собой регулирующий или регулируемый промотор, энхансер, другие последовательности, регулирующие транскрипцию, последовательности для связывания репрессоров, последовательности, регулирующие трансляцию, или любые другие регуляторные последовательности нуклеиновой кислоты, но не обязательно ограничивается ими. Таким образом, термин «нуклеиновая кислота, кодирующая полипептид НЕ4а» включает нуклеиновую кислоту, которая включает только кодирующую последовательность полипептида, ИА также нуклеиновую кислоту, включающую дополнительную кодирующую и/или некодирующую последовательность или последовательности.

[0074] Настоящее изобретение также относится к вариантам описанных в настоящей заявке нуклеиновых кислот, кодирующих фрагменты, аналоги и производные полипептида НЕ4а, например, полипептиды НЕ4а человека, имеющие расшифрованную аминокислотную последовательность любой из SEQ ID NOs:1, 3, 5, 7, 9, 11, 13 или 15 (НЕ4). Варианты нуклеиновых кислот, кодирующих НЕ4а, могут представлять собой природные аллельные или сплайс-варианты нуклеиновых кислот, или варианты, не существующие в природе. Как известно в данной области техники, аллельный вариант представляет собой альтернативную форму последовательности нуклеиновой кислоты, которая может содержать по меньшей мере одну замену, делецию или вставку одного или более нуклеотидов, любая из которых существенно не изменяет функцию кодируемого полипептида НЕ4а. Варианты и производные НЕ4а могут быть получены путем мутаций нуклеотидной последовательности, кодирующей полипептиды НЕ4а. Альтернативные варианты нативной последовательности аминокислот могут быть получены любым из ряда подходящих методов. Мутации в конкретном локусе могут быть осуществлены путем синтеза олигонуклеотидов, содержащих мутантную последовательность, фланкированную сайтами рестрикции, что делает возможным лигирование с фрагментами нативной последовательности. После лигирования полученная перестроенная последовательность кодирует аналог, содержащий желаемую аминокислотную вставку, замену или делецию.

[0075] Кроме того, процедуры олигонуклеотид-направленного сайт-специфичного мутагенеза могут применяться для получения измененного гена, что позволяет изменять заранее заданные кодоны путем замены, делеции или вставки, как хорошо известно специалистам в данной области техники.

[0076] Эквивалентные ДНК-конструкции, кодирующие различные вставки или замены аминокислотных остатков или последовательностей, или делеции терминальных или внутренних остатков или последовательностей, которые не являются необходимыми для осуществления биологической активности, также включены в объем настоящего изобретения. Например, последовательности, кодирующие остатки Cys, которые не являются существенными для биологической активности, могут быть изменены путем делегирования остатков Cys или их замены на другие аминокислоты для предотвращения образования нежелательных внутримолекулярных дисульфидных мостиков при ренатурации. Другие эквиваленты могут быть получены путем модификации соседних двухосновных аминокислотных остатков для увеличения экспрессии в дрожжевых системах, в которых присутствует активность протеазы KEX2. В качестве примера, в европейском патенте ЕР 212,914 раскрыто применение сайт-специфичного мутагенеза для инактивации сайтов процессинга протеазы КЕХ2 в белке. Сайты процессинга протеазы KEX2 инактивируют путем делеции, вставки или замены остатков с целью замены пар Arg-Arg, Arg-Lys, и Lys-Arg и для устранения присутствия таких соседних основных остатков. Парные остатки Lys-Lys являются в значительно меньшей степени подвержены расщеплению KEX2, и конверсия Arg-Lys или Lys-Arg на Lys-Lys представляется консервативным и предпочтительным подходом для инактивации сайтов KEX2.

[0077] Подходящие последовательность или последовательности ДНК могут быть встроены в любой из числа хорошо известных векторов, подходящих для выбранных клеток-хозяев, с помощью различных процедур. Обычно последовательность ДНК встраивают в подходящий сайт или сайты рестрикции эндонуклеазой с использованием процедур, известных в данной области техники. Стандартные методики клонирования, выделения ДНК, амплификации и очистки, ферментативных реакций с использованием ДНК-лигазы, ДНК-полимеразы, рестрикционных эндонуклеаз и тому подобное, и различные методики разделения хорошо известны и повсеместно применяются специалистами в данной области техники.

[0078] Примеры систем экспрессии млекопитающих включают линии COS-7 фибробластов почек обезьяны, описанные в Gluzman Y. SV40-transformed simian cells support the replication of early SV40 mutants. Cell. 1981 Jan;23(I): 175-82, и другие клеточные линии, способные экспрессировать совместимый вектор, например, клеточные линии С127, 3Т3, СНО, HeLa и ВНК. Экспрессионные векторы млекопитающих содержат точку начала репликации, подходящие промотор и энхансер, а также любой из необходимых сайтов связывания с рибосомой, сайт полиаденилирования, акцепторный и донорный сайты сплайсинга, последовательности терминации транскрипции, и 5'-фланкирующие нетранскрибируемые последовательности. Последовательности ДНК, происходящие, например, из сайтов сплайсинга и сайтов полиаденилирования SV40, могут быть использованы для получения необходимых нетранскрибируемых генетических элементов. Введение конструкции в клетку-хозяина может быть осуществлено различными методами, с которыми хорошо знакомы специалисты в данной области техники, включая, например, но не ограничиваясь ими: кальцийфосфатную трансфекцию, DEAE-декстран опосредованную трансфекцию или электропорацию (Davis, L.G., Dibner, M.D. and Battey, J.F.: Basic Methods in. Molecular Biology. Elsevier, New York, 1986).

[0079] Полипептид НЕ4а согласно настоящему изобретению может представлять собой немодифицированный полипептид или может представлять собой полипептид, который был подвергнут посттрансляционной модификации, например, путем гликозилирования, фосфорилирования, ацилирования жирными кислотами, включая модификацию с присоединением гликозилфосфатидилинозитольного якоря, или тому подобное; расщепления фосфолипазой, такого как гидролиз, опосредованный фосфатидилинозитол-специфичной фосфолипазой С, или тому подобное; расщепления протеазами, дефосфорилирования или любого другого типа пострансляционных модификаций белка, таких как модификации, которые влекут за собой образование или расщепление ковалентных химических связей.

[0080] Термины «фрагмент», «производное» и «аналог» по отношению к полипептидам НЕ4а, антигенным полипептидам НЕ4а или слитым белкам НЕ4а, относятся к любому полипептиду НЕ4а, который по существу сохраняет биологическую функцию и/или активность исходного полипептида. Таким образом, аналог может включать изоформу антигенного полипептида НЕ4а, такую как полипептид НЕ4а с отличной посттрансляционной модификацией или его вариант, например сплайс-вариант. Как хорошо известно в данной области техники, «сплайс-вариант» включает варианты или альтернативные формы полипептида, которые возникают в результате различного внутриклеточного процессинга РНК-транскрипта. Например, два различных молекулы мРНК могут быть сплайс-вариантами друг друга, при этом они различаются только включением всей последовательности или части последовательности, соответствующей конкретному экзону одной молекуле мРНК, и его отсутствию в других молекулах. Как понятно для специалистов в данной области техники, могут существовать другие структурные связи между вариантами мРНК, которые обычно относят к сплайс-вариантам,. Полипептид НЕ4а также включает пробелок, который может быть активирован путем расщепления части пробелка для получения активного полипептида НЕ4а.

[0081] Биологические функции и/или активность фрагментов, производных и аналогов полипептидов НЕ4а или антигенных полипептидов НЕ4а включают, но не должны ограничиваться перечисленными: применение таких полипептидов в качестве маркеров в методе скрининга на наличие злокачественного заболевания у субъекта, как раскрыто в настоящей заявке. Например, с помощью определения в образце, полученном от субъекта, молекулы, существующей в норме в растворимой форме и содержащей антигенную детерминанту, которая способна к взаимодействию с по меньшей мере одним антителом, специфичным к полипептиду НЕ4а, специалист в данной области техники может осуществлять мониторинг биологической функции и/или активности полипептида НЕ4а. Также следует отметить, что в некоторых вариантах осуществлени настоящего изобретения способ скрининга направлен на сравнение относительных количеств и/или уровней определяемой молекулы, существующей в норме в растворимой форме и содержащей антигеннную детерминанту, взаимодействующую с по меньшей мере одним антителом, специфичным к полипептиду НЕ4а, из: (i) первого биологического образца, полученного от первого субъекта, у которого подозревают злокачественное заболевание, и (ii) второго биологического образца, полученного от второго субъекта, который не имеет злокачественного заболевания. Соответственно, относительное количественное присутствие полипептида НЕ4а в биологическом образце может являться биологической функцией и/или активностью полипептида НЕ4а, хотя функция и/или активность не ограничивается только указанными.

[0082] Фрагмент, производное или аналог полипептида НЕ4а может представлять собой (i) такой, в котором один или более аминокислотных остатков заменены консервативными или неконсервативными аминокислотными остатками (предпочтительно консервативными аминокислотными остатками); (ii) такой, в котором дополнительные аминокислоты слиты с полипептидом НЕ4а, включая аминокислоты, которые могут быть использованы для очистки последовательности полипептида НЕ4а или пробелка; или (iii) усеченный полипептид НЕ4а. Такие фрагменты, производные и аналоги подразумеваются специалистами в данной области техники из пояснений, изложенных в настоящей заявке.

[0083] Усеченный полипептид НЕ4а может представлять собой любую молекулу полипептида НЕ4а, которая содержит меньше компонентов, чем полноразмерный вариант полипептида НЕ4а. Усеченные молекулы согласно настоящему изобретению могут включать усеченные биологические полимеры, и в предпочтительных вариантах осуществления изобретения такие усеченные молекулы могут представлять собой усеченные молекулы нуклеиновой кислоты или усеченные полипептиды. Усеченные молекулы нуклеиновой кислоты имеют меньшую последовательность, чем полноразмерная нуклеотидная последовательность известной или описываемой молекулы нуклеиновой кислоты, где такая известная или описываемая молекула нуклеиновой кислоты может представлять собой существующую в природе, синтетическую или рекомбинантную молекулу нуклеиновой кислоты, при условии, что специалист в данной области техники оценивает ее как полноразмерную молекулу. Таким образом, например, усеченные молекулы нуклеиновой кислоты, которые соответствуют последовательности гена, содержат меньше компонентов, чем полноразмерная последовательность гена, причем ген включает кодирующие и некодирующие последовательности, промоторы, энхансеры и другие регуляторные последовательности, фланкирующие последовательности и тому подобное, и другие функуциональные и нефункциональные последовательности, которые распознаются как часть гена. В другом примере, усеченные молекулы нуклеиновой кислоты и молекулы, соответствующие последовательности мРНК, содержат меньше компонентов, чем полноразмерный мРНК-транскрипт, который может включать различные транслируемые и нетранслируемые участки, также как и другие функциональные и нефункциональные последовательности. В других предпочтительных вариантах реализации усеченные молекулы представляют собой полипептиды, которые включают меньше компонентов, чем полноразмерная аминокислотная последовательность конкретного белка.

[0084] В настоящей заявке термин «делеция» имеет свое обычное значение, которое подразумевается специалистами в данной области техники, и может относиться к молекулам, в которых отсутствует одна или более частей последовательности в концевой или неконцевой области, родственным соответствующей полноразмерной молекуле, например, как в случае усеченной молекулы, предложенной в настоящей заявке. Усеченные молекулы, которые представляют собой линейные биологические полимеры, такие как молекулы нуклеиновых кислот или полипептиды, могут содержать одну или более делеций в концевой области молекулы или делецию в неконцевой области, причем такие делеций могут представлять собой делеций 1-1500 последовательных нуклеотидов или аминокислотных остатков и, более предпочтительно, 1-300 последовательных нуклеотидов или аминокислотных остатков.

[0085] Как известно в данной области техники, «подобие» между двумя полипептидами определяется путем сравнения последовательностей аминокислот и консервативных аминокислотных замен в полипептиде с последовательностью второго полипептида. Подобие между двумя полипептидными или нуклеотидными последовательностями, или даже процент идентичности, может быть легко определено путем сравнения последовательностей, с использованием компьютерных алгоритмов, хорошо известных специалистам в данной области техники, таких как алгоритм BLAST. Примеры других полезных компьютерных алгоритмов включают алгоритмы, используемые в таких программах, как, например, Align и FASTA, которые доступны, например, на Интернет веб-сайте Genestream Института Генетики Человека, Монпелье, Франция (www2.igh.cnrs.fr/home.eng.html). Фрагменты или части полипептидов согласно настоящему изобретению могут быть применены для получения соответствующих полноразмерных полипептидов путем пептидного синтеза, таким образом, фрагменты применяться в качестве промежуточных продуктов для получения полноразмерных полипептидов.

[0086] Термин «изолированный» («выделенный») означает материал, отделенный от своего обычного окружения (например, природного окружения, если оно обычно существует). Например, существующий в природе полипептид или полинуклеотид, присутствующий в живом животном, не является изолированным, но тот же самый полипептид или полинуклеотид, отделенный от некоторых или всех со-существующих материалов природной системы, является изолированным. Такие полипептиды или полинуклеотиды могут быть частью композиции, все еще оставаясь изолированными, если такая композиция не является частью его природного окружения.

[0087] Методики, основанные на аффинности, являются особенно для выделения полипептидов НЕ4а для применения в соответствии со способами настоящего изобретения, и могут включать любой способ с использованием специфичного связывания с полипептидом НЕ4а для разделения. Например, поскольку полипептиды НЕ4а могут содержать ковалентно связанные остатки олигосахаридов, может быть особенно полезна методика, основанная на аффинности, например, связывание полипептида НЕ4а с подходящим иммобилизованным пектином в условиях, которые делают возможным связывание углеводов с лектином. Другие полезные методики, основанные на аффинности, включают иммунологические методики выделения полипептида НЕ4а, которые основаны на специфическом связывающем взаимодействии между антителосвязывающими центрами антигена и антигенными детерминантами, присутствующими в комплексах. Иммунологические методики включают, но не ограничиваются ими: иммуноафинную хроматографию, иммунопреципитацию, твердофазную иммуноадсорбцию или другие иммуноафинные методы.

[0088] Согласно настоящему изобретению предложен слитый белок, содержащий полипептид, слитый с НЕ4а. Такие слитые белки НЕ4а кодируются нуклеиновой кислотой, содержащей кодирующую последовательность НЕ4а, слитую в рамке считывания с дополнительной кодирующей последовательностью для обеспечения экспрессии последовательности полипептида НЕ4а, слитой с дополнительной функциональной или нефункциональной полипептидной последовательностью, что обеспечивает, например, определение, изоляцию и/или очистку слитого белка НЕ4а. Такие слитые белки НЕ4а могут сделать возможными определение, изоляцию и/или очистку слитого белка НЕ4а с помощью методов очистки пептидов, основанных на белок-белковой аффинности, аффинности к металлам или аффинности зарядов, или путем специфичного протеазного расщепления слитого белка, содержащего слитую последовательность, которая расщепляется протеазой таким образом, чтобы полипептид НЕ4а отделился от слитого белка.

[0089] Таким образом, слитые белки НЕ4а могут включать аффинные сигнальные полипептидные последовательности, т.е. к полипептидам или пептидам, присоединенным к НЕ4а для облегчения определения и выделения НЕ4а посредством специфических аффинных взаимодействий с лигандом. Лиганд может представлять собой любую молекулу, рецептор, контррецептор, антитело или тому подобное, с которыми может взаимодействовать аффинная метка посредством специфических связывающих взаимодействий, как описано в настоящей заявке. Такие пептиды включают, например, полигистидин или антигенные идентифицирующие пептиды, описанные в патенте США 5,011,912 и в Т.Р. Норр, В. Gallis and K.S. Prickett (1988) A short polypeptide marker sequence useful in protein identification and purification. Bio/Technology 6:1204-1210, или эпитопную метку XPRESS™ (Invitrogen, Карлсбад, Калифорния). Аффинная последовательность может представлять собой гекса-гистидиновую метку (тэг), которая представлена например, в виде вектора pBAD/His (Invitrogen) или вектора pQE-9 для обеспечения очистки зрелого полипептида, связанного с маркером, в случае бактериального хозяина, или, например, аффинная последовательность может представлять собой гемагглютинининовую (НА) метку, в случае, если хозяином является млекопитающее, например, если используются клетки COS-7. Метка НА соответствует серологически типируемому эпитопу, происходящему из гемагглютинина белка вируса гриппа (Wilson IA, Niman HL, Houghten RA, Cherenson AR, Connolly ML, Lerner RA. The structure of an antigenic determinant in a protein. Cell. 1984 Jul; 37(3):767-78).

[0090] Слитые белки НЕ4а в конкретных вариантах реализации и как более подробно описано ниже, могут также содержать полипептиды константной области иммуноглобулина, присоединенные к НЕ4а для улучшения определения, выделения и/или локализации НЕ4а. Полипептид константной области иммуноглобулина предпочтительно объединяют с С-концом полипептида НЕ4а. В соответствии с неограничивающей теорией, включение доменов константной области иммуноглобулина (Ig) в слитые белки НЕ4а, как предложено в настоящей заявке, может предложить преимущества, например, связанные с иммуногенными/неиммуногенными свойствами конкретных областей Ig при применении в конкретных хозяевах (например, «свой» против «не своего»), или облегчающие изоляцию и/или определение слитого белка. Эти и другие преимущества слитых белков на основе Ig будут очевидны специалистам в данной области техники. Общие основы получения слитых белков, включающих гетерологичные полипептиды, слитые с различными частями полипептидов, происходящими из антител (включая Fc домен), описаны, например Ashkenazi A, Marsters SA, Capon DJ, Chamow SM, Figari IS, Pennica D, Goeddel DV, Palladino MA, Smith DH. Protection against endotoxic shock by a tumor necrosis factor receptor immunoadhesin. Proc Nati Acad Sci USA. 1991 Dec 1;88(23): 10535-9 и Byrn et al. (Bym RA, Mordenti J, Lucas C, Smith D, Marsters SA, Johnson JS, Cossum P, Chamow SM, Wurm FM, Gregory T, et al. Biological properties of a CD4 immunoadhesin. Nature. 1990 Apr 12; 344(6267):667-70. Слитый ген, кодирующий слитый белок HE4a:Fc, встраивают в соответствующий вектор экспрессии. В некоторых вариантах реализации настоящего изобретения слитые белки HE4a:Fc могут самопроизвольно объединяться наподобие молекул антител, с образованием внутрицепочечных дисульфидных связей между Fc-полипептидами, что приводит к формированию димерных слитых белков НЕ4а.

[0091] Слитые белки НЕ4а, обладающие аффинностью специфичного связывания с отобранными антигенам благодаря тому, что слитые полипептиды содержат V-области иммуноглобулина, кодируемые последовательностями ДНК, связанными в одной рамке считывания с последовательностями, кодирующими НЕ4а, также находятся в пределах объема настоящего изобретения, включая их варианты фрагменты, как описано в настоящей заявке. Общие стратегии конструирования слитых белков, содержащих слитые полипептиды с V-областями иммуноглобулина, раскрыты, например, в патенте ЕР 0318554; в патенте США 5,132,405; в патенте США 5,091,513; и в патенте США 5,476,786.

[0092] Нуклеиновая кислота согласно настоящему изобретению может также кодировать слитый белок, содержащий полипептид НЕ4а, соединенный с другими полипептидами, имеющими желаемые аффинные свойства, например, с ферментом, таким как глутатион-8-трансфераза. В качестве другого примера, слитые белки НЕ4а могут также содержать полипептид НЕ4а, соединенный с полипептидом белка A Staphylococcus aureus; нуклеиновая кислота, кодирующая белок А, и ее применение в конструировании слитых белков, обладающих аффинностью к константным областям иммуноглобулина, раскрыты в общем виде например, в патенте США 5,100,788. Другие полезные аффинные полипептиды для конструирования слитых белков НЕ4а могут включать слитые белки на основе стрептавидина, как раскрыто, например, в заявке на патент 89/03422, патенте США 5,489,528, патенте США 5,672,691; заявке на патент WO 93/24631, патенте США 5,168,049, патенте США 5,272,254 и где-либо в другом месте, и слитые белки на основе авидина (см., например, европейский патент 511,747). Как описано в настоящей заявке и в цитируемых источниках, последовательности полипептида НЕ4а могут быть слиты с последовательностями слитых полипептидов, которые могут представлять собой полноразмерные слитые полипептиды, и которые в альтернативном варианте могут представлять собой их варианты или фрагменты.

[0093] Настоящее изобретение также обеспечивает слитые белки НЕ4а, которые содержат последовательности полипептидов, направляющих слитый белок к клеточному ядру, для локализации в просвете эндоплазматического ретикулума (ЭР) для секретирования из клетки по классическому секреторному пути ЭР-Гольджи (см., например, von Heijne, G. (1990) The Signal Peptide. J.Membr.Biol. 115, 195-201), для включения в плазматическую мембрану, для объединения к определенными компонентами цитоплазмы, включая цитоплазматический домен трансмембранного рецептора клеточной поверхности, или для направления в конкретное субклеточное локацию расположение по любому из различных известных внутриклеточных механизмов белкового сортинга, с которыми знакомы специалисты в данной области техники. (см. в качестве примера, Rothman JE. Mechanisms of intracellular protein transport. Nature. 1994 Nov 3; 372(6501):55-63., Advani RJ, Bae HR, Bock JB, Chao DS, Doung YC, Prekeris R, Yoo JS, Scheller RH. Seven novel mammalian SNARE proteins localize to distinct membrane compartments. J Biol Chem. 1998). Соответственно, эти и близкие варианты реализации охватываются настоящими композициями и способами, способствующими нацеливанию целевого полипептида на определенную внутриклеточную, мембранную или внеклеточную локализацию.

[0094] Настоящее изобретение также относится к векторам и конструкциям, которые включают нуклеиновые кислоты согласно настоящему изобретению, и, в частности, к «рекомбинантным экспрессионным конструкциям», которые включают любые нуклеиновые кислоты, кодирующие полипептиды НЕ4а согласно настоящему изобретению, описанные выше; к клеткам-хозяевам, которые сконструированы с помощью методов генной инженерии и векторов и/или конструкций согласно настоящему изобретению, и к получению полипептидов НЕ4а и слитых белков согласно настоящему изобретению или их фрагментов или вариантов с использованием рекомбинантных методик. Белки НЕ4а могут быть экспрессированы в клетках млекопитающих, дрожжей, бактерий, или в других клетках под контролем соответствующих промоторов. Бесклеточные системы трансляции также могут быть применены для продукции таких белков с использованием РНК, происходящей из конструкций ДНК согласно настоящему изобретению.

[0095] В общем, рекомбинантные векторы экспрессии будут включать точку начала репликации и селективные маркеры, позволяющие производить трансформацию клеток-хозяев, например, ген резистентности к ампициллину Е. coli и ген TRP1 S. cerevisiae, и промотор, происходящий из высокоэкспрессируемого гена, чтобы направлять транскрипцию нижележащей структурной последовательности. Такие промоторы могут происходить из оперонов, кодирующих гликолитические ферменты, такие как 3-фосфоглицерат киназа (ФГК), α-фактор, кислая фосфатаза или белки теплового шока, в числе других. Гетерологичная структурная последовательность объединена в соответствующей фазе с инициацией трансляции и последовательностями терминации. При необходимости гетерологичная последовательность может кодировать слитый белок, включая N-концевой идентификационный пептид, обеспечивающий желаемые характеристики, например, стабилизацию или упрощенную очистку экспрессированного рекомбинантного продукта.

[0096] Полезные экспрессионные конструкции для применения в бактериях конструируют путем встраивания в вектор экспрессии структурной последовательности ДНК, кодирующей целевой белок вместе с подходящими сигналами инициации и терминации трансляции в функциональной фазе считывания с функциональным промотором. Конструкция может включать один фенотипический селективный маркер или более и точку начала репликации для обеспечения поддержания конструкции вектора и, если это необходимо, для обеспечения амплификации в хозяине. Подходящие прокариотические хозяева для трансформации включают Е. coli, Bacillus subtilis, Salmonella typhimurium и различные виды родов Pseudomonas, Streptomyces, и Staphylococcus, хотя также могут быть выбраны другие хозяева. Любая другая плазмида или вектор могут быть использованы при условии, что они являются реплицируемыми и жизнеспособными в данном хозяине.

[0097] В качестве репрезентативного, но не ограничивающего примера, полезные векторы экспрессии для применения в бактериях могут включать селективный маркер и бактериальную точку начала репликации, полученную из коммерчески доступных плазмид, включающих генетические элементы хорошо известного клонирующего вектора pBR322 (АТСС 37017). Такие коммерческие векторы включают, например, pKK223-3 (Pharmacia Fine Chemicals, Уппсала, Швеция) и GEM1 (Promega Biotec, Мэдисон, Висконсин., США). Эти части «остова» pBR322 комбинируют с соответствующим промотором и структурной последовательностью, которую необходимо экспрессировать.

[0098] После трансформации подходящего штамма хозяина и выращивания штамма хозяина до необходимой клеточной плотности, выбранный промотор, если он представляет собой регулируемый промотор, как описано в настоящей заявке, индуцируют соответствующими способами (например, используя температурный сдвиг или химическую индукцию), и клетки культивируют в течение дополнительного времени. Клетки обычно собирают центрифугированием, разрушают физическим или химическим способом, и полученный в результате этого суммарный экстракт сохраняют для дальнейшей очистки. Микробиальные клетки, применяемые в экспрессии белков, могут быть разрушены любым подходящим методом, включая циклы замораживания-оттаивания, обработку ультразвуком, механическое разрушение, или использование агентов лизиса клеток; эти методы хорошо известны специалистам в данной области техники.

[0099] Таким образом, например, нуклеиновая кислота согласно настоящему изобретению, описанному в настоящей заявке, может быть встроена в любую из различных существующих конструкций вектора экспрессии в качестве рекомбинантной экспрессионной конструкции для экспрессии полипептида НЕ4а. Такие векторы и конструкции включают последовательности хромосомной, нехромосомной и синтетической ДНК, например, производные SV40; бактериальные плазмиды, фаговую ДНК; бакуловирусы; дрожжевые плазмиды; векторы, происходящие из комбинаций плазмид и фаговой ДНК, вирусной ДНК, такой как ДНК вируса коровьей оспы, аденовируса, вируса оспы птиц и инфекционного бульбарного паралича. Однако любой другой вектор может быть использован для создания рекомбинантной конструкции экспрессии при условии, что он является реплицируемым и жизнеспособным в хозяине.

[00100] Подходящую последовательность (или последовательности) ДНК можно встроить в вектор с помощью любой из различных процедур. Обычно последовательность ДНК встраивают в соответствующий сайт рестрикции (или сайты) эндонуклеазой с использованием процедур, известных в данной области техники. Стандартные методики клонирования, выделения ДНК, амплификации и очистки, ферментативных реакций, включающих ДНК-лигазу, ДНК-полиперазу, рестрикционные эндонуклеазы и т.п., и различные методики разделения известны и широко применяются специалистами в данной области техники. Может применяться любая одна или несколько методик из числа известных стандартных методик.

[00101] Последовательность ДНК в векторе экспрессии функционально связана с по меньшей мере одной соответствующей последовательностью контроля экспрессии (например, промотором или регулируемым промотором) для направления синтеза мРНК. Репрезентативные примеры таких последовательностей контроля экспрессии включают LTR или промотор SV40, Е. coli lac или trp, промотор PL фага лямбда и другие промоторы, которые, как известно, контролируют экспрессию генов в прокариотических и эукариотических клетках или в их вирусах. Области промоторов могут быть выбраны из любого желаемого гена, с использованием САТ-векторов (векторов на основе хлорамфеникол трансферазы) или других векторов с селективными маркерами. Двумя подходящими векторами являются рКК232-8 и рСМ7. Отдельно названные бактериальные промоторы включают lac, lacZ, Т3, Т7, gpt, PR лямбда, PL и trp. Эукариотические промоторы включают самый ранний промотор цитомегаловируса CMV, тимидинкиназу HSV, ранний и поздний SV40, LTR ретровирусов, и металлотионеин-1 мыши. Выбор подходящих вектора и промотора находится в пределах обычной квалификации в данной области техники, и создание особенно предпочтительных рекомбинантных конструкций, включающих, по крайней мере один промотор или регулируемый промотор, функционально связанный с нуклеиновой кислотой, кодирующей полипептид НЕ4а, описано в настоящей заявке.

[00102] Как отмечено выше, в определенных вариантах реализации вектор может представлять собой вирусный вектор, такой как ретровирусный вектор. Например, ретровирусы, из которых могут происходить плазмидные ретровирусные векторы включают, но не ограничиваются перечисленными: вирус мышиного лейкоза Молони, вирус некроза селезенки, ретровирусы, такие как вирус саркомы Рауса, вирус саркомы Харви, вирус лейкоза птиц, вирус лейкоза гиббонов, вирус иммунодефицита человека, аденовирус, миелопролиферативный вирус саркомы и вирус опухоли молочной железы.

[00103] Вирусный вектор включает один промотор или более. Подходящие промоторы, которые могут применяться, включают, но не ограничиваются перечисленными: ретровирусные LTR; промотор SV40; и промотор цитомегаловируса человека (CMV), описанный Miller, et al., Biotechniques 7:980-990 (1989), или любой другой промотор (например, клеточные промоторы, такие как эукариотические клеточные промоторы, включая, но не ограничиваясь перечисленными: промоторы гистона, pol III и рβ-актина). Другие вирусные промоторы, которые могут быть использованы, включают, но не ограничиваются перечисленными: промоторы аденовируса, димидин киназы (TK) и промотор парвовируса В 19. Выбор подходящего промотора будет очевиден для специалиста в данной области техники из пояснений, содержащихся в настоящей заявке; и промоторы могут представлять собой, среди прочего, регулируемые промоторы или промоторы, описанные в настоящей заявке.

[00104] Ретровирусные плазмидные векторы применяют для трансдукции пакующих клеточных линий с получением продуцирующих клеточных линий. Примеры пакующих клеточных линий, которые могут подвергаться трансфекции, включают, но не ограничиваются перечисленными: клеточные линии РЕ501, РАЗ 17, ψ-2, ψ-АМ, РА12, Т19-14Х, VT-19-17-H2, ψCRE, ψCRIP, GP+E-86, GP+envAm12, и DAN, которые описаны в статье Miller, Human Gene Therapy, 1:5-14 (1990), которая включена в настоящую заявку посредством ссылки во всей полноте. Вектор может трансдуцировать пакующие клетки любым способом, известным в данной области техники. Такие способы включают, но не ограничиваются перечисленными: электропорацию, использование липосом и кальцийфосфатную преципитацию. В одном альтернативном варианте ретровирусный плазмидный вектор может быть инкапсулирован в липосому или объединен с липидом, и затем введен хозяину.

[00105] Линия клеток-продуцентов образует инфекционные ретровирусные частицы, которые содержат последовательность (или последовательности) нуклеиновой кислоты, кодирующей полипептиды НЕ4а или слитые белки НЕ4а. Такие ретровирусные векторные частицы могут затем быть применены для трансдукции эукариотических клеток либо in vitro, либо in vivo. Трансдуцированные эукариотические клетки будут экспрессировать последовательность (или последовательности) нуклеиновой кислоты, кодирующей полипептид НЕ4а или слитый белок НЕ4а. Эукариотические клетки, которые могут быть трансдуцированы, включают но, не ограничиваются перечисленными: эмбриональные стволовые клетки, эмбриональные клетки карциномы, а также гематопоэтические стволовые клетки, гепатоциты, фибробласты, миобласты, кератиноциты, эндотелиальные клетки, клетки бронхиального эпителия и различные другие адаптированные к культуре клеточные линии.

[00106] В другом примере варианта реализации настоящего изобретения вирусный вектор применяют для приготовления рекомбинантной конструкции, экспрессирующей НЕ4а; в одном предпочтительном варианте реализации клетки-хозяева трансдуцированы рекомбинантной вирусной конструкцией, направляющей экспрессию полипептидов НЕ4а или слитых белков НЕ4а, и могут образовывать вирусные частицы, содержащие экспрессированные полипептиды НЕ4а или слитые белки НЕ4а, которые происходят из частей мембраны клетки-хозяина, включенных в вирусные частицы во время отпочковывания вируса. В другом предпочтительном варианте реализации последовательности нуклеиновой кислоты, кодирующие НЕ4а, клонируют в бифункциональный бакуловирусный вектор, который затем рекомбинируют с бакуловирусом с получением рекомбинантной бакуловирусной экспрессирующей конструкции, которая используется для инфицирования, например, клеток-хозяев Sf9, как описано в Baculovirus Expression Protocols, Methods in Molecular Biology Vol.39, С.D. Richardson, Editor, Human Press, Totowa, N.J., 1995; Piwnica-Worms, "Expression of Proteins in Insect Cells Using Baculoviral Vectors," Секция II в Главе 16 в: Short Protocols in Molecular Biology, 2nd Ed., Ausubel et al., eds., John Wiley & Sons, New York, N.Y., 1992, страницы с 16-32 по 1648.

[00107] В другом аспекте настоящее изобретение относится к клеткам-хозяевам, содержащим описанную выше рекомбинантную конструкцию, экспрессирующую НЕ4а. Клетки-хозяева представляют собой клетки, полученные методом генетической инженерии (трансдукции, трансформации или трансфекции) векторами и/или экспрессионными конструкциями согласно настоящему изобретению, которые могут представлять собой, например, клонирующий вектор, бифункциональный вектор или экспрессионную конструкцию. Вектор или конструкция могут быть, например, в форме плазмиды, вирусной частицы, фага и т.п. Генно-инженерные клетки-хозяева могут культивироваться в соответствующей питательной среде, модифицированной, как необходимо для активации промоторов, отбора трансформантов или амплифицирования конкретных генов, таких как гены, кодирующие полипептиды НЕ4а или слитые белки НЕ4а. Условия культивирования для конкретных клеток-хозяев, выбранного для экспрессии, такие как температура, рН и тому подобное, будут очевидными для специалиста в данной области техники.

[00108] Клетка-хозяин может представлять собой клетку высшего эукариота, такую как клетка млекопитающего, или клетку низшего эукариота, такую как клетка дрожжей, или клетка-хозяин может представлять собой прокариотическую клетку, такую как клетка бактерии. Репрезентативные примеры подходящих клеток-хозяев в соответствии с настоящим изобретением включают, но не обязательно ограничиваются перечисленными: бактериальные клетки, такие как Е. coli, Streptomyces, Salmonella typhimurium; клетки грибов, такие как дрожжи; клетки насекомых, такие как Drosophila 52 и Spodoptera Sj9; клетки животных, такие как СНО, COS или клетки 293; аденовирусы; клетки растений или любую подходящую клетку, уже адаптированную к культивированию in vitro или полученную de novo. Предполагается, что выбор подходящего хозяина находится в пределах объема знаний специалистов в данной области техники, и может быть сделан на основании информации, приведенной в настоящей заявке.

[00109] Различные системы культур клеток млекопитающих также могут быть применены для экспрессии рекомбинантного белка. Изобретение, таким образом, частично относится к способу получения рекомбинантного полипептида НЕ4а путем культивирования клетки-хозяина, содержащей рекомбинантную экспрессионную конструкцию, которая включает по меньшей мере один промотор, функционально связанный с последовательностью нуклеиновой кислоты, кодирующей НЕ4а. В некоторых вариантах реализации промотор может представлять собой регулируемый промотор, описанный в настоящей заявке, например, тетрациклин-репрессируемый промотор. В некоторых вариантах реализации рекомбинантная экспрессионная конструкция представляет собой рекомбинантную вирусную экспрессионную конструкцию, описанную в настоящей заявке. Примеры экспрессионных систем млекопитающих включают линии фибробластов почек обезьян COS-7, описанные в Gluzman Y. SV40-transformed simian cells support the replication of early SV40 mutants. Cell. 1981 Jan; 23(I): 175-82, и другие линии клеток, способные экспрессировать совместимый вектор, например, клеточные линии С 127, 3Т3, СНО, HeLa и ВНК. Векторы экспрессии млекопитающих содержат точку начала репликации, подходящие промотор и энхансер, а также любой из необходимых сайтов связывания с рибосомой, сайт полиаденилирования, акцепторный и донорный сайты сплайсинга, последовательности терминации транскрипции, и 5'-фланкирующие нетранскрибируемые последовательности, например, как описано в настоящей заявке в отношении создания экспрессирующей конструкции MRA. Последовательности ДНК, происходящие, например, из сплайс-сайтов и сайтов полиаденилирования SV40, могут быть использованы для получения необходимых нетранскрибируемых генетических элементов. Введение конструкции в клетку-хозяина может быть осуществлено с помощью разнообразия методов, с которыми хорошо знакомы специалисты в данной области техники, включая, но не ограничиваясь ими: например, кальцийфосфатную трансфекцию, DEAE-декстран опосредованную трансфекцию или электропорацию (Davis, L.G., Dibner, M.D. and Battey, J.F.: Basic Methods in. Molecular Biology. Elsevier, New York, 1986).

[00110] Экспрессируемые рекомбинантные антигенные полипептиды НЕ4а (или полипептиды НЕ4а), или слитые белки, являющиеся их производными, могут быть полезны в качестве иммуногенов в форме интактных клеток-хозяев, интактных огранелл, таких как мембраны, внутриклеточные пузырьки, или других клеточных органелл; или разрушенных клеточных препаратов, включающих, но не ограничивающихся перечисленными: клеточные гомогенаты или лизаты, одно- и многослойные мембранные пузырьки или другие препараты. Кроме того, экспрессированные рекомбинантные антигенные полипептиды или слитые белки могут быть выделены и очищены из рекомбинантных культур клеток с помощью методов, включающих преципитацию сульфатом аммония или этанолом, кислотную экстракцию, анион- или катионобменную хроматографию, фосфоцеллюлозную хроматографию, хроматографию гидрофобных взаимодействий, аффинную хроматографию, включая иммуноаффинную хроматографию, гидроксилапатитную хроматографию и лектиновую хроматографию. При необходимости могут быть использованы стадии рефолдинга белка для завершения формирования структуры родительского белка. Наконец, на этапе конечной очистки может быть применена высокоэффективная жидкостная хроматография (ВЭЖХ). Экспрессированные рекомбинантные антигенные полипептиды НЕ4а (или полипептиды НЕ4а) или слитые белки могут также использоваться в качестве целевых антигенов в любом из множества вариантов анализа для скрининга антител в текущем режиме, который может быть легко осуществлен при наличии обычных знаний в данной области техники.

[00111] Антигенный полипептид НЕ4а (или полипептид НЕ4а), который является иммуногеном для продукции специфичных антител для применения в способе согласно настоящему изобретению, может, таким образом, быть природным очищенным продуктом, или быть продуктом, полученным в результате применения процедур химического синтеза, или быть полученным с помощью рекомбинантных методик из прокариотического или, предпочтительнее, эукариотического хозяина. В зависимости от применяемого в процедуре рекомбинантного получения хозяина, полипептиды согласно настоящему изобретению могут быть гликозилированы или иным образом посттрансляционно модифицированы, как известно в данной области техники и предложено в настоящей заявке.

[00112] Ниже объект настоящего описания изобретения описан со ссылками на Примеры. Эти Примеры приведены исключительно с целью иллюстрации, и объект не ограничивается этими Примерами, но включает все варианты, которые очевидны из пояснений, представленных в настоящей заявке.

[00113] ПРИМЕРЫ

[00114] До экспериментов, описанных в настоящей заявке, не было опубликовано протоколов, которые позволяли бы проводить оптимальные измерения домена N-WFDC в НЕ4а в образце, полученном от субъекта, с использованием иммуноцитохимического (ИЦХ) формата анализа. Аспекты и варианты реализации настоящего изобретения основаны на неожиданно обнаруженном факте, что моноклональные антитела 12А2 и 14Е2 обладают удивительными и неожиданными ценностью и эффективностью при применении одновременно или в комбинации для оценки присутствия полноразмерного НЕ4/НЕ4а.

[00115] В экспериментах, описанных в настоящей заявке, был изучен ряд факторов, которые привели к неожиданно возросшей/потенцированной эффективности. Например, было определено, что благодаря применению антител 12А2/14Е2 в определенных комбинациях с 2H5/3D8, может быть достигнуто более специфичное распознавание полноразмерного НЕ4 и более специфичные профили связывания. Дополнительно было определено, что в анализе НЕ4 в исследуемых образцах рака яичников (включая образцы с полноразмерным НЕ4), применение антител 12А2 или 14Е2 в комбинации с 2Н5 или 3D8 в типичном диагностическом анализе, включая ИГХ, полученные в результате соответствующие клинические данные и/или корреляция болезни демонстрируют неожиданный сниженный фон и/или удивительно улучшенное разрешение в получении профилей НЕ4.

[00116] В качестве примера были получены рекомбинантные слитые белки НЕ4 для иммунизации при продукции моноклональных AT против НЕ4.

[00117] ПРИМЕР 1

[00118] Получение рекомбинантных полноразмерных литых белков HE4ahIg/mIg, HE4a-V4HIg/mIg и HE4a-V2-hIg/mIg: амплификация кДНК НЕ4а (WFDC2) кДНК НЕ4а из высокопроизводительного клона для создания слитой конструкции.

[00119] Ген НЕ4а (WDFC2) объединяли с генами, кодирующими IgG, для конструирования слитых белков для иммунизации мыши и получения моноклональных антител (MAT). Мышей иммунизировали слитыми белками с «хвостом» Ig мыши, и проводили скрининг гибридом против слитых белков с «хвостом» Ig человека. Затем был разработан двухдетерминантный («сэндвич») твердофазный анализ (ELISA).

[00120] Последовательность мРНК для НЕ4а, изначально опубликованная Kirchoffet al. (15, 22) и депонированная в GenBank (учетный номер Х63 187), стала основой для олигонуклеотидного праймера, разработанного для клонирования кДНК, кодирующей НЕ4а. Для клонирования кДНК НЕ4а выделяли РНК из опухолей яичников, нормального эпидидимиса и из определенных клеточных линий опухолей яичников, включая 4007 и OVCAR3 (24), используя TRIzol (Life Technologies, Inc., Гейтерсберг, Мэриленд) в соответствии с инструкцией производителя. кДНК получали, используя 1-3 мкг РНК, случайные гексамеры и обратную транскриптазу Superscript II Reverse Transcriptase (Life Technologies, Inc.) в соответствии с указаниями производителя. кДНК НЕ4а амплифицировали с помощью ПЦР со случайным образом праймированной кДНК, используя стандартные условия. Были получены ПЦР-продукты ожидаемого размера, соответствующие полноразмерному НЕ4а, который затем клонировали. Анализ последовательности выявил различия в сравнении с последовательностью, опубликованной Kirchoff et al., и откорректированная последовательность НЕ4а, депонированная в GenBank (учетный номер AY212888), была использована для конструирования гибридных белков. Фрагмента кДНК с подтвержденной последовательностью, содержащий полноразмерный ген НЕ4а, клонировали в pSPORT, и ДНК плазмиды использовали как ПЦР-шаблон для конструирования слитых клонов.

[00121] Были сконструированы слитые белки, которые включали полный продукт гена НЕ4а, связанный с Fc-доменом IgG человека или мыши. Были разработаны праймеры, кодирующие соответствующие сайты рестрикции для клонирования и создающие необходимые внутрирамочные слияния доменов белков для конечной конструкции. 5' праймер (SEQ ID NO:2; 5'-GTTGTTAAGCTTGCCGCCATGCCTGCTTGTCGCCTAGGC-3'), включал сайт HindIII, последовательность Козака для улучшения экспрессии, присоединенную к первому ATG, и часть лидерного пептида НЕ4а, основанного на последовательности НЕ4а. 3' праймер (SEQ ID NO:4; 5'-GTTGTTGGAT CCGAAATTGGGAGTGACACAGGACAC-3') включал внутрирамочный сайт BamHI для слияния Ig-«хвоста» кДНК мыши/человека с 3'-концом последовательности, кодирующей НЕ4а, усеченной только до стоп-кодона. Реакции ПЦР-амплификации осуществляли в соответствии с инструкцией производителя (ExTaq; Takara Bio, Inc., Отсу, Шига, Япония), используя в качестве шаблона 100 нг плазмиды HE4a/pSPORT и 30 циклов амплификации (1 мин. при 94°С, 1 мин. при 55°С и 30 с при 72°С). ПЦР-продукты ожидаемого размера (400 п.н.), соответствующего полноразмерному НЕ4а, были получены и затем очищены, используя набор QIAquick PCR Purification Kit (Qiagen, Валенсия, Калифорния). Очищенные ПЦР-фрагменты были рестрицкионно расщеплены, очищены с использованием набора QIAEx II Gel Extraction Kit (Qiagen) и лигированы в слиянии с IgG2a Fc мыши (mIgG2a) и IgG1Fc человека (hIgG1) в экспрессионный вектор млекопитающего pD18, производный pCDNA 3, как было описано ранее. Фигура 1 схематически демонстрирует, как кДНК конструкции FL HE4a-mIgG2a и FL HE4a-hIgG1 были вставлены в виде фрагмента HindIII-XbaI в сайт множественного клонирования pD18.

[00122] Продукты лигирования трансформировали в бактериальные клетки DH5a, и осуществляли скрининг трансформантов на присутствие вставок слитых генов FL НЕ4а-mIgG2a и FL HE4a-hIgG1, что было подтверждено анализом последовательности. В дополнение, экспрессию белка подтверждали с использованием ДНК-плазмиды из этих изолянтов для случайной трансфекции клеток COS7 с применением описанной методики DEAE-декстран. Супернатанты культур собирали через 72 ч и проводили их скрининг с помощью иммунопреципитации с белком агарозой (Repligen, Кембридж, Массачусетс), редуцирующего электрофореза в ПААГ в присутствии додецилсульфата натрия (SDS-ПААГ) и Вестерн блота. Вестерн блот проводили, используя козьи античеловеческие IgG, конъюгированные с пероксидазой хрена (Caltag, Бурлингейм, Калифорния) в соотношении 1:5000, с последующим усиленным развитием хемилюминисценции (Amersham, Литл Чалфонт, Великобритания). ДНК плазмиды с подтвержденной последовательностью гена НЕ4а, слитого с «хвостом» IgGI Fc человека (плазмида pD18-HE4a-hIgG), была использована в качестве шаблона для амплификации и клонирования сплайс-вариантов НЕ4а, HE4a-V4 и HE4a-V2, описанных в публикации Bingle et al (Bingle L., Singleton V., Bingle C.D. The putative ovarian tumour marker gene HE4 (WFDC2), is expressed in normal tissues and undergoes complex alternative splicing to yield multiple protein isoforms. Oncogene, 21: 2768-2773, 2002). HE4a-V4 и HE4a-V2 сплайс-варианты были клонированы в слиянии с мышиным и человеческим Fc IgG, как было описано выше для полноразмерного НЕ4а. Нуклеотидные праймеры, использованные для амплификации, приведены ниже.

[00123] Для HE4a-V4:

[00124] Прямой праймер SEQ ID NO:21

5'-GTTGTTACCGGTGCAGCAGAGAAGACTGGCGTGTGCCCC-3'

[00125] Обратный праймер SEQ ID NO:23

5'-AATCTCCCAGAGCCTCCGTGTCTTTAGGTGCCAGTGGAACAGTGCATTGGGCAGAGAGCA-3'

[00126] Для HE4a-V2:

[00127] Прямой праймер SEQ ID NO:25

5'-GTTGTTACCGGTGCAAAGGAGGGTTCCTGCCCCCAG-3'

[00128] Обратный праймер: SEQ ID NO:27

5'-GTTGTTGGATCCGAAATTGGGAGTGACACAGGA-3'

[00129] Получение слитых белков HE4aIg.

[00130] Были созданы стабильные клеточные линии с кДНК конструкциями полноразмерных HE4a-mIgG2a и HE4a-hIgG1 и соответствующие конструкции для сплайс-вариантов HE4a-V4 и HE4a-V2. Для создания стабильных линий, экспрессирующих высокие уровни интересующих слитых белков, использовали клетки CHO-DG44. Стабильные линии СНО были созданы путем высококопийной электропорации плазмидных конструкций и отбора метотрексат-резистентных клонов путем предельного разведения в среде Excell 302 СНО (JRH Biosciences, Денвер, Пенсильвания), содержащей рекомбинантный инсулин (Life Technologies, Inc.), пируват натрия (Invitrogen Corp., Карлсбад, Калифорния), L-глутамин (Invitrogen Corp.), 2X заменимые аминокислоты (Invitrogen Corp.) и 100 нМ метотрексата (Sigma, Сент Луис, Миссури). Супернатанты культуры из резистентных клонов затем анализировали методом IgG твердофазного «сэндвич» ИФА для скрининга и поиска высокопродуктивных линий. Собирали использованные супернатанты с культур большого масштаба, и очищали слитые белки IgG с помощью аффинной хроматографии на основе белка А, после чего каждый из слитых белков проверяли методом Вестерн блота (данные не приведены). Слитый белок HE4a-hIgG1 мигрировал с молекулярной массой, в среднем, Mw 48000 на восстанавливающем геле или в Вестерн блоте, что превышает ожидаемую массу Mr 36000, рассчитанную на основании расшифрованной аминокислотной последовательности, что подтверждает факт того, что молекула является гликозилированной. Стабильные трансфектанты использовали для продукции достаточного количества белка для иммунизации мышей BALB/c.

[00131] В качестве примера, были разработаны гибридомы и моноклональные антитела, специфичные к домену N-WFDC в НЕ4а.

[00132] ПРИМЕР 2

[00133] Получение гибридом и моноклональных антител, специфичных к домену N-WFDC в НЕ4а

[00134] Мышей BALB/с иммунизировали каждые две недели, 5 раз, вводя HE4a-V4 mIgG, и шесть раз, вводя FL НЕ4а. Через три дня после последней иммунизации мышей умерщвляли и создавали гибридомы, как ранее было описано для мезотелина. Проводили скрининг супернатантов гибридом с HE4a-V4 hIgG, гибридомы 12А2 и 14Е2 были выбраны на основе их способности взаимодействовать с HE4a-V4 hIgG. Гибридомы дважды клонировали в соответствии со стандартными процедурами, и выбранные клоны использовали для продукции MAT к N-WFDC в НЕ4а. Моноклональные антитела получали путем культивирования клонов гибридомы in vitro путем инокуляции 104 клеток/мл в среде DMEM, содержащей 5% фетальной телячьей сыворотки, во вращающихся колбах и выращивания в течение 10-14 дней. Моноклональные антитела затем очищали от культуральной среды с помощью аффинной хроматографии с белком А в соответствии с рекомендациями производителя.

[00135] Пример 3. Характеристика специфичности связывания MAT против домена N-WFDC в НЕ4а

[00136] 3.1 Способность к взаимодействию (реакции) со слитыми белками hIgG НЕ4а

[00137] Затем изучали сспецифичность MAT 12A2 и 14Е2 в анализе методом твердофазного ИФА с использованием слитых белков FL НЕ4а, HE4a-V4 и HE4a-V2 hIgG. Лунки планшетов для микротитрования покрывали MAT 12A2 и 14Е2 путем инкубации MAT (10 мкг/мл) в карбонатно-бикарбонатном буфере (С-3041; Sigma). После удаления супернатанта, лунки блокировали в течение 2 ч при комнатной температуре с помощью 200 мкл/лунку блокирующего буфера GSC (Genetic Systems, Сиэтл). После этого следовали 4 промывки ФБР, содержащим 0,1 Твин, по 200 мкл/лунку.

[00138] Лунки, покрытые MAT, затем инкубировали со 100 мкг/лунку FL НЕ4а, HE4a-V4 и HE4a-V2 в течение 2 ч. Связавшийся слитый белок HIgG НЕ4а затем определяли путем инкубации с Анти-hIgG1, конъюгированными с пероксидазой хрена (ПХ), и определения оптической плотности при 450 нм.

[00139] MAT 12A2 и 14Е2 реагировали с полноразмерным НЕ4а и HE-V4, что указывает на специфичность к домену N-WFDC в НЕ4а, Фигура 2.

[00140] Специфичность MAT 3D8 и 2Н5, как MAT сравнения, также исследовали, используя ту же методику. Фигура 3.

[00141] 3.2 Способность взаимодействовать с доменами НЕ4а белков дисплее слитых фаговых белков

[00142] Специфичность MAT 12A2 и 14Е2 к домену N-WFDC в НЕ4а была также подтверждена с помощью исследования способность реагировать с доменом N-WFDC в НЕ4а и к домену C-WFDC в НЕ4а, экспрессированных в слитых белках с фаговым белком оболочки pVIII в фаговом ELISA.

[00143] кДНК, полученную из мРНК, выделенной из клеток OvCar-3, использовали в качестве шаблона для ПЦР-амплификации частей гена, кодирующих С- и N-концевые области WFDC, для клонирования в векторе f88-4 для фагового дисплея. Пары ПЦР праймеров, перечисленные в Таблице 2, были сконструированы для амплификации кодирующих областей аминокислотных остатков 31-75 (N-WFDC) и 76-124 (C-WFDC), соответственно. На 5'-концах находились сайты рестрикции для HindIII и PstI, вставленные для клонирования в слиянии с сигнальным пептидом pVIII и зрелым белком оболочки pVIII.

[00144] Области WFDC были отдельно амплифицированы из 0,5 мкл кДНК в реакционной смеси, содержащей 1 мкМ каждого прямого или обратного праймера, 75 мМ Трис-HCl (рН 8,8 при 25°С), 20 мМ (NH4)2SO4, 0,1% (об/об) Твин 20, 2 мМ MgCl2, 0,02 Ед/мкл Taq-полимеразы (Abgene, Суррей, Великобритания) и 0,1 мМ каждого дезоксинуклеотида в конечном объеме 25 мкл со следующими температурными циклами, повторяющимися 30 раз: 30 секунд инкубации при 95°С, 50°С и 72°С.

[00145] ПЦР-продукты и f88-4, расщепленные с помощью HindIII и PstI, лигировали вместе и трансфицировали в Е. coli JM109, где затем клоны отбирали на чашках со средой LB с тетрациклином. По два клона из каждой конструкции амплифицировали в Е. coli JM109, и полученную двухчепочечную ДНК использовали для секвенирования ДНК. Секвенирование ДНК осуществляли, используя набор для циклического сиквенса Big dye terminator v1.1 cycle sequencing kit и праймер, специфичный к вектору f88-4. Секвенирующие реакции отправляли в CyberGene AB (Huddinge, Швеция) для анализа. Первичные данные секвенирования анализировали, используя находящееся в свободном доступе программное обеспечение Chromas, версия 1.45 (Technelysium Pty Ltd., Австралия). Секвенирование нуклеотидов подтвердило вставку в рамке считывания с лидирующим пептидом и зрелым белком оболочки pVIII. Вставки НЕ4а демонстрировали идентичность с последовательностью НЕ4а (учетный номер AY212888), Фигура 4.

[00146] Фаговый твердофазный ИФА (ELISA)

[00147] Фаговые клоны с подтвержденной последовательностью были амплифицировали, очищали и концентрировали с помощью PEG/NaCl и разбавляли в 1% БСА в ФБР для применения в качестве антигена в фаговом ELISA. MAT 3D8 и 2Н5, разведенные до 1 мкг/мл в 1% БСА в ФБР, и MAT 12A2, в 100 мкл среды для клонирования, иммобилизовали в лунках (по 100 мкл/лунку), покрытых антимышиными IgG козы (Jackson Immuno Research). Планшеты закрывали и выдерживали в течение ночи при комнатной температуре. Лунки, покрытые MAT против НЕ4а, трижды промывали и добавляли фаговые частицы в объеме 100 мкл/лунку. Через 2 часа инкубации лунки промывали и добавляли анти-М13 антитела кролика (собственного производства). После инкубации и промывки добавляли меченные ПХ антикроличьи антитела свиньи (Dako). После конечной промывки добавляли субстрат ТМБ, и планшеты анализировали при 620 нм после 5 мин. инкубации, Фигура 5.

[00148] Исследования методом фагового ELISA с использованием доменов N-WFDC и C-WFDC, представленных в виде слитых белков с фаговым белком pVIII, и реактивность по отношению к слитым белкам HE4a-V2, HE4a-V4 и FL HE4a hIgG1 подтвердили, что MAT 12А2 и 14Е2 являются специфичными к домену N-WFDC в HE4a.

[00149] 3.3 Исследование эпитопов, распознаваемых MAT 12A2 и 14Е2

[00150] Тип эпитопов, распознаваемых MAT 12A2 и 14Е2, т.е. являются ли эти эпитопы линейными или конформационно-зависимыми, определяли с помощью исследования реактивности антител по отношению к денатурированным и восстановленным антигенам HE4a. Истощенную среду из стабильной клеточной линии, продуцирующей полноразмерный HE4a-hIgG1, неразведенную и разведенную в пять раз, денатурировали при 70°С и разделяли методом SDS-ПААГ в восстанавливающих условиях. Белки переносили методом блота на мембрану PVDF в соответствии со стандартной методикой. После инкубации мембраны с первичными антителами против HE4a связавшиеся антитела были определены с помощью анти-мышиных антител свиньи, меченных ПХ (Dako). Меченные ПХ антитела определяли по хемилюминисценции, используя системы определения Amersham™ ECL™.

[00151] MAT 12A2 не демонстрировало реактивности против денатурированного и восстановленного антигена HE4a (данные не представлены), демонстрируя тем самым, что антитело распознает конформационно-зависимый эпитоп. MAT 14Е2, напротив, демонстрировало специфическое окрашивание в полосе приблизительно 48 кДа, что соответствует ожидаемому размеру гибридизованной молекулы гликозилированного HE4a-hIgGl. В дорожке с более высокой концентрацией антигена наблюдалась полоса более, чем в два раза большего размера. Эта полоса, скорее всего, соответствует димеру антигена, в котором дисульфидные связи в Fc-части не были полностью разрушены. Данные Вестерн блота, свидетельствующие, что MAT 14Е2 распознает линейный эпитоп, приведены на Фигуре 6.

[00152] 3.4 Независимые эпитопы созданных антител, специфичных к N-WFDC в НЕ4

[00153] Разница в реактивности MAT 12A2 и 14Е2 по отношению к денатурированным и восстановленным антигенам HE4a указывает на то, что эти два антитела распознают два независимых эпитопа домена N-WFDC в HE4a.

[00154] Распознавание MAT 12A2 и 14Е2 независимых эпитопов домена N-WFDC в HE4a было затем подтверждено с помощью комбинирования MAT 12A2 и 14Е2 в «сэндвич» варианте иммуноанализа. MAT 14E2 использовали в качестве иммобилизованного MAT в комбинации с MAT 12A2, меченным ПХ, в качестве детектирующего антитела, и получали кривые «доза-эффект» по отношению антигенов НЕ4а. MAT 14E2 в концентрированной среде гибридомы захватывали в микролунки, покрытые антимышиными антителами козы (Jackson ImmunoResearch Lab). После промывки добавляли 25 мкл антигена НЕ4а (0-900 пМ) из набора НЕ4а EIA kit (Fujirebio Diagnostics Inc), и затем добавляли MAT 12A2, меченные ПХ. В качестве контроля проводили параллельный эксперимент с MAT 14E2 на твердой фазе и меченным ПХ индикаторным MAT 3D8, использованным в ферментативном иимуноанализе (ФИА) НЕ4а. MAT 3D8, как известно, нацеливается на С-концевую WAP область и, таким образом, должно образовывать пару в «сэндвич» ФИА с MAT 14E2. После проведения этапов инкубации и промывки, добавляли субстрат ТМБ, и после этапа инкубации в течение 30 мин. анализировали абсорбцию при 620 нм. Оба MAT, 3D8 и 12A2, демонстрировали кривые доза-эффект с MAT 14E2, Фигура 7.

[00155] Положительная кривая доза-эффект иммуноанализа в модификации «сэндвич» MAT 12A2 и MAT 14E2, в дополнение к их различной реактивности к восстановленному антигену НЕ4а, доказала, что MAT 14E2 и MAT 12A2 распознают независимые эпитопы, специфичные домену N-WFDC в НЕ4а.

[00156] Также были разработаны варианты иммуноанализа, специфичные к полноразмерному НЕ4а.

[00157] ПРИМЕР 4

[00158] Постановка иммуноанализа, специфичного к полноразмерному НЕ4а

[00159] Анализы, специфичные к полноразмерному НЕ4а (FL НЕ4а), были разработаны, используя антитела, специфичные к доменам N-WFDC и C-WFDC.

[00160] В одном аспекте изобретения антитела, специфичные к домену N-WFDC в НЕ4а, объединяли с антителами, специфичными к домену C-WFDC в НЕ4а, чтобы разработать методику иммуноанализа, специфичного к полноразмерному НЕ4а, если возникнет проблема с определением доменов N-WFDC в НЕ4а или C-WFDC вНЕ4а, или вариантов HE4a-V4 или HE4a-V2.

[00161] В первоначальном эксперименте MAT 12A2 и MAT 14E2 в соответствии с настоящим изобретением и MAT 3D8, реактивное по отношению к домену C-WFDC в НЕ4а (Hellstrom et al; The HE4 (WFDC2) Protein Is a Biomarker for Ovarian Carcinoma; Cancer Res July 1, 2003 63; 3695) использовали в качестве захватывающих антител в «сэндвич» варианте анализа, используя MAT 2H5, реактивное по отношению к домену C-WFDC в НЕ4а, в качестве детектирующего антитела. В «сэндвич» варианте анализа различные иммобилизованные MAT иммобилизировали в лунках планшета для микротитрования, используя процедуру, аналогичную описанной в Примере 2, и инкубировали со слитыми белками hIgFc с FL НЕ4а, доменами HE4a-V4 и HE4a-V2. Связавшиеся белки НЕ4а затем определяли путем инкубации с биотинилированными MAT 2H5 с последующей инкубацией со стрептавидин-ПХ и определением оптической плотности при 450 нм после инкубации с о-фенилендиамином, субстратом ПХ. «Сэндвич» вариант анализа продемонстрировал, что комбинация MAT 12A2 или MAT 14E2 с MAT 2H5 обнаруживала только полноразмерный слитый белок FL НЕ4а, тогда как комбинация MAT 3D8 и MAT 2H5 обнаруживала как полноразмерный FL НЕ4а, так и вариант HE4a.V2, Фигура 8.

[00162] В предпочтительной конфигурации постановки иммуноанализа, специфичного к FL HE4, MAT 2H5 использовали в качестве иммобилизованного антитела, и MAT 12A2 использовали в качестве детектирующего антитела. MAT 2H5 биотинилировали с помощью биотин-NHRS эфира капроновой кислоты, Sigma Chemical Co, США, применяя стандартные процедуры, и использовали в качестве иммобилизованного антитела. MAT 12A2 конъюгировали с ПХ в соответствии с модификацией процедуры Nakone. Биотинилированное MAT 2H5 и MAT 12A2, конъюгированное с ПХ, использовали в одноэтапном ФИА в соответствии со следующим протоколом.

[00163] Процедура анализа:

[00164] Прибавить 25 мкл рекомбинантного антигена FL HE4a-hIgG (0-1000 пМ в ФБР, 60 г/л БСА, рН 7,2) + 100 мкл MAT 2Н5-Биотин, 1 мкг/мл и ПХ MAT 12A2, 1 мкг/мл в буфере для анализа в планшетах для микротитрования, покрытых стрептавидином, Kaivogen Оу, Турку, Финляндия.

[00165] 2. Инкубировали в течение 1 ч±10 мин при перемешивании.

[00166] 3. Промывали 6 раз 5 мМ трисовым буфером, 0,05% Твин 40, рН 7,75.

[00167] 4. Добавляли 100 мкл ТМБ, Neogen, США.

[00168] 5. Инкубировали 30 мин. ±5 мин.

[00169] 6. Измеряли оптическую плотность при 620 нм на ридере ELISA.

[00170] Пример кривой доза-эффект, полученной с использованием НЕ4а -hIgG, разведенного для анализа в ФБР, 60 г/л БСА, показан на Фигуре 9. Чувствительность анализа составляла <5 пМ, что было существенно ниже уровня, определенного у здоровых субъектов. Таким образом, анализ будет подходящим для определения полноразмерного FL НЕ4а у здоровых объектов и у индивидуумов с раком яичников или подозрением на него.

[00171] Целью исследования была оценка пригодности новых MAT 12A2 путем оценки их свойств для оценки присутствия полноразмерногоНЕ4 в типичном формате анализа.

[00172] ПРИМЕР 5

[00173] Диагностика рака яичников с использованием иммуноанализа, специфичного к полноразмерному НЕ4а.

[00174] В одном аспекте изобретения антитела использовали для разработки иммуноанализа, направленного на серологическую диагностику рака яичников. Иммуноанализ FL НЕ4а, используя MAT 2H5 в комбинации с MAT 12A2, как описано в Примере 3, применяли для определения концентраций полноразмерного НЕ4а в образцах сыворотки здоровых индивидуумов, пациентов на начальных стадиях гинекологических заболеваний и пациентов, имеющих рак яичников.

[00175] Уровни FL НЕ4а были существенно выше у пациентов с раком яичников (р<0.001) в сравнении с пациентами на начальных стадиях гинекологических заболеваний или со здоровыми объектами. Таблица 3, Фигура 10.

[00176] Таблица 3. Уровень НЕ4а у здоровых объектов, индивидуумов на начальных стадиях гинекологических заболеваний и пациентов с раком яичников.

n НЕ4а, пМ 95% доверительный интервал Стандартная ошибка Стандартное отклонение
среднее
Здоровые 50 84 77 to 91 3,4 24,4
Начальные стадии гинекологических заболеваний 82 122 98 to 146 11,9 108,5
Рак яичников 25 2967 319 to 5614 1282,8 6413,8

[00177] Целью данного исследования была оценка пригодности нового MAT 12A2/формата анализа полноразмерного НЕ4 путем оценки их возможностей в определении и мониторинге клинического течения рака яичников.

[00178] ПРИМЕР 6

[00179] Мониторинг течения заболевания в случае рака яичников путем определения FL НЕ4а.

[00180] В другом аспекте настоящего изобретения иммуноанализ для определения FL НЕ4а в соответствии с Примером 3 использовали для отслеживания клинического течения заболевания у пациентов с диагностированным раком яичников.

[00181] Уровни FL НЕ4а у трех пациентов с раком яичников во время клинического течения заболевания показаны на Фигуре 11. Уровни FL НЕ4а, наблюдаемые во время клинического течения заболевания, являются пригодными для достижения полноты эффекта терапии рака яичников, также как для определения рецидива заболевания.

[00182] В качестве примера, целью исследования была оценка пригодности новых MAT 12A2/формата анализа полноразмерного НЕ4 в определении НЕ4а в образцах ткани.

[00183] ПРИМЕР 7

[00184] Диагностика рака яичников путем определения НЕ4а в срезах тканей

[00185] В дополнительном аспекте изобретения предложен способ диагностики рака яичников путем инкубации антител, специфичных к домену N-WFDC в НЕ4а, с тканями или клеткам, полученными от пациентов с подозрением на рак яичников, и определения связывания антител с тканями или клетками.

[00186] Наборы срезов тканей (Super Bio Chips) депарафинировали в соответствии с инструкцией производителя. Для демаскировки антигена срезы инкубировали в микроволновой печи в 10 мМ цитратном буфере, рН 6,0 в течение 10 мин. Эндогенную пероксидазу блокировали путем инкубации в 3% H2O2 в течение 5 мин. В предпочтительной конфигурации анализа срезы тканей инкубировали в течение 1 ч при комнатной температуре с MAT 12A2. Для визуализации связывания MAT 12A2 была использована система EnVision+System-HRP (Dako AS, Дания) в соответствии с инструкциями. Срезы контрастно окрашивали гематоксилином (Dako Cytomation), готовили из них препараты и анализировали с помощью микроскопии. Различные срезы рака яичников (Фигура 12A-D) были окрашены HaN-WFDC в НЕ4а, тогда как нераковые ткани были негативными (Фигура 12E-F).

[00187] Все патенты, публикации, научные статьи, веб-сайты и другие документы и материалы, на которых в настоящей заявке содержатся ссылки или упоминания, свидетельствуют об уровне специалистов в данной области техники, к которой относится настоящее изобретение, и каждый такой упоминаемый документ и материал включен в данное описание посредством ссылки в той же мере, как если бы он был в отдельности представлен в качестве ссылки во всей своей полноте, или был бы изложен в настоящей заявке во всей своей полноте. Заявители оставляют за собой право физически включать в это описание любые материалы и информацию из любых таких патентов, публикаций, научных статей, веб-сайтов, электронно доступной информации и других справочных материалов или документов.

[00188] Применяемые термины и выражения используются в качестве терминов для описания, а не ограничения, и использование таких терминов и выражений не имеет целью исключение любого эквивалента продемонстрированных и описанных признаков или их частей, следует учитывать, что возможны различные модификации в пределах заявленного объема изобретения. Таким образом, должно быть очевидно, что хотя настоящее изобретение было конкретно описано путем предпочтительных вариантов реализации и дополнительных функций, специалисты в данной области техники могут прибегать к модификации и изменению концепций, описанных в настоящей заявке, и такие модификации и изменения считаются входящими в рамки настоящего изобретения, как определено в прилагаемой формуле изобретения.

[00189] Настоящее изобретение в данном документе описано в широком и общем виде. Каждые из более узких видов и подклассов, входящих в общее раскрытие, также составляют часть настоящего изобретения. Данная заявка включает в себя общее описание изобретения с оговоркой или отрицательным ограничением удаления любого предмета из класса объектов, независимо от того, является ли удаленный материал конкретно указанным в настоящей заявке.

[00190] Другие варианты реализации находятся в рамках формулы изобретения. Кроме того, если признаки или аспекты изобретения описаны в терминах групп Маркуша, специалистам в данной области техники будет очевидно, что изобретение тем самым также описано в терминах любого отдельного элемента или подгруппы членов группы Маркуша.

1. Моноклональное антитело, продуцируемое линией клеток гибридомы 12А2, депонированной в ЕСАСС под депозитарным номером 10091401, при этом антитело специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а, представленной в SEQ ID NO: 17, причем антитело необязательно мечено детектируемым маркером.

2. Набор для диагностики рака яичников, содержащий антитело по п. 1.

3. Набор по п. 2, который дополнительно содержит антитело, которое специфично связывает домен C-WFDC полипептида НЕ4а, представленный в SEQ ID NO:19, причем антитело, которое специфично связывает домен C-WFDC полипептида НЕ4а, необязательно является детектируемо меченым.

4. Набор по п. 2, который содержит два антитела, которые специфично связывают различные эпитопы в домене N-WFDC полипептида НЕ4а.

5. Способ скрининга наличия рака яичников у субъекта или диагностики у субъекта рака яичников, включающий:

(a) контактирование биологического образца, полученного от субъекта, с моноклональным антителом, продуцируемым линией клеток гибридомы 12А2, депонированной в ЕСАСС под депозитарным номером 10091401, при этом антитело специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а, представленной в SEQ ID NO: 17, и при этом образец контактирует в условиях и в течение времени, достаточных для определения связывания антитела с полипептидом НЕ4а; и

(b) определение рака яичников или диагностику у субъекта рака яичников, где биологический образец содержит полипептид НЕ4а, который специфично связывается антителом.

6. Способ по п. 5, дополнительно включающий контактирование биологического образца, полученного от субъекта, со вторым антителом, при этом второе антитело специфично связывает домен C-WFDC антигенного полипептида НЕ4а.

7. Способ по п. 5 или 6, в котором полипептид НЕ4а в норме присутствует в растворимой форме и образец содержит кровь, сыворотку, серозную жидкость, плазму, лимфу, мочу, спинномозговую жидкость, слюну, секрет слизистых, вагинальный секрет, кондиционированную культуральную среду или лаважную жидкость.

8. Способ по п. 5 или 6, в котором по меньшей мере одно антитело иммобилизовано на твердой подложке.

9. Способ по п. 8, который имеет конфигурацию анализа «сэндвич» с использованием двух антител.

10. Способ по п. 5 или 6, в котором субъект подвергается лечению рака яичников и способ осуществляют с целью мониторинга течения заболевания.



 

Похожие патенты:

Настоящее изобретение относится к области биотехнологии, конкретно к эпитопам рецептора эпидермального фактора роста (EGFR), и может быть использовано в медицине для лечения злокачественного новообразования, связанного с активацией EGFR.

Настоящая группа объектов изобретения относится к области иммунологии. Предложено антитело, которое специфически связывает B7-H7CR человека, и его антигенсвязывающий фрагмент.

Изобретение относится к области медицины, в частности к онкологии, и предназначено для диагностики метастазов рака толстой кишки. Из тканевых проб толстой кишки выделяют тотальную ДНК.

Изобретение относится к области медицины, в частности к онкологии, и предназначено для диагностики метастазов рака толстой кишки. Из тканевых проб толстой кишки выделяют тотальную ДНК.

Изобретение относится к области медицины, в частности к онкологии и молекулярной биологии, и может быть использовано для дифференциальной диагностики рака предстательной железы (РПЖ) и доброкачественной гиперплазии предстательной железы (ДГПЖ).

Настоящее изобретение относится к области медицины, в частности к онкологии и молекулярной биологии, и может быть использовано для дифференциальной диагностики рака предстательной железы (РПЖ) и доброкачественной гиперплазии предстательной железы (ДГПЖ).

Группа изобретений относится к медицине и касается способа детектирования рака, включающего измерение уровня экспрессии CAPRIN-1, экспрессированного на клеточной поверхности, в биологическом образце посредством реакции «антиген-антитело» с использованием антитела или его антигенсвязывающего фрагмента, обладающего иммунологической реактивностью с полипептидом, имеющим аминокислотную последовательность, представленную в SEQ ID NO: 63.

Группа изобретений относится к медицине и касается способа детектирования рака, включающего измерение уровня экспрессии CAPRIN-1, экспрессированного на клеточной поверхности, в биологическом образце посредством реакции «антиген-антитело» с использованием антитела или его антигенсвязывающего фрагмента, обладающего иммунологической реактивностью с полипептидом, имеющим аминокислотную последовательность, представленную в SEQ ID NO: 66.

Представлен способ выявления ракового биомаркера у субъекта in vitro. Охарактеризованный способ включает получение от субъекта биологического образца; измерение уровня RISC-белка во фракции экзосом образца и/или активности процессинга первичной микроРНК или активности процессинга предшественника микроРНК во фракции экзосом образца и эталонного образца; идентификацию того, что субъект обладает раковым биомаркером, на основании (i) выявления RISC-белка во фракции экзосом образца, полученного от субъекта, или (ii) выявления активности процессинга микроРНК во фракции экзосом образца, которая отсутствует в эталонном образце.

Изобретение относится к области биотехнологии, конкретно к химерному антигенному рецептору (CAR), обладающему специфичностью к CD22, что может быть использовано в медицине.

Изобретение относится к клеточным технологиям. Описан способ улучшения сердечной функции у млекопитающего, включающий: трансплантацию кардиомиоцитов в миокард указанного млекопитающего, причем указанные кардиомиоциты содержат первый вектор экспрессии, содержащий первую последовательность нуклеиновой кислоты, кодирующую субъединицу R1 рибонуклеотидредуктазы, и второй вектор экспрессии, содержащий вторую последовательность нуклеиновой кислоты, кодирующую субъединицу R2 рибонуклеотидредуктазы, где указанные первая и вторая последовательности нуклеиновой кислоты функционально связаны с промотором, который индуцирует гиперэкспрессию R1 и R2, что обеспечивает образование дезокси-АТФ и улучшение сердечной функции у млекопитающего.

Изобретение относится к новым соединениям формулы I и их фармацевтически приемлемым солям, их способам получения ферментацией микроорганизма, принадлежащего видам Streptomyces (PM0626271/MTCC 5447), и к фармацевтическим композициям, содержащим одно или несколько соединений формулы I в качестве активного ингредиента.

Изобретение относится к способу определения и количественной оценки необычно модифицированных гликанов, который может использоваться при анализе гликанов. Предложенный способ включает стадии: a) обеспечения препарата гликана, содержащего необычно модифицированные гликаны, выбранные из группы, содержащей сульфатированные гликаны, фосфорилированные гликаны, полиацетилированные сиалированные гликаны и их комбинации, где указанные необычно модифицированные гликаны являются отрицательно заряженными, и где препарат гликана получен путем выделения гликанов и сиаловых кислот из терапевтической композиции гликопротеина, где сиаловые кислоты выделяют путем воздействия на терапевтическую композицию гликопротеина по меньшей мере одного агента, который расщепляет остатки сиаловых кислот, в условиях, обеспечивающих расщепление сиаловых кислот; b) подвергания препарата гликана хроматографическому методу разделения, который разделяет гликаны на основании отношения заряда к массе, посредством чего происходит разделение указанных необычно модифицированных гликанов; и c) количественного определения, по меньшей мере, одного отделенного необычно модифицированного гликана, используя, по меньшей мере, один стандарт количественной оценки.

Изобретение относится к области иммунологии. .

Изобретение относится к микробиологии и биохимии, в частности к выделению биологически активных соединений - антибиотиков для борьбы с микроскопическими водорослями.

Изобретение относится к биотехнологии, конкретно к получению гормонов, и может быть использовано в разведении беспозвоночных. .

Изобретение относится к области биохимии, в частности к способам и устройствам для получения окрашивающих веществ, и может быть использовано в пищевой и косметической промышленности, а также при проведении различного рода биологических исследований.

Изобретение относится к области биотехнологии и может быть использовано для получения биогенного поверхностно-активного вещества сурфактина, обладающего множественной биологической активностью.
Изобретение относится к области биотехнологии, в частности к терапевтическому бифункциональному агенту, подавляющему рост раковых стволовых клеток за счёт блокады опухолевых рецепторов CD47 и ERBB2.

Изобретение относится к области биохимии, в частности к антителу, которое специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а, а также к набору, его содержащему. Также раскрыт способ скрининга наличия рака яичников у субъекта или диагностики у субъекта рака яичников с использованием антитела, которое специфично связывает конформационно-зависимый эпитоп в аминокислотной последовательности домена N-WFDC полипептида НЕ4а. Изобретение позволяет эффективно осуществлять диагностику рака яичников у субъекта. 3 н. и 7 з.п. ф-лы, 12 ил., 3 табл., 7 пр.

Наверх