Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат



Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
Лечение воспалительных, аутоиммунных и нейродегенеративных нарушений иммуннодепрессивными полипетидами, являющимися производными тат
C12N2740/16311 - Микроорганизмы или ферменты; их композиции (биоциды, репелленты или аттрактанты или регуляторы роста растений, содержащие микроорганизмы, вирусы, микробные грибки, ферменты, агенты брожения или вещества, получаемые или экстрагируемые из микроорганизмов или из материала животного происхождения A01N 63/00; пищевые составы A21,A23; лекарственные препараты A61K; химические аспекты или использование материалов для бандажей, перевязочных средств, впитывающих подкладок или хирургических приспособлений A61L; удобрения C05); размножение, консервирование или сохранение микроорганизмов (консервирование живых тканей или органов людей или животных A01N 1/02); мутации или генная инженерия; питательные среды (среды для микробиологических испытаний C12Q)

Владельцы патента RU 2653754:

ПИН ФАРМА, ИНК. (US)

Настоящее изобретение относится к области биотехнологии, конкретно к иммунодепрессивным полипептидам, являющимся производными трансактиватора транскрипции (Tat), и может быть использовано в медицине для лечения аутоиммунного заболевания, ассоциированного с воспалением заболевания и/или нейродегенеративного заболевания. Иммунодепрессивный полипептид содержит (i) домен фактора транскрипции (TF), содержащий последовательность из иммунодепрессивного вируса иммунодефицита человека (ВИЧ), белка Tat SIV, hairless или искусственной иммунодепрессивной последовательности; (ii) цистеин-богатый домен из лентивирусного Tat или молекулы дефензина; и (iii) C-концевой домен из лентивирусного белка Tat1. Изобретение позволяет эффективно подавлять нежелательный иммунный ответ при заболеваниях, характеризующихся аберантными иммунными ответами. 3 н. и 11 з.п. ф-лы, 17 ил., 4 табл., 8 пр.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА НА РОДСТВЕННЫЕ ЗАЯВКИ

По настоящей заявке испрашивается приоритет предварительных патентных заявок США 61/734135, поданной 6 декабря 2012 года, и 61/881266, поданной 23 сентября 2013 года, содержание обеих из которых включено в настоящее описание в качестве ссылки в полном объеме.

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящая заявка относится к иммунодепрессивным полипептидам, являющимся производным трансактиватора (Tat) вируса иммунодефицита человека (ВИЧ), для лечения заболеваний, характеризующихся аберрантными иммунными ответами, таких как нейродегенеративные и аутоиммунные заболевания и обусловленные воспалением заболевания.

УРОВЕНЬ ТЕХНИКИ

Трансактиватор транскрипции (Tat) вируса иммунодефицита человека (HIV) опосредует по меньшей мере два независимых вида активности: опосредуемое рецептором инициирующее событие на клеточной поверхности и внутриклеточная активность транс-активации, которая контролирует дифференцировку антигенпредставляющих клеток (APC). Опосредуемое рецептором инициирующее событие, обусловленное Tat, является специфичным к APC, побуждая их к активации и дифференцировке в высоко иммунодепрессивные макрофаги, регулирующие антигенпредставляющие клетки, (AReg) или в дендритные клетки (DC), которые стимулируют специфические цитотоксические T-лимфоциты.

Антигенпредставляющие клетки, макрофаги и дендритные клетки являются критическими в патогенезе или ответе на различные заболевания, нарушения и нежелательные иммунные ответы. Tat запускает дифференцировку моноцитов в антигенпредставляющие макрофаги, экспрессирующие молекулы, которые специфически подавляют иммунный ответ на представляемый антиген(-ы). При аутоиммунных заболеваниях определенные собственные эндогенные молекулы организма неправильно распознаются как чужеродные, что приводит к чрезмерному воспалению и повреждению ткани. В одном примере деградация коллагена типа II на иммуногенные пептиды может запускать ревматоидный артрит (RA) у животных, и она ассоциирована с RA человека. Существенное исследование было сосредоточено на уменьшении иммунного ответа на эти белки. Индуцируемое антигенспецифическими макрофагами подавление, свойственное Tat, можно использовать для уменьшения нежелательного иммунного ответа на чужеродные и эндогенные молекулы, ассоциированные с воспалением и нейродегенерацией.

Попытки лечить воспаление и аутоиммунные нарушения имеют ограниченный успех. Это частично является следствием того факта, что этиология воспалительных и аутоиммунных нарушений состоит в комплексном ответе, основанном, частично, на различных индуцирующих воспаление молекулах и множестве опосредующих воспаление и сенсибилизирующих к воспалению молекул, которые, по-видимому, индуцируют воспаление через дублирующие механизмы. Таким образом, соединения, композиции и способы, которые могут лечить воспаление, нейродегенеративное заболевание или аутоиммунное нарушение, являются высокожелательными.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

В настоящем описании описаны соединения, композиции и способы лечения индивидуума, страдающего заболеваниями, ассоциированными с аберрантными иммунными ответами, такими как нейродегенеративные или аутоиммунные нарушения или ассоциированные с воспалением заболевания. Это осуществляется путем введения терапевтически эффективного количества иммунодепрессивного полипептида, являющегося производным Tat, или композиции, содержащей такие полипептиды, индивидууму, страдающему заболеванием. Как описано в настоящем описании, описанные иммунодепрессивные полипептиды, являющиеся производными Tat, продемонстрировали иммунодепрессивную активность.

В настоящем описании описаны иммунодепрессивные полипептиды, являющиеся производными трансактиватора транскрипции (Tat), имеющие аминокислотную последовательность, содержащую следующие домены в указанном порядке: домен фактора транскрипции (TF), содержащий последовательность из иммунодепрессивного вируса иммунодефицита человека (ВИЧ), Tat-белок SIV, последовательность hairless или искусственная иммунодепрессивная последовательность; цистеин-богатая область из лентивирусного Tat или молекулы дефензина; и C-концевая область из лентивирусного Tat-белка.

В другом варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, дополнительно содержит аргинин-богатый домен из лентивирусного белка Tat. В другом варианте осуществления домен TF дополнительно содержит последовательность повтора, содержащую (PVDPRLEPWKHPGSQP)n на N-конце, где n=2-10. В другом варианте осуществления по меньшей мере одна из аминокислот в TF-домене модифицирована консервативной аминокислотной заменой.

В другом варианте осуществления иммунодепрессивного полипептида, являющегося производным Tat, ВИЧ представляет собой ВИЧ-1 или ВИЧ-2. В другом варианте осуществления лентивирусный Tat происходит из ВИЧ-1, ВИЧ-2, SIV, FIV, BIV или EIAV.

В другом варианте осуществления иммунодепрессивного полипептида, являющегося производным Tat, домен TF имеет аминокислотную последовательность согласно одной из SEQ ID NO: 36, 39, 44, 48, 50, 54, 59, 60 или 61. В другом варианте осуществления цистеин-богатый домен имеет аминокислотную последовательность согласно одной из SEQ ID NO: 37, 40, 41, 43, 45, 47, 49, 51, 53, 55, 57, 58, 62, 63, 64 или 70. В другом варианте осуществления C-концевой домен содержит аминокислотную последовательность согласно одной из SEQ ID NO: 38, 42, 46, 47, 49, 52, 53, 68 или 71. В другом варианте осуществления как цистеин-богатая область, так и C-концевая область, происходят из одного и того же источника, и аминокислотная последовательность объединенной цистеин-богатой и C-концевой области представляет собой одну из SEQ ID NO: 47, 49 или 53. В другом варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, имеет более чем 85% идентичность последовательности, более чем 90% идентичность последовательности или более чем 95% идентичность последовательности с одной из SEQ ID NO: 9-11, 13-35 или 69.

Также в настоящем описании описана фармацевтическая композиция, содержащая один или несколько из иммунодепрессивных полипептидов, являющихся производными Tat, и фармацевтически приемлемый эксципиент. В другом варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, обладает более чем 85% идентичностью последовательности с одной или несколькими из SEQ ID NO: 9-11, 13-35 или 69.

Кроме того, в настоящем описании описан способ лечения заболевания, характеризующегося аберрантным иммунным ответом, причем способ включает: введение терапевтически эффективного количества одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, индивидууму, нуждающемуся в этом; и тем самым лечение заболевание путем подавления иммунной системы.

Кроме того, в настоящем описании описан способ увеличения экспрессии Fas-лиганда (FasL) на макрофагах, регулирующих антигенпредставляющие клетки (AReg), причем способ включает: введение терапевтически эффективного количества одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, индивидууму; и тем самым повышение экспрессии FasL на AReg.

Кроме того, в настоящем описании описан способ уменьшения воспаления, причем способ включает: введение терапевтически эффективного количества одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, индивидууму, нуждающемуся в этом, и тем самым уменьшение воспаления у индивидуума.

В одном варианте осуществления способов, описанных в настоящем описании, иммунодепрессивный полипептид, являющийся производным Tat, имеет более чем 85% идентичность последовательности с одной из SEQ ID NO: 9-11, 13-35 или 69.

В другом варианте осуществления способов, лечение повышает экспрессию Fas-лиганда на макрофагах, регулирующих антигенпредставляющие клетки (AReg). В другом варианте осуществления AReg представляют собой CD14+ макрофаги.

В другом варианте осуществления способов заболевание представляет собой аутоиммунное, нейродегенеративное или ассоциированное с воспалением нарушение. В одном варианте осуществления аутоиммунное нарушение представляет собой острый диссеминированный энцефаломиелит (ADEM), болезнь Аддисона, аллергию, аллергический ринит, болезнь Альцгеймера, синдром антифосфолипидных антител (APS), артрит, астму, синдром аутоиммунного дефицита, аутоиммунную гемолитическую анемию, аутоиммунный гепатит, аутоиммунное заболевание внутреннего уха, буллезный пемфигоид, глютеновую болезнь, болезнь Шагаса, хроническое обструктивное заболевание легких (COPD), сахарный диабет 1 типа (IDDM), экзему, эндометриоз, желудочно-кишечное нарушение, синдром Гудпасчера, болезнь Грэйвса, синдром Гийена-Барре (GBS), тиреоидит Хашимото, гнойный гидраденит, идиопатическую тромбоцитопеническую пурпуру, воспалительное заболевание кишечника, воспалительное дерматологическое заболевание, интерстициальный цистит, волчанку, очаговую склеродермию, рассеянный склероз (MS), миастению гравис, миопатию, нарколепсию, нейромиотонию, пемфигус обыкновенный, пернициозную анемию, первичный билиарный цирроз, псориаз, рекуррентный диссеминированный энцефаломиелит, ревматическую атаку, шизофрению, склеродермию, синдром Шегрена, нарушение кожи, теносиновит, увеит, васкулит или витилиго. В другом варианте осуществления заболевание, ассоциированное с воспалением, представляет собой угревую сыпь, кислотный рефлюкс/изжогу, аллергию, аллергический ринит, болезнь Альцгеймера, аппендицит, артериит, артрит, астму, атеросклероз, аутоиммунное нарушение, баланит, блефарит, бронхиолит, бронхит, бурсит, рак, кардит, глютеновую болезнь, целлюлит, цервицит, холангит, холецистит, хориоамнионит, хроническое обструктивное заболевание легких (COPD), цирроз, колит, конъюнктивит, цистит, вирусную инфекцию верхних дыхательных путей, дакриоаденит, деменцию, дерматит, дерматомиозит, экзему, эмфизему, энцефалит, эндокардит, эндометрит, энтерит, энтероколит, эпикондилит, эпидидимит, фасциит, фиброзит, гастрит, гастроэнтерит, гингивит, гломерулонефрит, глоссит, заболевание сердца, гепатит, гнойный гидраденит, высокое кровяное давление, илеит, резистентность к инсулину, интерстициальный цистит, ирит, ишемическую болезнь сердца, кератит, кератоконъюнктивит, ларингит, волчанку, мастит, мастоидит, менингит, метаболический синдром (синдром X), мигрень, рассеянный склероз, миелит, миокардит, миопатию, миозит, нефрит, невропатию, ожирение, омфалит, оофорит, орхит, остеохондрит, остеопению, остеопороз, остеит, отит, панкреатит, болезнь Паркинсона, паротит, воспалительное заболевание таза, перикардит, перитонит, фарингит, флебит, плеврит, пневмонит, проктит, простатит, псориаз, пульпит, пиелонефрит, пилефлебит, ревматическую атаку, ринит, сальпингит, сиаладенит, синусит, спастический толстый кишечник, стоматит, синовит, тендинит, тендиноз, теносиновит, тромбофлебит, тонзиллит, тригонит, опухоль, уретрит, увеит, вагинит, васкулит или вульвит. В другом варианте осуществления нейродегенеративное заболевание представляет собой болезнь Александера, болезнь Альперса, болезнь Альцгеймера, амилоидоз, боковой амиотрофический склероз, тревожность, атаксию-телеангиэктазию, дефицит внимания, болезнь Канавана, травмы центральной нервной системы, болезнь Шарко-Мари-Тута, синдром Кокейна, кортикобазальную дегенерацию, болезнь Крейтцфельда-Якоба, депрессию, энцефалит (например, бактериальный, паразитарный, грибковый или вирусный), атаксию Фридрейха, лобно-височную деменцию, наследственный спастический парапарез, синдром Гийена-Барре (и его варианты: острая невропатия аксонов двигательных нервов, острая воспалительная демиелинизирущая полиневропатия и синдром Фишера), ВИЧ/СПИД-дементный комплекс, болезнь Гентингтона, ишемическое повреждение нервной системы, болезнь Кеннеди, болезнь Краббе, деменцию с тельцами Леви, болезнь Мачадо-Джозефа, менингит (например, бактериальный, паразитарный, грибковый или вирусный), рассеянный склероз, множественную системную атрофию, повреждение нервной системы, например, сотрясение головного мозга, травму спинного мозга и травматическое повреждение нервной системы, невропатию, например, такую как индуцированная химиотерапией невропатия, ассоциированная с диабетом невропатия и периферическая невропатия, болезнь Паркинсона, болезнь Пелицеуса-Мерцбахера, болезнь Пика, первичный латеральный склероз, прионные нарушения, прогрессирующий надъядерный паралич, болезнь Рефсума, болезнь Сандхоффа, шизофрению, болезнь Шильдера, спиномозжечковую атрофию, болезнь Стила-Ричардсона-Ольшевского, инсульт, сухотку спинного мозга или сосудистую деменцию.

В другом варианте осуществления способов введение, кроме того, вызывает уменьшение по меньшей мере одного симптома, ассоциированного с аутоиммунным заболеванием, нейродегенеративным заболеванием или заболеванием, ассоциированным с воспалением, и симптомом которого является воспаление, усталость, головокружение, беспокойство, лихорадка и высокая температура тела, чрезмерная чувствительность к холоду в руках и ступнях, слабость и скованность мышц и суставов, изменение массы тела, пищеварительные и желудочно-кишечные проблемы, низкое или высокое кровяное давление, раздражимость, тревожность или депрессия, бесплодие или снижение полового влечения (низкое либидо), изменения уровня сахара в крови и, в зависимости от типа аутоиммунного заболевания, увеличение размера органа или ткани или разрушение органа или ткани.

В другом варианте осуществления способов, индивидуум не имеет иммунодефицита. В другом варианте осуществления иммунная система индивидуума становится дефицитной в результате введения. В другом варианте осуществления в результате введения секреция цитокинов из AReg снижается.

В другом варианте осуществления способов, иммунодепрессивный полипептид, являющийся производным Tat, вводят многократными дозами. В другом варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, вводят раз в сутки, раз в неделю, раз в две недели, раз в месяц или раз в два месяца. В другом варианте осуществления стадия введения включает повторяющиеся курсы введения, где каждый курс включает введение множества доз иммунодепрессивного полипептида, являющегося производным Tat, в определенный период времени, за которым следует период покоя, и где курс повторяют множество раз.

Также в настоящем описании описано применение одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, для получения лекарственного средства для лечения заболевания, характеризующегося аберрантным иммунным ответом, у индивидуума, нуждающегося в этом; где один или несколько иммунодепрессивных полипептидов, являющихся производными Tat, по меньшей мере на 85% идентичны иммунодепрессивному полипептиду, являющемуся производным Tat, по п.1, и где введение иммунодепрессивного полипептида, являющегося производным Tat, обеспечивает лечение заболевания путем подавления иммунной системы у индивидуума.

Кроме того, в настоящем описании описано применение одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, для получения лекарственного средства для увеличения экспрессии Fas-лиганда (FasL) на макрофагах, регулирующих антигенпредставляющие клетки, (AReg) у индивидуума, где один или несколько иммунодепрессивных полипептидов, являющихся производными Tat, по меньшей мере на 85% идентичны иммунодепрессивному полипептиду, являющемуся производным Tat, по п.1, где введение иммунодепрессивных полипептидов, являющихся производными Tat, увеличивает экспрессию FasL на AReg.

Кроме того, в настоящем описании описано применение одного или нескольких иммунодепрессивных пептидов, являющихся производными Tat, для получения лекарственного средства для уменьшения воспаления у индивидуума, где один или несколько иммунодепрессивных полипептидов, являющихся производными Tat, по меньшей мере на 85% идентичны иммунодепрессивному полипептиду, являющемуся производным Tat, по п.1, и где введение иммунодепрессивных полипептидов, являющихся производными Tat, уменьшает воспаление у индивидуума.

В другом варианте осуществления применения лечение увеличивает экспрессию Fas-лиганда на макрофагах, регулирующих антигенпредставляющие клетки (AReg). В другом варианте осуществления AReg представляют собой CD14+ макрофаги. В другом варианте осуществления секреция цитокинов из AReg снижается. В другом варианте осуществления у индивидуума отсутствует иммунодефицит. В другом варианте осуществления иммунная система индивидуума не становится дефицитной в результате введения.

В другом варианте осуществления применения иммунодепрессивный полипептид, являющийся производным Tat, обладает более чем 85% идентичностью последовательности с одной из SEQ ID NO: 9-11, 13-35 или 69.

В другом варианте осуществления применения заболевание представляет собой аутоиммунное, нейродегенеративное или ассоциированное с воспалением нарушение. В другом варианте осуществления аутоиммунное нарушение представляет собой острый диссеминированный энцефаломиелит (ADEM), болезнь Аддисона, аллергию, аллергический ринит, болезнь Альцгеймера, синдром антифосфолипидных антител (APS), артрит, астму, синдром аутоиммунного дефицита, аутоиммунную гемолитическую анемию, аутоиммунный гепатит, аутоиммунное заболевание внутреннего уха, буллезный пемфигоид, глютеновую болезнь, болезнь Шагаса, хроническое обструктивное заболевание легких (COPD), сахарный диабет 1 типа (IDDM), экзему, эндометриоз, желудочно-кишечное нарушение, синдром Гудпасчера, болезнь Грэйвса, синдром Гийена-Барре (GBS), тиреоидит Хашимото, гнойный гидраденит, идиопатическую тромбоцитопеническую пурпуру, воспалительное заболевание кишечника, воспалительное дерматологическое заболевание, интерстициальный цистит, волчанку, очаговую склеродермию, рассеянный склероз (MS), миастению гравис, миопатию, нарколепсию, нейромиотонию, пемфигус обыкновенный, пернициозную анемию, первичный билиарный цирроз, псориаз, рекуррентный диссеминированный энцефаломиелит, ревматическую атаку, шизофрению, склеродермию, синдром Шегрена, нарушение кожи, теносиновит, увеит, васкулит или витилиго. В другом варианте осуществления заболевание, ассоциированное с воспалением, представляет собой угревую сыпь, кислотный рефлюкс/изжогу, аллергию, аллергический ринит, болезнь Альцгеймера, аппендицит, артериит, артрит, астму, атеросклероз, аутоиммунное нарушение, баланит, блефарит, бронхиолит, бронхит, бурсит, рак, кардит, глютеновую болезнь, целлюлит, цервицит, холангит, холецистит, хориоамнионит, хроническое обструктивное заболевание легких (COPD), цирроз, колит, конъюнктивит, цистит, вирусную инфекцию верхних дыхательных путей, дакриоаденит, деменцию, дерматит, дерматомиозит, экзему, эмфизему, энцефалит, эндокардит, эндометрит, энтерит, энтероколит, эпикондилит, эпидидимит, фасциит, фиброзит, гастрит, гастроэнтерит, гингивит, гломерулонефрит, глоссит, заболевание сердца, гепатит, гнойный гидраденит, высокое кровяное давление, илеит, резистентность к инсулину, интерстициальный цистит, ирит, ишемическую болезнь сердца, кератит, кератоконъюнктивит, ларингит, волчанку, мастит, мастоидит, менингит, метаболический синдром (синдром X), мигрень, рассеянный склероз, миелит, миокардит, миопатию, миозит, нефрит, невропатию, ожирение, омфалит, оофорит, орхит, остеохондрит, остеопению, остеопороз, остеит, отит, панкреатит, болезнь Паркинсона, паротит, воспалительное заболевание таза, перикардит, перитонит, фарингит, флебит, плеврит, пневмонит, проктит, простатит, псориаз, пульпит, пиелонефрит, пилефлебит, ревматическую атаку, ринит, сальпингит, сиаладенит, синусит, спастический толстый кишечник, стоматит, синовит, тендинит, тендиноз, теносиновит, тромбофлебит, тонзиллит, тригонит, опухоль, уретрит, увеит, вагинит, васкулит или вульвит. В другом варианте осуществления, нейродегенеративное заболевание представляет собой болезнь Александера, болезнь Альперса, болезнь Альцгеймера, амилоидоз, боковой амиотрофический склероз, тревожность, атаксию-телеангиэктазию, дефицит внимания, болезнь Канавана, травмы центральной нервной системы, болезнь Шарко-Мари-Тута, синдром Кокейна, кортикобазальную дегенерацию, болезнь Крейтцфельда-Якоба, депрессию, энцефалит (например, бактериальный, паразитарный, грибковый или вирусный), атаксию Фридрейха, лобно-височную деменцию, наследственный спастический парапарез, синдром Гийена-Барре (и его варианты: острая невропатия аксонов двигательных нервов, острая воспалительная демиелинизирущая полиневропатия и синдром Фишера), ВИЧ/СПИД-дементный комплекс, болезнь Гентингтона, ишемическое повреждение нервной системы, болезнь Кеннеди, болезнь Краббе, деменцию с тельцами Леви, болезнь Мачадо-Джозефа, менингит (например, бактериальный, паразитарный, грибковый или вирусный), рассеянный склероз, множественную системную атрофию, повреждение нервной системы, например, сотрясение головного мозга, травму спинного мозга и травматическое повреждение нервной системы, невропатию, например, такую как индуцированная химиотерапией невропатия, ассоциированная с диабетом невропатия и периферическая невропатия, болезнь Паркинсона, болезнь Пелицеуса-Мерцбахера, болезнь Пика, первичный латеральный склероз, прионные нарушения, прогрессирующий надъядерный паралич, болезнь Рефсума, болезнь Сандхоффа, шизофрению, болезнь Шильдера, спиномозжечковую атрофию, болезнь Стила-Ричардсона-Ольшевского, инсульт, сухотку спинного мозга или сосудистую деменцию.

В другом варианте осуществления применение иммунодепрессивного полипептида, являющегося производным Tat, кроме того, вызывает уменьшение по меньшей мере одного симптома, ассоциированного с аутоиммунным заболеванием, нейродегенеративным заболеванием или заболеванием, ассоциированным с воспалением, и симптомом которого является воспаление, усталость, головокружение, беспокойство, лихорадка и высокая температура тела, чрезмерная чувствительность к холоду в руках и ступнях, слабость и скованность мышц и суставов, изменение массы тела, пищеварительные и желудочно-кишечные проблемы, низкое или высокое кровяное давление, раздражимость, тревожность или депрессия, бесплодие или снижение полового влечения (низкое либидо), изменения уровня сахара в крови и, в зависимости от типа аутоиммунного заболевания, увеличение размера органа или ткани или разрушение органа или ткани.

В другом варианте осуществления применения иммунодепрессивный полипептид, являющийся производным Tat, вводят многократными дозами. В другом варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, вводят раз в сутки, раз в неделю, раз в две недели, раз в месяц или раз в два месяца. В другом варианте осуществления стадия введения включает повторяющиеся курсы введения, где каждый курс включает введение множества доз иммунодепрессивного полипептида, являющегося производным Tat, в определенный период времени, за которым следует период покоя, и где курс повторяют множество раз.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фиг.1 представлен анализ с помощью активируемого флуоресценцией клеточного сортера (FACS) результатов активации моноцитов посредством Tat. Моноциты периферической крови человека коммитировали на дифференцировку в дендритные клетки (DC) путем культивирования в течение пяти суток с GM-CSF и IL-4. Коммитированные DC культивировали в течение ночи либо в среде отдельно (контроль), либо с липополисахаридом (LPS), либо с Tat, после чего их окрашивали антителом против CD86 и анализировали с помощью FACScan в отношении индукции (левая панель) или генерализованной активации (правая панель, увеличение в рамке R2, показанное для Tat-стимулированных клеток) по CD86, специфическому маркеру активации DC.

На фиг.2 представлено усиление антигенспецифической активации цитотоксических T-лимфоцитов (CTL) комплексами Tat*-антиген (Ag). Активность CTL количественно определяли в качестве числа секретирующих γ-интерферон образующих пятна колоний (SFC)/106 посеянных клеток с использованием анализа ELISPOT.

На фиг.3 представлена средняя флуоресценция моноцитов, культивированных в течение шести суток, либо без стимула (0), либо с фактором некроза опухоли альфа (TNF-α), либо с LPS, либо со снижающимися концентрациями C-Tat (общепринятый нативный иммунодепрессивный Tat из ВИЧ), либо с окисленным C-Tat (ox-C-Tat) и окрашенных моноклональным антителом (Mab) против Fas-лиганда (FasL), а затем флуоресцеинированным поликлональным антителом козы против антител мыши.

На фиг.4A-B представлен титр антител к иммуногенному антигену в присутствии иммунодепрессивного Tat (PT) или неиммунодепрессивного ox-Tat* (Ag) через две недели (фиг.4A) или шесть недель (фиг.4B).

На фиг.5 представлен FACS-анализ перитонеальных макрофагов мыши, которые были выделены либо после стимуляции тиогликолятом in vivo (стимулированные + адъювант), либо без стимуляции in vivo (покоящиеся). Перитонеальные макрофаги мыши культивировали в течение пяти суток в отсутствие дополнительной стимуляции (C), с LPS или с Tat. Активацию определяли в качестве процента увеличенных клеток (фракция M1).

На фиг.6 представлено стабильное подавление стимулированных антигеном T-лимфоцитов комплексами Tat-Ag через две недели после иммунизации иммунодепрессивным Tat.

На фиг.7 представлена антигенная специфичность подавления Tat. Мышей иммунизировали на 0 сутки и подвергали вспомогательной иммунизации на 7 сутки адъювантной эмульсией, содержащей либо Tat (Ag+Tat), либо Ag отдельно в качестве контроля. На 14 сутки клетки дренирующих лимфатических узлов собирали и стимулировали либо специфическим, либо неспецифическим антигеном и измеряли пролиферацию по захвату 3H-тимидина (CPM) после культивирования в течение четырех суток.

На фиг.8 представлен FACS-анализ моноцитов периферической крови человека, культивированных в течение четырех суток в контрольной среде (контроль), или в среде, содержавшей Tat или LPS. Собранные клетки подвергали двойному окрашиванию флуоресцеинированным Mab против FasL (αFasL-FITC) и меченным родамином Mab против CD14. Клетки анализировали с помощью FACScan в отношении активации (малоугловое рассеяние), экспрессии CD14 (% макрофаги, R2) и индукции FasL (MFI). Популяция T-клеток обозначена как R1.

На фиг.9A-B представлены характеристики регуляции и иммуносупрессии Tat-активированных макрофагов. (A) Мононуклеарные клетки периферической крови (PBMC) человека от одного индивидуума (PBMC #3), культивированные в течение пяти суток либо в среде со столбнячным антигеном (Ag), либо с антигеном с последующим добавлением Tat (Ag+Tat), либо Ag с Tat и рекомбинантным белком sFas (Ag+Tat+sFas). Результаты представлены на графике в качестве индекса стимуляции (среднее значение cpm в стимулированной культуре/среднее значение cpm в контрольной среде). (B) Пролиферацию PBMC, культивированных в течение 6 суток либо со столбнячным антигеном, либо с антигеном Candida отдельно (Ag), сравнивают с культурами, в которые добавляли Tat (Ag+Tat) или Tat и антагонистическое антитело против Fas ZB4 (Ag+Tat+αFas).

На фиг.10 представлена стимуляция моноцитов человека производными Tat.

На фиг.11 представлена кривая доза-эффект для стимуляции моноцитов человека производными Tat.

На фиг.12A-C представлено окрашивание клеток Jurkat посредством Hoechst-NucBlue и меченного Alexa488 производного Tat SEQ ID NO: 9 (фиг.12A), меченного Alexa488 производного Tat SEQ ID NO: 11 (фиг.12B) или контроля (без производного Tat, фиг.12C). Левая колонка соответствует окрашиванию ядра Hoechst-NucBlue, центральная колонка соответствует окрашиванию Alexa488 и в правой колонке представлено наложение левого и правого изображений.

На фиг.13A-C представлено окрашивание клеток U937 посредством Hoechst-NucBlue и меченного Alexa488 производного Tat SEQ ID NO: 9 (фиг.13A), меченного Alexa488 производного Tat SEQ ID NO: 11 (фиг.13B) или контроля (без производного Tat, фиг.13C). Левая колонка соответствует окрашиванию ядер посредством Hoechst-NucBlue, центральная колонка соответствует окрашиванию Alexa488, и в правой колонке представлено наложение левого и центрального изображений.

На фиг.14A-C представлена активация мононуклеарных клеток периферической крови (PBMC) человека при измерении по экспрессии FasL без стимула (фиг.14A), с LPS (фиг.14B) или с производным Tat SEQ ID NO: 9 (фиг. 14C).

На фиг.15 представлена пролиферация CD14+ PBMC человека при измерении по экспрессии CD14 на клеточной поверхности без стимула, с LPS или с производным Tat SEQ ID NO: 9.

На фиг.16 представлен процент CD14+ клеток в трехдневных культурах PBMC, обработанных LPS, производным Tat SEQ ID NO: 9 или без стимула.

На фиг.17A-E представлены PBMC, экспрессирующие как FasL, так и CD14, после обработки TNF-альфа (фиг.17B), LPS (фиг.17C), производным Tat SEQ ID NO: 9 (фиг.17D) или без стимуляции (фиг.17A) после культивирования в течение пяти суток. На фиг.17E представлены данные с фиг.27A-D в графическом формате.

ОПИСАНИЕ

Настоящее описание относится к соединениям, композициям и способам для лечения индивидуума, страдающего заболеваниями, ассоциированными с аберрантными иммунными ответами, такими как аутоиммунные нарушения, включающие нейродегенеративные нарушения или ассоциированные с воспалением нарушения. Это осуществляют путем введения терапевтически эффективного количества иммунодепрессивного полипептида, являющегося производным Tat, или композиции, содержащей такие полипептиды, индивидууму, страдающему такими заболеваниями. Как описано в настоящем описании, описанные иммунодепрессивные полипептиды, являющиеся производными Tat, обладают противовоспалительной активностью. Иммунодепрессивные пептиды-производные в объеме настоящего изобретения являются иммунодепрессивными.

Как используют в рамках изобретения, термин "аберрантные иммунные ответы" относится к увеличенным, нежелательным, чрезмерным или ненадлежащим иммунным ответам, при которых иммунный ответ на антигены, такие как собственные антигены, увеличивается так, что наблюдают воспаление и/или аутоиммунное заболевание или нейродегенеративное заболевание. Аберрантные иммунные ответы, как используют в рамках изобретения, характеризуются иммунным каскадом, приводящим к разрушению ткани организма. Как правило, аберрантный иммунный ответ не наблюдают при нормальном ответе на инфекцию, однако он может запускаться инфекцией

Белок Tat ВИЧ представляет собой вариабельный РНК-связывающий пептид длиной 86-110 аминокислот, который кодируется на двух отдельных экзонах генома ВИЧ. Исходя из молекулярного анализа, белок Tat (SEQ ID NO: 2) кодирует индивидуальные и связанные виды активности пептидов. В настоящем описании описаны полипептидные композиции, которые являются такими производными канонической структуры Tat ВИЧ-1 по меньшей мере в первой или N-концевой части, в которых усиливается иммунотерапевтический потенциал полипептида. N-концевая часть Tat включает короткую пептидную область из ядерного фактора транскрипции (TF), как правило, фланкированную остатками пролина. Эта область определяет, по меньшей мере частично, насколько стимулирующим или насколько подавляющим является полипептид Tat для клеток иммунной системы, в частности, клеток врожденной иммунной системы, таких как дендритные клетки (DC) и макрофаги (антигенпредставляющие клетки или APC). Следовательно, прогнозируется, что модификации в области TF могут делать полипептиды более активными при терапии заболевания.

Предшествующие исследования показали, что Tat ВИЧ является иммунодепрессивным в большинстве штаммов ВИЧ. Однако у индивидуумов с длительным отсутствием прогрессирования (LTNP) - подгруппы ВИЧ-инфицированных индивидуумов с высокой вирусной нагрузкой, которые не имеют существенного уменьшения количества T4-клеток и которые не прогрессируют в синдром приобретенного иммунодефицита (СПИД) - белок Tat ВИЧ является иммуностимулирующим. Белок Tat, встречающийся у LTNP, способен трансактивировать вирусную РНК; однако Tat LTNP (обозначаемый в настоящем описании как "IS-Tat" от иммуностимулирующего Tat) не индуцирует апоптоз в клетках T4 или макрофагах и не является иммунодепрессивным. Более того, клетки T4, инфицированные ex vivo ВИЧ, выделенным из LTNP (такие клеточные линии обозначают "TcL Tat ") сверхэкспрессируют белки IS-Tat, часто практически исключая другие вирусные белки, которые являются в высокой степени стимулирующими рост, а не проапоптотическими. Гены tat, клонированные с этих TcL Tat проявляют изменения последовательности в двух областях tat, на N-конце и в первой части второго экзона.

Исходя из молекулярного анализа, белок Tat ВИЧ (SEQ ID NO: 2) содержит три различных представляющих интерес области. Первая представляющая интерес область представляет собой домен передачи сигнала на N-конце Tat (аминокислоты 3-19). Вторая представляющая интерес область представляет собой цистеин-богатый лигандсвязывающий домен (аминокислоты 22-37), который содержит семь консервативных остатков цистеина. Третья представляющая интерес область представляет собой последовательность транслокации через мембрану (MTS), которая охватывает аминокислоты 47-57.

Пролин-богатый участок вблизи N-конца (аминокислоты 3-19) Tat ВИЧ-1 и ВИЧ-2 в домене передачи сигнала представляет собой SH3-связыващий домен, обладающий значительной гомологией с SH3-связывающим доменом гена hairless (hr) (SEQ ID NO: 72) мышей. SH3-связывающий домен представляет собой важную мишень для фармацевтической разработки, обладающую потенциалом в диагностике, профилактике и лечении нежелательных клеточных процессов, таких как аутоиммунитет.

Неожиданно, у мышей, экспрессирущих мутацию в гене hr, развивается СПИД-подобный синдром, характеризующийся низкой функцией CTL, сдвигом хелперных T-лимфоцитов от T-лимфоцитов, регулирующих клеточно-опосредуемый иммунитет (TH1), к T-лимфоцитам, регулирующим антитело-опосредуемый иммунитет (TH2), и увеличенной чувствительностью к индуцируемому химически и ультрафиолетовым светом раку кожи. Кроме того, варианты Tat встречаются у инфицированных ретровирусом обезьян, у которых не развивается иммунодефицит и которые не обладают эпидемической инфекцией. Однако эти варианты Tat не обладают SH3-связывающим доменом, а вместо этого имеется замена на отличающуюся последовательность, также имеющую остатки пролина на каждом конце последовательности, в домене трансдукции. Таким образом, SH3-связывающий домен является центральным для иммунодепрессивной активности Tat. Генетические данные указывают на то, что SH3-связывающий домен регулирует дифференцировку моноцитов в макрофаги, регулирующие антигенпредставляющие клетки (AReg). Tat-белки, которые не содержат SH3-домен или в которых этот домен является мутантным, направляют моноциты на дифференцировку в DC, которые стимулируют ответы CTL.

Область MTS позволяет Tat свободно проходить через эндосомальную мембрану в цитоплазму после связывания с рецептором, где она трансактивирует экспрессию генов, включая, но не ограничиваясь этим, гены ВИЧ-1. Было неверно предположено, что MTS способствует вхождению Tat в клетку, что может происходить только при высоких концентрациях, которые не могут достигаться in vivo.

В отличие от современных способов иммунодепрессивной терапии, описанные композиции на основе Tat, иммунодепрессивные полипептиды, являющиеся производными Tat, обладают потенциалом к подавлению антигенспецифических иммунных ответов, не вызывая иммунодефицита у пациента. Они сохраняют иммунодепрессивную активность общепринятого Tat ВИЧ в отсутствие вируса, и, таким образом, иммунодепрессивные производные Tat модулируют специфичность иммунного ответа, ключевого компонента для естественной защиты организма. Это является особенно важным, когда требуется длительная иммунодепрессивная терапия, такая как при аутоиммунных, нейродегенеративных и ассоциированных с воспалением заболеваниях.

Иммунодепрессивные эффекты Tat опосредуются макрофагами. При стимуляции Tat, либо при естественной инфекции ВИЧ-1, либо при захвате Tat, макрофаги индуцируют Fas-лиганд (FasL), который в свою очередь индуцирует запрограммированную клеточную гибель (апоптоз) реагирующих с антигеном экспрессирующих Fas хелперных T-клеток (фиг.3). Tat повышает жизнеспособность культивируемых макрофагов мыши, если макрофаги были первоначально активированы in vivo, по сравнению с отсутствием предшествующей стимуляции, и стимулированы относительно высокими концентрациями Tat. Для сравнения, LPS увеличивает жизнеспособность макрофагов мыши, независимо от стимуляции in vivo, и в той же концентрации, которая является эффективной для макрофагов человека. Определенные композиции на основе Tat, описанные в настоящем описании, вызывают стабильное подавление пролиферации лимфоцитов мыши и также могут служить для подавления антигенспецифического иммунного ответа на различные антигены.

Макрофаги, ответственные за эти ответы, были обозначены как макрофаги, регулирующие антигенпредставляющие клетки (AReg). AReg также известны как "альтернативно активируемые" макрофаги. AReg представляют собой стабильные макрофаги, экспрессирующие FasL и секретирующие цитокины IL-10 и IL-6. AReg являются стабильными и отвечают аутокринным и паракринным образом на эти два цитокина, а также паракринным образом на IL-4. Эти цитокины накапливаются и переключают иммунный ответ с TH1 (на основе хелперных T-лимфоцитов) на TH2 (на основе супрессивных T-лимфоцитов). По мере накопления этих цитокинов, они перегружают и подавляют иммунный ответ, и это объясняет, почему иммунные ответы обычно являются самоограничивающимися антигенспецифическим образом.

Неожиданным является наблюдение, что в 1000 раз более низкие концентрации Tat (500 пМ) запускают этот эффект на макрофагах по сравнению с концентрацией, требуемой для инициации прямого апоптоза CD4+ T-клеток (приблизительно 500 нМ). Таким образом, при концентрациях Tat, достигаемых в качестве системно вводимого иммуномодулятора, эффект на макрофаги предпочтительно будет преобладать над эффектом на T-клетки.

Tat-опосредуемое антигенспецифическое подавление опосредуется транс- (внутриклеточной) активацией CD14+ FasL+ макрофагов. Tat-активируемые макрофаги представляют собой иммунодепрессивные AReg. При низких концентрациях Tat (50 нМ), Tat-индуцируемая иммуносупрессия не только полностью обращалась вспять при добавлении растворимого Fas, но в этих условиях, Tat в действительности становился немного стимулирующим (относительно обработки антигеном отдельно). Антитела к FasL обращали вспять иммуносупрессию посредством Tat ответов на столбняк и усиливали ответ на Candida относительно обработки Tat отдельно. Подавление можно было полностью обратить вспять (>95% от контроля) при дополнительном добавлении антител против IL-10 и против IL-6 в культуры, где оба этих цитокина образовывались в макрофагах в этих условиях культивирования. Частично в индуцируемую Tat иммуносупрессию вносит вклад индукция FasL, хотя другие Tat-индуцируемые факторы могут участвовать в подавлении пролиферативных ответов T-клеток, особенно при более высоких концентрациях Tat.

Полная аминокислотная последовательность Tat ВИЧ-1, кодируемого экзонами 1 и 2 гена Tat, приведена ниже:

Tat имеет пролин(P)-богатый сегмент вблизи N-конца (аминокислоты 3-19, подчеркнут ниже). Эта высококонсервативная область Tat ВИЧ-1 представляет собой канонический SH3-связывающий домен, также обозначаемый в настоящем описании как домен ядерного фактора транскрипции (TF). Ген hairless (hr) мыши также имеет SH3-связывающий мотив (TF, аминокислоты 176-196 hr; SEQ ID NO: 72). Между SH3-связывающим доменом Tat человека (SEQ ID NO: 4) и SH3-связывающим доменом гена hr мыши существует гомология:

Варианты Tat, встречающиеся в ретровирусах обезьяны, не вызывают иммунодефицита, не имеют SH3-связывающего домена, а вместо этого имеют следующую фланкируемую пролином последовательность:

Pro Leu Arg Glu Gln Glu Asn Ser Leu Glu Ser Ser Asn Glu Arg Ser Ser Cys Ile Leu Glu Ala Asp Ala Thr Thr Pro (SEQ ID NO: 3)

Эквивалентом у человека для последовательности обезьяны (SEQ ID NO: 3) выше является:

Ser Asn Glu Arg Ser Ser Cys Glu Leu Glu Val (SEQ ID NO. 4)

Другой представляющей интерес областью является цистеин-богатый предполагаемый лиганд-связывающий домен (аминокислоты 22-37), который содержит семь остатков цистеина.

Cys Thr Thr Cys Tyr Cys Lys Lys Cys Cys Phe His Cys Gln Val Cys (SEQ ID NO: 5)

Производные Tat, полученные путем модулирования мотива передачи сигнала, определяемого SH3-связывающим доменом, запускают дифференцировку преимущественно дендритных клеток или иммунодепрессивных AReg. AReg также являются критическими участниками инвазии опухолей желудка, поджелудочной железы и инфильтрирующих опухолей протоков молочной железы, а также компонентами толерантности при трансплантации органов. Два внешних остатка пролина в положениях 3 и 18, фланкирующих SH3-домен, сохраняются для обеспечения надлежащей структуры для связывания SH3. Кроме того, домен трансдукции из неиммунодепрессивного варианта Tat человека или домен вследствие мутации hr может заменить аминокислоты 3-19 Tat, хотя, согласно прогнозам, последовательность hr увеличивает подавление. Кроме того, стимулирующая форма Tat обезьяны (SEQ ID NO: 3) или ее эквивалентная последовательность человека (SEQ ID NO: 4), может быть заменена в этом домене. Дополнительные химические модификации, такие как ox-Tat (химически окисленный Tat, как описано в US 2006/0160183, включенном в качестве ссылки для всего, что он содержит в отношении производных Tat), можно использовать для стимуляции ответов дендритных клеток/CTL.

В одном варианте осуществления, описанном в настоящем описании, иммунодепрессивное производное Tat включает Tat-пептид, в котором аминокислоты 3-19 изменены. Эти изменения включают замену индивидуальных аминокислот альтернативными аминокислотами или замену всех аминокислот 3-19 другой последовательностью. Пептиды Tat, пригодные для применения для конструирования описанных иммуносупрессивных производных Tat, включают Tat из вариантов ВИЧ-1, вариантов ВИЧ-2 и вариантов SIV. Варианты SIV могут происходить из любого вида примата, который инфицирован SIV, как указано в таблице 4. Также являются пригодными иммунодепрессивные лентивирусные последовательности Tat из не являющегося приматом вида, включая, но не ограничиваясь ими, кошачьих (Tat из вируса иммунодефицита кошачьих, FIV), бычьих (Tat из вируса иммунодефицита бычьих, BIV) или лошадиных (Tat из вируса инфекционной анемии лошадиных, EIAV). Для целей настоящего описания, термин "варианты" относится к пептидам, соответствующим последовательности различных штаммов, встречающихся в природе или мутантных, указанных вирусов.

SH3-связывающие белки содержат серию внутренних остатков пролина, требуемых для функции ядерного фактора транскрипции (TF). В определенных вариантах осуществления каждый из внутренних остатков пролина заменен аланином, что делает SH3-связывающий участок неактивным.

Иллюстративные иммунодепрессивные производные Tat в объеме настоящего изобретения представлены в таблице 1. Как правило, иммунодепрессивный полипептид, являющийся производным Tat, для лечения воспаления, аутоиммунных нарушений и нейродегенерации содержит три области. Первая область представляет собой производное TF, вторая область представляет собой цистеин-богатую область, и третья область представляет собой C-концевую область Tat.

Область TF, цистеин-богатая область и C-концевая область расположены в полипептиде, являющемся производным Tat, в указанном порядке. Область TF может происходить из источника, включающего, но не ограничивающегося ими, Tat ВИЧ-1, Tat ВИЧ-2, Tat SIV, ген hairless или искусственные иммунодепрессивные последовательности. Цистеин-богатая область может происходить из Tat лентивируса или цистеин-богатой молекулы дефензина. C-концевая область может происходить из Tat лентивируса. Кроме того, C-концевые области производного Tat могут содержать аргинин-богатую область из Tat ВИЧ-1, Tat ВИЧ-2 или Tat SIV (также обозначаемая как последовательность транслокации через мембрану).

Как используют в рамках изобретения, термин "молекула дефензина" относится к небольшим цистеин-богатым катионным белкам, встречающимся как у позвоночных, так и у беспозвоночных. Дефензины содержат 18-45 аминокислот, включая от шести до восьми консервативных остатков цистеина. Дефензины подразделяют на три группы: α-дефензины, β-дефензины и θ-дефензины.

В другом варианте осуществления область TF дополнительно содержит последовательность повтора, включающую, но не ограничивающуся ими (PVDPRLEPWKHPGSQP)n (SEQ ID NO: 12), где n=2-10, на N-конце. Более того, последовательность повтора может быть отделена от N-конца иммунодепрессивного полипептида, являющегося производным Tat, одной или несколькими аминокислотами, действующими в качестве спейсера.

В другом варианте осуществления аминокислотная последовательность области TF представляет собой одну из SEQ ID NO: 36, 39, 44, 48, 50, 54, 59, 60 или 61. В другом варианте осуществления аминокислотная последовательность цистеин-богатой области представляет собой одну из SEQ ID NO: 37, 40, 41, 43, 45, 47, 49, 51, 53, 55, 57, 58, 62, 63, 64 или 70. В другом варианте осуществления аминокислотная последовательность C-концевой области представляет собой одну из SEQ ID NO: 38, 42, 46, 47, 49, 52, 53, 68 или 71. В другом варианте осуществления как цистеин-богатая область, так и C-концевая область, происходят из одного и того же источника, и аминокислотная последовательность цистеин-богатой/C-концевой области представляет собой одну из SEQ ID NO: 47, 49 или 53.

В дополнительных вариантах осуществления одна или несколько аминокислот, включая, но не ограничиваясь ими, пролин, в домене TF удалены или заменены путем консервативной аминокислотной замены.

В дополнительных вариантах осуществления предусматривается применение консервативно модифицированных вариантов иммунодепрессивных производных Tat. Варианты, описанные в настоящем описании, сохраняют биологическую активность исходной или являющейся источником молекулы.

Таблица 1
SEQ ID NO. Аминокислотная последовательность Источник †
(SEQ ID NO: )
Область TF Цистеин-богатая область C-концевая область
6
(Nani-P1)
MEPVDANLEAWKHAGSQPRKTACTTCYCKKCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD ВИЧ-1
SEQ ID NO: 59
ВИЧ-1
SEQ ID NO: 62
ВИЧ-1
SEQ ID NO: 42
7
(Nani-P2)
MDPKGEEDQDVSHQDLIKQYRKPRTACNNCYCKKCCFHCYACFLRKGLGITYHAFRTRRKKIASADRIPVPQQSISIRGRDSQTTQESQKKVEEQAKANLRISRKNLGDETRGPVGAGN SIVagma
SEQ ID NO: 60
ВИЧ-1
SEQ ID NO: 63
SIVagm
SEQ ID NO: 68
8
(Nani-P3)
METPLKEQENSLESCREHSSSISEVDVPTPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRKPFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD SIVsmmb
SEQ ID NO: 61
β-дефензин-3 мыши
SEQ ID NO: 64
ВИЧ-1
SEQ ID NO: 42
9 MDPIDPDLEPWKHPGSQPETACNNCFCKKCSYHCLVCFQKKGLGISHGRKKRRQRRSAPPSSEDHQNLISKQPIPRTQGDQTGSEESKKKVESKTETDPFD SIVcpzc
SEQ ID NO: 39
ВИЧ-1
SEQ ID NO: 49
10 MEPLTPHPWVYSGGQPKVPTTACSKCYCKICCWHCQLCLKKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD Ген hr человека
SEQ ID NO: 48
ВИЧ-1
SEQ ID NO: 66
ВИЧ-1
SEQ ID NO: 42
11 MAGPHPVIVITGPHEEPRKTACTTCYCKKCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD VIVITd
SEQ ID NO: 50
ВИЧ-1
SEQ ID NO: 67
ВИЧ-1
SEQ ID NO: 42
13 MDPTDPELPPWQQPGSQPPTPRKTACTTCYCKKCCFHCQVCFLQKGLGITYARPRKRAARSISEDDSAPTEPYPGPEGPRQTRRRRRRQWRQRRTQRLYLQQRIFEAIFGSRTAALEDSLQQLQISD SIVgore
SEQ ID NO: 36
ВИЧ-1
SEQ ID NO: 37
SIVsykf
SEQ ID NO: 38
14 MDPIDPDLEPWKHPGSQPETACNNCFCKKCSYHCLVCFLQKGLGITYARPRKRAARSISEDDSAPTEPYPGPEGPRQTRRRRRRQWRQRRTQRLYLQQRIFEAIFGSRTAALEDSLQQLQISD SIVcpz
SEQ ID NO: 39
ВИЧ-1
SEQ ID NO: 40
SIVsyk
SEQ ID NO: 38
15 MDPIDPDLEPWKHPGSQPACYCRIPACIAGERRYGTCIYQGRLWAFCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD SIVcpz
SEQ ID NO: 39
α-дефензин-1 человека
SEQ ID NO: 41
ВИЧ-1
SEQ ID NO: 42
16 MDPIDPDLEPWKHPGSQPGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD SIVcpz
SEQ ID NO: 39
β-дефензин-2 человека
SEQ ID NO: 43
ВИЧ-1
SEQ ID NO: 42
17 MEPVDPRLEPWKHPGSQPKTACNNCHCKVCCYHCVYCFTKKGLGISYGRKKRRRPARTADKDQDNQDPVSKQSLAGTRSQQE ВИЧ-1
SEQ ID NO: 44
SIVcpz
SEQ ID NO: 45
SIVgor
SEQ ID NO: 46
18 MDPIDPDLEPWKHPGSQPTTACSKCYCKICCWHCQLCLKKGLGISYGRKKRKHRRGTPQSSKDHQNPIPEQPLPIIRGNPTDPKESKKEVASKAETDPFD SIVcpz
SEQ ID NO: 39
ВИЧ-1
SEQ ID NO: 47
19 MEPLTPHPWVYSGGQPKVPETACNNCFCKKCSYHCLVCFQKKGLGISHGRKKRRQRRSAPPSSEDHQNLISKQPIPRTQGDQTGSEESKKKVESKTETDPFD Ген hr человека
SEQ ID NO: 48
ВИЧ-1
SEQ ID NO: 49
20 MAGPHPVIVITGPHEEPTTACSKCYCKICCWHCQLCLKKGLGISYGRKKRKHRRGTPQSSKDHQNPIPEQPLPIIRGNPTDPKESKKEVASKAETDPFD VIVIT
SEQ ID NO: 50
ВИЧ-1
SEQ ID NO: 47
21 MAGPHPVIVITGPHEEPETACNNCFCKKCSYHCLVCFQKKGLGISHGRKKRRQRRSAPPSSEDHQNLISKQPIPRTQGDQTGSEESKKKVESKTETDPFD VIVIT
SEQ ID NO: 50
ВИЧ-1
SEQ ID NO: 49
22 MEPLTPHPWVYSGGQPKVPRTCHCRSRCLRRESNSGSCNINGRISSLCCFLKKGLGISYEKSHRRRRTPKKAKANTSSASNEPIPNRIRLCQPKKAKKETVEAAVATAPGLGR Ген hr человека
SEQ ID NO: 48
Миелоидный α-дефензин-9g
SEQ ID NO: 51
SIVmach
SEQ ID NO: 52
23 MAGPHPVIVITGPHEEPRTCHCRSRCLRRESNSGSCNINGRISSLCCFLKKGLGISYEKSHRRRRTPKKAKANTSSASNEPIPNRIRLCQPKKAKKETVEAAVATAPGLGR VIVIT
SEQ ID NO: 50
Миелоидный α-дефензин-9
SEQ ID NO: 51
SIVmac
SEQ ID NO: 52
24 MDPIDPDLEPWKHPGSQPRTCHCRSRCLRRESNSGSCNINGRISSLCCFLKKGLGISYEKSHRRRRTPKKAKANTSSASNEPIPNRIRLCQPKKAKKETVEAAVATAPGLGR SIVcpz
SEQ ID NO: 39
Миелоидный α-дефензин-9
SEQ ID NO: 51
SIVmac
SEQ ID NO: 52
25 MEPLTPHPWVYSGGQPKVPLEACYNKCYCKRCCYHCQHCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR Ген hr человека
SEQ ID NO: 48
SIVsmm
SEQ ID NO: 53
26 MAGPHPVIVITGPHEEPLEACYNKCYCKRCCYHCQHCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR VIVIT
SEQ ID NO: 50
SIVsmm
SEQ ID NO: 53
27 MDPIDPDLEPWKHPGSQPLEACYNKCYCKRCCYHCQHCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR SIVcpz
SEQ ID NO: 39
SIVsmm
SEQ ID NO: 53
28 MMEPVDPDLPKEQHPPATPRCESCKLGRGRCRKECLENEKPDGRCRLNFLCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD SIVmoni
SEQ ID NO: 54
β-дефензин-105j
SEQ ID NO: 55
ВИЧ-1
SEQ ID NO: 42
29 MEPLTPHPWVYSGGQPKVPCESCKLGRGRCRKECLENEKPDGRCRLNFLCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD Ген hr человека
SEQ ID NO: 48
β-дефензин-105
SEQ ID NO: 55
ВИЧ-1
SEQ ID NO: 42
30 MDPIDPDLEPWKHPGSQPCESCKLGRGRCRKECLENEKPDGRCRLNFLCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD SIVcpz
SEQ ID NO:
β-дефензин-105
SEQ ID NO: 55
ВИЧ-1
SEQ ID NO: 42
31 MAGPHPVIVITGPHEEPCESCKLGRGRCRKECLENEKPDGRCRLNFLCCFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERET ETDPFD VIVIT
SEQ ID NO: 50
β-дефензин-105
SEQ ID NO: 55
ВИЧ-1
SEQ ID NO: 42
32 MEPVDPRLEPWKHPGSQPPEPVDPRLEPWKHPGSQPKTACNNCHCKVCCYHCVYCFFHCQVCFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQPASQSRGDPTGPTESKKKVERETETDPFD ВИЧ-1
SEQ ID NO: 56
SIVcpz
SEQ ID NO: 57
ВИЧ-1
SEQ ID NO: 42
33 MEPLTPHPWVYSGGQPKVPLRCICRRGICRLLQRRYGSCAFPGRLYRICCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR Ген hr человека
SEQ ID NO: 48
θ-дефензинk
SEQ ID NO: 58
SIVsmm
SEQ ID NO: 52
34 MAGPHPVIVITGPHEEPLRCICRRGICRLLQRRYGSCAFPGRLYRICCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR VIVIT
SEQ ID NO: 50
θ-дефензин
SEQ ID NO: 58
SIVsmm
SEQ ID NO: 52
35 MDPIDPDLEPWKHPGSQPLRCICRRGICRLLQRRYGSCAFPGRLYRICCFLKKGLGICYEQQRRRTPKKTKANTSSASDKSLSRRARNCQPKKEKKETVEAEVATDLGLGR SIVcpz
SEQ ID NO: 39
θ-дефензин
SEQ ID NO: 58
SIVsmm
SEQ ID NO: 52
69 MEPLTPHPWVYSGGQPKVPLEACYNKCYCKRCCYHCQHCFSKKGLGISYERKGRRRRTPRKTKTPSPSAPDKSISTRTGDSQPTKEQKKTSEATVVTTCGLGQ Ген hr человека
SEQ ID NO: 48
SIVsmm
SEQ ID NO: 70
ВИЧ-2
SEQ ID NO: 71
a agm = африканская зеленая мартышка; b smm = дымчатый мангабей; c cpz = шимпанзе; d VIVIT = искусственная последовательность TF; e gor = горилла; f syk = обезьяна Сайкса; g из Macaca mulatta; h mac = макак; i mon = мартышка мона; j из Chlorocebus aethiops; k из Pongo abelli.

Как используется в рамках изобретения, термин "консервативно модифицированные варианты" относится к вариантам пептидов, которые имеют ту же или сходную биологическую активность, что и исходные пептиды. Например, можно проводить консервативные аминокислотные замены, которые, хотя они и изменяют первичную последовательность белка или пептида, не изменяют их функцию. Консервативный вариант имеет по меньшей мере одну аминокислоту, замененную другой аминокислотой или аналогом аминокислоты, который имеет по меньшей мере одно свойство, сходное со свойством исходной аминокислоты из иллюстративного эталонного пептида. Примеры свойств включают, но не ограничиваются ими, сходный размер, топографию, заряд, гидрофобность, гидрофильность, липофильность, способность образовывать ковалентные связи, способность образовывать водородные связи, физико-химические свойства и т.п. или любую их комбинацию. Консервативную замену можно оценивать с помощью различных факторов, например, таких как физические свойства подвергаемой замене аминокислоты (таблица 2) или то, насколько исходная аминокислота допускает замену (таблица 3). Выбор того, какую аминокислоту можно заменять другой аминокислотой в пептиде, описанном в настоящем описании, известен специалисту в данной области. Консервативный вариант может функционировать по существу аналогично иллюстративному эталонному пептиду, и он может заменять другой иллюстративный эталонной пептид в любом аспекте настоящего описания.

Таблица 2
Свойства аминокислот
Свойство Аминокислоты
Алифатические G, A, I, L, M, P, V
Ароматические F, H, W, Y
C-бета-разветвленные I, V, T
Гидрофобные C, F, I, L, M, V, W
Небольшие полярные D, N, P
Небольшие неполярные A, C, G, S, T
Крупные полярные E, H, K, Q, R, W, Y
Крупные неполярные F, I, L, M, V
Заряженные D, E, H, K, R
Незаряженные C, S, T
Отрицательные D, E
Положительные H, K, R
Кислотные D, E
Основные K, R
Амидные N, Q

Таблица 3
Замены аминокислот
Аминокислота Благоприятная замена Нейтральные замены Неблагоприятные замены
A G, S, T C, E, I, K, M, L, P, Q, R, V D, F, H, N, Y, W
C F, S, Y, W A, H, I, M, L, T, V D, E, G, K, N, P, Q, R
D E, N G, H, K, P, Q, R, S, T A, C, I, L,
E D, K, Q A, H, N, P, R, S, T C, F, G, I, L, M, V, W, Y
F M, L, W, Y C, I, V A, D, E, G, H, K, N, P, Q, R, S, T
G A, S D, K, N, P, Q, R C, E, F, H, I, L, M, T, V, W, Y
H N, Y C, D, E, K, Q, R, S, T, W A, F, G, I, L, M, P, V
I V, L, M A, C, T, F, Y D, E, G, H, K, N, P, Q, R, S, W
K Q, E, R A, D, G, H, M, N, P, S, T C, F, I, L, V, W, Y
L F, I, M, V A, C, W, Y D, E, G, H, K, N, P, Q, R, S, T
M F, I, L, V A, C, R, Q, K, T, W, Y D, E, G, H, N, P, S
N D, H, S E, G, K, Q, R, T A, C, F, I, L, M, P, V, W, Y
P - A, D, E, G, K, Q, R, S, T C, F, H, I, L, M, N, V, W, Y
Q E, K, R A, D, G, H, M, N, P, S, T C, F, I, L, V, W, Y
R K, Q A, D, E, G, H, M, N, P, S, T C, F, I, L, V, W, Y
S A, N, T C, D, E, G, H, K, P, Q, R, T F, I, L, M, V, W, Y
T S A, C, D, E, H, I, K, M, N, P, Q, R, V F, G, L, W, Y
V I, L, M A, C, F, T, Y D, E, G, H, K, N, P, Q, R, S, W
W F, Y H, L, M A, C, D, E, G, I, K, N, P, Q, R, S, T, V
Y F, H, W C, I, L, M, V A, D, E, G, K, N, P, Q, R, S, T
Matthew J. Betts и Robert, B. Russell, Amino Acid Properties and Consequences of Substitutions, pp. 289-316, In Bioinformatics for Geneticists, (eds Michael R. Barnes, Ian C. Gray, Wiley, 2003).

Таблица 4
Сокращенные обозначения штаммов SIV, пригодных для пептидов, являющихся производными Tat
Обозначение SIV-хозяина Вид SIV-хозяина Латинское обозначение
SIVagmVer (африканская зеленая мартышка) Vervet Chlorocebus pygerythrus
SIVagmGri (африканская зеленая мартышка) Grivet Chlorocebus aethiоps
SIVagmTan (африканская зеленая мартышка) Tantalus Chlorocebus tantalus
SIVagmSab (африканская зеленая мартышка) Sabeus Chlorocebus sabaeus
SIVrcm Красношапочный мангабей Cercocebus torquatus torquatus
SIVsyk Обезьяна Сайкса Cercopithecus albogularis
SIVagi Хохлатый мангабей Cercocebus agilis
SIVsun Желтохвостая мартышка Cercopithecus solatus
SIVlho Бородатая мартышка Cercopithecus lhoesti
SIVstm Короткохвостый макак Macaca arctoides
SIVmac Макак Macaca mulatta
SIVsmm Дымчатый мангабей Cercocebus atys atys
SIVmnd Мандрил Mandrillus sphinx
SIVdrl Дрил Mandrillus leucophaeus
SIVtal Крошечная мартышка Miopithecus talapoin
SIVmus Усатая мартышка Cercopithecus cephus
SIVdeb Мартышка де Бразза Cercopithecus neglectus
SIVden Мартышка Дента Cercopithecus denti
SIVmon Мартышка мона Cercopithecus mona
SIVgor Горилла Gorilla gorilla
SIVwrc Западный красный колобус Procolobus verus
SIVcpzPtt Pan Troglodytes Troglodytes Pan troglodytes troglodytes
SIVcpzPts Pan Troglodytes Schweinfurthi Pan troglodytes schweinfurthii
SIVmne Свинохвостый макак Macaca nemestrina
SIVasc Краснохвостая мартышка Cercopithecus ascanius schmidti
SIVbab Желтый бабуин Papio spp.
SIVblc Черный колобус Биоко Cercopithecus satanas satanas
SIVbkm Черный мангабей Lophocebus aterrimus
SIVblu Голубая мартышка Cercopithecus mitis
SIVcol Королевский колобус Colobus guereza
SIVolc Оливковый колобус procolobus verus
SIVgsn Большая белоносая мартышка Cercopithecus nictitans
SIVkrc Красный колобус Кибале Procolobus [Piliocolobus] rufomitratus tephrosceles
SIVpat Мартышка-гусар Erythrocebus patas
SIVpre Мартышка Преусса Cercopithecus preussi
SIVreg Красноухая мартышка Cercopithecus erythrotis erythrotis
SIVtrc Красный колобус Чуапа Piliocolobus tholloni
SIVwcm Белоголовый мангабей Cercocebus torquatus lunulatus
SIVwol Мартышка Вольфа Cercopithecus wolfi

В одном варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, представляет собой пептид, описанный в таблице 1. Иммунодепрессивный полипептид, являющийся производным Tat, также может содержать консервативные варианты полипептида, являющегося производным Tat. В одном варианте осуществления консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, представляет собой консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, описанного в настоящем описании. В аспектах этого варианта осуществления консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, может иметь, например, аминокислотную последовательность, обладающую по меньшей мере 50%, 55%, 60%, 65%, 70%, 75%, по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью аминокислотной последовательности с иммунодепрессивным полипептидом, являющимся производным Tat. В других аспектах этого варианта осуществления консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, может иметь, например, аминокислотную последовательность, обладающую не более чем 50%, 55%, 60%, 65%, 70%, 75%, не более чем 80%, не более чем 85%, не более чем 90%, не более чем 95%, не более чем 97% или не более чем 98%, или не более чем 99% идентичностью аминокислотной последовательности с иммунодепрессивным полипептидом, являющимся производным Tat.

В других аспектах этого варианта осуществления консервативный вариант иммунодепрессивного полипептида, являющийся производным Tat, может представлять собой, например, иммунодепрессивный полипептид, являющийся производным Tat, имеющий 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30 или более консервативных замен аминокислотной последовательности иммунодепрессивного полипептида, являющегося производным Tat. В других аспектах этого варианта осуществления консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, может иметь, например, аминокислотную последовательность, имеющую по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 20, или по меньшей мере 25 консервативных замен аминокислотной последовательности иммунодепрессивного полипептида, являющегося производным Tat. В других аспектах этого варианта осуществления консервативный вариант иммунодепрессивного полипептида, являющегося производным Tat, может иметь, например, аминокислотную последовательность, имеющую не более 1, не более 2, не более 3, не более 4, не более 5, не более 6, не более 7, не более 8, не более 9, не более 10, не более 11, не более 12, не более 13, не более 14, не более 15, не более 20, не более 25 или не более 30 консервативных замен аминокислотной последовательности иммунодепрессивного полипептида, являющегося производным Tat.

Модификации (которые обычно не изменяют первичную последовательность) включают химическую дериватизацию полипептидов in vivo, или in vitro, например, ацетилирование или карбоксилирование. Также включены модификации путем гликозилирования, например, модификации характера гликозилирования полипептида в процессе синтеза и процессинга или на последующих стадиях процессинга; например, путем воздействия на полипептид ферментов, которые влияют на гликозилирование, например, гликозилирующие или дегликозилирующие ферменты млекопитающих. Также охватываются последовательности, которые имеют фосфорилированные аминокислотные остатки, например, фосфотирозин, фосфосерин или фосфотреонин.

Также включены иммунодепрессивные полипептиды, являющиеся производными Tat, которые модифицированы с использованием обычных молекулярно-биологических способов, чтобы улучшить их устойчивость к протеолитической деградации или чтобы оптимизировать свойства растворимости. Аналоги таких полипептидов включают аналоги, содержащие остатки, отличные от встречающихся в природе L-аминокислот, например, D-аминокислоты или не встречающиеся в природе синтетические аминокислоты. Пептиды, описанные в настоящем описании, не ограничиваются продуктами какого-либо конкретного иллюстративного процесса, приведенного в настоящем описании.

В дополнение к по существу полноразмерным полипептидам, настоящее изобретение также относится к биологически активным фрагментам иммунодепрессивных полипептидов, являющихся производными Tat.

Как используют в рамках изобретения, аминокислотные последовательности, которые являются по существу одинаковыми, как правило, обладают более чем 95% аминокислотной идентичностью. Однако подразумевается, что белки (и ДНК или мРНК, кодирующие такие белки), обладающие менее чем описанным выше уровнем идентичности, появляющиеся в качестве вариантов по сплайсингу, или которые модифицированы консервативными аминокислотными заменами (или заменой вырожденных кодонов), входят в объем настоящего изобретения. Как общеизвестно специалистам в данной области, для выравнивания последовательностей для их сравнения были разработаны различные способы, например, оценочная матрица Blosum 62, как описано Henikoff and Henikoff, Proc. Natl. Acad Sci. USA 89:10915 (1992). Алгоритмы, которые удобно использовать для этой цели, широко доступны (см., например, Needleman and Wunsch, J. Mol. Bio. 48:443 (1970).

Таким образом, в настоящем описании описаны аминокислотные последовательности, на 85%, 90%, 95%, 98%, 99% или 100% идентичные иммуносупрессивным производным Tat, представленным в таблице 1.

Иммунодепрессивное производное Tat содержит измененный пептид Tat. В одном аспекте этого варианта осуществления иммунодепрессивное производное Tat содержит пептид Tat, в котором аминокислоты 3-19 изменены. В другом аспекте этого варианта осуществления иммунодепрессивное производное Tat содержит пептид Tat, в котором аминокислоты 3-19 SEQ ID NO: 6-11, 13-35 или 69 изменены.

В других аспектах этого варианта осуществления иммунодепрессивное производное Tat обладает, например, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90%, по меньшей мере 93%, по меньшей мере 95%, по меньшей мере 97%, или по меньшей мере 99% аминокислотной идентичностью с SEQ ID NO: 6-11, 13-35 или 69. В других аспектах этого варианта осуществления иммунодепрессивное производное Tat имеет, например, не более чем 70%, не более чем 75%, не более чем 80%, не более чем 85%, не более чем 90%, не более чем 93%, не более чем 95%, не более чем 97%, или не более чем 99% аминокислотную идентичность с SEQ ID NO: 6-11, 13-35 или 69.

В других аспектах этого варианта осуществления иммунодепрессивное производное Tat имеет, например, по меньшей мере одну, по меньшей мере две, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять или по меньшей мере десять последовательно расположенных аминокислотных замен, делеций и/или вставок относительно SEQ ID NO: 6-11, 13-35 или 69. В других аспектах этого варианта осуществления иммунодепрессивное производное Tat имеет, например, не более одной, не более двух, не более трех, не более четырех, не более пяти, не более шести, не более семи, не более восьми, не более девяти или не более десяти последовательно расположенных аминокислотных замен, делеций и/или вставок относительно SEQ ID NO: 6-11, 13-35 или 69.

В других аспектах этого варианта осуществления иммунодепрессивное производное Tat имеет, например, по меньшей мере одну, по меньшей мере две, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять или по меньшей мере десять не являющихся соседними аминокислотных замен, делеций и/или вставок относительно SEQ ID NO: 6-11, 13-35 или 69. В других аспектах этого варианта осуществления иммунодепрессивное производное Tat имеет, например, не более одной, не более двух, не более трех, не более четырех, не более пяти, не более шести, не более семи, не более восьми, не более девяти или не более десяти не являющихся соседними аминокислотных замен, делеций и/или вставок относительно SEQ ID NO: 6-11, 13-35 или 69.

Более того, пептиды, описанные в настоящем описании, могут самоассоциировать в мультимеры, включая, но не ограничиваясь ими, димеры, тримеры и тетрамеры, в дополнение к существованию в мономерной форме. Мультимеризация пептидов может происходить спонтанно, или она может облегчаться воздействием на пептиды условий, способствующих мультимеризации. Эти условия известны специалистам в области пептидной химии. Композиции, описанные в настоящем описании, могут включать мономеры или мультимеры пептидов или смесь мономеров и мультимеров.

Следующие экспрессирующие системы являются пригодными для применения для экспрессии описанных иммунодепрессивных производных Tat: экспрессирующие системы клеток млекопитающих, такие как, но не ограничиваясь ими, экспрессирующие системы клеток насекомых, такие как, но не ограничиваясь ими, экспрессирующая система Bac-to-Bac, бакуловирусная экспрессирующая система и экспрессирующие системы DES; и экспрессирующие системы E. coli, включая, но не ограничиваясь ими, экспрессирующие системы pET, pSUMO и GST. В другом варианте осуществления производные Tat экспрессируются с гистидиновой меткой, пригодной для выделения полипептида. Системы для очистки с гистидиновыми метками известны специалистам в данной области. Более того, иммунодепрессивные производные Tat можно синтезировать общепринятыми способами химического синтеза, известными специалистам в данной области.

Как используют в рамках изобретения, термины "проведение лечения" или "лечение", когда их используют в отношении нарушения, включают предупреждение по меньшей мере одного симптома состояния, т.е. обеспечение того, чтобы клинический симптом не развивался в значительной степени у индивидуума, который может иметь или может быть предрасположенным к заболеванию, но не испытывать или не проявлять симптомы заболевания, ингибирование заболевания, т.е. остановку или уменьшение развития заболевания или его симптомов, или смягчение заболевания, т.е. обеспечение регрессии заболевания или его клинических симптомов. Лечение, предупреждение и смягчение состояния, как используют в рамках изобретения, может включать, например, снижение или устранение вредоносного или опасного состояния, ассоциированного с воспалением, аутоиммунным нарушением или нейродегенеративным заболеванием.

"Терапевтически эффективное количество" обозначает количество, требуемое для достижения терапевтического эффекта.

Настоящее изобретение также относится к фармацевтическим композициям, содержащим описанные выше иммунодепрессивные полипептиды, являющиеся производными Tat. Дозировки и желаемые концентрации лекарственного средства в описанных фармацевтических композициях могут варьировать в зависимости от конкретного предполагаемого применения. Определение подходящей дозировки или пути введения находится в пределах квалификации среднего врача. Эксперименты на животных обеспечивают надежное руководство для определения эффективных доз для терапии человека. Межвидовое масштабирование эффективных доз можно проводить в соответствии с принципами Mardenti, J. and Chappell, W. "The use of interspecies scaling in toxicokinetics", Toxicokinetics and New Drug Development, Yacobi et al, Eds., Pergamon Press, New York 1989, pp. 42-96. В одном варианте осуществления заболевание присутствует. В другом варианте осуществления жизнь индивидуума продлевается благодаря способам, описанным в настоящем описании.

Таким образом, композиции, предназначенные для перорального, назального, лингвального, сублингвального, буккального, интрабуккального, внутривенного, подкожного, внутримышечного и легочного введения, можно получать без излишнего экспериментирования способами, известными в данной области, например, с инертными разбавителем или с фармацевтически приемлемым носителем. Для целей терапевтического введения в фармацевтические композиции можно включать эксципиенты и использовать в форме таблеток, лепешек, капсул, эликсиров, суспензий, растворов, сиропов и т.п. "Фармацевтически приемлемый носитель" означает любой из стандартных фармацевтических носителей. Примеры подходящих носителей хорошо известны в данной области, и они могут включать, но не ограничиваться ими, любой из стандартных фармацевтических носителей, таких как фосфатно-солевые буферы, фосфатно-солевой буфер, содержащий Polysorb 80, вода, эмульсии, такие как эмульсия типа "масло/вода" и различные типы смачивающих веществ. Другие носители также могут включать стерильные растворы, таблетки, покрытые таблетки и капсулы. Как правило, такие носители содержат эксципиенты, такие как крахмал, молоко, сахар, определенные типы глины, желатин, стеариновая кислота или ее соли, магний или стеарат кальция, тальк, растительные жиры или масла, камеди, гликоли и другие известные. Композиции, содержащие такие носители, составляют хорошо известными общепринятыми способами.

Композиции иммунодепрессивного полипептида, являющегося производным Tat, можно без труда вводить парентерально, например, путем внутривенной, внутримышечной, интратекальной или подкожной инъекции. Парентеральное введение можно осуществлять путем включения соединений в раствор или суспензию. Такие растворы или суспензии также могут включать стерильные разбавители, такие как вода для инъекций, солевой раствор, жирные масла, полиэтиленгликоли, глицерин, пропиленгликоль или другие синтетические растворители. Парентеральные составы также могут включать антибактериальные средства, например, такие как бензиловый спирт или метилпарабены, антиоксиданты, например, такие как аскорбиновая кислота или бисульфит натрия и хелатирующие агенты, такие как EDTA. Также можно добавлять буферы, такие как ацетаты, цитраты или фосфаты и средства для коррекции тоничности, такие как хлорид натрия или декстроза. Парентеральный препарат может быть заключен в ампулы, одноразовые шприцы или флаконы с многократной дозой, изготовленные из стекла или пластмассы.

Трансдермальное введение включает впитывание композиции через кожу. Трансдермальные составы включают пластыри, устройства для ионофереза, мази, кремы, гели, бальзамы и т.п.

Композиция может включать различные материалы, которые модифицируют физическую форму твердой или жидкой дозированной единицы. Например, композиция может включать материалы, которые образуют оболочку вокруг активных ингредиентов. Материалы, которые образуют оболочку, как правило, являются инертными и могут быть выбраны, например, из сахара, шеллака и других кишечнорастворимых оболочек. Альтернативно, активные ингредиенты могут быть заключены в желатиновую капсулу или крахмальную капсулу.

Композиции иммунодепрессивного полипептида, являющегося производным Tat, по настоящему изобретению можно вводить в терапевтически эффективном количестве, в соответствии с соответствующим режимом дозирования. Как понятно квалифицированному специалисту, точное требуемое количество может варьировать от индивидуума к индивидууму в зависимости от вида, возраста и общего состояния индивидуума, тяжести заболевания, конкретного средства(средств) и способа введения. В некоторых вариантах осуществления вводят от приблизительно 0,0001 мг/кг до приблизительно 50 мг/кг композиции в расчете на массу тела индивидуума, один или несколько раз в сутки, для достижения желаемого терапевтического эффекта. В других вариантах осуществления вводят от приблизительно 0,001 мг/кг до приблизительно 50 мг/кг, от приблизительно 0,01 мг/кг до приблизительно 50 мг/кг, от приблизительно 0,1 мг/кг до приблизительно 50 мг/кг, от приблизительно 1 мг/кг до приблизительно 50 мг/кг, от приблизительно 10 мг/кг до приблизительно 50 мг/кг, от приблизительно 0,0001 мг/кг до приблизительно 25 мг/кг, от приблизительно 0,0001 мг/кг до приблизительно 10 мг/кг, от приблизительно 0,0001 мг/кг до приблизительно 5 мг/кг, от приблизительно 0,0001 мг/кг до приблизительно 1 мг/кг, от приблизительно 1 мг/кг до приблизительно 45 мг/кг, от приблизительно 1 мг/кг до приблизительно 40 мг/кг, от приблизительно 1 мг/кг до приблизительно 35 мг/кг, от приблизительно 1 мг/кг до приблизительно 30 мг/кг, от приблизительно 1 мг/кг до приблизительно 25 мг/кг, от приблизительно 1 мг/кг до приблизительно 20 мг/кг, от приблизительно 1 мг/кг до приблизительно 15 мг/кг, от приблизительно 1 мг/кг до приблизительно 10 мг/кг или от приблизительно 1 мг/кг до приблизительно 5 мг/кг композиции в расчете на массу тела индивидуума, один или несколько раз в сутки для достижения желаемого терапевтического эффекта.

Общую суточную дозировку композиций определяет лечащий врач по своему усмотрению. Конкретный уровень терапевтически эффективной дозы для любого конкретного пациента или индивидуума зависит от различных факторов, включая нарушение, подвергаемое лечению и тяжесть нарушения; активность конкретного используемого соединения; конкретную используемую композицию; возраст, массу тела, общее состояние здоровья, пол и режим питания пациента или индивидуума; время введения, путь введения и скорость экскреции конкретного используемого соединения; длительность лечения; лекарственные средства, используемые в комбинации или по совпадению с конкретным используемым соединением, и другие факторы, хорошо известные в области медицины.

Описанные композиции также можно использовать в комбинированной терапии. Следовательно, композиции, описанные в настоящем описании, можно вводить одновременно, до или после одной или нескольких других желаемых композиций, терапевтических средств, способов лечения или медицинских процедур. Конкретную комбинацию способов терапии определяет лечащий врач, и он учитывает совместимость способов лечения и желаемого терапевтического эффекта, который намереваются достигнуть. Будет понятно, что терапевтически активные вещества, используемые в комбинации, можно вводить вместе в одной композиции, способе лечения или процедуре, или альтернативно их можно вводить по отдельности. Пригодные лекарственные средства включают, но не ограничиваются ими, иммунодепрессивные средства, противовоспалительные средства, химиотерапевтические средства, иммуномодулирующие средства, биологические средства и низкомолекулярные средства.

В другом варианте осуществления предусматривается повторяющееся или частое дозирование описанных иммунодепрессивных производных Tat. Частое дозирование представляет собой одну из процедур, используемых, например, при терапии аллергии, которая может поддерживать иммунологическую толерантность к средству.

Число повторяющихся доз иммунодепрессивных производных Tat может быть установлено медицинским профессионалом, исходя из ответа пациента на дозы. В одном варианте осуществления иммунодепрессивное производное Tat вводят один раз в трое суток на протяжении 3 доз в течение периода десяти суток. Затем эту схему введения повторяют в течение нескольких курсов. Настоящее изобретение предусматривает множество различных схем введения, где иммунодепрессивное производное Tat вводят множество раз в выбранные временные рамки, а затем схему введения повторяют в течение множества курсов. В другом варианте осуществления введение иммунодепрессивного производного Tat может чередоваться с введением одного или нескольких других лекарственных средств.

Аспекты настоящего описания относятся, частично, к композиции, содержащей иммунодепрессивный полипептид, являющийся производным Tat. Иммунодепрессивный полипептид, являющийся производным Tat, включает соединения, описанные в настоящем описании. Композиции, описанные в настоящем описании, могут содержать или могут не содержать любое число и комбинацию соединений, описанных в настоящем описании. Например, композиция может содержать два или более соединений, описанных в настоящем описании, или три или более соединений, описанных в настоящем описании.

Соединение, описанное в настоящем описании, или композицию, содержащую такое соединение, как правило, вводят индивидууму в качестве фармацевтической композиции. Фармацевтические композиции можно получать путем комбинирования терапевтически эффективного количества по меньшей мере одного соединения, как описано в настоящем описании, в качестве активного ингредиента с общепринятыми фармацевтическими эксципиентами, и путем получения единичных дозированных форм, пригодных для терапевтического применения. Как используют в рамках изобретения, термин "фармацевтическая композиция" относится к терапевтически эффективной концентрации активного соединения, например, такого как любые из соединений, описанных в настоящем описании. Предпочтительно, фармацевтическая композиция не вызывает неблагоприятной, аллергической или другой неблагоприятной или нежелательной реакцией при введении индивидууму. Фармацевтическая композиция, описанная в настоящем описании, является пригодной для медицинских и ветеринарных применений. Фармацевтическую композицию можно вводить индивидууму отдельно или в комбинации с дополнительными активными соединениями, средствами, лекарственными средствами или гормонами. Фармацевтические композиции можно получать с использованием любого из множества процессов, включая, но не ограничиваясь ими, общепринятое смешение, растворение, гранулирование, изготовление драже, растирание, эмульгирование, инкапсулирование, улавливание и лиофилизацию. Фармацевтическая композиция может принимать любую из множества форм, включая, но не ограничиваясь ими, стерильный раствор, суспензию, эмульсию, лиофилизат, порошок, сироп, эликсир или любую другую дозированную форму, пригодную для введения.

Жидкие дозированные формы, пригодные для парентеральной инъекции, могут содержать физиологически приемлемые стерильные водные или неводные растворы, дисперсии, суспензии или эмульсии и стерильные порошки для разбавления в стерильные инъецируемые растворы или дисперсии. Примеры пригодных водных и неводных носителей, разбавителей, растворителей или наполнителей включают воду, этанол, полиолы (пропиленгликоль, полиэтиленгликоль (PEG), глицерин и т.п.), их подходящие смеси, растительные масла (такие как оливковое масло) и инъецируемые органические сложные эфиры, такие как этилолеат. Надлежащую текучесть можно поддерживать, например, с использованием покрытия, такого как лецитин, путем поддержания требуемого размера частиц в случае дисперсий и с использованием поверхностно-активных веществ. В жидких составах терапевтически эффективное количество соединения, описанного в настоящем описании, может составлять от приблизительно 0,0001% (масс./об.) до приблизительно 50% (масс./об.), от приблизительно 0,001% (масс./об.) до приблизительно 10,0% (масс./об.) или от приблизительно 0,01% (масс./об.) до приблизительно 1,0% (масс./об.).

Фармацевтическая композиция, описанная в настоящем описании, необязательно может включать фармацевтически приемлемый носитель, которые облегчает переработку активного соединения в фармацевтически приемлемые композиции. Как используют в рамках изобретения, термин "фармацевтически приемлемый" относится к соединениям, материалам, композициям и/или дозированным формам, которые по мнению медицинского специалиста пригодны для контактирования с тканями человека и животных без чрезмерной токсичности, раздражения, аллергического ответа или других осложнений в соответствии с приемлемым соотношением польза/риск. Как используют в рамках изобретения, термин "фармакологически приемлемый носитель" является синонимом термину "фармакологический носитель", и он относится к любому носителю, который по существу не обладает длительным или постоянным вредоносным эффектом при введении и охватывает термины, такие как "фармакологически приемлемый носитель, стабилизатор, разбавитель, добавка, вспомогательное вещество или эксципиент". Такой носитель, как правило, смешивают с активным соединением, или ему позволяют разбавить или заключить в себе активное соединение, и он может представлять собой твердое, полутвердое или жидкое средство. Понятно, что активные соединения могут быть растворимыми, или их можно добавлять в качестве суспензии в желаемом носителе или разбавителе. Можно использовать любой из множества фармацевтически приемлемых носителей, включая, но не ограничиваясь ими, водные среды, например, такие как вода, солевой раствор, глицин, гиалуроновая кислота и т.п.; твердые носители, например, такие как крахмал, стеарат магния, маннит, сахарин натрия, тальк, целлюлоза, глюкоза, сахароза, лактоза, трегалоза, карбонат магния и т.п.; растворители; дисперсионные среды; покрытия; антибактериальные и противогрибковые средства; изотонические и замедляющие всасывание средства; или любой другой неактивный ингредиент. Выбор фармакологически приемлемого носителя может зависеть от способа введения. За исключением случаев, когда какой-либо фармакологически приемлемый носитель является несовместимым с активным соединением, предусматривается его применение в фармацевтически приемлемых композициях. Неограничивающие примеры конкретных применений таких фармацевтических носителей могут быть найдены в Pharmaceutical Dosage Forms and Drug Delivery Systems (Howard C. Ansel et al., eds., Lippincott Williams & Wilkins Publishers, 7th ed. 1999); Remington: The Science and Practice of Pharmacy (Alfonso R. Gennaro ed., Lippincott, Williams & Wilkins, 20th ed. 2000); Goodman & Gilman's The Pharmacological Basis of Therapeutics (Joel G. Hardman et al., eds., McGraw-Hill Professional, 10th ed. 2001); и Handbook of Pharmaceutical Excipients (Raymond C. Rowe et al., APhA Publications, 4th edition 2003). Эти протоколы являются стандартными, и любые модификации входят в пределы квалификации специалиста в данной и идей, описанных в настоящем описании.

Фармацевтическая композиция, описанная в настоящем описании, необязательно может включать, но не ограничиваться ими, другие фармацевтически приемлемые компоненты (или фармацевтические компоненты), включая, но не ограничиваясь ими, буферы, консерванты, средства для коррекции тоничности, соли, антиоксиданты, средства для коррекции осмолярности, физиологические вещества, фармакологические вещества, объемообразующие вещества, эмульгаторы, смачивающие вещества, подсластители или вкусовые добавки и т.п. Для получения фармацевтической композиции, описанной в настоящем описании, можно использовать различные буферы и средства для коррекции pH при условии, что полученный препарат является фармацевтически приемлемым. Такие буферы включают, но не ограничиваются ими, ацетатные буферы, боратные буферы, цитратные буферы, фосфатные буферы, нейтральный забуференный солевой раствор и фосфатно-солевой буфер. Понятно, при необходимости что кислоты или основания можно использовать для коррекции pH композиции. Фармацевтически приемлемые антиоксиданты включают, но не ограничиваются ими, метабисульфит натрия, тиосульфат натрия, ацетилцистеин, бутилированный гидроксианизол и бутилированный гидрокситолуол. Пригодные консерванты включают, но не ограничиваются ими, хлорид бензалкония, хлорбутанол, тимеросал, ацетат фенилртути, нитрат фенилртути, стабилизированную оксихлорную композицию, например, такую как хлорит натрия и хелатирующие агенты, например, такие как DTPA или DTPA-бисамид, кальций-DTPA и CaNaDTPA-бисамид. Средства для коррекции тоничности, пригодные в фармацевтической композиции, включают, но не ограничиваются ими, соли, например, такие как хлорид натрия, хлорид калия, маннит или глицерин и другое фармацевтически приемлемое средство для коррекции тоничности.

Соединение, описанное в настоящем описании, или композицию, содержащую такое соединение, также можно включать в платформу для доставки лекарственного средства, чтобы достигнуть профиля контролируемого высвобождения соединения с течением времени. Такая платформа для доставки лекарственного средства содержит соединение, описанное в настоящем описании, диспергированное в полимерной матрице, как правило, биодеградируемой, биоразлагаемой и/или биоресорбируемой полимерной матрице. Как используют в рамках изобретения, термин "полимер" относится к синтетическим гомо- или сополимерам, встречающимся в природе гомо- или сополимерам, а также к их синтетическим модификациям или производным, имеющим линейную, разветвленную или звездообразную структуру. Сополимеры могут быть организованы в любой форме, например, такой как случайный сополимер, блок-сополимер, сегментированный сополимер, клиновидный блок-сополимер, привитой сополимер или тройной блок-сополимер. Полимеры, как правило, представляют собой конденсационные полимеры. Полимеры, кроме того, можно модифицировать для повышения их механических свойств или свойств деградации путем добавления сшивающих средств или изменения гидрофобности боковых остатков. Если они являются сшитыми, полимеры обычно являются менее чем на 5% сшитыми, обычно менее чем на 1% сшитыми.

Пригодные полимеры включают, но не ограничиваются ими, альгинаты, алифатические полиэфиры, полиалкиленоксалаты, полиамиды, сложные полиамидоэфиры, полиангидриды, поликарбонаты, полиэфиры, полиэтиленгликоль, полигидроксиалифатические карбоновые кислоты, сложные полиортоэфиры, сложные полиоксаэфиры, полипептиды, полифосфазены, полисахариды и полиуретаны. Полимер обычно содержит по меньшей мере приблизительно 10% (масс./масс.), по меньшей мере приблизительно 20% (масс./масс.), по меньшей мере приблизительно 30% (масс./масс.), по меньшей мере приблизительно 40% (масс./масс.), по меньшей мере приблизительно 50% (масс./масс.), по меньшей мере приблизительно 60% (масс./масс.), по меньшей мере приблизительно 70% (масс./масс.), по меньшей мере приблизительно 80% (масс./масс.) или по меньшей мере приблизительно 90% (масс./масс.) платформы для доставки лекарственного средства. Примеры биодеградируемых, биоразлагаемых и/или биоресорбируемых полимеров и способов, пригодных для получения платформы для доставки лекарственного средства, описаны, например, в патенте США 4756911; патенте США 5378475; патенте США 7048946; публикации патента США 2005/0181017; публикации патента США 2005/0244464; публикации патента США 2011/0008437; все из которых включены в настоящее описание в качестве ссылок в полном объеме.

В аспектах этого варианта осуществления полимер, составляющий матрицу, представляет собой полипептид, например, такой как фиброин шелка, кератин или коллаген. В других аспектах этого варианта осуществления полимер, составляющий матрицу, представляет собой полисахарид, например, такой как целлюлоза, агароза, эластин, хитозан, хитин или гликозаминогликан, такой как хондроитинсульфат, дерматансульфат, кератансульфат или гиалуроновая кислота. В других аспектах этого варианта осуществления, полимер, составляющий матрицу, представляет собой полиэфир, например, такой как D-молочная кислота, L-молочная кислота, рацемическая молочная кислота, гликолевая кислота, капролактон и их комбинации.

Специалисту в данной области будет понятно, что выбор подходящего полимера для формирования подходящей описанной платформы для доставки лекарственного средства зависит от нескольких факторов. Наиболее значимые факторы при выборе подходящего полимера(-ов), включают, но не ограничиваются ими, совместимость полимера с лекарственным средством, желаемую кинетику высвобождения, желаемую кинетику высвобождения лекарственного средства, желаемую кинетику биодеградации платформы в области имплантации, желаемую кинетику биоразлозжения платформы в области имплантации, желаемую кинетику биоресорбции платформы в области имплантации, механическую эффективность платформы in vivo, температуру переработки, биосовместимость платформы и переносимость пациентом. Другие значимые факторы, которые до некоторой степени диктуют поведение полимера in vitro и in vivo, включают химический состав, пространственное распределение компонентов, молекулярную массу полимера и степень кристалличности.

Платформа для доставки лекарственного средства включает как платформу для доставки лекарственного средства с замедленным высвобождением, так и платформу для доставки лекарственного средства с пролонгированным высвобождением. Как используют в рамках изобретения, термин "замедленное высвобождение" относится к высвобождению соединения, описанного в настоящем описании, в течение периода, составляющего приблизительно семь суток или более. Как используют в рамках изобретения, термин "пролонгированное высвобождение" относится к высвобождению соединения, описанного в настоящем описании, в течение периода времени, составляющего менее чем приблизительно семь суток.

В аспектах этого варианта осуществления платформа для доставки лекарственного средства с замедленным высвобождением высвобождает соединение, описанное в настоящем описании, по существу с кинетикой первого порядка на протяжении периода, например, составляющего приблизительно 7 суток после введения, приблизительно 15 суток после введения, приблизительно 30 суток после введения, приблизительно 45 суток после введения, приблизительно 60 суток после введения, приблизительно 75 суток после введения или приблизительно 90 суток после введения. В других аспектах этого варианта осуществления платформа для доставки лекарственного средства с замедленным высвобождением высвобождает соединение, описанное в настоящем описании, по существу с кинетикой высвобождения первого порядка на протяжении периода, например, по меньшей мере 7 суток после введения, по меньшей мере 15 суток после введения, по меньшей мере 30 суток после введения, по меньшей мере 45 суток после введения, по меньшей мере 60 суток после введения, по меньшей мере 75 суток после введения или по меньшей мере 90 суток после введения.

В аспектах этого варианта осуществления платформа для доставки лекарственного средства высвобождает соединение, описанное в настоящем описании, по существу с кинетикой высвобождения первого порядка в течение периода, например, составляющего приблизительно 1 сутки после введения, приблизительно 2 суток после введения, приблизительно 3 суток после введения, приблизительно 4 суток после введения, приблизительно 5 суток после введения или приблизительно 6 суток после введения. В других аспектах этого варианта осуществления платформа для доставки лекарственного средства высвобождает соединение, описанное в настоящем описании, по существу с кинетикой первого порядка на протяжении периода, например, не более чем 1 сутки после введения, не более чем 2 суток после введения, не более чем 3 суток после введения, не более чем 4 суток после введения, не более чем 5 суток после введения или не более чем 6 суток после введения.

Аспекты настоящего изобретения относятся, частично, к аутоиммунному нарушению. Аутоиммунное нарушение возникает в результате сверхактивного иммунного ответа организма против веществ и тканей, обычно присутствующих в организме, что приводит к нарушению толерантности к собственным антигенам. Иными словами, организм фактически атакует свои собственные клетки, поскольку иммунная система ошибочно принимает некоторую часть организма за патоген и атакует ее. Аутоиммунные нарушения, характеризующиеся развитием патогенных популяции T-клеток, инфильтрирующих орган-мишень или ткань-мишень, могут ограничиваться определенными органами или вовлекать конкретную ткань в различных местах.

Аспекты настоящего изобретения относятся, частично, к воспалению. Воспаление относится к фактическому ответу ткани (отек, эритема и т.д.) на болевой раздражитель. Нейрогенное воспаление относится к тому факту, что этот ответ ткани инициируется и/или поддерживается путем высвобождения медиаторов воспаления из периферических чувствительных нервных окончаний (т.е. эфферентная функция в противоположность нормальной афферентной передаче сигнала в этих нервах в спинной мозг). Нейрогенное воспаление охватывает серию сосудистых и несосудистых воспалительных ответов, опосредуемых комплексным биологическим процессом, который в конечном итоге приводит к местному высвобождению медиаторов воспаления и сенсибилизирующих соединений из чувствительных нейронов. При повреждении болевым раздражителем, например, таким как патоген, повреждение клеток или раздражитель, опосредующие воспаление и сенсибилизирующие молекулы, например, такие как гистамин, простагландины, лейкотриены, серотонин, нейтральные протеазы, цитокины, брадикинин и оксид азота, высвобождаются из опосредующих воспаление клеток, например, таких как тучные клетки, иммунные клетки, сосудисто-эндотелиальные клетки и гладкомышечные клетки сосудов. См. Richardson and Vasko, J. Pharmacol. Exp. Ther. 302:839-845, (2002), которая включена в настоящее описание в качестве ссылки в полном объеме. Эти опосредующие воспаление и сенсибилизирующие молекулы действуют на чувствительные нейроны, стимулируя высвобождение индуцирующих воспаление молекул, например, таких как нейропептиды, такие как вещество P (SP) и родственный гену кальцитонина пептид (CGRP), простагландины и аминокислоты, такие как глутамат, из окончаний периферических нервов. При высвобождении эти индуцирующие воспаление молекулы ответственны за индукцию воспалительного ответа, как правило, характеризующегося отеком (опухание, вторичное на фоне экстравазации плазмы), гиперчувствительностью (вторичной на фоне изменений возбудимости определенных чувствительных нейронов) и эритемой (покраснение и ощущение теплоты, вторичные на фоне расширения сосудов), который выходит за пределы области стимуляции (гиперемический ответ). Там же. Поскольку лежащие в основе воспалительные симптомы запускаются активацией первичных сенсорных нейронов и последующим высвобождением индуцирующих воспаление молекул, ответ называют нейрогенным воспалением.

Воспаление включает как острое воспаление, так и хроническое воспаление. Как используют в рамках изобретения, термин "острое воспаление" означает воспалительный ответ, имеющий патофизиологические эффекты, где по меньшей мере один из основных симптомов, подвергаемых лечению, имеет этиологию болевого раздражителя, например, такую как противомикробный ответ. Как используют в рамках изобретения, термин "хроническое воспаление" означает воспалительный ответ, имеющий патофизиологические эффекты, где по меньшей мере один из основных симптомов, подвергаемых лечению, является результатом этиологии, основанной на ноцицептивном чувствительном нерве, например, такой как высвобождение индуцирующей воспаление молекулы. Хроническое воспаление включает как первичное нейрогенное воспаление, так и вторичное нейрогенное воспаление. Как используют в рамках изобретения, термин "первичное" нейрогенное воспаление относится к тканевому воспалению (симптомам воспаления), которое инициируется или является результатом высвобождения веществ из первичных окончаний чувствительных нервов (таких как волокна C и A-дельта). Как используют в рамках изобретения, термин "вторичное нейрогенное воспаление" относится к воспалению ткани, инициируемому ненейрональными источниками (например, эстравазация из сосудистого ложа или происходящие из тканевого интерстиция, как например, из тучных клеток или иммунных клеток) медиаторов воспаления, таких как пептиды или цитокины, стимулирующие чувствительные нервные окончания и вызывающие высвобождение медиаторов воспаления из нервов. Эти происходящие из нервов медиаторы воспаления могут, в свою очередь, стимулировать чувствительные нервы, а также действовать на ненейрональные мишени (например, тучные клетки). Суммарным эффектом обеих форм (первичной и вторичной) нейрогенного воспаления является наличие воспалительного состояния, которое поддерживается путем сенсибилизации периферических чувствительных нервных волокон. Физиологическое следствие конечного нейрогенного воспаления зависит от представляющей интерес ткани, вызывающей, например, кожную боль (аллодиния, гипералгезия), суставной артрит, висцеральную боль и дисфункцию, легочную дисфункцию (астма, COPD) и дисфункцию мочевого пузыря (боль, гиперактивный мочевой пузырь).

Симптомы воспаления и/или аутоиммунного нарушения включают, но не ограничиваются ими, отек, гиперемию, эритему, кровоподтеки, болезненность, скованность, опухание, лихорадку, озноб, конгестию дыхательных путей, в том числе носа и бронхов, конгестию синуса, нарушение дыхания, задержку жидкости, сгусток крови, потерю аппетита, увеличенную частоту сердечных сокращений, образование гранулем, фибринозную, гнойную или невязкую серозную жидкость, образование язвы или боль. Истинные симптомы, ассоциированные с воспалением и аутоиммунным нарушением, описанным в настоящем описании, хорошо известны и могут быть определены специалистом в данной области, учитывая факторы, включающие, но не ограничивающиеся ими, область воспаления или аутоиммунного нарушения, причину воспаления или аутоиммунного нарушения, тяжесть воспаления или аутоиммунного нарушения, ткань или орган, пораженные воспалением или аутоиммунным нарушением, и нарушение, ассоциированное с воспалением.

Обычно воспаление служит в качестве защитного механизма организма для устранения вреднодействующих стимулов, а также для инициации процесса заживления поврежденной ткани. Острое нейрогенное воспаление формирует защиту первой линии путем поддержания целостности и участия в репарации тканей. В действительности, в отсутствие острого нейрогенного воспаления, раны и инфекции никогда не заживут, и прогрессирующее разрушение ткани поставит под угрозу выживание организма. Однако, тяжелая или длительная вреднодействующая стимуляция приводит к хроническому воспалительному ответу, вызывающему повреждение, а не опосредующему репарацию. Это воспаление вовлечено в патофизиологию широкого диапазона неродственных нарушений, которые лежат в основе широкого множества заболеваний человека.

Хроническое воспаление и ассоциированные с ним симптомы могут быть ассоциированы с большой неродственной группой нарушений, которые лежат в основе различных заболеваний человека. Неограничивающие примеры нарушений, проявляющих воспаление в качестве симптома, включают, но не ограничиваются ими, угревую сыпь, кислотный рефлюкс/изжогу, болезнь Альцгеймера, аппендицит, артериит, артрит, астму, аллергию, аллергический ринит, атеросклероз, аутоиммунное нарушение, баланит, блефарит, бронхиолит, бронхит, буллезный пемфигоид, бурсит, рак, кардит, глютеновую болезнь, целлюлит, цервицит, холангит, холецистит, хориоамнионит, хроническое обструктивное заболевание легких (COPD), цирроз, колит, конъюнктивит, цистит, вирусную инфекцию верхних дыхательных путей, дакриоаденит, деменцию, дерматит, дерматомиозит, экзему, эмфизему, энцефалит, эндокардит, эндометрит, энтерит, энтероколит, эпикондилит, эпидидимит, фасциит, фиброзит, гастрит, гастроэнтерит, гингивит, гломерулонефрит, глоссит, заболевание сердца, гепатит, гнойный гидраденит, высокое кровяное давление, илеит, воспалительное дерматологическое заболевание, воспалительную невропатию, резистентность к инсулину, интерстициальный цистит, ирит, ишемическую болезнь сердца, кератит, кератоконъюнктивит, ларингит, мастит, мастоидит, менингит, метаболический синдром (синдром X), мигрень, миелит, миокардит, миозит, нефрит, ожирение, омфалит, оофорит, орхит, остеохондрит, остеопению, остеопороз, остит, отит, панкреатит, болезнь Паркинсона, паротит, воспалительное заболевание таза, пемфигус обыкновенный, перикардит, перитонит, фарингит, флебит, плеврит, пневмонит, проктит, простатит, псориаз, пульпит, пиелонефрит, пилефлебит, ревматическую атаку, ринит, сальпингит, сиаладенит, синусит, спастический толстый кишечник, стоматит, синовит, тендинит, тендиноз, теносиновит, тромбофлебит, тонзиллит, тригонит, опухоль, уретрит, увеит, вагинит, васкулит и вульвит.

Одним типом нарушения, проявляющим симптом воспаления, является артрит. Артрит включает группу состояний, вовлекающих повреждение составов организма вследствие воспаления синовиальной оболочки, включая, но не ограничиваясь ими, остеоартрит, ревматоидный артрит, ювенильный идиопатический артрит, спондилоартропатии, такие как анкилозирующий спондилит, реактивный артрит (синдром Рейтера), псориатический артрит, энтеропатический артрит, ассоциированный с воспалительным заболеванием кишечника, болезнь Уиппла и болезнь Бехчета, септический артрит, подагру (также известную как подагрический артрит, кристалл-индуцированный синовит, метаболический артрит), псевдоподагру (заболевание с отложением пирофосфата кальция) и болезнь Стилла. Артрит может поражать один сустав (моноартрит), от двух до четырех суставов (олигоартрит) или пять или более суставов (полиартрит), и он может представлять собой либо аутоиммунное заболевание, либо неаутоиммунное заболевание.

Аспекты настоящего изобретения относятся, частично, к аутоиммунному нарушению. Аутоиммунные нарушения также проявляют симптомы воспаления. Аутоиммунные заболевания можно широко подразделить на системные и органоспецифические аутоиммунные нарушения, в зависимости от основных клинико-патологических признаков каждого заболевания. Системные аутоиммунные заболевания включают, но не ограничиваются ими, системную красную волчанку (SLE), синдром Шегрена, склеродермию, ревматоидный артрит и полимиозит. Местные аутоиммунные заболевания могут быть эндокринологическими (сахарный диабет 1 типа, тиреоидит Хашимото, болезнь Аддисона и т.д.), дерматологическими (пемфигус обыкновенный), гематологическими (аутоиммунная гемолитическая анемия), нервными (рассеянный склероз), или они могут вовлекать практически любую ограниченную массу ткани организма. Типы аутоиммунных нарушений включают, но не ограничиваются ими, острый диссеминированный энцефаломиелит (ADEM), болезнь Аддисона, аллергию, аллергический ринит, болезнь Альцгеймера, синдром антифосфолипидных антител (APS), артрит, астму, аутоиммунную гемолитическую анемию, аутоиммунный гепатит, аутоиммунное заболевание внутреннего уха, буллезный пемфигоид, сердечно-сосудистое заболевание, глютеновую болезнь, болезнь Шагаса, хроническое обструктивное заболевание легких (COPD), сахарный диабет 1 типа (IDDM), экзему, эндометриоз, фибромиалгию, синдром Гудпасчера, болезнь Грэйвса, синдром Гийена-Барре (GBS), тиреоидит Хашимото, гнойный гидраденит, идиопатическую тромбоцитопеническую пурпуру, воспалительное заболевание кишечника, воспалительное дерматологическое заболевание, интерстициальный цистит, волчанку (включая дискоидную красную волчанку, индуцируемую лекарственным средством красную волчанку, волчаночный нефрит, неонатальную волчанку, подострую красную волчанку и системную красную волчанку), очаговую склеродермию, рассеянный склероз (MS), миастению гравис, миопатии, нарколепсию, нейромиотонию, пемфигус обыкновенный, пернициозную анемию, псориаз, первичный билиарный цирроз, рекуррентный диссеминированный энцефаломиелит (многофазный диссеминированный энцефаломиелит), ревматическую атаку, шизофрению, склеродермию, синдром Шегрена, теносиновит, васкулит и витилиго.

Другим типом нарушения, проявляющим симптом воспаления, является воспалительная миопатия. Воспалительные миопатии вызываются проблемами с иммунной системой, атакующей компоненты мышц, что приводит к признакам воспаления в мышце. Воспалительные миопатии включают, но не ограничиваются ими, дерматомиозит, миозит с тельцами включения и полимиозит.

Другим типом нарушения, проявляющим симптом воспаления, является васкулит. Васкулит представляет собой различную группу нарушений, признаком которых является воспаление сосудистой стенки лимфатических сосудов и кровеносных сосудов, таких как вены (флебит), артерии (артериит) и капилляры вследствие миграции лейкоцитов и итогового повреждения. Воспаление может поражать кровеносный сосуд любого размера по всему организму. Оно может поражать либо артерии и/или вены. Воспаление может быть местным, что означает, что оно поражает одну область в сосуде; или оно может быть широко распространенным с областями воспаления, рассеянными по конкретному органу или ткани, или даже поражающим более одной системы органов в организме. Васкулит включает, но не ограничивается ими, болезнь Бюргера (облитерирующий тромбангит), церебральный васкулит (васкулит центральной нервной системы), артериит Черджа-Стросс, криоглобулинемию, эссенциальный криоглобулинемический васкулит, гигантоклеточный (височный) артериит, васкулит гольфиста, пурпуру Геноха-Шенлейна, обусловленный гиперчувствительностью васкулит (аллергический васкулит), болезнь Кавасаки, микроскопический полиартериит/полиангиит, узелковый полиартериит, ревматическую полимиалгию (PMR), ревматоидный васкулит, артериит Такаясу, гранулематоз Вегенера и васкулит, являющийся вторичным на фоне нарушений соединительной ткани, таких как системная красная волчанка (SLE), ревматоидный артрит (RA), рецидивирующий полихондрит, болезнь Бехчета или другие нарушения соединительной ткани, васкулит, являющийся вторичным на фоне вирусной инфекции.

Другим типом нарушения, проявляющего симптом воспаления, является нарушение кожи. Кожные нарушения включают, но не ограничиваются ими, дерматит, включая хронический актинический дерматит, экзему, такую как атопическая экзема, контактную экзему, ксеротическую экзему, себорейный дерматит, дисгидроз, дискоидную экзему, венозную экзему, герпетиформный дерматит, нейродерматит и аутоэкзематизацию, и дерматит на фоне стаза, гнойный гидраденит, псориаз, включая бляшковидный псориаз, псориаз ногтей, каплевидный псориаз, псориаз кожи черепа, инверсный псориаз, пустелезный псориаз и эритродермический псориаз, розовые угри и склеродермию, включая очаговую склеродермию.

Другим типом нарушения, проявляющего симптом воспаления, является желудочно-кишечное нарушение. Желудочно-кишечное нарушение включает, но не ограничивается ими, болезнь раздраженной кишки, воспалительное заболевание кишечника, включая болезнь Крона и язвенный колит, такой как язвенный проктит, левосторонний, панколит и молниеносный колит.

Аспекты настоящего изобретения относятся, частично, к нейродегенеративному заболеванию. Нейродегенеративные заболевания возникают в результате прогрессирующей утраты структуры или функции нейронов, включая гибель нейронов. Неограничивающие примеры нейродегенеративных заболеваний включают, но не ограничиваются ими, болезнь Александера, болезнь Альперса, болезнь Альцгеймера, амилоидоз, боковой амиотрофический склероз, тревожность, атаксию-телеангиэктазию, дефицит внимания, болезнь Канавана, травмы центральной нервной системы, болезнь Шарко-Мари-Тута, синдром Кокейна, кортикобазальную дегенерацию, болезнь Крейтцфельда-Якоба, депрессию, энцефалит (например, бактериальный, паразитарный, грибковый или вирусный), атаксию Фридрейха, лобно-височную деменцию, наследственный спастический парапарез, cиндром Гийена-Барре (и его варианты: острая невропатия двигательных нейронов, острая воспалительная демиелинизирующая полиневропатия и синдром Фишера), ВИЧ/СПИД-дементный комплекс, болезнь Гентингтона, ишемическое повреждение нервной системы, болезнь Кеннеди, болезнь Краббе, деменцию с тельцами Леви, болезнь Мачадо-Джозефа, менингит (например, бактериальный, паразитарный, грибковый или вирусный), рассеянный склероз, множественную системную атрофию, повреждение нервной системы, например, сотрясение головного мозга, травму спинного мозга и травматическое повреждение нервной системы, невропатию, например, такую как индуцированная химиотерапией невропатия, ассоциированная с диабетом невропатия и периферическая невропатия, болезнь Паркинсона, болезнь Пелицеуса-Мерцбахера, болезнь Пика, первичный латеральный склероз, прионные нарушения, прогрессирующий надъядерный паралич, болезнь Рефсума, болезнь Сандхоффа, шизофрению, болезнь Шильдера, спиномозжечковую атрофию, болезнь Стила-Ричардсона-Ольшевского, инсульт, сухотку спинного мозга или сосудистую деменцию. Нейродегенерация может быть ассоциирована с аутоиммунным заболеванием или неаутоиммунным заболеванием, и нейродегенерация может представлять собой системное нарушение или органоспецифическое нарушение. Неограничивающие примеры симптома, уменьшаемого способом лечения нейродегенеративного заболевания, описанного в настоящем описании, включают тревожность, афазию, когнитивное нарушение, дезориентацию во времени и в пространстве, депрессию, боль, паралич, спастичность, тики и треморы.

Аспекты настоящего изобретения относятся, частично, к уменьшению симптома, ассоциированного с аутоиммунным нарушением или нейродегенеративным заболеванием. В одном аспекте этого варианта осуществления уменьшаемый симптом представляет собой воспаление, усталость, головокружение, беспокойство, лихорадку и высокую температуру тела, чрезмерную чувствительность к холоду в руках и стопах, слабость и скованность мышц и суставов, изменения массы тела, пищеварительные или желудочно-кишечные проблемы, низкое или высокое кровяное давление, раздражительность, тревожность или депрессию, бесплодие или снижение полового влечения (низкое либидо), изменения уровня сахара в крови и, в зависимости от типа аутоиммунного заболевания, увеличение размера органа или ткани или разрушение органа или ткани.

В одном варианте осуществления иммунодепрессивный полипептид, являющийся производным Tat, обладает активностью, которая приводит к увеличенной экспрессии Fas-лиганда (FasL) в макрофагах, регулирующих антигенпредставляющие клетки (AReg), подвергнутых воздействию иммунодепрессивного полипептида, являющегося производным Tat. В аспектах этого варианта осуществления иммунодепрессивный полипептид, являющийся производным Tat, увеличивает экспрессию FasL в клетках по меньшей мере на 10%, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40%, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 100%, по меньшей мере на 200%, по меньшей мере на 300%, по меньшей мере на 400% или по меньшей мере на 500%, относительно клеток, не подвергаемых воздействию того же иммунодепрессивного полипептида, являющегося производным Tat. В других аспектах этого варианта осуществления иммунодепрессивный полипептид, являющийся производным Tat, увеличивает экспрессию FasL в клетках на от приблизительно 10% до приблизительно 25%, от приблизительно 10% до приблизительно 50%, от приблизительно 10% до приблизительно 75%, от приблизительно 10% до приблизительно 100%, от приблизительно 10% до приблизительно 200%, от приблизительно 10% до приблизительно 300%, от приблизительно 10% до приблизительно 400%, от приблизительно 10% до приблизительно 500%, от приблизительно 25% до приблизительно 50%, от приблизительно 25% до приблизительно 75%, от приблизительно 25% до приблизительно 100%, от приблизительно 25% до приблизительно 200%, от приблизительно 25% до приблизительно 300%, от приблизительно 25% до приблизительно 400%, от приблизительно 25% до приблизительно 500%, от приблизительно 50% до приблизительно 100%, от приблизительно 50% до приблизительно 200%, от приблизительно 50% до приблизительно 300%, от приблизительно 50% до приблизительно 400% или от приблизительно 50% до приблизительно 500%, относительно клеток, не подвергнутых воздействию того же иммунодепрессивного производного Tat. В определенных вариантах осуществления AReg представляют собой CD14+ макрофаги.

Описанные аутоиммунные, нейродегенеративные и ассоциированные с воспалением заболевания представляют собой иммуноопосредуемые нарушения, характеризующиеся повышением опосредуемого T-клеточного воспаления, которое желательно уменьшить. Лекарственное средство, которое увеличивает или индуцирует экспрессию FasL на AReg или дендритных клетках, уменьшает опосредуемое T-клетками воспаление и тем самым осуществляет лечение аутоиммунного, нейродегенеративного или ассоциированного с воспалением заболевания. Таким образом, в одном варианте осуществления настоящее изобретение относится к способу уменьшения опосредуемого T-клетками воспаления у индивидуума с аутоиммунным, нейродегенеративным и ассоциированным с воспалением заболеванием путем введения одного или нескольких описанных иммунодепрессивных полипептидов, являющихся производными Tat, тем самым осуществляя лечение аутоиммунного, нейродегенеративного или ассоциированного с воспалением заболевания. В другом варианте осуществления настоящее изобретение относится к способу индукции экспрессии FasL на AReg у индивидуума с аутоиммунным, нейродегенеративным или ассоциированным с воспалением заболеванием путем введения одного или нескольких из описанных иммунодепрессивных полипептидов, являющихся производными Tat, тем самым осуществляя лечение аутоиммунного, нейродегенеративного или ассоциированного с воспалением заболевания.

Кроме того, аспекты настоящего изобретения относятся, частично, к уменьшению симптома, ассоциированного с воспалением. В одном аспекте настоящего изобретения уменьшаемым симптомом является отек, гиперемия, эритема, кровоподтеки, болезненность, скованность, опухание, лихорадка, озноб, конгестия дыхательных путей, в том числе носа и бронхов, конгестия синуса, нарушение дыхания, задержка жидкости, сгусток крови, потеря аппетита, увеличенная частота сердечных сокращений, образование гранулем, фибринозная, гнойная или невязкая серозная жидкость, образование язвы или боль.

Аспекты настоящего изобретения относятся, частично, к млекопитающему. Млекопитающее включает человека, и человек может быть пациентом. Другие аспекты настоящего изобретения относятся, частично, к индивидууму. Индивидуум включает млекопитающего и человека, и человек может быть пациентом. В других вариантах осуществления млекопитающие включают домашних животных, таких как собаки, кошки, лошади, крупный рогатый скот, овцы, козы и приматы.

Аспекты настоящего изобретения относятся, частично, к введению соединения или композиции, описанной в настоящем описании. Как используют в рамках изобретения, термин "введение" означает механизм доставки, который предоставляет индивидууму соединение или композицию, описанную в настоящем описании, которая потенциально приводит к клинически, терапевтически или экспериментально благоприятному результату.

Введение соединения или композиции, описанной в настоящем описании, включает множество энтеральных или парентеральных подходов, включающих, но не ограничивающихся ими, пероральное введение в любой приемлемой форме, например, такой как таблетка, жидкость, капсула, порошок и т.п.; местное введение в любой приемлемой форме, например, такой как капли, спреи, кремы, гели или мази; буккальное, назальное и/или ингаляционное введение в любой приемлемой форме; ректальное введение в любой приемлемой форме; вагинальное введение в любой приемлемой форме; внутрисосудистое введение в любой приемлемой форме, например, такое внутривенная болюсная инъекция, внутривенная инфузия, интраартериальная болюсная инъекция, интраартериальная инфузия и вливание через катетер в сосуды; около- и внутритканевое введение в любой приемлемой форме, например, такое как внутрибрюшинная инъекция, внутримышечная инъекция, подкожная инъекция, подкожная инфузия, внутриглазная инъекция, ретинальная инъекция или субретинальная инъекция или эпидуральная инъекция; внутрипузырное введение в любой приемлемой форме, например, такой как вливание через катетер; и путем помещения устройства, например, такого как имплантат, стент, пластырь, гранула, катетер, осмотический насос, суппозиторий, биоразлагаемая система доставки, небиоразлагаемая система доставки или другая имплантируемая система с пролонгированным или замедленным высвобождением. Иллюстративный перечень биодеградируемых полимеров и способов применения описан, например, в Handbook of Biodegradable Polymers (Abraham J. Domb et al., eds., Overseas Publishers Association, 1997).

Соединение или композицию, описанные в настоящем описании, можно вводить млекопитающему с использованием различных путей. Пути введения, пригодные для лечения воспаления, аутоиммунного нарушения или нейродегенеративного заболевания, как описано в настоящем описании, включают как местное, так и системное введение. Местное введение приводит к значительно большей доставке композиции в конкретную область по сравнению со всем организмом млекопитающего, в то время как системное введение приводит к доставке композиции по существу по всему телу индивидуума. Пригодные пути введения также включают как центральное, так и периферическое введение. Центральное введение приводит к доставке соединения или композиции по существу в центральную нервную систему индивидуума и включает, например, интратекальное введение, эпидуральное введение, а также внутричерепную инъекцию или имплантат. Периферическое введение обеспечивает доставку соединения или композиции по существу в любую область индивидуума вне центральной нервной системы и охватывает любой путь введения, отличный от прямого введения в позвоночник или головной мозг. Фактический путь введения используемых соединения или композиции, описанных в настоящем описании, может определить любой специалист в данной области, учитывая факторы, включающие, но не ограничивающиеся ими, тип, расположение, причину и тяжесть воспаления или аутоиммунного или нейродегенеративного нарушения, желаемую продолжительность лечения, желаемую степень смягчения, желаемую продолжительность смягчения, конкретное используемое соединение или композицию, скорость экскреции используемого соединения или композиции, фармакодинамику используемого соединения или композиции, природу других соединений, включаемых в композицию, конкретный путь введения, конкретные характеристики, анамнез и факторы риска индивидуума, например, такие как возраст, масса тела, общее состояние здоровья и т.п., ответ индивидуума на лечение или любая их комбинация. Таким образом, эффективную величину дозы соединения или композиции, описанной в настоящем описании, может определить специалист в данной области, учитывая все критерии и с использованием его точного мнения об индивидууме.

В одном варианте осуществления соединение или композицию, описанные в настоящем описании, вводят системно млекопитающему. В другом варианте осуществления соединение или композицию, описанные в настоящем описании, вводят местно млекопитающему. В одном аспекте этого варианта осуществления соединение или композицию, описанные в настоящем описании, вводят в область воспаления, нейродегенерации или аутоиммунного нарушения у млекопитающего. В другом аспекте этого варианта осуществления соединение или композицию, описанные в настоящем описании, вводят в область, окружающую воспаление, нейродегенеративное заболевание или аутоиммунное нарушение у млекопитающего.

Аспекты настоящего описания относятся, частично, к введению терапевтически эффективного количества соединения или композиции, описанной в настоящем описании. Как используют в рамках изобретения, термин "терапевтически эффективное количество" является синонимом термину "терапевтически эффективная доза" и, когда его используют в отношении лечения воспаления, нейродегенерации или аутоиммунного нарушения, означает минимальную дозу соединения или композиции, описанных в настоящем описании, необходимую для достижения желаемого терапевтического эффекта, и включает дозу, достаточную для уменьшения симптома, ассоциированного с воспалением, нейродегенерацией или аутоиммунным нарушением. В аспектах этого варианта осуществления терапевтически эффективное количество соединения или композиции, описанных в настоящем описании, уменьшает симптом, ассоциированный с воспалением, нейродегенерацией или аутоиммунным нарушением, например, по меньшей мере на 10%, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40%, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90% или по меньшей мере на 100%. В других аспектах этого варианта осуществления терапевтически эффективное количество соединения или композиции, описанных в настоящем описании, уменьшает симптом, ассоциированный с воспалением, нейродегенерацией или аутоиммунным нарушением, например, не более чем на 10%, не более чем на 20%, не более чем на 30%, не более чем на 40%, не более чем на 50%, не более чем на 60%, не более чем на 70%, не более чем на 80%, не более чем на 90% или не более чем на 100%. В других аспектах этого варианта осуществления терапевтически эффективное количество соединения или композиции, описанной в настоящем описании, уменьшает симптом, ассоциированный с воспалением, нейродегенерацией или аутоиммунным нарушением, например, на от приблизительно 10% до приблизительно 100%, от приблизительно 10% до приблизительно 90%, от приблизительно 10% до приблизительно 80%, от приблизительно 10% до приблизительно 70%, от приблизительно 10% до приблизительно 60%, от приблизительно 10% до приблизительно 50%, от приблизительно 10% до приблизительно 40%, от приблизительно 20% до приблизительно 100%, от приблизительно 20% до приблизительно 90%, от приблизительно 20% до приблизительно 80%, от приблизительно 20% до приблизительно 20%, от приблизительно 20% до приблизительно 60%, от приблизительно 20% до приблизительно 50%, от приблизительно 20% до приблизительно 40%, от приблизительно 30% до приблизительно 100%, от приблизительно 30% до приблизительно 90%, от приблизительно 30% до приблизительно 80%, от приблизительно 30% до приблизительно 70%, от приблизительно 30% до приблизительно 60%, или от приблизительно 30% до приблизительно 50%. В других аспектах этого варианта осуществления терапевтически эффективное количество соединения или композиции, описанных в настоящем описании, в дозировке, достаточной для уменьшения симптома, ассоциированного с воспалением, нейродегенерацией или аутоиммунным нарушением в течение, например, по меньшей мере одной недели, по меньшей мере одного месяца, по меньшей мере двух месяцев, по меньшей мере трех месяцев, по меньшей мере четырех месяцев, по меньшей мере пяти месяцев, по меньшей мере шести месяцев, по меньшей мере семи месяцев, по меньшей мере восьми месяцев, по меньшей мере девяти месяцев, по меньшей мере десяти месяцев, по меньшей мере одиннадцати месяцев или по меньшей мере двенадцати месяцев.

Количество активного компонента в соединении или композиции, описанных в настоящем описании, для лечения воспаления, нейродегенерации или аутоиммунного нарушения может варьировать, чтобы достигалась подходящая дозировка. Фактическое терапевтически эффективное количество соединения или композиции, описанных в настоящем описании, подлежащих введению млекопитающему, может определять специалист в данной области, учитывая факторы, включающие, но не ограничивающиеся ими, тип, положение, причину или тяжесть воспаления, нейродегенерации или аутоиммунного нарушения, желаемую продолжительность лечения, желаемую степень смягчения, желаемую продолжительность смягчения, конкретное используемое соединение или композицию, скорость экскреции используемого соединения или композиции, фармакодинамику используемого соединения или композиции, природу других соединений, включаемых в композицию, конкретный путь введения, конкретные характеристики, анамнез и факторы риска индивидуума, например, такие как возраст, масса тела, общее состояние здоровья и т.п., ответ индивидуума на лечение или любая их комбинация. Таким образом, эффективную величину дозы соединения или композиции, описанной в настоящем описании, может определить специалист в данной области, учитывая все критерии и с использованием его точного мнения об индивидууме.

Кроме того, когда используют повторяющееся введение соединения или композиции, описанных в настоящем описании, фактическое эффективное количество соединения или композиции, описанных в настоящем описании, кроме того, зависят от факторов, включающих, но не ограничивающихся ими, частоту введения, время полужизни соединения или композиции, описанных в настоящем описании, или любую их комбинацию. Специалисту в данной области известно, что эффективное количество соединения или композиции, описанных в настоящем описании, можно экстраполировать из анализов in vitro и исследований введения in vivo с использованием моделей на животных перед введением человеку. Следует ожидать широкого варьирования необходимого эффективного количества ввиду различной эффективности различных путей введения. Например, как правило, следует ожидать, что пероральное введение потребует более высоких уровней доз, чем введение внутривенной инъекцией или инъекцией внутрь стекловидного тела. Варьирование этих уровней доз можно проводить с использованием стандартных эмпирических путей оптимизации, которые хорошо известны специалисту в данной области. Точные уровни и профили терапевтически эффективной дозировки предпочтительно определяет лечащий врач с учетом указанных выше факторов.

Дозирование может представлять собой однократную дозировку или совокупную дозировку (последовательное дозирование), и его может без труда определить специалист в данной области. Например, лечение воспаления, нейродегенерации или аутоиммунного нарушения может включать однократное введение эффективной дозы соединения или композиции, описанных в настоящем описании. В качестве неограничивающего примера, эффективную дозу соединения или композиции, описанных в настоящем описании, можно вводить один раз млекопитающему, например, в качестве однократной инъекции или депонирования в или вблизи области, проявляющей симптом воспаления, нейродегенерации или аутоиммунного нарушения, или однократного перорального введения соединения или композиции. Альтернативно, лечение воспаления, нейродегенерации или аутоиммунного нарушения может включать множество введений эффективной дозы соединения или композиции, описанных в настоящем описании, вводимых на протяжении диапазона периодов времени, например, каждые сутки, один раз в несколько суток, раз в неделю, раз в месяц или раз в год. В качестве неограничивающего примера соединение или композицию, описанные в настоящем описании, можно вводить млекопитающему один раз в неделю или два раза в неделю. Расписание введения может варьировать от млекопитающего к млекопитающему, в зависимости от таких факторов, как тяжесть симптомов млекопитающего. Например, эффективную дозу соединения или композиции, описанных в настоящем описании, можно вводить млекопитающему один раз в месяц в течение неопределенно долгого периода времени или до тех пор, когда млекопитающему более не будет требоваться терапия. Специалисту в данной области будет понятно, что состояние млекопитающего можно подвергать мониторингу в ходе лечения и что эффективное количество соединения или композиции, описанных в настоящем описании, которое вводят, можно корректировать соответствующим образом.

Соединение или композицию, как описано в настоящем описании, также можно вводить млекопитающему в комбинации с другими терапевтическими соединениями для увеличения общего терапевтического эффекта лечения. Применение множества соединений для лечения аутоиммунных, нейродегенеративных и ассоциированных с воспалением заболеваний входит в объем настоящего изобретения. Кроме того, настоящее изобретение включает применение описанных для лечения аутоиммунных, нейродегенеративных и ассоциированных с воспалением заболеваний, и к применению описанных пептидов для изготовления лекарственного средства для лечения аутоиммунных, нейродегенеративных и ассоциированных с воспалением заболеваний.

ПРИМЕРЫ

Следующие неограничивающие примеры предоставлены только для иллюстративных целей для обеспечения более полного понимания репрезентативных вариантов осуществления, описанных в настоящем описании. Эти примеры не следует истолковывать как ограничивающие какой-либо из вариантов осуществления, описанных в настоящем описании, включая варианты, относящиеся к способам лечения аутоиммунного нарушения, воспаления или нейродегенеративных заболеваний с использованием производных Tat, описанных в настоящем описании.

Пример 1

Эффекты Tat на линию дендритных клеток

Tat индуцирует увеличение моноцитов, коммитированных в линию дендритных клеток (DC), в активированные CD86+ DC APC (фиг.1). Моноциты человека, увеличенные в количестве из PBMC путем разделением в градиенте плотности Percoll и прикрепления на покрытые антителом против CD14 магнитные гранулы (Dynabeads M-450, Dynal Biotech), коммитировали на дифференцировку в DC после культивирования в течение пяти суток с GM-CSF (100 нг/мл) и IL-4 (100 нг/мл). Коммитированные DC культивировали в течение ночи либо в среде отдельно (контроль), либо с LPS (100 нг/мл), либо с Tat (50 нМ), после чего их окрашивали антителом против CD86 (BD Pharmingen) и анализировали с помощью FACScan в отношении индукции CD86 (левая панель) или генерализованной активации (правая панель, увеличение в рамке R2, показано для Tat-стимулированных клеток). MFI для экспрессии CD86 представляют собой 9 (контроль), 30 (LPS) и 187 (Tat), где CD86 представляет собой специфическую детерминанту активации DC.

Дериватизированный Tat уменьшает дифференцировку AReg и мощно усиливает антигенспецифическую активацию CTL (фиг.2). Tat химически дериватизируют окислением (Tat* или ox-Tat), чтобы он не индуцировал AReg из предшественников моноцитов APC (фиг.3). Десять микрограмм конъюгата Tat/p24 Tat*-Ag (Ag-Tat*) вводили в бок мышей Balb/C в адъюванте на 0 сутки и 7 сутки. Экспериментальные группы иммунизировали для сравнения в адъюванте с 5 мкг p24 в один блок и 5 мкг дериватизированного Tat в другой бок (Ag и Tat*), или 10 мкг p24 в адъюванте (Ag). Контрольным мышам проводили две инъекции адъюванта. В каждой группе проводили введение четырем мышам. На 14 сутки дренирущие клетки лимфатических узлов от каждого животного собирали и повторно стимулировали в течение ночи в культурах облученных клеток Ap24 (клетки H-2d, стабильно трансфицированные для экспрессии антигена p24) или контрольных нетрансфицированных клеток. Активность CTL количественно определяли в качестве количества секретирующих γ-интерферон образующих пятна колоний (SFC)/106 посеянных клеток с использованием анализов ELISPOT. Из каждого результата вычитали фоновое значение для нетрансфицированных мышей с повторной стимуляцией, которое во всех случаях составляло <10 SFC/106. Результаты представлены для трех сходных экспериментов.

Пример 2

Активация посредством Tat макрофагов и подавление иммунного ответа

Рекомбинантный белок Tat получали, как описано выше (Li, C.J. et al. (1995), Science 268:429-31), в мягких денатурирующих условиях, и ренатурировали в присутствии 0,1 мМ DTT.

Активация посредством Tat моноцитов является дозозависимой и насыщаемой (фиг.3). Моноциты человека культивировали в возрастающих концентрациях рекомбинантного Tat в течение шести суток, и в это время их анализировали в отношении индукции лиганда Fas (FasL) в качестве показателя активации с использованием проточной цитометрии (FACScan, Becton Dickinson) для количественного определения интенсивности окрашивания (средний показатель флуоресценции (MFI)) с моноклональным антителом против Fas-лиганда (Nok 1, BD Pharmingen). Более высокие концентрации Tat не увеличивали MFI (не представлено), и T-клетки не могли активироваться 50 нМ Tat (не представлено), что является стимулирующей концентрацией области плато для APC.

Tat подавляет антигенспецифический гуморальный иммунный ответ на ВИЧ-1 p24 (FIG. 4). На 0 неделе мышей (4 в каждой группе) иммунизировали 5 мкг рекомбинантного белка p24 (Chiron, Emeryville, CA) и либо 5 мкг рекомбинантного белка Tat (PT), либо 5 мкг рекомбинантного белка ox-Tat* (Ag), смешанных в 100 мкл полного адъюванта Фрейнда, и вводили подкожно в бок. После иммунизации сыворотки собирали раз в две недели в течение 10 недель и анализировали в отношении специфического антительного ответа на p24 с помощью коммерчески доступного ELISA (Abbott Laboratories, Abbott Park, IL). Титр антитела p24 через 2 недели (фиг.4A) полностью подавлялся белком Tat (PT) по сравнению с контролем в виде ox-Tat* (Ag). Этот ответ сохранялся в течение по меньшей мере 6 недель. Титры антител через 6 недель были приблизительно в десять раз более высокими, чем на 2 неделе, вследствие созревания иммунного ответа.

Tat повышает жизнеспособность культивируемых макрофагов мыши, если макрофаги сначала активировались in vivo, по сравнению с отсутствием предшествующей активации и стимулировались относительно высокими концентрациями Tat (фиг.5). APC выделяли посредством перитонеального лаважа из мышей, которым внутрибрюшинно инъецировали за четверо суток до этого либо 2,9% тиогликолят (в качестве адъюванта), либо 0,85% солевой раствор (состояние покоя). Собранные смытые клетки культивировали в количестве 106 клеток/мл в течение пяти суток в среде отдельно (контроль, C), с липополисахаридом (LPS, 100 нг/мл), или с Tat, продуцированным в качестве рекомбинантного белка в E. coli (Tat, 500 нг/мл). Активацию определяли в качестве % увеличенных клеток (фракция M1).

Иммунодепрессивный Tat обеспечивает стабильное подавление пролиферации лимфоцитов мыши (фиг.6). Мышей иммунизировали в четырех экземплярах адъювантной эмульсией Фрейнда, содержавшей либо 5 мкг Tat/толероген p24 (рекомбинантный белок p24 gag ВИЧ-1) (GRP 2), либо 5 мкг авидин-p24 (GRP 1) в качестве контроля. Через две недели остаточные клетки дренирующих лимфатических узлов собирали, объединяли в каждой группе и культивировали в количестве 105 клеток/лунка микротитрационного планшета в течение четырех суток в присутствии ступенчатых концентраций рекомбинантного белка p24 (p24, мкг/мл). Пролиферацию оценивали в качестве детерминанты вторичного ответа T-клеток путем количественного определения захвата 3H-тимидина (CPM) в течение ночи в жидкостном сцинтилляционном счетчике. Этот ответ сохраняется в течение вплоть до шести недель.

Кроме того, иммунодепрессивный Tat обеспечивает антигенспецифическое иммунное подавление (фиг.7). Мышей в четырех экземплярах иммунизировали на 0 сутки и подвергали вспомогательной иммунизации на 7 сутки адъювантной эмульсией, содержащей либо 5 мкг Tat/толероген p24 (Ag+Tol), либо 5 мкг авидин-p24 (Ag отдельно) в качестве контроля. На 14 сутки, клетки дренирующих лимфатических узлов собирали и стимулировали в количестве 105 клеток/лунка микротитрационного культурального планшета либо с добавлением антигена (специфический, рекомбинантный p24, 1 мкг/мл), либо с добавлением моноклонального антитела против T-клеточного рецептора (неспецифический, 2C11, 10 мкг/мл). Захват меченного тритием тимидина (CPM) определяли по жидкостной сцинтилляции на 4 сутки культивирования. Специфический ответ Ag+Tol подавляется на 98% относительно Ag и неотличим от клеток в отсутствие стимула.

Пример 3

Подавление посредством Tat опосредуется AReg

Опосредуемое Tat антигенспецифическое подавление опосредуется транс-(внутриклеточной) активацией CD14+ FasL+ макрофаг (фиг.8). У мышей, Tat вызывает толерантность на уровне T-клеток, и она сохраняется в течение по меньшей мере шести недель после первоначальной обработки в условиях, продемонстрированных на фиг.6. Популяцию периферических мононуклеарных клеток крови (PBMC) человека, обогащенную моноцитами посредством центрифугирования Percoll, культивировали в течение четырех суток либо в среде, содержавшей 5% эмбриональную телячью сыворотку (FCS, контроль), либо Tat (50 нМ), либо LPS (100 нг/мл). Собранные клетки подвергали двойному окрашиванию с флуоресциенированным (антитело против fl1) моноклональным антителом против FasL (Mab), (αFasL-FITC, Nok 1, BD Pharmingen) и меченным родамином Mab против CD14 (αCD14fl2, BD Biosciences, CD14 представляет собой детерминанту, специфическую для макрофагов (MΦ). Клетки анализировали с помощью FACScan (Becton Dickinson) в отношении активации (рассеяние вперед), экспрессии CD14 (R2, процента MΦ) и в отношении индукции FasL (MFI). Популяция T-клеток (R1) была CD14- и не экспрессировала FasL. Сходные результаты получали для клеток, собранных после культивирования в течение 2, 3, 5 или 6 суток в качестве PBMC, собранных на четвертые сутки.

В клетках человека Tat-активированные макрофаги представляют собой иммунодепрессивные макрофаги, регулирующие APC (AReg) (фиг.9). Для определения каскада иммунодепрессии Tat через индукцию FasL на макрофаге, приводящую к утрате вторичных ответов хелперных T-клеток, использовали анализы T-клеточной пролиферации с сенсибилизирующими антигенами, tat и антагонистами FasL. На фиг.9A, PBMC человека от одного индивидуума культивировали в трех экземплярах в течение 5 суток либо в среде (не показано), либо со столбнячным антигеном (Ag, 0,3 Lf/мл), либо с антигеном с дополнительным добавлением 50 нМ Tat (Ag+Tat) или Ag с 50 нМ Tat и рекомбинантным белком sFas (25 мкг/мл) для блокирования поверхностного Fas L, экспрессируемого на макрофагах (Ag+Tat+sFas). Меченный тритием тимидин добавляли в течение последних 18 часов, и результаты нанесены на график в качестве индекса стимуляции (среднее значение cpm в стимулированной культуре/среднее значение cpm в контроле в виде среды). Результаты являются репрезентативными для трех сходных экспериментов. При низких концентрациях Tat (50 нМ) индуцированная Tat иммуносупрессия не только полностью обращалась вспять при добавлении растворимого Fas, но в этих условиях Tat фактически становился стимулирующим (141% относительно обработки антигеном отдельно). Фиг.9B: Пролиферация PBMC, культивируемых в течение 6 суток либо с возбудителем столбняка, либо с антигеном Candida отдельно (Ag), по сравнению с культурами, в которых также добавляли Tat (Ag+Tat, 125 нМ), или Tat (125 нМ) и антагонистическое антитело против Fas, ZB4 (250 мкг/мл, Upstate Biotechnology) (Ag+Tat+αFas). Результаты являются репрезентативными для трех сходных экспериментов.

Пример 4

Биоанализ in vitro в отношении дифференцировки моноцитов

Сверхчувствительный биоанализ моноцитов Tat in vitro используют для оценки иммунодепрессивной или иммуностимулирующей активности белков Tat, описанных в настоящем описании. В этом анализе используются свежие моноцитарные клетки, по существу очищенные из периферической крови человека с использованием стандартных процедур увеличения содержания клеток в градиенте плотности или других протоколов выделения клеток, известных в данной области. По существу очищенные моноциты промывают, а затем культивируют в RPMI-1640, дополненной 10% FBS при 37°C.

Биоанализ сверхчувствительных моноцитов Tat in vitro проводят с использованием положительного контроля (FasL, индуцирующее соединение) и отрицательного контроля (в культуру не добавляют активного соединения). Дополнительные подходящие положительные контроли включают, но не ограничиваются ими, липополисахарид (LPS) и/или фактор некроза опухоли (TNF-α) в конечной концентрации 100 нг/мл и 50 нг/мл, соответственно. Исследуемые образцы (препараты Tat) анализируют в конечных концентрациях от 50 пМ до 50 нМ, и они включают Tat, ox-Tat и другие производные и мутанты Tat.

Исследуемые образцы и контроли по отдельности смешивают с по существу чистыми моноцитами, высеянными при плотности 106 клеток/мл в круглодонных пробирках, содержавших RPMI-1640 с 10% FBS (обозначаемые в настоящем описании в совокупности как анализируемые культуры). Затем анализируемые культуры инкубируют в течение подходящего периода времени, предпочтительно от пяти до шести суток, при 37°C, в условиях 5% CO2.

В конце периода инкубации клетки извлекают из каждой анализируемой культуры и выявляют наличие какой-либо индуцируемой экспрессии FasL (для измерения дифференцировки в AReg) или экспрессии CD86 (для дифференцировки в дендритные клетки) путем окрашивания антителами против FasL или против CD86 и соответствующими флуоресцентными средствами для обнаружения. После окрашивания культур флуоресценцию выявляют с использованием системы активируемой флуоресценцией сортировки клеток (FACS). Контрольное окрашивание проводят с использованием только системы для обнаружения флуоресценции и вычитают из специфического окрашивания антителом против FasL или антителом против CD86, наблюдаемым в культурах для анализа. Чем более высоким является процент положительных по FasL клеток в данной культуре для анализа, тем более иммунодепрессивным является исследуемый образец в анализируемой культуре. Напротив, если анализируемая культура имеет преобладание CD86-положительных клеток, исследуемый образец идентифицируют как иммуностимулирующий. Отрицательные контроли всегда должны оставаться нереагирующими с антителами, и положительные контроли должны находиться в заданных диапазонах.

Пример 5

Синтез производных Tat

Синтетические пептиды собирали с помощью стандартной химии Fmoc с использованием автоматизированного устройства для синтеза CS336X (C S Bio Co., Menlo Park, CA). Пептиды отщепляли от смолы с использованием коктейля для расщепления трифторуксусной кислоты/удаления защитной группы, сочетающегося с присутствием семи остатков цистеина. Очистку проводили с использованием обращенно-фазовой ВЭЖХ. Конечный продукт лиофилизировали из H2O/ацетонитрила. В части каждого синтеза проводили мечение Alexa-488. Все синтетические производные Tat достигали чистоты >95%. Синтетические пептиды разбавляли в фосфатном буфере в присутствии 0,1 мМ дитиотреитола перед применением.

Пример 6

Активность производных Tat in vitro

Моноциты культивировали в течение 24-28 часов с производным Tat (SEQ ID NO: 7, Nani-P2), (фиг.10) или липополисахаридом (LPS) (фиг.11) а затем клетки промывали и окрашивали флуоресцентно меченным CD86. Производное Tat стимулировало более высокую экспрессию CD86, чем либо ISS (TLR), либо LPS.

Пример 7

Визуализация в живых клетках производных Tat в клеточных линиях T-лимфоцитов и моноцитов

Клеточную линию Jurkat (клон E6-1, American Type Culture Collection) поддерживали в RPMI-1640 (GIBCO), 10% инактивированной нагреванием FBS (GIBCO), 50 Е пенициллина/50 мкг/мл стрептомицина (GIBCO) и 2 мМ L-глутамине (GIBCO) при 37°C в 5% CO2. Клетки U937 (American Type Culture Collection) выдерживали в RPMI-1640 (GIBCO), 10% инактивированной нагреванием FBS, 50 Е пенициллина, 50 мкг/мл стрептомицина и 2 мМ L-Глутамине (GIBCO), 10 мМ HEPES (GIBCO) и 0,005% β-меркаптоэтаноле (Sigma-Aldrich) при 37°C в 5% CO2.

Один миллион живых клеток Jurkat или клеток U937 инкубировали в полной культуральной среде в течение 60-120 минут при 37°C в 5% CO2, с добавлением или без добавления 5 мкМ меченного Alexa-488 синтетического производного Tat. Клетки промывали в PBS, содержавшем 0,1% инактивированную нагреванием FBS, 1 мМ EDTA, и окрашивали красителем HOECHST-NucBlue Live Cell Stain (Molecular Probes) путем добавления 2 капель/мл в клеточную суспензию. Клетки поддерживали на льду до тех пор, пока не проводили визуализацию живых клеток.

Клетки помещали в чашки со стеклянным дном (MatTek Corp.) и визуализировали на микроскопе Zeiss Axio Observer.Z1 (Carl Zeiss) с использованием объектива Plan-Neofluor 100×/1,3. Для возбуждения окрашенной HOESCHT ДНК и меченного Alexa488 белка использовали LED (Colibri; Carl Zeiss) при 365 нм и 470 нм. Испускание получали с помощью стандартных фильтров флуоресценции DAPI и FITC. Флуоресцентные и фазово-контрастные изображения получали с помощью камеры Orca ER cooled CCD camera (Hamamatsu Photonics).

Результаты, представленные на фиг.12 и 13, демонстрируют способность синтетических производных Tat входить в линии клеток T-лимфоцитов и моноцитов in vitro. T-клетки Jurkat (фиг.12) и моноциты U937 (фиг.13), обработанные меченными Alexa488 производными Tat, демонстрируют клеточный захват и ядерную локализацию флуоресцентно меченных белков, демонстрируя применения этих молекул в качестве проникающих в клетку пептидов, наделенных способностью локализоваться в и вокруг ядра.

Пример 8

Активированная флуоресценцией сортировка клеток, обработанных производным Tat

Мононуклеарные клетки периферической крови (PBMC) человека выделяли из цельной крови центрифугированием в градиенте плотности со средой для разделения Histopaque с использованием центрифужной пробирки ACCUSPIN™ (Sigma-Aldrich). Культуры PBMC получали в RPMI-1640, 10% инактивированной нагреванием эмбриональной телячьей сыворотке, 50 Е пенициллина/50 мкг/мл стрептомицина и 2 мМ L-глутамина при плотности клеток 1×106 клеток/мл в 12-луночном планшете для культивирования тканей. PBMC инкубировали либо в отсутствие стимула, в присутствии либо 1 мкг/мл LPS (Sigma-Aldrich), либо 100 нг/мл TNF-α (Peprotech), либо 1 мкг/мл синтетического производного Tat (SEQ ID NO: 9) при 37°C в 5% CO2. После 3-5 суток клетки собирали, промывали и окрашивали моноклональным антителом мыши против CD14, конъюгированным с аллофикоцианином (APC) (клон M5E2, BD Biosciences) или моноклональным антителом мыши против Fas-лиганда человека, конъюгированным с флуоресцеином (FITC) (клон SB93a, Southern Biotech). Добавляли йодид пропидия для оценки жизнеспособности, а затем проводили активированную флуоресценцией сортировку клеток (FACS) на проточном цитометре BD LSR II Flow Cytometer (BD Biosciences).

Результаты, представленные на фиг.14-17 демонстрируют способность производных Tat стимулировать и увеличивать количество CD14 и FasL на клеточной поверхности PBMC человека in vitro относительно нестимулированных контролей в анализе FACS, что указывает на присутствие клеток AReg, способных подавлять T-клеточный иммунный ответ.

В заключение, следует понимать, что хотя аспекты настоящего изобретения продемонстрированы с помощью конкретных вариантов осуществления, специалисту в данной области будет понятно, что эти описанные варианты осуществления только иллюстрируют принципы объекта, описанного в настоящем описании. Таким образом, следует понимать, что описанный объект никоим образом не ограничивается конкретной методологией, протоколом и/или реагентом, и т.д., описанными в настоящем описании. По существу, различные модификации или изменения или альтернативные конфигурации описанного объекта можно проводить в соответствии с указаниями в настоящем описании без отклонения от сущности настоящего описания. Наконец, терминология, используемая в настоящем описании, предназначена только для описания конкретных вариантов осуществления и не предназначена для ограничения объема настоящего изобретения, который определяется только формулой изобретения. Таким образом, настоящее изобретение не ограничивается точно тем, что показано и описано.

В настоящем описании описаны определенные варианты осуществления настоящего изобретения, включая наилучший способ, известный авторам изобретения, для осуществления изобретения. Безусловно, варианты этих описанных вариантов осуществления станут очевидными специалистам в данной области при прочтении представленного выше описания. Авторы изобретения ожидают, что квалифицированные специалисты будут использовать такие варианты соответствующим образом, и авторы изобретения подразумевают, что настоящее изобретение можно применять на практике иначе, чем конкретно описано в настоящем описании. Таким образом, настоящее изобретение включает все модификации и эквиваленты объекта, указанного в формуле изобретения, прилагаемой к настоящему описанию, допустимые действующим законодательством. Более того, любая комбинация описанных выше вариантов осуществления во всех возможных их вариантах охватывается изобретением, если нет иных указаний в настоящем описании или если контекст явно этому не противоречит.

Группирование альтернативных вариантов осуществления, элементов или стадий по настоящему изобретению не следует истолковывать как ограничения. Каждый представитель группы может быть указан и заявлен индивидуально или в любой комбинации с другими представителями групп, описанными в настоящем описании. Ожидается, что один или несколько представителей групп могут быть включены или удалены из группы по причинам удобства и/или патентоспособности. Когда происходит такое включение или удаление, подразумевается, что описание включает группу, модифицированную таким образом, удовлетворяющую письменному описанию всех групп Маркуша, используемых в прилагаемой формуле изобретения.

Если нет иных указаний, все числа, выражающие характеристику, пункт, количество, параметр, свойство, термин и т.д., используемые в настоящем описании и формуле изобретения следует понимать как модифицированные во всех случаях термином "приблизительно". Как используют в рамках изобретения, термин "приблизительно" означает, что характеристика, пункт, количество, параметр, свойство или термин, определенный таким образом, охватывает диапазон плюс или минус десять процентов выше или ниже величины указанной характеристики, пункта, количества, параметра, свойства или термина. Таким образом, если не указано обратное, числовые параметры, указанные в описании и прилагаемой формуле изобретения, являются приближенными величинами, которые могут варьировать. Самое меньшее и не в попытках ограничить использование доктрины эквивалентов в объеме изобретения, каждую числовую величину следует истолковывать по меньшей мере с учетом количеств сообщенных значащих цифр и с использованием стандартных методик округления. Несмотря на то, что числовые диапазоны и величины, отражающие широкий объем изобретения являются приближениями, числовые диапазоны и величины, указанные в конкретных примерах, указаны настолько точно, насколько это возможно. Однако любой числовой диапазон или величина по своей природе содержит определенные ошибки, являющиеся обязательным следствием стандартного отклонения при их соответствующих измерениях в исследовании. Перечисление числовых диапазонов величин предназначено только в качестве сокращенного способа индивидуального указания на каждую отдельную числовую величину в этом диапазоне. Если в настоящем описании нет иных указаний, каждая индивидуальная величина числового диапазона включена в настоящее описание, как если бы это было отдельно указано в настоящем описании.

Форму единственного числа в контексте описания настоящего изобретения (особенно в контексте представленной ниже формулы изобретения) следует истолковывать как охватывающую как единственное, так и множественное число, если в настоящем описании нет иных указаний или если контекст этому явно не противоречит. Все способы, описанные в настоящем описании, можно выполнять в любом подходящем порядке, если нет иных указаний в настоящем описании или если контекст этому явно не противоречит. Использование любых и всех примеров или иллюстративных формулировок (например, "такой как"), представленных в настоящем описании, предназначено только для лучшей иллюстрации настоящего изобретения и не ограничивает объем изобретения, заявленный иным образом. Никакую формулировку в настоящем описании не следует истолковывать, как указывающую на какой-либо незаявленный элемент, существенный для применения изобретения на практике.

Конкретные варианты осуществления, описанные в настоящем описании, может дополнительно ограничиваться в формуле изобретения с использованием формулировки "состоящий из" или "по существу состоящий из". При использовании в формуле изобретения, либо поданной, либо добавленной с изменениями, переходный термин "состоящий из" исключает любой элемент, стадию или ингредиент, не указанные в формуле изобретения. Переходный термин "по существу состоящий из" ограничивает объем пункта формулы изобретения указанными материалами или стадиями и теми, которые не оказывают существенного влияния на основную и новую характеристику(-и). Варианты осуществления настоящего изобретения, заявленные таким образом, имманентно или недвусмысленно описаны и раскрыты в настоящем описании.

Все патенты, патентные публикации и другие публикации, приведенное в качестве ссылок и указанные в настоящем описании, индивидуально и прямо включены в настоящее описание в качестве ссылок в полном объеме для целей описания и раскрытия, например, композиций и методологий, описанных в таких публикациях, которые могут быть использованы применительно к настоящему изобретению. Эти публикации предоставлены только для их раскрытия до даты подачи настоящей заявки. Ничто в этом отношении не следует истолковывать как допущение того, что авторы изобретения не имеют право противопоставлять факт создания изобретения с более ранним приоритетом в силу настоящего изобретения или по любой другой причине. Все указания в отношении даты или представления содержимого этих документов основаны на информации, доступной для заявителя и не устанавливают какого-либо признания действительным точности дат или содержания этих документов.

1. Иммунодепрессивный полипептид, являющийся производным трансактиватора транскрипции (Tat), имеющий аминокислотную последовательность, содержащую следующие домены в указанном порядке:

(i) домен фактора транскрипции (TF), содержащий последовательность из иммунодепрессивного вируса иммунодефицита человека (ВИЧ), белка Tat SIV, hairless или искусственной иммунодепрессивной последовательности, где домен TF содержит аминокислотную последовательность согласно одной из SEQ ID NO: 36, 39, 44, 48, 50 или 54, и необязательно дополнительно содержащий последовательность повтора, содержащую (PVDPRLEPWKHPGSQP)n на N-конце, где n=2-10;

(ii) цистеин-богатый домен из лентивирусного Tat или молекулы дефензина, где цистеин-богатый домен содержит аминокислотную последовательность согласно одной из SEQ ID NO: 37, 40, 41, 43, 45, 51, 55, 57, 58, 62, 63, 64 или 70; и

(iii) C-концевой домен из лентивирусного белка Tat, где C-концевой домен содержит аминокислотную последовательность согласно одной из SEQ ID NO: 38, 42, 46, 52, 68 или 71;

или где иммунодепрессивный полипептид, являющийся производным трансактиватора транскрипции (Tat), содержит домен фактора транскрипции (TF)согласно (i) и где цистеин-богатый домен (ii) и C-концевой домен (iii) совместно содержат аминокислотную последовательность SEQ ID NO: 47, 49 или 53.

2. Иммунодепрессивный полипептид, являющийся производным Tat, по п.1, дополнительно содержащий аргинин-богатый домен из лентивирусного белка Tat.

3. Иммунодепрессивный полипептид, являющийся производным Tat, по п.1, где лентивирусный Tat происходит из ВИЧ-1, ВИЧ-2, SIV, FIV или EIAV.

4. Иммунодепрессивный полипептид, являющийся производным Tat, по п.1, где домен TF дополнительно содержит последовательность повтора, содержащую (PVDPRLEPWKHPGSQP)n на N-конце, где n=2-10.

5. Иммунодепрессивный пептид, являющийся производным Tat, по п.1, содержащий одну из SEQ ID NO: 9, 13-15 или 69.

6. Иммунодепрессивный пептид, являющийся производным Tat, по п.1, где как цистеин-богатый домен, так и C-концевой домен происходят из одного источника и аминокислотная последовательность объединенного цистеин-богатого и C-концевого домена представляет собой одну из SEQ ID NO: 47, 49 или 53.

7. Фармацевтическая композиция для лечения заболевания, характеризующегося аберрантными иммунными ответами, содержащая в эффективном количестве один или несколько иммунодепрессивных полипептидов, являющихся производными Tat, по п.1 и фармацевтически приемлемый эксципиент.

8. Способ лечения заболевания, характеризующегося аберрантными иммунными ответами, включающий:

введение терапевтически эффективного количества одного или нескольких иммунодепрессивных полипептидов, являющихся производными Tat, по п.1 индивидууму, нуждающемуся в этом; и

тем самым осуществление лечения заболевания путем подавления иммунной системы, где заболевание, характеризующееся аберрантными иммунными ответами, представляет собой заболевание, выбранное из аутоиммунного, нейродегенеративного или ассоциированного с воспалением заболевания.

9. Способ по п.8, где заболевание представляет собой аутоиммунное нарушение, и аутоиммунное нарушение представляет собой острый диссеминированный энцефаломиелит (ADEM), болезнь Аддисона, аллергию, аллергический ринит, болезнь Альцгеймера, синдром антифосфолипидных антител (APS), артрит, астму, синдром аутоиммунного дефицита, аутоиммунную гемолитическую анемию, аутоиммунный гепатит, аутоиммунное заболевание внутреннего уха, буллезный пемфигоид, глютеновую болезнь, болезнь Шагаса, хроническое обструктивное заболевание легких (COPD), сахарный диабет 1 типа (IDDM), экзему, эндометриоз, желудочно-кишечное нарушение, синдром Гудпасчера, болезнь Грэйвса, синдром Гийена-Барре (GBS), тиреоидит Хашимото, гнойный гидраденит, идиопатическую тромбоцитопеническую пурпуру, воспалительное заболевание кишечника, воспалительное дерматологическое заболевание, интерстициальный цистит, волчанку, очаговую склеродермию, рассеянный склероз (MS), миастению гравис, миопатию, нарколепсию, нейромиотонию, пемфигус обыкновенный, пернициозную анемию, первичный билиарный цирроз, псориаз, рекуррентный диссеминированный энцефаломиелит, ревматическую атаку, шизофрению, склеродермию, синдром Шегрена, нарушение кожи, теносиновит, увеит, васкулит или витилиго.

10. Способ по п.8, где заболевание представляет собой заболевание, ассоциированное с воспалением, которое представляет собой угревую сыпь, кислотный рефлюкс/изжогу, аллергию, аллергический ринит, болезнь Альцгеймера, аппендицит, артериит, артрит, астму, атеросклероз, аутоиммунное нарушение, баланит, блефарит, бронхиолит, бронхит, бурсит, рак, кардит, глютеновую болезнь, целлюлит, цервицит, холангит, холецистит, хориоамнионит, хроническое обструктивное заболевание легких (COPD), цирроз, колит, конъюнктивит, цистит, вирусную инфекцию верхних дыхательных путей, дакриоаденит, деменцию, дерматит, дерматомиозит, экзему, эмфизему, энцефалит, эндокардит, эндометрит, энтерит, энтероколит, эпикондилит, эпидидимит, фасциит, фиброзит, гастрит, гастроэнтерит, гингивит, гломерулонефрит, глоссит, заболевание сердца, гепатит, гнойный гидраденит, высокое кровяное давление, илеит, резистентность к инсулину, интерстициальный цистит, ирит, ишемическую болезнь сердца, кератит, кератоконъюнктивит, ларингит, волчанку, мастит, мастоидит, менингит, метаболический синдром (синдром X), мигрень, рассеянный склероз, миелит, миокардит, миопатию, миозит, нефрит, невропатию, ожирение, омфалит, оофорит, орхит, остеохондрит, остеопению, остеопороз, остеит, отит, панкреатит, болезнь Паркинсона, паротит, воспалительное заболевание таза, перикардит, перитонит, фарингит, флебит, плеврит, пневмонит, проктит, простатит, псориаз, пульпит, пиелонефрит, пилефлебит, ревматическую атаку, ринит, сальпингит, сиаладенит, синусит, спастический толстый кишечник, стоматит, синовит, тендинит, тендиноз, теносиновит, тромбофлебит, тонзиллит, тригонит, опухоль, уретрит, увеит, вагинит, васкулит или вульвит.

11. Способ по п.8, где заболевание представляет собой нейродегенеративное заболевание и нейродегенеративное заболевание представляет собой болезнь Александера, болезнь Альперса, болезнь Альцгеймера, амилоидоз, боковой амиотрофический склероз, тревожность, атаксию-телеангиэктазию, дефицит внимания, болезнь Канавана, травмы центральной нервной системы, болезнь Шарко-Мари-Тута, синдром Кокейна, кортикобазальную дегенерацию, болезнь Крейтцфельда-Якоба, депрессию, энцефалит (например, бактериальный, паразитарный, грибковый или вирусный), атаксию Фридрейха, лобно-височную деменцию, наследственный спастический парапарез, синдром Гийена-Барре (и его варианты: острая невропатия аксонов двигательных нервов, острая воспалительная демиелинизирущая полиневропатия и синдром Фишера), ВИЧ/СПИД-дементный комплекс, болезнь Гентингтона, ишемическое повреждение нервной системы, болезнь Кеннеди, болезнь Краббе, деменцию с тельцами Леви, болезнь Мачадо-Джозефа, менингит (например, бактериальный, паразитарный, грибковый или вирусный), рассеянный склероз, множественную системную атрофию, повреждение нервной системы, например, сотрясение головного мозга, травму спинного мозга и травматическое повреждение нервной системы, невропатию, например, такую как индуцированная химиотерапией невропатия, ассоциированная с диабетом невропатия и периферическая невропатия, болезнь Паркинсона, болезнь Пелицеуса-Мерцбахера, болезнь Пика, первичный латеральный склероз, прионные нарушения, прогрессирующий надъядерный паралич, болезнь Рефсума, болезнь Сендхоффа, шизофрению, болезнь Шильдера, спиномозжечковую атрофию, болезнь Стила-Ричардсона-Ольшевского, инсульт, сухотку спинного мозга или сосудистую деменцию.

12. Способ по п.8, где способ дополнительно вызывает уменьшение по меньшей мере одного симптома, ассоциированного с аутоиммунным заболеванием, нейродегенеративным заболеванием или заболеванием, ассоциированным с воспалением, и симптомом которого является воспаление, усталость, головокружение, беспокойство, лихорадка и высокая температура тела, чрезмерная чувствительность к холоду в руках и ступнях, слабость и скованность мышц и суставов, изменение массы тела, пищеварительные и желудочно-кишечные проблемы, низкое или высокое кровяное давление, раздражимость, тревожность или депрессия, бесплодие или снижение полового влечения (низкое либидо), изменения уровня сахара в крови и, в зависимости от типа аутоиммунного заболевания, увеличение размера органа или ткани или разрушение органа или ткани.

13. Способ по п.8, где иммунодепрессивный полипептид, являющийся производным Tat, вводят многократными дозами.

14. Способ по п.8, где иммунодепрессивный полипептид, являющийся производным Tat, вводят раз в сутки, раз в неделю, раз в две недели, раз в месяц или раз в два месяца.



 

Похожие патенты:

Настоящее изобретение относится к области биотехнологии. Предложена интерферирующая рибонуклеиновая кислота (РНК).

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к способу получения гетеротетрамерного рекомбинантного стрептавидина. Настоящий способ предусматривает создание двух плазмид, одна из которых кодирует стрептавидин мутантного типа, а другая – стрептавидин дикого типа, трансформацию указанными плазмидами клеток E.coli, индукцию синтеза стрептавидинов, выделение периплазматической фракции клеток и очистку гетеротетрамерного стрептавидина на аффинном сорбенте.

Изобретения касаются способа доставки или переноса гетерологичной полинуклеотидной последовательности в печень млекопитающему и способа лечения млекопитающего с недостаточностью экспрессии фактора свертывания крови или функции.

Настоящее изобретение относится к области биотехнологии, конкретно к конъюгату антисмыслового олигомера, и может быть использовано в медицине. Изобретение направлено на получение конструкции, позволяющей улучшить терапевтический индекс представляющего интерес антисмыслового олигонуклеотида и его высвобождение в клетках вследствие конъюгации олигонуклеотида с расщепляемой фосфодиэфирной областью и направляющей группой, способствующей доставке полученного конструкта в нужное место в клетке и обеспечивающей направленный захват действующего антисмыслового олигомера целевыми клетками.

Настоящее изобретение относится к биотехнологии и генетической инженерии, в частности к генетически модифицированным грызунам, таким как мышь и крыса, которые экспрессируют химерный человеческий/не относящийся к человеку полипептид МНС I и/или человеческий полипептид β2 микроглобулина, а также к клеткам таких грызунов.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к генетической конструкции для обеспечения экспрессии целевых гомологичного и гетерологичного генов в клетках реципиентного гриба Penicillium verruculosum.

Изобретение относится к области медицинской вирусологии и касается штамма вируса гриппа. Вакцинный штамм A/17/Нью Йорк/15/5364 (H1N1) pdm09 - реассортант, полученный путем скрещивания «дикого» вируса А/Нью Йорк/61/2015 (H1N1) pdm09 с холодоадаптированным температурочувствительным вирусом А/Ленинград/134/17/57 (H2N2) - донором аттенуации, безвредным для людей.

Изобретение относится к области биохимии. Описан набор олигонуклеотидных проб для определения генотипа митохондриальной ДНК человека, характеризующийся тем, что данный набор позволяет определить генотип митохондриальной ДНК человека в 38 однонуклеотидных сайтах, расположенных в различных участках митохондриального генома и полиморфных в популяциях населения России различного этнического происхождения, с помощью метода ферментативного однонуклеотидного удлинения гибридизированной пробы, причем структура олигонуклеотидных проб учитывает вариабельность ДНК в близлежащих сайтах и группировку генотипируемых сайтов в 3 панели для мультиплексных реакций.

Изобретение относится к области биотехнологии, в частности к гибридомной технологии, и представляет собой штамм гибридных клеток mus musculus α - продуцент моноклональных антител к раково-тестикулярному антигену человека GAGE.

Изобретение относится к биотехнологии, медицине, в частности к применению подкожного ксенографта клеточной линии беспигментной меланомы кожи человека mel Rac с мутацией гена NRAS и с адаптацией к росту со стабильной кинетикой у иммунодефицитных мышей Balb/c nude для доклинического изучения таргетных противоопухолевых средств.

Изобретение относится к области биохимии, в частности к одноцепочечному антителу, которое связывается с раково-эмбриональным антигеном (РЭА). Также раскрыты химерный мономолекулярный Т-клеточный рецептор, включающий указанное антитело, вектор для экспрессии указанного рецептора, клетка-хозяин, продуцирующая указанный рецептор.

Изобретение относится к области биохимии и биотехнологии, в частности к нецитотоксическому анальгетическому одноцепочечному полипептидному слитому белку. Настоящий слитый белок содержит нецитотоксическую протеазу, первый спейсер, сайт расщепления протеазой, направляющий фрагмент галанина, второй спейсер и домен транслокации.

Изобретение относится к области иммунологии. Предложено одноцепочечное антитело к раково-эмбриональному антигену, а также включающий его химерный мономолекулярный Т-клеточный рецептор, вектор и клетка-хозяин для получения химерного мономолекулярного Т-клеточного рецептора.

Изобретение относится к области биотехнологии, конкретно к получению вариантов альбумина, что может быть использовано в медицине. Получают полипептиды, характеризующиеся по меньшей мере 90% идентичностью с исходным человеческим альбумином, а также их конъюгаты, слитые с ними белки, ассоциаты, наночастицы и фармацевтические композиции.

Настоящее изобретение относится к области биотехнологии, конкретно к связывающим белкам, специфичным к VEGF-A, и может быть использовано в медицине. Рекомбинантным путем получают связывающий белок, содержащий до четырех анкириновых повторных домена, которые способны ингибировать связывание VEGF-A165 с VEGFR-2.

Изобретение относится к области биотехнологии, в частности к способу очистки рекомбинантного белка - аналога интерферона альфа-17, представленного последовательностью SEQ ID NO: 1.

Изобретение относится к области биотехнологии, конкретно к получению рекомбинантных белков, повышающих иммуногенность последовательности иммуногенного полипептида, что может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к слитым белкам домена CD95, и может быть использовано для ингибирования сигнального пути CD95. Получен химерный белок, содержащий функциональный фрагмент укороченного по N-концу внеклеточного домена CD95, непосредственно сшитого с Fc-доменом, где функциональный фрагмент укороченного по N-концу внеклеточного домена CD95 расположен на N-конце Fc-домена или его функционального фрагмента, и где химерный белок лишен дополнительной N-концевой последовательности.

Изобретение относится к области биотехнологии, конкретно к получению нового рекомбинантного фактора свертывания крови, представляющего собой химерный белок с увеличенным временем полужизни в плазме, состоящий из фактора III человека и мутантного Fc-фрагмента IgG человека, что может быть использовано в медицине.

Настоящее изобретение относится к области биотехнологии. Предложена интерферирующая рибонуклеиновая кислота (РНК).

Настоящее изобретение относится к области биотехнологии, конкретно к иммунодепрессивным полипептидам, являющимся производными трансактиватора транскрипции, и может быть использовано в медицине для лечения аутоиммунного заболевания, ассоциированного с воспалением заболевания иили нейродегенеративного заболевания. Иммунодепрессивный полипептид содержит домен фактора транскрипции, содержащий последовательность из иммунодепрессивного вируса иммунодефицита человека, белка Tat SIV, hairless или искусственной иммунодепрессивной последовательности; цистеин-богатый домен из лентивирусного Tat или молекулы дефензина; и C-концевой домен из лентивирусного белка Tat1. Изобретение позволяет эффективно подавлять нежелательный иммунный ответ при заболеваниях, характеризующихся аберантными иммунными ответами. 3 н. и 11 з.п. ф-лы, 17 ил., 4 табл., 8 пр.

Наверх