Связывающие mica агенты

Изобретение относится к области биохимии и биотехнологии, а именно к моноклональному антителу, которое связывается с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, и содержащей его фармацевтической композиции. Изобретение также относится к способу лечения или предотвращения рака у нуждающегося в этом пациента с помощью вышеуказанной композиции, а также способу лечения или профилактики рака у пациента с помощью вышеуказанного моноклонального антитела. Изобретение позволяет эффективно лечить рак у пациента благодаря новому подходу к направленному воздействию на MICA терапевтическими агентами. 4 н. и 9 з.п. ф-лы, 11 ил., 6 табл., 12 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА РОДСТВЕННЫЕ ЗАЯВКИ

Настоящая заявка испрашивает приоритет на основании предварительной заявки на патент США №61/595902, поданной 7 февраля 2012 г., и предварительной заявки на патент США №61/625841, поданной 18 апреля 2012 г.; все указанные заявки полностью включены в настоящий документ посредством ссылок, включая все чертежи.

ССЫЛКИ НА ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

К настоящей заявке прилагается перечень последовательностей в электронном формате. Указанный перечень последовательностей представлен в виде файла с названием «РСТ Seq list MICA_ST25», созданного 7 февраля 2013 г., имеющего размер 77 кБ. Информация, представленная в электронном формате в перечне последовательностей, включена в настоящий документ полностью посредством ссылки.

ОБЛАСТЬ ТЕХНИКИ

В настоящем изобретении предложены антигенсвязывающие белки, способные связываться с полипептидами MICA. Указанные антигенсвязывающие белки обладают повышенной активностью при лечении расстройств, характеризующихся наличием MICA-экспрессирующих клеток, в частности, опухолевых клеток.

УРОВЕНЬ ТЕХНИКИ

Иммунорецептор NKG2D в норме экспрессируется на Т-клетках человека (например, Т-клетках CD8+, Т-клетках γδ) и НК-клетках. На преактивированных клетках CD8+ NKG2D функционирует как синергистический костимулятор CD28- и TCR-сигнализации за счет связывания DAP10, тогда как в НК-клетках он функционирует как прямой активатор. Таким образом после захвата лиганда NKG2D передает прямые активирующие или костимулирующие сигналы через сопряженный адаптерный белок DAP10, способствуя таким образом формированию иммунитета против рака и инфекционных заболеваний.

Идентифицированы и описаны различные лиганды NKG2D человека (hNKG2D), включая полипептиды, родственные А и В цепям главного комплекса гистосовместимости класса I (MICA и MICB), семейство UL16-связывающих белков (ULBP) и семейство индуцируемых ретиноевой кислотой ранних траскриптов-1 (RAET1). MICA часто ассоциирован с эпителиальными опухолями, индуцируемыми микробными инфекциями, и аберрантно экспрессируется в определенных очагах повреждения при аутоиммунных заболеваниях. Структура MICA сходна с укладкой белков ГКГС (МНС) класса I, с доменом-платформой α1α2 и мембрано-проксимальным Ig-подобным α3-доменом (Li et al., 2001 Nat. Immunol. 2:443). И MICA, и близкородственный ему MICB, который также функционирует в качестве лиганда NKG2D, полиморфны; было показано, что указанный полиморфизм влияет на сродство к NKG2D (Steinle et al. 2001 Immunogenetics 53:279).

У мышей, у которых отсутствуют гены цепей ГКГС класса I (MIC), семейства белков, структурно родственных ULBP, ранние индуцируемые ретиноевой кислотой (RAE-1) молекулы функционируют в качестве лигандов NKG2D. Было показано, что экспрессия RAE-1 индуцируется канцерогенами и стимулирует противоопухолевую активность Т-клеток. При этом NKG2D мышей распознает полипептиды MICA человека (Wiemann (2005) J. Immunol. 175:820-829).

Понимание роли MICA в биологии раковых заболеваний усложняется тем фактом, что MICA высвобождается на поверхности опухолевых клеток (например, аллель *019) и на поверхности экзосом (*08 аллель) в растворимой форме (Ashiru et al. (2010) Cancer Res. 70(2):481-489)). Высокие уровни растворимого MICA (sMICA) могут обнаруживаться, например, в сыворотке пациентов со злокачественными новообразованиями ЖКТ (Salih et al., 2002 J. Immunol. 169:4098). Сообщалось, что ММП ADAM10 и ADAM17, а также дисульфидизомераза Erp5, принимают участие в расщеплении и выделении (шеддинге) MICA (Waldhauer (2008) Cancer Research 68 (15) 6368-76; Kaiser et al. (2007) Nature; и Salih (2002) J. Immunol 169: 4098-4102). Мембраносвязанный MICA, как сообщалось, понижающе регулирует экспрессирование NKG2D на НК-клетках и/или Т-клетках (Von Lilienfeld-Toal et al. (2010) Cancer Immunol. Immunother.). В частности, Wiemann (2005), выше, исследовал MICA-трансгенных мышей и пришел к выводу, что понижающая регуляция поверхностного NKG2D на нетрансгенных спленоцитах была наиболее выражена после совместного культивирования со спленоцитами от MICA-трансгенных мышей in vitro, и только незначительно - после обработки сывороткой мышей H2Kb-MICA, при этом инкубирование с контрольными клетками и сывороткой нетрансгенных мышей nontgLM, соответственно, не оказывало эффекта; в целом данные свидетельствуют о том, что снижение количества поверхностного NKG2D на H2-K-MICA НК-клетках приводит к дисфункции NKG2D, и о том, что понижающую регуляцию NKG2D главным образом обуславливает постоянное воздействие клеточно-связанным MICA in vivo.

Также, согласно имеющимся сообщениям, выяснилось, что NKG2D на НК-клетках понижающе регулируется sMICA (Groh et al. (2002) Nature; Arreygue-Garcia (2008) BMC; Jinushi et al. (2005) J. Hepatol.), что приводит к меньшей реакционноспособности НК-клеток. Обоснованием, возможно, является то, что аналогичные системы были обнаружены в других семействах белков, например, Ig-подобных белков и суперсемействе ФНО; как было показано, они высвобождаются в растворимой форме, и высвобождение указанных молекул влияет на взаимодействие между клетками за счет снижения плотности лигандов и модулирует НК-клетки, несущие соответствующий рецептор (Salih 2002). В этой связи попытки получения антител против MICA направлены на разработку антител, которые подавляют выделение MICA.

Также сообщалось, что экспрессия лигандов NKG2D MICA и MICB на здоровых клетках может нарушать равновесие между активацией иммунитета и толерантностью, и активировать аутоиммунитет. Исследования генетического сцепления показали, что наблюдается положительная зависимость между некоторыми аллелями MICA и диабетом I типа; развитие заболевания у мышей NOD в предиабетическом периоде, на островковых клетках которых экспрессируется Rael, может быть полностью предотвращено лечением NKG2D-блокирующими моноклональными антителами, которые сокращают размножение и функционирование аутореактивных CD8+Т-клеток. Активность молекул MICA и MICB также сильно повышена в синовиоцитах при РА, и они активируют Т-клетки NKG2D-зависимым образом. Кроме того, у пациентов с ревматоидным артритом, как сообщалось, наблюдаются высокие уровни ИЛ-15 и ФНО-α в сыворотке и воспаленных суставах, что индуцирует экспрессирование NKG2D на CD4+CD28- субпопуляции Т-клеток. Имеются сведения о массивной инфильтрации интраэпителиальными NKG2D+CD8+CD Т-лимфоцитами в кишечнике при глютеновой болезни; у пациентов с активной формой заболевания существенно повышается экспрессирование белков MIC на поверхности эпителиальных клеток. При воспалительных заболеваниях кишечника были обнаружены повышенные уровни экспрессирования MIC на кишечных эпителиальных клетках, и обнаружено, что экспрессирование NKG2D на некоторых кишечных эпителиальных CD4+Т-клетках коррелирует с воспалением кишечника.

До настоящего времени подходы к лечению воспаления, основанные на системе NKG2D, были направлены на блокаду собственно NKG2D, а не его лигандов (Ogasawara et al. (2004) Immunity 20(6):757-767; Andersson et al. (2011) Arthritis. Rheum. 63(9):2617-2629; Steigerwald et al. (2009) MAbs 1 (2):115-127. Одной из возможных причин концентрации на NKG2D, а не на его лиганде, является очевидная трудность направленного воздействия на систему NKG2D-лигандов, включающую множество лигандов, и в некоторых случаях - значительное число аллелей.

Существует более 50 аллелей MICA и MICB, и идентифицировано по меньшей мере 13 аллелей MICB. Последовательности аминокислот полипептидов MIC в домене α1α2 (домен, вовлеченный в формирование контактной поверхности NKG2D) идентичны всего на 43%, и 80% замен аминокислот являются неконсервативными (Steinle et al. (2001) Immunogenetics 53:279-287; Steinle et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95:12510-12515), что указывает на маловероятность получения антител, эффективных для большинства индивидуумов в популяции. Кроме того, биморфизм метионин/валин в положении 129 MICA определяет различия в связывании NKG2D, и несмотря на то, что боковая цепь остатка 129 частично погружена и образует гидрофобные связи с глутамином 136, аланином 139 и метионином 140 в первом α2-спиральном участке, это может быть связано с конформационными отличиями указанного домена от форм MICA с валином 129 (Steinle et al. (2001) Immunogenetics 53:279-287).

Таким образом, существует потребность в новых подходах к направленному воздействию на MICA терапевтическими агентами.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Согласно одному аспекту настоящее изобретение является результатом, в том числе, обнаружения антител с высоким сродством в отношении всех аллелей MICA человека (а также в отношении MICA не являющихся человеком приматов).

Указанные антитела связывают, в частности, один или более аллелей MICA из каждой из двух основных групп MICA, которые, как установлено, представляют основные семейства MICA: аллелей группы 1, сильно связывающих NKG2D (в том числе MICA*001, *002, *007, *012, *017 и *018) и группы 2, слабо связывающих NKG2D (МIСА*004, *006, *008, *009 и *019). Связываясь с эпитопом, присутствующим на MICA подгрупп *001, *004, *007 и *008, или *001, *004, *007, *008 и *019, указанные антитела охватывают аллели обеих групп, присутствующие практически у всех индивидуумов. Необязательно, ЕС50 указанных антител составляет не более чем 5 мкг/мл, необязательно не более чем 3 мкг/мл, не более чем 2 мкг/мл, не более чем 1 мкг/мл или не более чем 0,5 мкг/мл для связывания с клетками, модифицированными для экспрессии на их поверхности *001, для клеток, модифицированных для экспрессии на их поверхности *004, для клеток, модифицированных для экспрессии на их поверхности *007 и для клеток, модифицированных для экспрессии на их поверхности *008.

Высокоаффинное связывание обладает преимуществом, в том числе, эффективного опосредования антителом CDC (комплементзависимой цитотоксичности, КЗЦ) и АЗКЦ (антителозависимой клеточноопосредованной цитотоксичности, АЗКЦ). В настоящем изобретении предложены эпитопы MICA в составе доменов α1 и/или α2, представляющие собой оптимальные связывающие антитело области для индуцирования высокой АЗКЦ-и/или КЗЦ-активности, и в то же время обнаруживаемые во всех основных аллелях MICA. Указанные эпитопы обычно расположены на боковой стороне доменов α1 и/или α2, и либо находятся полностью на наружной стороне связывающей поверхности NKG2D, либо частично заходят на связывающую поверхность NKG2D. Кроме того, идентифицированы эпитопы α3, способствующие повышенным уровням АЗКЦ/КЗЦ и демонстрирующие связывание с несколькими аллелями.

Также были идентифицированы подгруппы антител, блокирующие взаимодействие MICA с NKG2D. Помимо индуцирования АЗКЦ- и КЗЦ-активности при наличии Fc-доменов, связываемых Fcγ-рецепторами, или блокирования провоспалительной активности при наличии Fc-доменов, по существу не связываемых Fcγ-рецепторами, указанные антитела обладали полезной способностью блокировать индуцированное sMICA понижающее модулирование NKG2D.

Были также идентифицированы другие подгруппы антител, не блокирующие способность MICA на поверхности клеток (например, опухолевых клеток, трансфектантов) индуцировать NKG2D активность в NKG2D-экспрессирующей иммунной клетке, приведенной в контакт с указанной MICA-экспрессирующей клеткой в присутствии антитела против MICA. Помимо индуцирования АЗКЦ- и КЗЦ-активности, указанные антитела обладали полезной способностью действовать в обход ингибирования NKG2D, так что NKG2D-экспрессирующие иммунные эффекторные клетки сохраняли способность лизировать целевые клетки через NKG2D (например, дополнительно к любому опосредованному Fcγ-рецепторами механизму).

Рекомбинантный и связанный с клеточной поверхностью MICA, по-видимому, способен находиться в различных конформациях, и связывание клеточносвязанного MICA может оказывать отдаленное действие на белок MICA. В частности, блокирование способности MICA на поверхности клеток (например, опухолевых клеток, трансфектантов) индуцировать сигнализацию через NKG2D неожиданным образом не всегда коррелирует со способностью блокировать MICA-NKG2D взаимодействия при применении рекомбинантных белков (исследование Biacore). Также крайне неожиданным было то, что, хотя мультиаллельные антитела, как было обнаружено, не находятся полностью в составе зоны связывания NKG2D на плато домена α1α2, MICA-блокада способности MICA на поверхности клеток (например, опухолевых клеток, трансфектантов) индуцировать NKG2D-сигнализацию не коррелировала с расположением связывающего эпитопа. Некоторые антитела, находящиеся далеко от области взаимодействия NKG2D, были способны блокировать индуцирование активности NKG2D, тогда как некоторые другие антитела, находясь рядом с областью взаимодействия NKG2D или частично перекрываясь с ней, не блокировали индуцирование активности NKG2D. Антитела также различались по способности опосредовать КЗЦ как функции их эпитопов.

Аллели MICA группы 1 обычно содержат М в качестве остатка 129, в то время как аллели группы 2 в качестве остатка 129 содержат V. Согласно одному из вариантов реализации группы MICA характеризуют в соответствии с присутствием остатка метионина (М) или валина (V) в положении 129 полипептида MICA, при этом М ассоциирован с формой MICA, сильно связывающей NKG2D, а V ассоциирован с более слабым связыванием с NKG2D.

Согласно одному из вариантов реализации в настоящем изобретении предложены антитела, перекрестно реагирующие с аллелем MICA, содержащим метионин в положении 129, и аллелем MICA, содержащим валин в положении 129. Согласно одному аспекту в настоящем изобретении предложено моноклональное антитело, которое специфически связывается с полипептидом MICA человека, содержащим метионин в положении 129, и полипептидом MICA человека, содержащим валин в положении 129. ЕС50 указанных антител необязательно составляет не более чем 5 мкг/мл, необязательно не более чем 3 мкг/мл, не более чем 2 мкг/мл, не более чем 1 мкг/мл или не более чем 0,5 мкг/мл для связывания с клетками, модифицированными для экспрессии на их поверхности полипептида MICA человека, содержащего метионин в положении 129, и с клетками, модифицированными для экспрессии на их поверхности полипептида MICA человека, содержащего валин в положении 129.

Согласно одному варианту реализации указанное антитело также связывается с полипептидом MICB, содержащим валин в положении 152 (например, с полипептидом MICB, соответствующим последовательности SEQ ID NO: 6).

Обнаруженные области связывания присутствуют и на гликозилированном MICA, в частности, гликозилированном MICA, экспрессируемом преимущественно опухолевыми клетками человека.

Согласно одному из вариантов реализации настоящее изобретение является результатом, в том числе, обнаружения антител, эффективных in vitro и in vivo для индуцирования лизиса эффекторными клетками (например, НК-клетками и/или Т-клетками) MICA-экспрессирующих опухолевых клеток, в то же время блокирующих взаимодействие MICA с NKG2D. Антитела, блокирующие взаимодействия NKG2D-MICA, обладают преимуществом, заключающимся в том, что такие антитела способны предотвращать индуцированную sMICA понижающую регуляцию NKG2D, как показано в настоящем описании. Такие блокирующие антитела могут быть особенно полезны для лечения пациентов с высокими уровнями растворимого MICA, например, в кровотоке. Согласно другому варианту реализации в настоящем изобретении предложены антитела, эффективные in vitro и in vivo для индуцирования лизиса эффекторными клетками (например, НК-клетками и/или Т-клетками) MICA-экспрессирующих опухолевых клеток, и подавляющие индуцированное sMICA понижающее модулирование экспрессирования NKG2D на поверхности иммунной эффекторной клетки, по существу без блокирования выделения MICA из MICA-экспрессирующих клеток (например, опухолевых клеток). Такие антитела могут подавлять индуцированное sMICA понижающее модулирование экспрессирования NKG2D путем ингибирования взаимодействия MICA с NKG2D. Указанное антитело необязательно содержит CDR легкой и тяжелой цепей, необязательно с одной или большим количеством модификаций аминокислот в CDR, антител 9С10, 19Е9, 12А10, 18Е8, 14 В4 или 10F3.

Согласно другому варианту реализации в настоящем изобретении предложены антитела, эффективные in vitro и in vivo для индуцирования лизиса эффекторными клетками (например, НК-клетками и/или Т-клетками) MICA-экспрессирующих опухолевых клеток по существу без блокирования выделения MICA из MICA-экспрессирующих клеток (например, опухолевых клеток), и по существу без блокирования взаимодействия MICA с NKG2D. Указанное антитело необязательно содержит CDR легкой и тяжелой цепей, необязательно с одной или большим числом модификаций аминокислот в CDR, антител 6Е4, 20С6, 16А8, 15F9 10А7 или 14В4.

Согласно одному из вариантов реализации предложены антитела, которые связываются с доменом α1α2 (домен, участвующий в формировании контактной поверхности NKG2D), перекрестно реагирующие с несколькими аллелями MICA (например, аллелем MICA, содержащим метионин в положении 129, и аллелем MICA, содержащим валин в положении 129; аллелями MICA *001, *004, *007 и *008) и связывающие с высоким сродством такие аллели MICA (например, с ЕС50, составляющей не более чем 5 мкг/мл, необязательно не более чем 3 мкг/мл, не более чем 2 мкг/мл, не более чем 1 мкг/мл или не более чем 0,5 мкг/мл для связывания с клетками, модифицированными для экспрессии на их поверхности полипептида MICA человека, соответствующего указанному аллелю). Указанные антитела необязательно связываются с областями на домене α1α2, расположенными с наружной стороны или частично с наружной стороны контактной поверхности NKG2D, но не входящими полностью в состав контактной поверхности NKG2D.

Анализ связывания с аллелями MICA и оценка соответствующих значений ЕС50 могут осуществляться с применением, например, проточной цитометрии, в соответствии со способами, описанными в настоящем документе в примере 3.

Согласно другому варианту реализации настоящее изобретение является результатом обнаружения антител, связывающих домен α1 и/или α2 MICA, по существу не блокируя взаимодействие MICA с NKG2D (например, при условии, что каждый из MICA и NKG2D экспрессируется на поверхности клеток). Такие антитела могут необязательно характеризоваться отсутствием конкуренции с hNKG2D за связывание MICA. Как вариант, указанные антитела не подавляют способность MICA индуцировать NKG2D активность в NKG2D-экспрессирующей клетке. Такие антитела могут, как вариант, быть охарактеризованы как не снижающие или не блокирующие способность NKG2D- экспрессирующей эффекторной клетки (например, СD16-негативной эффекторной клетки) к лизированию MICA-экспрессирующей целевой клетки. Как вариант, указанные антитела по существу не блокируют выделение MICA из опухолевых клеток.

Согласно одному из вариантов реализации не блокирующее домен α1α2 антитело связывает эпитоп на полипептиде MICA, соответствующем последовательности SEQ ID NO: 1, содержащий один или два остатка, выбранных из группы, состоящей из K81 и D82, один или два остатка, выбранных из группы, состоящей из Q83 и К84, один, два или три остатка, выбранных из группы, состоящей из Н109, Y111 и L116, необязательно остаток D113, один, два или три остатка, выбранных из группы, состоящей из Q131, S132 и Q136, один, два или три остатка, выбранных из группы, состоящей из S133, R134 и Т137, и/или 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из Ml40, N141, R143 и N144 (например, антитело 20С6 и 10А7).

Согласно одному из вариантов реализации не блокирующее домен α1α2 антитело связывает эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из R6 и N8, один или два остатка, выбранных из группы, состоящей из Е97 и Н99, один, два или три остатка, выбранных из группы, состоящей из Е100, D101 и N102, один, два или три остатка, выбранных из группы, состоящей из S103, Т104 и R105, необязательно остаток Е115, и/или один, два или три остатка, выбранных из группы, состоящей из L178, R179 и R180 (например, антитело 15F9).

Согласно одному из вариантов реализации не блокирующее домен α1α2 антитело связывает эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из Q48 и W49 полипептида MICA, соответствующего последовательности SEQ ID NO: 1, и/или 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из Е51, D52, V53 и L54 полипептида MICA, соответствующего последовательности SEQ ID NO: 1 (например, антитело 6Е4).

Согласно другому варианту реализации настоящее изобретение является результатом, в том числе, обнаружения антител, связывающих α3-домен MICA, отличающихся тем, что указанные антитела не подавляют взаимодействие MICA с NKG2D (например, при условии, что каждый из MICA и NKG2D экспрессируется на поверхности клеток). Необязательно указанные антитела по существу не блокируют выделение MICA из опухолевых клеток. Необязательно такое антитело может, как вариант, быть охарактеризовано как не конкурирующее с hNKG2D за связывание с MICA.

Согласно одному из вариантов реализации не блокирующее α3 домен антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из S224, Н225 и D226, один, два или три остатка, выбранных из группы, состоящей из Т227, Q228 и Q229, и/или один или два остатка, выбранных из группы, состоящей из W230 и D232 (например, антитела 16А8).

Согласно другому варианту реализации настоящее изобретение является результатом обнаружения антител, связывающих α1- и/или α2-домен MICA и подавляющих взаимодействие MICA с NKG2D (например, при условии, что каждый из MICA и NKG2D экспрессируется на поверхности клеток). Такое антитело может, как вариант, быть охарактеризовано как конкурирующее с hNKG2D за связывание с MICA. Указанные антитела необязательно подавляют индуцированное sMICA понижающее модулирование экспрессирования NKG2D на поверхности иммунной эффекторной клетки, по существу не блокируя выделение MICA из опухолевых клеток.

Согласно одному из вариантов реализации блокирующее домен α1α2 антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из Е100, D101 и N102, один, два или три остатка, выбранных из группы, состоящей из S103, Т104 и R105, один или два остатка, выбранных из группы, состоящей из N121 и Е123, и/или один или два остатка, выбранных из группы, состоящей из Т124 и Е126 (например, антитела 19Е9, 18Е8 и 10F3).

Согласно одному из вариантов реализации блокирующее α1α2 антитело связывает эпитоп, содержащий 1, 2 или 3 остатка, выбранных из группы, состоящей из N56, K57 и Т58 полипептида MICA, соответствующего последовательности SEQ ID NO: 1, и/или один или два остатка, выбранных из группы, состоящей из R61 и R64 полипептида MICA, соответствующего последовательности SEQ ID NO: 1 (например, антитело 9С10 и 12А10).

Согласно другому варианту реализации настоящее изобретение является результатом, в том числе, обнаружения антител, связывающих α3 домен MICA, отличающихся тем, что указанные антитела подавляют взаимодействие MICA с NKG2D (например, при условии, что каждый из MICA и NKG2D экспрессируются на поверхности клеток). Необязательно указанные антитела по существу не блокируют выделение MICA из опухолевых клеток. Необязательно такое антитело может, как вариант, быть охарактеризовано как конкурирующее с hNKG2D за связывание с MICA. Указанные антитела необязательно подавляют индуцированное sMICA понижающее модулирование экспрессирования NKG2D на поверхности иммунной эффекторной клетки. Указанные антитела могут по существу блокировать выделение MICA из опухолевых клеток или как вариант, могут по существу не блокировать выделение MICA из опухолевых клеток.

Согласно одному из вариантов реализации блокирующее α3-домен антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из Т227, Q228 и Q229 (антитело 14 В4).

Без связи с конкретной теорией считается, что, несмотря на представленные в научной литературе данные, предполагающие наличие причинной связи между MICA (например, sMICA или мембраносвязанным MICA) и понижающей регуляцией NKG2D и нарушениями в эффекторных клетках, сам по себе MICA в условиях опухоли не всегда вызывает существенное нарушения в эффекторных клетках. В частности, в то время как sMICA может понижающе регулировать NKG2D, концентрации sMICA in vivo во многих случаях могут быть слишком низкими для того, чтобы они сами по себе могли существенно подавлять NKG2D (см. пример 9). Кроме того, в условиях опухоли (например, развившееся заболевание или заболевание на поздней стадии) пациент, как правило, находится в состоянии иммуносупрессии за счет ряда других компонентов помимо MICA (например, ТРФ-бета), обладающие потенциальной способностью, помимо других эффектов, понижающе модулировать NKG2D. В связи с этим агенты, блокирующие или не блокирующие взаимодействие NKG2D-MICA и не подавляющие выделение MICA, эффективны при лечении раковых заболеваний, при условии, что они способны индуцировать КЗЦ и/или АЗКЦ. Антитела, не блокирующие взаимодействия NKG2D-MICA, обладают преимуществом, поскольку MICA-экспрессирующие опухолевые клетки потенциально могут оставаться распознаваемыми для NKG2D на имеющихся иммунокомпетентных эффекторных клетках (например, при восстановлении иммунокомпетентности у пациента во время или после лечения, при продолжительном лечении, при повторных назначениях или при введении высоких доз). Антитела, блокирующие взаимодействие NKG2D-MICA, обладают преимуществом, заключающимся в том, что такие антитела могут предотвращать MICA-индуцированную понижающую регуляцию NKG2D (см. пример 9). Такие блокирующие антитела могут, в частности, подходить для лечения пациентов с высокими уровнями растворимого MICA, например, в кровотоке.

Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение, предпочтительно антитело, которое специфически связывается с полипептидом MICA (антитело против MICA), при этом не уменьшая на детектируемую величину связывание MICA и NKG2D (например, взаимодействие поверхностного MICA на опухолевых клетках с поверхностным NKG2D на эффекторных клетках), например, по существу не блокируя взаимодействие MICA и NKG2D. Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение (например, связывающий MICA полипептид), которое связывается с полипептидом MICA, по существу не блокируя выделение MICA из опухолевых клеток. Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение, которое связывается с полипептидом MICA, по существу не блокируя взаимодействие MICA с NKG2D и по существу не блокируя выделение MICA из опухолевых клеток.

Согласно другому варианту реализации в настоящем изобретении предложены антитела, связывающие MICA человека (в частности, в доменах α1 и/или α2), распознающее основные аллели MICA: MICA*001, MICA*004, MICA*008 и необязательно также MICA*007 и/или MICA*019. Согласно одному из вариантов реализации указанные антитела необязательно также распознают MICA не являющихся человеком приматов (например, яванского макака). Согласно одному из вариантов реализации указанные антитела необязательно также распознают полипептид MICB, содержащий последовательность аминокислот SEQ ID NO 6. Согласно другому варианту реализации указанные антитела так же, как вариант, не распознают MICB. Как вариант, указанные антитела по существу не блокируют выделение MICA из опухолевых клеток. Как вариант, указанные антитела по существу не блокируют взаимодействие MICA с NKG2D.

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с гликозилированным полипептидом MICA, экспрессируемым опухолевой клеткой человека.

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, экспрессируемым клеткой не являющегося человеком примата.

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA (антитело против MICA), отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO 2 (MICA*004) и/или полипептид, соответствующий последовательности SEQ ID NO 4 (MICA*008). Согласно одному из вариантов реализации указанное антитело также связывает полипептид, соответствующий последовательности SEQ ID NO 1 (MICA*001). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO 5 (MICA*019). Согласно одному из вариантов реализации указанное антитело также связывает полипептид, соответствующий последовательности SEQ ID NO 3 (MICA*007). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO 2 (MICA* 004), полипептид, соответствующий последовательности SEQ ID NO 4 (MICA*008) и полипептид, соответствующий последовательности SEQ ID NO 5 (MICA*019). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO 1 (MICA*001), полипептид, соответствующий последовательности SEQ ID NO 2 (MICA*004), полипептид, соответствующий последовательности SEQ ID NO 4(MICA*008), и полипептид, соответствующий последовательности SEQ ID NO 5 (MICA*019), необязательно также отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO 3 (MICA*007). За счет связывания с аллелями MICA*001, *004 и *008, (и предпочтительно также *007 и *019) в обеих группах аллелей MICA, Группе 1 и Группе 2, лечение таким анти-MICA агентом согласно настоящему изобретению подходит фактически для всей человеческой популяции. Согласно любому варианту реализации полипептид, соответствующий последовательностям SEQ ID NO 1-5, может содержать О-гликан (N-ацетиллактозамин, соединенный с серином или треонином). Согласно любому варианту реализации полипептид, соответствующий последовательностям SEQ ID NO 1-5, может содержать О-гликан кора 2 (О-гликан, содержащий N-ацетилглюкозаминовую цепь, соединенную с N-ацетилгалактозамином) и/или N-связанный гликан. Согласно одному из вариантов реализации указанное антитело связывается с полипептидом MICA, по существу не блокируя взаимодействие MICA с NKG2D и/или по существу не блокируя выделение MICA из опухолевых клеток. Согласно одному из вариантов реализации указанное антитело связывает домен α1 и/или α2 MICA. Согласно одному из вариантов реализации указанное антитело связывает α3-домен MICA.

Предпочтительно, указанное соединение представляет собой антитело, необязательно тетрамерное антитело, содержащее две тяжелые цепи Ig и две легкие цепи Ig. Предпочтительно, указанное антитело обладает сродством к связыванию (KD), необязательно бивалентным сродством к связыванию, полипептида MICA человека, составляющим менее чем 10-9 М, предпочтительно менее чем 10-10 М или предпочтительно менее чем 10-11. Предпочтительно, указанное антитело представляет собой истощающее антитело, необязательно отличающееся тем, что указанное антитело индуцирует АЗКЦ и/или КЗЦ в отношении экспрессирующей MICA опухолевой клетки.

Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, опосредующее элиминацию MICA-экспрессирующих опухолевых клеток НК-клеткой или Т-клеткой (например, in vivo или in vitro) по существу без подавления NKG2D-опосредованной цитотоксичности экспрессирующей hNKG2D НК- или Т-клетки.

Согласно конкретному варианту реализации антитело согласно настоящему изобретению не конкурирует с hNKG2D за связывание с MICA.

Согласно конкретному варианту реализации при связывании антитела согласно настоящему изобретению с MICA на MICA-экспрессирующей клетке в указанной MICA-экспрессирующей клетке по существу не снижается количество поверхностного hNKG2D за счет, например, стимуляции понижающего регулирования и/или интернализации hNKG2D, указанное антитело обладает высоким сродством и малой скоростью диссоциации, вступает в перекрестную реакцию с MICA яванского макака и/или макака-резуса, и принадлежит к истощающему изотипу, такому как, например, IgG1 человека.

Согласно одному аспекту в настоящем изобретении предложено антитело, которое специфически связывает MICA, отличающееся тем, что указанное антитело обладает одной или несколькими (включая любую их комбинацию, или все) из следующих характеристик:

(a) Kd связывания полипептида MICA составляет менее чем 10-8 М, предпочтительно менее чем 10-9 М, или предпочтительно менее чем 10-10 М;

(b) связывается по меньшей мере с одним остатком в сегменте, соответствующем остаткам домена, выбранным из группы, состоящей из 1-88, 89-181 и 182-274 полипептида MICA, соответствующего последовательности SEQ ID NO: 1, и/или связывается с эпитопом (один или более аминокислотных остатков на MICA) согласно описанию в настоящем документе;

(c) связывается с двумя, тремя, четырьмя или пятью полипептидами из MICA*001, *004, *007, *008, и *019, содержащими последовательность, соответствующую SEQ ID NO: 1-5, соответственно;

(d) по существу не блокирует выделение MICA из опухолевых клеток;

(e) по существу не блокирует взаимодействие MICA с NKG2D (например, взаимодействие поверхностного MICA на опухолевых клетках с поверхностным NKG2D на эффекторных клетках);

(f) не вызывает существенного уменьшения лизиса MICA-экспрессирующих клеток эффекторными клетками (например, NKG2D+CD16- НК-клетками);

(g) индуцирует комплемент-зависимую цитотоксичность (КЗЦ) и/или антитело зависимую клеточную цитотоксичность (АЗКЦ) в отношении клетки, которая экспрессирует MICA на поверхности; и

(h) конкурирует за связывание полипептида MICA с антителом 6Е4, 20С6, 16А8, 15F9 и 10А7.

Согласно любому из представленных в настоящем документе вариантов реализации антитело согласно настоящему изобретению может характеризоваться любым одним или несколькими признаками из приведенных выше в пп.(а)-(h).

Согласно одному из вариантов реализации предложен способ тестирования антитела против MICA, при этом указанный способ включает: (i) оценку того, блокирует ли указанное антитело выделение MICA из MICA-экспрессирующих клеток и/или (ii) оценку того, блокирует ли указанное антитело взаимодействие MICA с NKG2D. Этап (i) может необязательно включать приведение антитела, связывающего полипептид MICA, в контакт с клеткой, экспрессирующей полипептид MICA. Этап (ii) может необязательно включать приведение антитела, связывающего полипептид MICA, в контакт с полипептидом MICA (например, выделенным полипептидом или полипептидом, экспрессируемым на поверхности клетки), в присутствии полипептида NKG2D (например, выделенного полипептида или полипептида, экспрессируемого на поверхности клетки).

Согласно другому варианту реализации предложен способ получения антитела, связывающего полипептид MICA у субъекта-млекопитающего, необязательно для лечения ракового заболевания, при этом указанный способ включает следующие этапы: а) получение совокупности антител, необязательно иммунизация не являющегося человеком млекопитающего иммуногеном, содержащим полипептид MICA; и b) осуществление отбора антитела из указанной совокупности, причем этот этап включает:

(i) проверка того, связывается ли антитело с полипептидом MICA человека, необязательно одним, двумя, тремя, четырьмя или всеми полипептидами из соответствующих последовательностям SEQ ID NO 1-5, и отбор антитела в том случае, если оно связывается с полипептидом(ами) MICA человека; и/или

(ii) проверка того, блокирует ли антитело выделение MICA из MICA-экспрессирующих клеток, и отбор антитела в том случае, если оно не блокирует выделение; и/или

(iii) проверка того, блокирует ли антитело взаимодействие MICA (например, поверхностного MICA) с NKG2D, предпочтительно отличающееся тем, что указанное антитело вызывает существенное снижение лизиса MICA-экспрессирующих клеток эффекторными клетками (например, NKG2D+CD16- НК-клетками, и отбор антитела в том случае, если оно не блокирует взаимодействие MICA (например, поверхностного MICA) с NKG2D, предпочтительно отличающееся тем, что указанное антитело не вызывает существенного снижения лизиса MICA-экспрессирующих клеток.

Согласно одному аспекту настоящее изобретение является результатом, в том числе, открытия блокирующих антител против MICA, обладающих высоким сродством ко всем основным аллелям MICA человека, принадлежащим к двум главным группам аллелей MICA (а также к MICA и MICB не являющихся человеком приматов). Согласно одному из вариантов реализации группы MICA характеризуются присутствием остатка метионина (М) или валина (V) в положении 129 полипептида MICA, при этом М ассоциирован с формой MICA, сильно связывающей NKG2D, а V ассоциирован с более слабым связыванием NKG2D. Согласно одному из вариантов реализации в настоящем изобретении предложены блокирующие антитела, которые перекрестно реагируют с аллелем MICA, содержащим метионин в положении 129, и аллелем MICA, содержащим валин в положении 129. Согласно одному аспекту в настоящем изобретении предложено моноклональное антитело, которое специфически связывается с полипептидом MICA человека, содержащим метионин в положении 129, и полипептидом MICA человека, содержащим валин в положении 129, отличающееся тем, что указанное антитело подавляет опосредованную MICA активность hNKG2D. Согласно одному варианту реализации указанное антитело также связывается с полипептидом MICB, содержащим валин в положении 152 (например, полипептидом MICB, соответствующим последовательности SEQ ID NO: 1). Предпочтительно, указанное антитело подавляет опосредованную MICB активность hNKG2D. Полипептиды MICB, содержащие валин в положении 152, как сообщалось, демонстрируют сильное связывание с растворимым NKG2D. Антитела, связывающие полипептиды MICB, содержащие валин в положении 152, и полипептиды MICA, содержащие метионин в положении 129, могут быть предпочтительными для индивидуумов с большей чувствительностью или тяжелым заболеванием, вызываемым аллелями, сильно связывающими NKG2D.

Блокирующие антитела против MICA согласно настоящему изобретению также перекрестно реагируют (связывают) один или более широко распространенных аллелей из каждой из двух основных групп MICA, которые, как было определено, представляют главные семейства MICA: аллели группы 1, сильно связывающие NKG2D (в том числе MICA*001, *002, *007, *012, *017 и *018) и группы 2, слабо связывающих NKG2D (MICA*004, *006, *008, *009 и *019). Связываясь с эпитопом, присутствующим на MICA подгруппы *001, *004, *007, *008 и *019, указанные антитела охватывают аллели из обеих групп, присутствующие практически у всех индивидуумов. Аллели MICA группы 1 обычно содержат М в качестве остатка 129, тогда как аллели группы 2 содержат V в качестве остатка 129.

Согласно другому аспекту настоящее изобретение является результатом, в том числе, обнаружения антител против определенных эпитопов MICA (а также MICA и MICB не являющихся человеком приматов), значительно более эффективных для блокады NKG2D, чем какие-либо другие антитела против MICA или против NKG2D, и также более эффективных для блокирования NKG2D-опосредованной цитотоксичности, чем можно было бы ожидать исходя из их способности к связыванию MICA. В частности, ингибирующая способность антител против MICA со значениями сродства в пикомолярном диапазоне была на 4 логарифмированные единицы выше, чем у антител против MICA со сродством (KD), меньшим на 2 логарифмированные единицы.

Блокирующие MICA антитела согласно настоящему изобретению могут характеризоваться способностью предотвращать любую конкуренцию с NKG2D, замещение NKG2D или остаточное связывание NKG2D. Другие высокоаффинные антитела к NKG2D или MICA могут оставлять некоторую возможность замещения соответствующим им лигандом (например, MICA/ULPB/RAET1 или NKG2D, соответственно). Также, как видно из кристаллических структур взаимодействия NKG2D-MICA, NKG2D функционирует в виде гомодимера, и в его состав входят две симметричные поверхности (по одной на каждой цепи NKG2D), которые взаимодействуют с верхней частью платформенного домена MICA αlα2. Обе указанные цепи NKG2D участвуют во взаимодействии путем связывания с отчетливо различающимися поверхностями асимметричного платформенного домена MICA (см., например, Li et al. (2001) Nature Immunol. 2(5):443-450). Антитела согласно настоящему изобретению могут, соответственно, необязательно блокировать взаимодействие MICA-NKG2D полностью, например, блокируя (например, взаимодействуя, конкурируя) связывание обоих мономеров NKG2D в гомодимере NKG2D с полипептидом MICA. Другие MICA-антитела (или NKG2-антитела) могут блокировать полностью только один из двух участков связывания NKG2D.

Лечение блокирующими антителами против MICA согласно настоящему изобретению, помимо применения для устранения MICA-экспрессирующих клеток при использовании в качестве истощающего антитела (например, изотип IgG1 или IgG3), обеспечивает способ направленного воздействия на MICA (и MICB) при воспалительных состояниях, которые предположительно запускаются опосредованной MICA и/или В активацией NKG2D, не вызывая нежелательного более обширного подавления иммунной системы за счет уменьшения числа рецепторов NKG2D, доступных для связывания с другими лигандами (например, ULBP) и последующей активации. Возможность получения таких полностью блокирующих антител против MICA также открывает возможности для местной доставки антител против MICA в области воспаления (например, в суставы или другие области воспаления у пациентов с артритом), не вызывающей генерализованного иммуносупрессивного эффекта, обусловленного введением NKG2D-антител.

Согласно одному из вариантов реализации в настоящем изобретении предложены антитела, эффективные in vitro и in vivo для подавления лизиса эффекторными клетками (например, НК-клетками и/или Т-клетками) MICA-экспрессирующих клеток и по существу блокирующие взаимодействие MICA с NKG2D.

Согласно одному из вариантов реализации, в частности, при применении для лечения воспалительных или аутоиммунных расстройств, антитело согласно настоящему изобретению представляет собой неистощающее антитело, по существу снижающее или подавляющее активацию NKG2D, сигнализацию NKG2D, активацию NKG2D-экспрессирующих НК-клеток или Т-клеток, или лизис MICA-экспрессирующих клеток эффекторными клетками (например, NKG2D+CD16- НК-клетками).

Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение, предпочтительно антитело, которое специфически связывается с полипептидом MICA (антитело против MICA) и уменьшает (например, по существу элиминирует) связывание между MICA и hNKG2D (например, взаимодействие поверхностного MICA на клетках с поверхностным NKG2D на эффекторных клетках).

Согласно одному из вариантов реализации антитело против MICA или связывание соединение также специфически связывается с полипептидом MICB и снижает (например, по существу элиминирует) связывание между MICB и hNKG2D.

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, конкурирующее с hNKG2D за связывание с MICA (и необязательно MICB) и предотвращающее связывание hNKG2D с MICA (и необязательно MICB).

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое подавляет или блокирует взаимодействие полипептида MICA (и необязательно MICB) с обеими цепями hNKG2D гомодимера hNKG2D. Указанное антитело необязательно блокирует взаимодействие обоих доменов, домена α1 полипептида MICA (и необязательно полипептида MICB) и домена α1 полипептида MICA (и необязательно полипептида MICB) с гомодимером hNKG2D (например, указанное антитело подавляет взаимодействие доменов платформы α1α2 MICA с обеими hNKG2D-цепями гомодимера hNKG2D).

Согласно одному из вариантов реализации антитело согласно настоящему изобретению по существу не связывается с полипептидом HCMV, UL18, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5 или ULBP6 (см. Champsaur et al. (2010) Immunol. Rev. 235: 267-285).

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с общей детерминантой на полипептиде MICA человека (например, встречающегося в природе аллеля MICA), содержащем метионин в положении 129, и полипептиде MICA человека (например, встречающегося в природе аллеля MICA), содержащем валин в положении 129, необязательно также специфически связывается с общей детерминантой на полипептиде MICB человека (например, встречающегося в природе аллеля MICB) содержащем валин в положении 152 отличающееся тем, что указанное антитело снижает (например, по существу элиминирует) связывание между MICA и NKG2D (и необязательно между MICB и NKG2D).

Согласно дополнительному варианту реализации настоящее изобретение является результатом, в том числе, обнаружения антител, связывающих MICA человека, предпочтительно в платформенном домене α1α2 (т.е. домене α1 и/или α2), и распознающих основные аллели MICA: MICA*001, MICA*004, MICA*008 и необязательно также MICA*007 и/или MICA*019, и необязательно также распознающих MICA не являющихся человеком приматов (например, яванского макака), и необязательно также распознающих MICB. Согласно одному из вариантов реализации указанные антитела также распознают полипептид MICB, содержащий последовательность аминокислот SEQ ID NO: 6. Необязательно указанные антитела также по существу не подавляют выделение MICA из опухолевых клеток.

Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA (антитело против MICA), отличающееся тем, что указанное антитело снижает (например, по существу элиминирует) связывание между MICA и NKG2D и отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO: 2 (MICA*004) и/или полипептид, соответствующий последовательности SEQ ID NO: 4 (MICA*008). Согласно одному из вариантов реализации указанное антитело также связывает полипептид, соответствующий последовательности SEQ ID NO: 1 (MICA*001). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO: 5 (MICA*019). Согласно одному из вариантов реализации указанное антитело также связывает полипептид, соответствующий последовательности SEQ ID NO: 3 (MICA*007). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO: 2 (MICA*004), полипептид, соответствующий последовательности SEQ ID NO: 4 (MICA*008) и полипептид, соответствующий последовательности SEQ ID NO: 5 (MICA*019). Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, которое специфически связывается с полипептидом MICA, отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO: 1 (MICA* 001), полипептид, соответствующий последовательности SEQ ID NO: 2 (MICA*004), полипептид, соответствующий последовательности SEQ ID NO: 4(MICA*008), и полипептид, соответствующий последовательности SEQ ID NO: 5 (MICA*019), необязательно также отличающееся тем, что указанное антитело связывает полипептид, соответствующий последовательности SEQ ID NO: 3 (MICA*007). За счет связывания с аллелями MICA*001, *004 и *008, (и предпочтительно также *007 и *019) в обеих группах 1 и 2 аллелей MICA лечение таким анти-MICA агентом согласно настоящему изобретению подходит практически для всей популяции человека. Согласно одному из вариантов реализации указанное антитело связывает домены MICA α1 и/или α2.

Указанное соединение предпочтительно представляет собой антитело, необязательно тетрамерное антитело, содержащее две тяжелые цепи Ig и две легкие цепи Ig.

Указанное антитело предпочтительно обладает сродством к связыванию (KD), при этом сродство к связыванию необязательно является моновалентным или бивалентным, в отношении полипептида человека MICA и/или MICB (например, любого одного или нескольких, либо всех упоминаемых здесь аллелей MICA и/или MICB) составляет менее чем 10-9 М, предпочтительно менее чем 10-10 М, предпочтительно менее чем 10-11 М, предпочтительно менее чем 10-12 М, или предпочтительно менее чем 10-13 М. Указанное антитело предпочтительно представляет собой тетрамерное антитело, содержащее две тяжелые цепи Ig и две легкие цепи Ig, и KD бивалентна. Необязательно, ЕС50 указанного антитела в отношении связывания с клетками, модифицированными для экспрессии конкретного полипептида MICA и/или MICB, например, любого одного, нескольких или всех аллелей MICA и/или MICB, упоминаемых в настоящей документе, составляет не более чем 10, 5, или 1 мкг/мл. Примерами подходящих клеток являются клетки C1R-MICA.

Согласно одному из вариантов реализации, в частности, когда антитело предназначено для применения при лечении или предотвращении воспалительного или аутоиммунного заболевания, указанное соединение представляет собой неистощающее антитело (антитело, не устраняющее клетки, с которым оно связывается). Указанное антитело предпочтительно представляет собой гибридное, гуманизированное или человеческое антитело. Указанное антитело предпочтительно не содержит константную область, с которой может быть связываться рецептор Fcγ3A (CD 16), например, антитело подтипа IgG4 человека или фрагмент антитела, в котором отсутствует Fc-домен. Указанное антитело предпочтительно содержит константную область тяжелой цепи изотипа IgG4 человека.

Согласно одному из вариантов реализации указанное антитело специфически связывается с полипептидом MICA, экспрессируемым клеткой не являющегося человеком примата. Согласно конкретному варианту реализации антитело согласно настоящему изобретению обладает высоким сродством к связыванию и малой скоростью диссоциации с MICA человека, и вступает в перекрестную реакцию с MICA яванского макака (Масаса fascicularis) и/или макака-резуса (Масаса mulatta).

Согласно одному аспекту в настоящем изобретении предложено антитело, которое специфически связывает MICA, отличающееся тем, что указанное антитело обладает одним или несколькими (включая любую их комбинацию, или все перечисленные) из следующих качеств:

(a) Kd для связывания полипептида MICA составляет менее чем 10-9 М, предпочтительно менее чем 10-10 М, предпочтительно менее чем 10-11 М, предпочтительно менее чем 10-12 М или предпочтительно менее чем 10-13 М, при этом указанное антитело предпочтительно обладает сродством, характеризующимся указанной KD, к каждому из аллелей полипептида MICA: MICA*001, *004, и *008, и необязательно также *007 и/или *019;

(b) связывается по меньшей мере с одним остатком в сегменте, соответствующем остаткам домена, выбранным из группы, состоящей из остатков 1-88 или 89-181 полипептида MICA, соответствующего последовательности SEQ ID NO: 1, и/или связывается с эпитопом (остатки на MICA) согласно описанию в настоящем документе;

(c) связывается с полипептидом MICA человека (например, встречающимся в природе аллелем MICA), содержащим метионин в положении 129, и полипептидом MICA человека (например, встречающимся в природе аллелем MICA), содержащие валин в положении 129, при этом указанное антитело уменьшает (например, по существу элиминирует) связывание между MICA и NKG2D; и/или связывается с полипептидом MICB человека (например, встречающимся в природе аллелем MICA), содержащим валин в положении 152;

(d) связывается с двумя, тремя, четырьмя или пятью из полипептидов MICA*001, *004, *007, *008, и *019, содержащими, соответственно, последовательность, соответствующую последовательностям SEQ ID NO: 1-5;

(e) по существу не блокирует выделение MICA из опухолевых клеток;

(f) подавляют и/или по существу блокируют взаимодействие MICA с NKG2D (например, взаимодействие поверхностного MICA на опухолевых клетках с поверхностным NKG2D на эффекторных клетках), необязательно отличающееся тем, что указанные антитела блокируют взаимодействие MICA с обеими цепями NKG2D в составе гомодимера NKG2D.

(g) способны уменьшать или подавлять опосредованную MICA активацию NKG2D, NKG2D-сигнализацию, активацию NKG2D-экспрессирующих НК- или Т-клеток или лизис MICA-экспрессирующих клеток эффекторными клетками (например, NKG2D+CD 16- НК-клетками);

(h) индуцирует или по существу не индуцирует (например, в зависимости от того, обнаруживается ли указанное моноклональное антитело CD16, в зависимости от природы Fc-области антитела) комплементзависимую цитотоксичность (КЗЦ) и/или антителозависимую клеточную цитотоксичность (АЗКЦ) в отношении клетки, которая экспрессирует MICA на поверхности;

(i) способны уменьшать или подавлять опосредованное sMICA понижающее модулирование экспрессирования NKG2D на поверхности NKG2D-экспрессирующих клеток (например, Т-клеток или НК-клеток);

и

(j) конкурирует за связывание полипептида MICA с антителом 9С10, 19Е9, 12А10, 18Е8 или 10F3.

Согласно любому из представленных в настоящем документе вариантов реализации антитело согласно настоящему изобретению может характеризоваться любым одним или несколькими признаками из приведенных выше в пп. (а)-(j).

Согласно одному из вариантов реализации предложен способ тестирования антитела против MICA, при этом указанный способ включает: (i) оценку того, связывает ли указанное антитело с высоким сродством как полипептид MICA, содержащий метионин в качестве остатка 129, так и полипептид MICA, содержащий валин в качестве остатка 129 (и необязательно также полипептид MICB, содержащий метионин в качестве остатка 152), и (ii) оценку того, блокирует ли указанное антитело взаимодействие MICA (и необязательно MICB) с NKG2D. Согласно одному из вариантов реализации предложен способ тестирования антитела против MICA, при этом указанный способ включает: (i) оценку того, связывает ли указанное антитело с высоким сродством два, три, четыре или пять полипептидов из MICA*001, *004, *007, *008, и *019, содержащих, соответственно, последовательность, соответствующую последовательностям SEQ ID NO: 1-5 и (ii) оценку того, блокирует ли указанное антитело взаимодействие MICA с NKG2D. Этап (i) может необязательно включать приведение антитела, связывающего полипептид MICA, в контакт с клеткой, экспрессирующей полипептид MICA. Этап (ii) может необязательно включать приведение антитела, связывающее полипептид MICA, в контакт с полипептидом MICA (например, выделенным полипептидом или полипептидом, экспрессируемым на поверхности клетки), в присутствии полипептида NKG2D (например, выделенного полипептида или полипептида, экспрессируемого на поверхности клетки). Антитело, связывающее указанные полипептиды MICA на этапе (i) и блокирующее взаимодействие MICA с NKG2D на этапе (ii) могут быть идентифицировано и/или отобрано как кандидатное лекарственное средство для лечения воспалительного или аутоиммунного расстройства.

Согласно другому варианту реализации предложен способ получения антитела, связывающего полипептид MICA у субъекта-млекопитающего, необязательно для лечения ракового заболевания, при этом указанный способ включает следующие этапы: а) получение совокупности антител, необязательно иммунизация не являющегося человеком млекопитающего иммуногеном, содержащим полипептид MICA, или получение библиотеки антител с применением фагового дисплея; и b) осуществление отбора антитела из указанной совокупности, причем указанный этап включает:

(i) проверку того, связывает ли указанное антитело с высоким сродством полипептид MICA человека, необязательно один, два, три или все аллели из MICA* 001, *004, *007, *008, и *019, например, полипептиды, содержащие последовательности SEQ ID NO: 1-5, соответственно, и отбор антитела при условии, что оно связывает с высоким сродством указанный полипептид MICA; и/или

(ii) проверку того, блокирует ли указанное антитело взаимодействие MICA (например, поверхностного MICA, любого одного, двух, трех или всех аллелей из MICA*001, *004, *007, *008, и *019) с hNKG2D и/или снижает или подавляет ли указанное антитело активацию NKG2D, NKG2D-сигнализацию, активацию NKG2D-экспрессирующих НК- или Т-клеток или лизис MICA-экспрессирующих клеток эффекторными клетками (например, NKG2D+ Т-клетками, NKG2D+CD16+ НК-клетками, NKG2D+CD16 - НК-клетками), и отбор антитела при условии, что оно блокирует взаимодействие MICA с hNKG2D; и/или.

(iii) проверку того, уменьшает или подавляет ли антитело понижающее модулирование NKG2D (уменьшение экспрессирования на клеточной поверхности) в NKG2D-экспрессирующей клетке при приведении указанной NKG2D-экспрессирующей клетки в контакт с растворимым полипептидом MICA в присутствии указанного антитела, и отбор антитела при условии, что указанное антитело снижает или подавляет понижающее модулирование NKG2D.

Указанный способ может необязательно включать этап отбора (iv), включающий проверку того, блокирует ли антитело выделение MICA из MICA-экспрессирующих клеток, и отбор антитела в том случае, если оно не блокирует выделение.

Согласно одному из вариантов реализации антитело согласно настоящему изобретению связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6, 7 или более остатков полипептида MICA человека, выбранных из группы, состоящей из R6, N8, Q48, W49, Е51, D52, V53, L54, N56, K57, Т58, R61, R64, K81, D82, Q83, K84, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Н109, Ylll, D113, Е115, L116, N121, Е123, Т124, Е126, Q131, S132, S133, R134, Q136, Т137, М140, N141, R143, N144, L178, R179, R180, S224, Н225, D226, Т227, Q228, Q229, W230 и D232 (в отношении MICA, соответствующего любой из последовательностей SEQ ID NO 1-5).

Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение, предпочтительно антитело против MICA, которое связывается по меньшей мере частично, или, как вариант, полностью, внутри домена α1 и/или α2 полипептидов MICA. Домены α1 и α2 расположены в области аминокислотных остатков 1-88 (необязательно 1-85) и 89-181 (необязательно 86-181), соответственно, полипептида MICA, соответствующего последовательности SEQ ID NO 1. Согласно любому из представленных в настоящем документе вариантов реализации указанное антитело необязательно связывается с аминокислотным остатком в составе домена α1 полипептида MICA (аминокислотные остатки 1-88 (необязательно 1-85) последовательности SEQ ID NO 1). Согласно любому из представленных в настоящем документе вариантов реализации указанное антитело необязательно связывается с аминокислотным остатком в составе домена α2 полипептида MICA (аминокислотные остатки 89-181 (необязательно 86-181) последовательности SEQ ID NO 1). Согласно любому из представленных в настоящем документе вариантов реализации указанное антитело необязательно связывается с аминокислотными остатками в составе доменов α1 и α2 полипептида MICA.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из Q48 и W49, и/или 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из Е51, D52, V53 и L54 (антитело 6Е4).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2 или 3 остатка, выбранных из группы, состоящей из N56, K57 и Т58, и/или один или два остатка, выбранных из группы, состоящей из R61 и R64 (антитело 9С10 и 12А10).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из K81 и D82, один или два остатка, выбранных из группы, состоящей из Q83 и K84, один, два или три остатка, выбранных из группы, состоящей из Н109, Y111 и L116, необязательно остаток D113, один, два или три остатка, выбранных из группы, состоящей из S133, R134 и Т137, и/или 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из М140, N141, R143 и N144 (антитело 20С6).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из К81 и D82, один или два остатка, выбранных из группы, состоящей из Q83 и К84, один, два или три остатка, выбранных из группы, состоящей из HI09, Y111 и L116, необязательно остаток D113, один, два или три остатка, выбранных из группы, состоящей из Q131, S132 и Q136, и/или 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из M140, N141, R143 и N144 (антитело 10А7).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из Е100, D101 и N102, один, два или три остатка, выбранных из группы, состоящей из S103, Т104 и R105, один или два остатка, выбранных из группы, состоящей из N121 и Е123, и/или один или два остатка, выбранных из группы, состоящей из Т124 и Е126 (антитело 19Е9 и 18Е8).

Согласно одному из вариантов реализации указанные антитела связывают эпитоп, содержащий один или два остатка, выбранных из группы, состоящей из R6 и N8, один или два остатка, выбранных из группы, состоящей из Е97 и Н99, один, два или три остатка, выбранных из группы, состоящей из Е100, D101 и N102, один, два или три остатка, выбранных из группы, состоящей из S103, Т104 и R105, необязательно остаток Е115, и/или один, два или три остатка, выбранных из группы, состоящей из L178, R179 и R180 (антитело 15F9).

Согласно одному из вариантов реализации в настоящем изобретении предложено связывающее MICA соединение, предпочтительно антитело против MICA, связывающееся по меньшей мере частично внутри α3 домена полипептидов MICA. Домен α3 расположен в области аминокислотных остатков 182-274, соответственно, полипептида MICA, соответствующего последовательности SEQ ID NO 1. Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из Т227, Q228 и Q229 (антитело 14В4 и 16А8). Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий один, два или три остатка, выбранных из группы, состоящей из S224, Н225 и D226, один, два или три остатка, выбранных из группы, состоящей из Т227, Q228 и Q229, и/или один или два остатка, выбранных из группы, состоящей из W230 и D232 (антитело 16А8).

Связывание указанного антитела с полипептидом MICA, содержащим модификации любых из перечисленных выше остатков в составе домена(ов) α1 и/или α2, необязательно по существу уменьшено по сравнению со связыванием с полипептидом MICA дикого типа, соответствующим последовательности SEQ ID NO: 1.

Настоящим изобретением предусмотрено, что применение антител против MICA может подходить для лечения раковых заболеваний, воспалительных и аутоиммунных расстройств, например, у субъектов-люд ей.

Согласно одному аспекту антитело, которое не подавляет взаимодействие NKG2D и MICA, или антитело, которое подавляет взаимодействие NKG2D и MICA, является истощающим антителом. Такие антитела подходят, в частности, для лечения раковых заболеваний, но могут также применяться при воспалительных и аутоиммунных расстройствах. Могут применяться антитела, спаренные или не спаренные с токсическим или другим агентом в зависимости от требуемого эффекта или предполагаемого применения указанных антител. Согласно одному из вариантов реализации указанное антитело против MICA представляет собой ««свободное» антитело» и не спарено с токсичным агентом; указанное «свободное» антитело необязательно содержит Fc-область, модифицированную для усиления связывания с Fcγ-рецептором, например, CD16. Согласно одному из вариантов реализации «свободное» или спаренное антитело содержит тяжелую цепь, содержащую Fc-область человека (например, IgG1), связывающую Fcγ-рецепторы (например, CD 16). Необязательно такое антитело индуцирует комплемент-зависимую цитотоксичность (КЗЦ) и/или антителозависимую клеточную цитотоксичность (АЗКЦ) в отношении клетки, которая экспрессирует MICA на поверхности.

Согласно любому варианту реализации указанное антитело (например, IgG1, фрагмент антитела и т.д.) необязательно также содержит токсичный агент (например, химиотерапевтический агент), токсичный для клетки.

Согласно одному аспекту антитело, которое подавляет MICA-индуцированную активность NKG2D в эффекторной клетке, является не-истощающим антителом (антителом, которое не истощает клетки, с которым связывается). Согласно одному аспекту указанное антитело представляет собой гибридное антитело, гуманизированное антитело или антитело человека. Согласно одному аспекту указанное антитело не содержит константную область, которую может связывать Fcγ3А-рецептор (CD16), например, антитело подтипа IgG4 человека или фрагмент антитела, в котором отсутствует Fc-домен. Согласно одному из вариантов реализации указанное антитело содержит тяжелую цепь IgG4, содержащую модификацию остатка 228: серин→пролин в соответствии с EU-индексом. Указанное антитело предпочтительно содержит константную область тяжелой цепи изотипа IgG4 человека. Такие антитела подходят, в частности, для лечения воспаления и аутоиммунных расстройств.

В настоящем изобретении также предложены антитела, фрагменты и производные антител, специфически связывающих MICA человека. В настоящем изобретении предложены композиции с такими антителами, а также их применение в любых соответствующих настоящему изобретению способах лечения, предотвращения и диагностики раковых заболеваний, воспалительных расстройств и аутоиммунных расстройств.

Согласно одному из вариантов реализации указанные антитела обладают сродством к связыванию (KD) полипептида MICA человека (например, одного, двух, трех или всех полипептидов аллелей MICA*001, *004, *007, *008, и *019, соответствующих последовательностям SEQ ID NO 1-5, предпочтительно каждого из MICA*001, *004 и *008), составляющим менее чем 10-8М, предпочтительно менее чем 10-9М, или предпочтительно менее чем 10-10М.

Согласно одному аспекту любого из вариантов реализации настоящего изобретения антитело могут содержать тяжелую и/или легкую цепь, содержащую одну, две или три области CDR соответствующей тяжелой и/или легкой цепи антитела, выбранного из группы, состоящей из антител 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 и 14В4.

Согласно одному аспекту любого из вариантов реализации настоящего изобретения антитело конкурирует за связывание полипептида MICA с любым одним или любой комбинацией моноклональных антител 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 и 14В4. Согласно одному из вариантов реализации антитело согласно настоящему изобретению конкурирует за связывание полипептида MICA с антителом, выбранным из группы, состоящей из:

(a) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 7 и 8 (6Е4), соответственно;

(b) (а) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 20 и 21 (20С6), соответственно;

(c) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 33 и 34 (16А8), соответственно;

(d) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 46 и 47 (19Е9), соответственно;

(e) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 57 и 58 (9С10), соответственно;

(f) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 68 и 69 (12А10), соответственно;

(g) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 79 и 80 (10А7), соответственно;

(h) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 90 и 91 (18Е8), соответственно;

(i) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 101 и 102 (10F3), соответственно;

(j) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 112 и 113 (15F9), соответственно; и

(k) антитела, содержащего область VH и область VL, соответствующие последовательностям SEQ ID NO: 123 и 124 (14В4), соответственно.

Согласно одному из вариантов реализации указанное антитело подходит для человека. Согласно одному варианту реализации указанное антитело является гибридным, например, содержит константную область не от мыши, необязательно от человека. Согласно одному из вариантов реализации указанное антитело является антителом человека или гуманизированным. Согласно одному аспекту любого из вариантов реализации настоящего изобретения изотип указанного антитела представляет собой IgG человека, необязательно IgG1, IgG2, IgG3 или IgG4 человека. Согласно одному варианту реализации указанное антитело содержит Fc домен человека или относится к изотипу, связываемому FcγR (например, FcγRIIIA), например, представляет собой антитело изотипа IgG1 или IgG3.

Согласно одному аспекту любого из вариантов реализации настоящего изобретения антитело представляет собой фрагмент антитела, выбранный из Fab, Fab', Fab'-SH, F(ab')2, Fv, диател, одноцепочечного фрагмента антитела, или мультиспецифического антитела, содержащего несколько разных фрагментов антител. Необязательно антитела согласно настоящему изобретению также представляют собой тетрамерные антитела (две тяжелые и две легкие цепи) и соответственно являются бивалентными (например, антитела IgG).

Согласно определенным вариантам реализации антитела согласно настоящему изобретению также содержат токсичный агент.Согласно одному из вариантов реализации указанные антитела, содержащие токсичный агент, способны непосредственно приводить к гибели клеток, экспрессирующих MICA. Согласно одному из вариантов реализации указанные антитела способны непосредственно индуцировать (например, в отсутствие иммунных эффекторных клеток) гибель по меньшей мере 20%, 30%, 40% или 50%, например, в анализе in vitro, MICA-экспрессирующих клеток.

Согласно одному аспекту в настоящем изобретении предложены способы лечения с применением антител против MICA согласно настоящему изобретению. Указанные антитела могут применяться в качестве профилактического или терапевтического лечения; согласно любому из представленных в настоящем документе вариантов реализации терапевтически эффективное количество указанного антитела может использоваться взаимозаменяемо с профилактически эффективным количеством антитела. Согласно одному аспекту в настоящем изобретении предложен способ лечения пациента с раковым заболеванием, аутоиммунным расстройством или воспалительным расстройством, отличающийся тем, что указанный способ включает введение указанному пациенту фармацевтически эффективного количества антигенсвязывающего соединения согласно настоящему изобретению, которое специфически связывается с полипептидом MICA.

Способы лечения согласно настоящему изобретению и антитело против MICA согласно настоящему изобретению могут применяться для лечения индивидуума в комбинации со вторым терапевтическим агентом, в том числе с противораковым агентом при применении для лечения рака (например, химиотерапевтическими лекарственными средствами, противоопухолевыми вакцинами, антителами, которые связываются с опухолеспецифическими антигенами на опухолевых клетках, антителами, индуцирующими АЗКЦ в отношении опухолевых клеток, антителами, потенцирующими иммунный ответ и т.д.) или агентом, подходящим для лечения аутоиммунитета или воспаления. Согласно одному из вариантов реализации указанный второй терапевтический агент представляет собой агент (например, антитело), которое связывается с активирующим рецептором и активирует его, либо связывается с ингибирующим рецептором на эффекторной клетке (например, НК-клетке, Т-клетке) и блокирует его. Согласно одному из вариантов реализации указанный второй терапевтический агент представляет собой агент (например, химиотерапевтический агент), который повышающе регулирует экспрессирование лиганда NKG2D на опухолевых клетках. Например, могут применяться ингибиторы гистондеацетилазы. Например, вальпроат и гидралазин повышают экспрессию и уменьшают выделение MICA/B. (Chavez-Bianco 2011 Int J Oncol 39(6):1491-1499).

Повышенные уровни sMIC в кровотоке были связаны с неблагоприятным прогнозом и/или экспрессирующими MIC опухолями. Настоящее изобретение также относится к способу выбора субъектов, имеющих раковое заболевание, отвечающее на лечение с применением анти-MICA агента согласно настоящему изобретению (например, антитела, которое связывается с полипептидом MICA), отличающемуся тем, что указанный способ включает определение того, выводится ли полипептид MICA из опухолевых клеток у указанного субъекта (например, с помощью оценки уровней sMIC в кровотоке); выделение полипептида MICA из опухолевых клеток свидетельствует о том, что субъект отвечает на лечение.

Настоящее изобретение также относится к способу выбора субъектов, у которых имеется расстройство (например, раковое заболевание, аутоиммунное расстройство, воспалительное расстройство) отвечающее на лечение с применением анти-MICA агента согласно настоящему изобретению (например, антитела, которое связывается с полипептидом MICA), отличающегося тем, что указанный способ включает определение того, экспрессируют ли клетки (например, опухолевые клетки, провоспалительные клетки и т.д.) указанного субъекта полипептид MICA, при этом экспрессирование полипептида MICA свидетельствует о том, что субъект отвечает на лечение. Согласно одному из вариантов реализации указанный способ включает определение того, экспрессируют ли клетки (например, опухолевые клетки, провоспалительные клетки и т.д.) указанного субъекта полипептид MICA, выбранный из группы, состоящей из последовательностей SEQ ID NO 1-5. Согласно одному из вариантов реализации указанный способ включает определение того, экспрессируют ли клетки указанного субъекта полипептид MICA, выбранный из группы, состоящей из полипептидов MICA*001, *004, *007, *008, и *019, соответственно, содержащий последовательность, соответствующую последовательностям SEQ ID NO: 1-5, при этом экспрессия полипептида MICA свидетельствует о том, что субъект отвечает на лечение. Согласно одному из вариантов реализации этап определения того, экспрессируют ли клетки указанного субъекта полипептид MICA, включает приведение биологического образца, полученного от субъекта (например, путем проведения биопсии и/или получения образца раковых клеток, образцы крови или другой ткани и т.д.) в контакт с антителом против MICA согласно настоящему изобретению (например, антителом, связывающим один, два, три, четыре или все полипептиды из MICA*001, *004, *007, *008, и *019). Согласно одному из вариантов реализации указанный способ включает определение того, присутствует ли у указанного субъекта выделенный MICA (например, обнаружение sMICA в кровотоке или обнаружение присутствия MICA на поверхности экзосом (например, аллеля *008).

Необязательно любой из указанных способов также включает введение отвечающему на лечение субъекту антитела (например, антитела против MICA согласно настоящему изобретению), которое связывается с полипептидом MICA.

Согласно предпочтительному варианту реализации экспрессию полипептида MICA в связанной с заболеванием клетке определяют с применением MICA-специфического лиганда. Указанный лиганд предпочтительно представляет собой антитело, его фрагмент или производное.

Согласно другому аспекту настоящим изобретением охвачен способ (например, способ проведения диагностического анализа, анализа отклика на лечение и т.д.), включающий оценку того, присутствуют ли у пациента связанные с заболеванием клетки (например, опухолевые клетки), экспрессирующие полипептид MICA, например, полипептид MICA (один или более аллелей MICA), связываемые антителом согласно настоящему изобретению. Указанный способ может включать, например, получение биологического образца от пациента, у которого присутствуют связанные с заболеванием клетки, приведение указанных связанных с заболеванием клеток в контакт с таким антителом и оценка того, связывается ли указанное антитело со связанными с заболеванием клетками. Обнаружение экспрессирования MICA связанными с заболеванием клетками указывает на то, что состояние пациента характеризуется наличием MICA-экспрессирующих клеток и/или для лечения пациента подходит антитело против MICA согласно настоящему изобретению. Указанный пациент также может получать лечение, подходящее для конкретного заболевания, характеризующегося наличием MICA-экспрессирующих клеток. Необязательно указанный пациент получает лечение антителом против MICA. Согласно одному из вариантов реализации указанный способ применяют для выбора субъектов, у которых имеется раковое заболевание, и указанные связанные с заболеванием клетки представляют собой раковые клетки.

В настоящем изобретении также предложен способ лечения пациента, включающий:

a) определение того, присутствуют ли у указанного пациента патогенные MICA-экспрессирующие клетки, и

b) введение антигенсвязывающего соединения (например, антитела) согласно настоящему изобретению в том случае, если у пациента определено наличие патогенных MICA-экспрессирующих клеток.

В настоящем изобретении также предложен способ лечения пациента, включающий:

a) определение уровня выделенного MICA у пациента, и

b) введение антигенсвязывающего соединения (например, антитела) согласно настоящему изобретению, подавляющего способность sMICA вызывать понижающее модулирование NKG2D на иммунной эффекторной клетке, в том случае, если у пациента определены повышенные уровни выделенного MICA.

Описания указанных и дополнительных предпочтительных аспектов и признаков настоящего изобретения могут также присутствовать в других местах в тексте настоящего документа.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фиг. 1А и 1В показано связывание антител, полученных в первом, втором и третьем циклах иммунизации к MICA-экспрессирующим CR1 клеткам-трансфектантам C1R-MICA*001, C1R-MICA*004, C1R-MICA*007 и C1R-MICA*008, согласно анализу с применением проточной цитометрии.

На фиг. 2A-2G представлена визуализация полипептида MICA, включая выделенные черным аминокислотные остатки, модификация которых приводила (в различных комбинациях) к прекращению связывания антителами. Серым выделен сайт связывания NKG2D в верхней части полипептидов MICA (а также на ленточных диаграммах, связанный с MICA).

На фиг. 3 показано приведены совмещенные сенсограммы, соответствующие впрыскиванию MICA*01-BirA на чип NKG2D-Fc, отдельно или после предварительного инкубирования с контрольным изотипом или гибридными антителами против MICA. Сенсограммы нормализовали по Y-оси и выравнивали по Х-оси в конце впрыскивания. Сенсограммы представляют два независимых эксперимента.

На фиг. 4 представлены результаты функционального анализа блокады MICA-NKG2A, демонстрирующие способность антител против MICA уменьшать или подавляют опосредованный клетками NKG2D+CD16- NK92 киллинг трансфицированных MICA*019 BaF/3 согласно оценке с помощью измерения высвобождения целевыми клетками 51Cr.

На фиг. 5А, 5В и 5С приведены совмещенные сенсограммы, соответствующие впрыскиванию на ULBP-1-Fc (Fc1), MICB-Fc (Fc2), ULBP-2-Fc (Fc3) и ULBP-3-Fc (Fc4) антител против MICA. Сенсограммы выравнивали по Х-оси в начале впрыскивания.

На фиг. 6 показано связывание антител против MICA с MICA Масаса fascicularis.

На фиг. 7 показано ингибирование выделения MICA, опосредованное ВАМ03 против домена α3, но 16А8, в анализе на способность блокировать выделение MICA согласно оценке путем измерения концентрации растворимого MICA в супернатанте после инкубирования MICA-экспрессирующих клеток с антителами против MICA в течение ночи.

На фиг. 8 видно, что активность NKG2D понижающе регулируется до 30-40% от начального уровня в присутствии повышенных доз рекомбинантного бивалентного белка MICA*019*Fc (R&D Systems), и что антитела против MICA, блокирующие взаимодействие NKG2D-MICA в анализе цитотоксичности из примера 5 В (таблица Е), блокируют взаимодействие NKG2D, экспрессируемого на НК-клетках, с MICA*019-Fc, устраняя таким образом понижающее модулирование NKG2D, индуцированное белком MICA*019-Fc.

На фиг. 9 показана жизнеспособность указанных клеток Raji-MICA*01 в присутствии комплемента человека. Результаты указывают на то, что антитела против MICA (совпадающего изотипа) приводят к увеличению числа погибших клеток и способны индуцировать КЗЦ эпитоп-зависимым образом.

На фиг. 10А видно, что каждое антитело против MICA индуцировало специфический лизис клеток C1R-MICA*008 НК-клетками человека линии KHYG-1 hCD16V относительно негативного контроля (контрольное антитело изотипа IgG1 человека), что, соответственно, подтверждает, что указанные антитела индуцируют АЗКЦ в отношении MICA*008-экспрессирующих целевых клеток. На фиг. 10В показан уровень связывания антитела с клеткой.

На фиг. 11 представлены результаты тестирования в долгосрочной модели опухоли RAJI-MICA*01 на мышах. Выживаемость мышей Nod SCID, которым трансплантировали Raji-MICA01 High 15М IV, получавших лечение гибридным антителом против MICA, либо контрольным изотипом (IC) (300 мкг интраперитонеально 2 раза в неделю на протяжении 3 недель), либо ФСБ. Антитела против MICA согласно настоящему изобретению повышали выживаемость.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Введение

Антитела согласно настоящему изобретению способны прямо и специфично направленно воздействовать на MICA-экспрессирующие клетки, в частности, на опухолевые клетки и клетки, вовлеченные в воспалительные или аутоиммунные процессы. В настоящем изобретении предложен ряд обладающих такими свойствами антител, которые связывают аллели как группы 1, так и группы 2, и, более того, все основные аллели MICA человека в составе указанных групп.Также предложены различные антитела, подходящие для конкретных методов. Некоторые антитела блокируют взаимодействие MICA-NKG2D и предотвращают индуцированное растворимым MICA (sMICA) понижающее модулирование поверхностного экспрессирования NKG2D; таким образом, они подходят для восстановления экспрессирования NKG2D у пациента. Такие антитела могут также применяться ввиду их способности блокировать активацию NKG2D, вызванную связыванием MICA и NKG2D на лимфоцитах, и, в частности, обладают преимуществами при лечении воспаления и аутоиммунных расстройств. Другие антитела не конкурируют с NKG2D за связывание с MICA и будут предпочтительными при лечении раковых заболеваний в тех случаях, когда требуется сохранить функционирование NKG2D на эффекторных клетках. Указанные антитела необязательно не будут блокировать выделение MICA из MICA-экспрессирующей опухолевой клетки. Указанные антитела необязательно связывают домен α1α2 MICA (участок белка MICA, образованный доменами α1 и α2). Также предложены эпитопы на домене α1α2 и домене α3, присутствующие во всех аллелях MICA, которые могут быть мишенями антител ввиду высокого сродства к связыванию.

MICA (PERB11.1) относятся к связанной с полипептидами ГКГС класса I последовательности А (См., например, UniProtKB/Swiss-Prot Q29983), ее гену, кДНК и ее генному продукту, или их встречающимся в природе вариантам. Номенклатура генов и белков MICA, а также ссылки на номера доступа последовательностей для разных аллелей, приведены в источнике: Frigoul A. and Lefranc, М-Р. Recent Res. Devel. Human Genet., 3(2005):95-145 ISBN: 81-7736-244-5, содержание которого включено в настоящий документ посредством ссылки. Генные и белковые последовательности MICA, включая полиморфизмы на уровне белка и ДНК, также доступны по ссылке: http://mhc-x.u-strasbg.fr/human.htm, поддерживаемой лабораторией проф. Бахрама (Dr. Bahram).

Аминокислотные последовательности MICA впервые были описаны в источниках: Bahram et al. (1994) Proc. Nat. Acad. Sci. 91:6259-6263, и Bahram et al. (1996) Immunogenetics 44:80-81, содержание которых включено в настоящий документ посредством ссылок. Ген MICA является полиморфным, для него наблюдается необычный разброс ряда вариантов аминокислот во внеклеточных доменах альфа-1, альфа-2 и альфа-3. Для получения дополнительных характеристик полиморфизма MICA Petersdorf et al. (1999) исследовали его аллели у 275 индивидуумов с часто и редко встречающимися генотипами HLA. Последовательности аминокислот внеклеточных доменов α1, α2, и α3 MICA человека представлены в SEQ ID NO 1-5. Полная последовательность MICA также содержит лидерную последовательность из 23 аминокислот, а также трансмембранный домен и цитоплазматический домен. Последовательности аминокислот внеклеточных доменов α1, α2 и α3 выбранных аллелей MICA человека представлены в SEQ ID NO 1-5. Последовательность аминокислот MICA*001 приведена в SEQ ID NO 1, соответствующей номеру доступа в Genbank ААВ41060. Последовательность аминокислот аллеля MICA человека MICA*004 приведена в SEQ ID NO 2, соответствующей номеру доступа в Genbank ААВ41063. Последовательность аминокислот аллеля MICA человека MICA*007 приведена в SEQ ID NO 3, соответствующей номеру доступа в Genbank ААВ41066. Последовательность аминокислот аллеля MICA человека MICA*008 приведена в SEQ ID NO 4, соответствующей номеру доступа в Genbank ААВ41067. Последовательность аминокислот аллеля MICA человека MICA*019 приведена в SEQ ID NO 5, соответствующей номеру доступа в Genbank AAD27008. Последовательность аминокислот MICB человека приведена в SEQ ID NO 6, соответствующей номеру доступа в Genbank САН 8747.

Ген MICA кодирует белок, принадлежащий MhcSF и IgSF. Указанный белок представляет собой трансмембранную ГКГС-I-альфа-подобную (I-альфа-подобную) цепь, которая содержит три внеклеточных домена, два дистальных G-подобных домена, G-альфа1-подобный (также называемый «D1» или «α1») и G-альфа2-подобный (также называемый «D2» или «α2») и С-подобный-домен (также называемый «D3» или «α3»), ближайший к клеточной мембране, и три области, соединяющую область, трансмембранную область и цитоплазматическую область (разметка в соответствии с IMGT Scientific Chart от IMGT (International Immunogenetics Information System®), http://imgt.org и LeFranc et al. In Silico Biology, 2005; 5:45-60). Зрелый белок MICA, включающий лидерный, внеклеточный, трансмембранный и цитоплазматический домены, состоит из 360-366 аминокислот; различия обуславливает полиморфизм микросателлитов трансмембранной области. Домены α1, α2 и α3 могут быть определены с применением любой подходящий системы нумерации (например, системы нумерации IMGT). Согласно одному из вариантов реализации домен α1 содержит остатки 1-88 полипептида MICA, соответствующего последовательности SEQ ID NO 1; домен α2 содержит остатки 89-181 полипептида MICA, соответствующего последовательности SEQ ID NO 1; и домен α3 содержит остатки 182-274 полипептида MICA, соответствующего последовательности SEQ ID NO 1. Каждый из доменов α1 и α2 содержит цепи А, В, С и D, петли АВ, ВС и CD и спираль. Домен α3 содержит цепи А, В, С, D, Е, F и G, петлю ВС, цепь CD, DE-петлю и FG-петлю. Белок MICA высокогликозилирован, он включает 8 сайтов потенциального гликозилирования, два в домене α1, один в α2 и пять в α3, в том числе О-гликанами (N-ацетиллактозамин, связанный с серином или треонином) и/или N-гликанами. В то время как в определенных клетках MICA экспрессируется конститутивно, низкие уровни экспрессии MICA обычно не стимулируют прикрепление хозяйских иммунных клеток. Однако MICA повышающе регулируется в быстро пролиферирующих клетках, таких как опухолевые клетки. MICA является наиболее интенсивно экспрессируемым из всех лигандов NKG2D, и он обнаруживается при опухолях разнообразных типов (таких как карциномы в целом, рак мочевого пузыря, меланома, рак легкого, гепатоцеллюлярный рак, глиобластома, рак предстательной железы, гематологические злокачественные новообразования в целом, острая миелоидная лейкемия, острый лимфолейкоз, хронический миелолейкоз и хронический лимфолейкоз. Недавно Tsuboi с коллегами (2011) (EMBO J: 1-13) сообщили, что О-гликан-ветвящий фермент, β-1,6-N-ацетилглюкозаминилтрансфераза (C2GnT) кора 2, активен в MICA-экспрессирующих опухолевых клетках, и что MICA из опухолевых клеток содержит О-гликан кора 2 (О-гликан, содержащий N-ацетилглюкозаминовую ветвь, соединенную с N-ацетилгалактозамином).

У Bauer et al. Science 285:727-729, 1999 описана роль MICA как стресс-индуцируемого лиганда NKG2D. В настоящем документе «MICA» относится к любому полипептиду MICA, включая любой вариант, производное или изоформу гена MICA или кодируемого(ых) белка(ов), которому(ым) они соответствуют. Ген MICA является полиморфным, для него наблюдается необычный разброс ряда вариантов аминокислот во внеклеточных доменах альфа-1, альфа-2 и альфа-3. Описаны различные аллельные варианты полипептидов MICA (например, MICA), каждый из которых включен с помощью соответствующего термина, в том числе, например, полипептиды MICA человека MICA*001, MICA*002, MICA*004, MICA*005, MICA*006, MICA*007, MICA*008, MICA*009, MICA*010, MICA*011, MICA*012, MICA*013, MICA*014, MICA*015, MICA*016, MICA*017, MICA*018, MICA*019, MICA*020, MICA*022, MICA*023, MICA*024, MICA*025, MICA*026, MICA*027, MICA*028, MICA*029, MICA*030, MICA*031, MICA*032, MICA*033, MICA*034, MICA*035, MICA*036, MICA*037, MICA*038, MICA*039, MICA*040, MICA*041, MICA*042, MICA*043, MICA*044, MICA*045, MICA*046, MICA*047, MICA*048, MICA*049, MICA*050, MICA*051, MICA*052, MICA*053, MICA*054, MICA*055 и MICA*056. Также включены любые последовательности нуклеиновых кислот или белков, характеризующихся одним или несколькими биологическими свойствами или функциями полноразмерного MICA дикого типа, соответственно, и обладающие нуклеотидными или аминокислотными последовательностями, идентичными по меньшей мере на 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% или более.

В настоящем документе «hNKG2D» и, если не указано иное или если это не противоречит контексту, термины «NKG2D», «NKG2-D», «CD314», «D12S2489E», «KLRK1», «член 1 подсемейства К лектиноподобных рецепторов киллерных клеток», или «KLRK1», относятся к гену активирующего рецептора киллерных клеток человека, его кДНК {например, номер доступа GenBank NM_007360), и его генному продукту (номер доступа GenBank NP_031386), или к его встречающимся в природе вариантам. В НК-клетках и Т-клетках hNKG2D может образовывать гетеродимеры или комплексы более высокого порядка с такими белками, как DAP 10 (номер доступа GenBank AAG29425, AAD50293). Любая описанная в настоящем документе активность hNKG2D, например, активация клеток, распознавание антител и т.д., может также быть отнесена к hNKG2D в форме гетеродимера, например, hNKG2D-DAP10, или к комплексам более высокого порядка, содержащим указанные два (и/или другие) компоненты.

Определена трехмерная структура MICA в комплексе с NKG2D (см., например, Li et al., Nat. Immunol. 2001; 2:443-451, код доступа 1hyr; и в базе данных трехмерных структур IMGT (Kaas et al. Nucl. Acids Res. 2004; 32: D208-D210)). Когда MICA входит в комплекс с гомодимером NKG2D, остатки 63-73 (нумерация IGMT) MICA α2 располагаются так, что добавляют почти два оборота спирали. Два мономера NKG2D вносят равный вклад во взаимодействие с MICA, и семь положений в каждом мономере NKG2D взаимодействуют с одним из спиральных доменов MICA α1 или α2.

В настоящем изобретении предложены способы применения антигенсвязывающих соединений согласно настоящему изобретению; например, в настоящем изобретении предложен способ подавления пролиферации или активности клеток, доставки молекулы в клетку (например, токсической молекулы, детектируемого маркера и т.д.), для направленного действия, идентифицирования или очищения клетки, истощения, киллинга или элиминации клетки, понижения пролиферации клеток, отличающийся тем, что указанный способ включает воздействие на клетку, такую как опухолевая клетка, которая экспрессирует полипептид MICA, антигенсвязывающего соединения согласно настоящему изобретению, связывающего полипептид MICA. Следует иметь в виду, что для целей настоящего изобретения «пролиферация клеток» может относиться к любому аспекту роста или пролиферации клеток, например, клеточному росту, клеточному делению или любому аспекту клеточного цикла. Клетка может находиться в клеточной культуре (in vitro) или в организме млекопитающего (in vivo), например, млекопитающего, страдающего патологией, характеризующейся экспрессией MICA. В настоящем изобретении также предложен способ индуцирования гибели клетки или подавления пролиферации или активности клетки, которая экспрессирует полипептид MICA, включающий воздействие на указанную клетку антигенсвязывающего соединения, связывающего полипептид MICA, соединенного с токсичным агентом, в количестве, эффективном для индуцирования гибели и/или подавления пролиферации указанной клетки. Соответственно, в настоящем изобретении предложен способ лечения млекопитающего, страдающего пролиферативным заболеванием, и любого состояния, характеризующегося патогенным размножением клеток, экспрессирующих полипептид MICA, отличающийся тем, что указанный способ включает введение фармацевтически эффективного количества антигенсвязывающего соединения, описанного в настоящем документе, млекопитающему, например, для лечения ракового заболевания.

Определения

В настоящем описании под терминами, приведенными в единственном числе, может подразумеваться «один или более». В пункте(ах) формулы изобретения в сочетании с термином «включающий/содержащий» термины в единственном числе могут подразумевать «один или более одного». В настоящем описании «другой» может означать по меньшей мере второй или более.

Термин «включающий/содержащий» может предпочтительно быть заменен на «состоящий по существу из», более предпочтительно на «состоящий из».

При упоминании где-либо в тексте настоящего описания «лечения пролиферативного заболевания» или «лечения опухоли», или «лечения ракового заболевания» или т.п. с указанием на анти-MICA связывающий агент (например, антитело), имеется в виду: (а) способ лечения пролиферативного заболевания, причем указанный способ включает этап введения (по меньшей мере однократная обработка/лечение) анти-MICA связывающего агента, (предпочтительно в фармацевтически приемлемом носителе) теплокровному животному, в частности, человеку, нуждающемуся в таком лечении, в дозировке, обеспечивающей лечение указанного заболевания (терапевтически эффективного количества), предпочтительно в дозировке (количестве), указанной как предпочтительная выше или ниже в тексте настоящего документа; (b) применение анти-MICA связывающего агента для лечения пролиферативного заболевания, или анти-MICA связывающий агент, для применения при указанном лечении (в частности, у человека); (с) применение анти-MICA связывающего агента для получения фармацевтического состава для лечения пролиферативного заболевания, способ применения анти-MICA связывающего агента для получения фармацевтического состава для лечения пролиферативного заболевания, содержащего смесь анти-MICA связывающего агента с фармацевтически приемлемым носителем, или фармацевтический состав, содержащий эффективную дозу анти-MICA связывающего агента, подходящий для лечения пролиферативного заболевания; или (d) любая комбинация а), b), и с), в соответствии с патентоспособностью предмета изобретения в стране, где подается заявка.

Термины «рак/раковое заболевание» и «опухоль» в настоящем документе определены как новообразование клеток или ткани, включающее неконтролируемое и прогрессирующее размножение. Согласно конкретному варианту реализации при естественном развитии событий раковое заболевание приводит к смертельному исходу. Согласно специфическим вариантам реализации раковое заболевание является инвазивным, метастатическим и/или анапластическим (потеря дифференцировки и ориентации клеток друг относительно друга и осевой ориентации).

Термин «биопсия» в настоящем документе определен как извлечение ткани из органа с целью исследования, например, постановки диагноза. Примеры типов биопсии включают биопсию с помощью отсасывания, например, иглой, присоединенной к шприцу; инструментальное извлечение фрагмента ткани; путем извлечения при помощи подходящих инструментов через эндоскоп; извлечение хирургическим путем, например, извлечение всего очага поражения; и т.п.

Термин «антитело», в настоящем документе относится к поликлональным и моноклональным антителам. В зависимости от типа константного домена в тяжелых цепях антитела относят к одному из пяти главных классов: IgA, IgD, IgE, IgG и IgM. Некоторые из указанных классов также делят на подклассы или изотипы, такие как IgG1, IgG2, IgG3, IgG4 и т.п. Типичная структурная единица иммуноглобулина (антитела) включает тетрамер. Каждый тетрамер состоит из двух идентичных пар полипептидных цепей, каждая пара содержит одну «легкую» (приблизительно 25 кДа) и одну «тяжелую» цепь (приблизительно 50-70 кДа). N-конец каждой цепи образует вариабельную область, состоящую приблизительно из 100-110 или более аминокислот, отвечающую в первую очередь за распознавание антигена. Термины «вариабельная легкая цепь» (VL) и «вариабельная тяжелая цепь» (VH) относятся к указанным легким и тяжелым цепям, соответственно. Константные домены тяжелых цепей, соответствующие разным классам иммуноглобулинов, называют «альфа», «дельта», «эпсилон», «гамма» и «мю», соответственно. Субъединичные структуры и трехмерные конфигурации разных классов иммуноглобулинов хорошо известны. IgG и/или IgM являются предпочтительными классами антител, применяемых в настоящем изобретении, в частности, предпочтительными являются IgG, поскольку они представляют собой наиболее распространенные антитела в физиологических условиях, и их проще всего получить в лабораторных условиях. Антитело согласно настоящему изобретению предпочтительно представляет собой моноклональное антитело. В частности предпочтительными являются гуманизированные, гибридные, человеческие или другие подходящие для человека антитела. «Антитела» также включают любой фрагмент или производное любого из описанных в настоящем документе антител.

Термин «специфически связывается с» означает, что антитело способно связываться, предпочтительно в анализе конкурентного связывания, с партнером для связывания, например, MICA, по оценке с применением либо рекомбинантных форм указанных белков, их эпитопов, либо нативных белков, присутствующих на поверхности выделенных целевых клеток. Анализ конкурентного связывания и другие способы определения специфического связывания также описаны ниже и хорошо известны в данной области техники.

Если сказано, что антитело «конкурирует с» конкретным моноклональным антителом (например, 6Е4, 20С6 или 16А8), это означает, что указанное антитело конкурирует с указанным моноклональным антителом в анализе связывания с применением либо молекул рекомбинантного MICA, либо молекул экспрессируемого на поверхности MICA. Например, если тестируемое антитело уменьшает связывание 6Е4, 20С6 или 16А8 с полипептидом MICA или MICA-экспрессирующей клеткой в анализе связывания, говорят, что указанное антитело «конкурирует» с 6Е4, 20С6 или 16А8, соответственно.

Термин «аффинность/сродство», в настоящем документе означает силу связывания антитела с эпитопом. Аффинность антитела задается константой диссоциации KD, определяемой как [Ab]×[Ag]/[Ab-Ag], где [Ab-Ag] представляет собой молярную концентрацию комплекса антитело-антиген, [Ab] представляет собой молярную концентрацию несвязанного антитела, и [Ag] представляет собой молярную концентрацию несвязанного антигена. Константа аффинности Ka определяется как 1/Kd. С предпочтительными способами определения аффинности моноклональных антител можно ознакомиться в источниках: Harlow, et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993), и Muller, Meth. Enzymol. 92:589-601 (1983), полностью включенных в настоящий документ посредством ссылки. Одним из предпочтительных стандартных методов определения аффинности моноклональных антител, хорошо известным в данной области техники, является скрининг с применением поверхностного плазмонного резонанса (ППР) (например, анализ с помощью аналитического устройства для ППР от BIAcore™).

В контексте настоящего изобретения «детерминанта» означает участок взаимодействия или связывания на полипептиде.

Термин «эпитоп» относится к антигенной детерминанте, и обозначает участок или область антигена, с которым(ой) связывается антитело. Белковый эпитоп может содержать аминокислотные остатки, непосредственно вовлеченные в связывание, а также аминокислотные остатки, которые эффективно блокируются специфическим антигенсвязывающим антителом или пептидом, т.е. аминокислотные остатки в составе «области распознавания» антитела. Это простейшая форма или минимальный структурный участок комплекса антигенной молекулы, способный соединяться, например, с антителом или рецептором. Эпитопы могут быть линейными или конформационными/структурными. Термин «линейный эпитоп» определен как эпитоп, состоящий из аминокислотных остатков, располагающихся последовательно в линейной последовательности аминокислот (первичная структура). Термин «конформационный или структурный эпитоп» определен как эпитоп, состоящий из аминокислотных остатков, не все из которых являются смежными и, соответственно, представляют разные части линейной последовательности аминокислот, и сближающиеся за счет укладки молекулы (вторичная, третичная и/или четвертичная структура). Конформационный эпитоп определяется трехмерной структурой. Соответственно, термин «конформационный» часто используется взаимозаменяемо с термином «структурный».

Термин «истощающий» в отношении MICA-экспрессирующих клеток означает процесс, способ или соединение, способное к киллингу, элиминированию, лизированию, или способное индуцировать такой киллинг, элиминирование или лизис, таким образом, что это отражается негативно на числе MICA-экспрессирующих клеток в образце или у субъекта.

«Агент» или «соединение» в соответствии с настоящим изобретением включает малые молекулы, полипептиды, белки, антитела или фрагменты антител. Под малыми молекулами в контексте настоящего изобретения понимают, согласно одному варианту реализации, химические вещества, молекулярная масса которых меньше, чем 1000 дальтон, в частности, менее 800 дальтон, в более конкретном варианте менее 500 дальтон. Термин «терапевтический агент» относится к агенту, обладающему биологической активностью. Термин «противораковый агент» относится к агенту, обладающему биологической активностью, направленной против раковых клеток.

Термин «подходящий для человека» в отношении антитела относится к любому антителу, дериватизированному антителу или фрагменту антитела, безопасному для применения у человека, например, в способах терапии, описанных в настоящем документе. Подходящие для человека антитела включают все типы гуманизированных, гибридных или полностью человеческих антител, или любые антитела, по меньшей мере часть которых получена от человека, или другим образом модифицированные для того, чтобы избежать иммунного ответа, обычно провоцируемого применением нативных не принадлежащих человеку антител. Для целей настоящего изобретения «гуманизированное» антитело или «антитело человека» относится к антителу, в котором константная и вариабельная каркасная область одного или нескольких иммуноглобулинов человека слита с областью связывания, например, CDR, иммуноглобулина животного. Сконструированные таким образом антитела сохраняют специфичность связывания не принадлежащего человеку антитела, из которого происходят области связывания, но позволяют избежать иммунной реакции против указанного не принадлежащего человеку антитела. Такие антитела могут быть получены от трансгенных мышей или других животных, «сконструированных» для продуцирования специфических антител человека в ответ на стимуляцию антигеном (см., например, источники: Green et al. (1994) Nature Genet 7:13; Lonberg et al. (1994) Nature 368:856; Taylor et al. (1994) Int Immun 6:579, содержание которых полностью включено в настоящий документ посредством ссылки). Может также быть сконструировано полностью человеческое антитело с применением методов генной или хромосомной трансфекции, а также технологии фагового дисплея, все из которых известны в данной области техники (см., например, McCafferty et al. (1990) Nature 348:552-553). Антитела человека могут быть также получены с применением in vitro активированных В-клеток (см., например, патенты США №5567610 и №5229275, полностью включенные в настоящий документ посредством ссылки).

«Гибридное антитело» представляет собой молекулу антитела, в которой (а) константная область или ее участок изменен(а), замещена или заменена таким образом, что антигенсвязывающий участок (вариабельная область) соединен с константной областью другого(ой) или измененного(ой) класса, эффекторной функции и/или вида, или совершенно отдельной молекулой, придающей новые свойства указанному гибридному антителу, например, ферментом, токсином, гормоном, фактором роста, лекарственным средством и т.д.; или (b) вариабельная область или ее участок изменена, замещена или заменена вариабельной областью, обладающей другой или измененной антигенной специфичностью.

Термины «Fc-домен», «Fc-часть», и «Fc-область» относятся к С-концевому фрагменту тяжелой цепи антитела, например, от приблизительно 230 аминокислоты (АК) до приблизительно 450 АК тяжелой цепи γ (гамма) человека или эквивалентной последовательности в тяжелых цепях антител других типов (например, α, δ, ε и μ антител человека), или его встречающегося в природе аллотипа. Если не указано иное, везде в настоящем описании для иммуноглобулинов используют общепринятую систему нумерации аминокислот по Kabat (см. Kabat et al. (1991) Sequences of Protein of Immunological Interest, 5е изд. Службы общественного здравоохранения США, Национальный институт здравоохранения, Бетесда, Мэриленд, также называемый «Kabat EU»).

Термин «антителозависимая клеточноопосредованная цитотоксичность», или «АЗКЦ», представляет собой широко используемый в данной области техники термин и относится к клеточно-опосредованной реакции, при которой неспецифические цитотоксические клетки, которые экспрессируют Fc-рецепторы (FcR), распознают связанное антитело на целевой клетке и в результате вызывают лизис указанной целевой клетки. Неспецифические цитотоксические клетки, опосредующие АЗКЦ, включают естественные киллерные (НК) клетки, макрофаги, моноциты, нейтрофилы и эозинофилы.

Термин «комплементзависимая цитотоксичность», или «КЗЦ», представляет собой термин, хорошо известный в данной области техники, и относится к способности молекулы лизировать мишень в присутствии комплемента. Путь активации комплемента инициируется связыванием первого компонента системы комплемента (C1q) с молекулой (например, антителом) в комплексе с распознаваемым антигеном.

Термин «выделение» («шеддинг») в отношении MICA относится к высвобождению фрагмента растворимого внеклеточного домена (ECD) MICA с поверхности клетки, которая экспрессирует MICA. Такое выделение может вызываться протеолитическим расщеплением (например, посредством действия матриксных металлопротеиназ (ММП), например, ADAM 10 и/или ADAM 17) MICA на клеточной поверхности, приводящим к высвобождению фрагмента ECD с поверхности клетки, либо растворимый ECD или его фрагмент может кодироваться альтернативным транскриптом.

Термины «выделенный», «очищенный» или «биологически чистый» относятся к материалу, по существу не содержащему компонентов, которые обычно обнаруживаются в нем в естественном состоянии. Чистоту и гомогенность, как правило, определяют с применением техник аналитической химии, таких как электрофорез в полиакриламидном геле или высокоэффективная жидкостная хроматография. Белок, преобладающий в составе, является по существу очищенным.

Термины «полипептид», «пептид» и «белок» используются в настоящем документе взаимозаменяемо, относясь к полимеру из аминокислотных остатков. Указанные термины используются для обозначения полимеров аминокислот, в которых один или более аминокислотных остатков представляют собой искусственный химический миметик соответствующей встречающейся в природе аминокислоты, а также для обозначения встречающихся в природе полимеров аминокислот и не встречающихся в природе полимеров аминокислот.

Термин «рекомбинантный» при использовании в отношении, например, клетки, нуклеиновой кислоты, белка или вектора, указывает на то, что указанная(ый) клетка, нуклеиновая кислота, белок или вектор был(а) модифицирован(а) путем введения гетерологичной нуклеиновой кислоты или белка, или изменения нативной(ого) нуклеиновой кислоты или белка; либо на то, что указанная клетка получена из клетки, модифицированной указанным образом. Соответственно, рекомбинантные клетки, например, экспрессируют гены, не обнаруживаемые в нативной (нерекомбинантной) форме указанной клетки, или экспрессируют нативные гены, которые в ином случае экспрессируются аномальным образом, недостаточно экспрессируются или вообще не экспрессируются.

В настоящем документе «НК-клетки» относится к субпопуляции лимфоцитов, вовлеченной в безусловный иммунитет. НК-клетки могут быть идентифицированы на основании определенных характеристики и биологических свойств, таких как экспрессирование специфических поверхностных антигенов, включая CD56 и/или CD16 у НК-клеток человека, отсутствие альфа/бета или гамма/дельта Т-клеточного рецепторного комплекса (TCR-комплекса) на клеточной поверхности, способность к связыванию и киллингу клеток, не экспрессирующих «собственные» ГКГС-антигены посредством активации специфических цитолитических механизмов, способность к киллингу опухолевых клеток или других пораженных заболеванием клеток, которые экспрессируют лиганд активирующих НК рецепторов, и способность высвобождать белковые молекулы, называемые цитокинами, которые стимулируют или подавляют иммунный ответ. Любые из указанных характеристик и видов активности могут быть использованы для идентифицирования НК-клеток с применением способов, хорошо известных в данной области техники. Любая субпопуляция НК-клеток также охвачена термином «НК-клетки». В контексте настоящего изобретения под «активными» НК-клетками подразумеваются биологически активные НК-клетки, в том числе НК-клетки, обладающие способностью к лизису целевых клеток или усиливающие иммунную функцию других клеток. Например, «активная» НК-клетка может быть способна к киллингу клеток, которые экспрессируют лиганд активирующего рецептора НК и/или не экспрессируют ГКГС-антигены, распознаваемые иммуноглобулиноподобными рецепторами киллерных клеток (KIR-рецепторами) на НК-клетке. НК-клетки могут быть получены с помощью применения различных техник, известных в данной области техники, таких как выделение из образцов крови, цитаферез, сбор тканей или клеток и т.д. Подходящие протоколы для анализов, для которых используют НК-клетки, можно найти в руководстве Natural Killer Cells Protocols (под редакцией Campbell KS, Colonna M). Human Press, pp. 219-238 (2000).

В настоящем документе термин «Т-клетки» относится к субпопуляции лимфоцитов, созревающих в вилочковой железе и экспонирующих на поверхности, наряду с другими молекулами, Т-клеточные рецепторы. Т-клетки могут быть идентифицированы на основании определенных характеристик и биологических свойств, таких как экспрессия специфических поверхностных антигенов, включая TCR, CD4 или CD8, способность определенных Т-клеток убивать опухолевые или инфицированные клетки, способность определенных Т-клеток активировать другие клетки иммунной системы и способность высвобождать белковые молекулы, называемые цитокинами, которые стимулируют или подавляют иммунный ответ. Любые указанные характеристики и виды активности могут применяться для идентифицирования Т-клеток с помощью способов, хорошо известных в данной области техники. В контексте настоящего изобретения под «активными» или «активированными» Т-клетками или НК-клетками понимаются биологически активные Т-клетки или НК-клетки, в частности, Т-клетки или НК-клетки, обладающие способностью к цитолизу или стимуляции иммунного ответа, например, путем секретирования цитокинов. Активные клетки могут быть обнаружены с помощью любых из множества хорошо известных способов, в том числе функциональных анализов и анализов на основе экспрессии, например, экспрессии цитокинов.

В контексте настоящего изобретения термин «антитело, связывающее» полипептид или эпитоп означает антитело, связывающее указанную детерминанту со специфичностью и/или сродством.

Антитела

Антитела согласно настоящему изобретению представляют собой антитела, связывающие MICA человека, соответствующие разным аллелям. Согласно одному из вариантов реализации указанные антитела связываются с полипептидом MICA (антитело против MICA) по существу не блокируя взаимодействие MICA с NKG2D (например, взаимодействие поверхностного MICA на опухолевых клетках с поверхностным NKG2D на эффекторных клетках). Согласно другому варианту реализации указанные антитела связываются с полипептидом MICA (антитело против MICA) и подавляют взаимодействие MICA с NKG2D; предпочтительно, указанные антитела подавляют понижающее модулирование NKG2D на поверхности иммунных клеток, обусловленное sMICA. Согласно одному из вариантов реализации указанные антитела связываются с полипептидом MICA на поверхности клетки, по существу не блокируя выделение MICA с клеточной поверхности (например, из опухолевых клеток). Согласно одному из вариантов реализации указанные антитела связывают домены α1 и/или α2 MICA. Согласно одному из вариантов реализации указанные антитела связывают домен α3 MICA. Согласно одному из вариантов реализации указанные антитела обладают сродством к MICA человека, соответствующим аллелям *001, *004 и *008, необязательно также *007 и/или *019, и необязательно характеризуются Kd, составляющей менее чем 10-9 М, предпочтительно менее чем 10-10 М.

Согласно одному из вариантов реализации указанное антитело конкурирует за связывание полипептида MICA с любым одним или несколькими из антител 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 и 14В4. Указанное антитело предпочтительно распознает, связывает тот же или по существу тот же эпитоп или «эпитопный участок» на полипептиде MICA или обладает в отношении него иммуноспецифичностью.

Эпитопы антител

Согласно другому варианту реализации указанные антитела связывают по существу тот же эпитоп, что и антитела 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 и 14В4. Согласно другому варианту реализации указанные антитела по меньшей мере частично захватывает сегмент или включает по меньшей мере один остаток в сегменте, соответствующем остаткам 1-88, остаткам 89-181 или остаткам 182-274 полипептида MICA, содержащего последовательности аминокислот SEQ ID NO: 1-5. Согласно одному из вариантов реализации все ключевые остатки эпитопа находятся в сегменте, соответствующем остаткам 1-88, остаткам 89-181 или остаткам 182-274 полипептида MICA, содержащего последовательности аминокислот SEQ ID NO: 1-5. Согласно одному из вариантов реализации антитело связывает эпитоп, захватывающий соединение (а) домена α1 и/или α2 и (b) домена α3, при этом все ключевые остатки эпитопа находятся в сегменте, соответствующем остаткам 1-181 (например, остаткам 1-88 (необязательно 1-85) или 89-181 (необязательно 86-181)) полипептида MICA, содержащего последовательности аминокислот SEQ ID NO: 1-5. Согласно одному из вариантов реализации указанные антитела связывают эпитоп, содержащий 1, 2, 3, 4, 5, 6, 7 или более остатков из в сегменте, соответствующем остаткам 1-88 (необязательно 1-85) или остаткам 89-181 (необязательно 86-181) полипептида MICA, содержащегопоследовательности аминокислот SEQ ID NO: 1-5. Предпочтительно остатки, связанные указанным антителом, находятся на поверхности полипептида MICA, например, в полипептиде MICA, экспрессируемого на поверхности клетки.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6, 7 или более остатков, выбранных из группы, состоящей из R6, N8, Q48, W49, Е51, D52, V53, L54, N56, K57, Т58, R61, R64, K81, D82, Q83, K84, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Н109, Y111, D113, Е115, L116, N121, Е123, Т124, Е126, Q131, S132, S133, R134, Q136, Т137, М140, N141, R143, N144, L178, R179, R180, S224, Н225, D226, Т227, Q228, Q229, W230 и D232 (в отношении MICA, соответствующего любой из последовательностей SEQ ID NO 1-5).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий:

(a) один или более остатков, выбранных из группы, состоящей из R6 и N8;

(b) один или более остатков, выбранных из группы, состоящей из N56, K57, Т58;

(c) один или более остатков, выбранных из группы, состоящей из R61 и R64;

(d) один или более остатков, выбранных из группы, состоящей из K81, D82;

(e) один или более остатков, выбранных из группы, состоящей из Q83, K84;

(f) один или более остатков, выбранных из группы, состоящей из Е97, Н99;

(g) один или более остатков, выбранных из группы, состоящей из Е100, D101, N102;

(h) один или более остатков, выбранных из группы, состоящей из S103, Т104, R105;

(i) один или более остатков, выбранных из группы, состоящей из D113, Е115;

(j) один или более остатков, выбранных из группы, состоящей из N121, Е123;

(к) один или более остатков, выбранных из группы, состоящей из Т124 и Е126;

(1) один или более остатков, выбранных из группы, состоящей из HI09, Y111, L116;

(m) один или более остатков, выбранных из группы, состоящей из Q131, S132, Q136;

(n) один или более остатков, выбранных из группы, состоящей из S133, R134, Т137;

или

(о) один или более остатков, выбранных из группы, состоящей из Ml40, N141, R143 и N144;

(р) один или более остатков, выбранных из группы, состоящей из S224, Н225 и D226;

(q) один или более остатков, выбранных из группы, состоящей из Т227, Q228 и Q229; и/или

(r) один или более остатков, выбранных из группы, состоящей из W230 и D232. Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий любую комбинацию 2, 3 или 4 пунктов (а) - (r).

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из Q48, W49, Е51, D52, V53 и L54.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из N56, K57, Т58, R61 HR64.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, Н109, Y111, D113, L116, S133, R134, Т137, М140, N141, R143 и N144.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, Н109, Y111, D113, L116, Q131, S132, Q136, М140, N141, R143 и N144.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из Е100, D101, N102, S103, Т104, R105, N121, Е123, Т124 и Е126.

Согласно одному из вариантов реализации указанные антитела связывают эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из R6, N8, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Е115, L178, R179 и R180.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из S224, Н225, D226, Т227, Q228, Q229, W230 и D232. Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий 1, 2, 3, 4, 5, 6 или более остатков, выбранных из группы, состоящей из Т227, Q228 и Q229.

Согласно одному из вариантов реализации антитело связывает эпитоп, содержащий:

(a) 1 или более остатков, выбранных из группы, состоящей из K81, D82, и 1 или более остатков, выбранных из группы, состоящей из Q83, K84;

(b) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, и 1, 2 или 3 остатка, выбранных из группы, состоящей из Н109, Y111, L116;

(c) остаток D113, и 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из K81, D82, Q83, K84;

(d) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, и 1, 2 или 3 остатка, выбранных из группы, состоящей из Q131, S132, Q136;

(e) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, и 1, 2 или 3 остатка, выбранных из группы, состоящей из S133, R134, Т137;

(f) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, и 1, 2 или 3 остатка, выбранных из группы, состоящей из M140, N141, R143 и N144;

(g) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84; 1, 2 или 3 остатка, выбранных из группы, состоящей из Н109, Y111, L116; необязательно D113; и 1, 2 или 3 остатка, выбранных из группы, состоящей из Q131, S132, Q136;

(h) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84; 1, 2 или 3 остатка, выбранных из группы, состоящей из Н109, Y111, L116; необязательно D113; и 1, 2 или 3 остатка, выбранных из группы, состоящей из S133, R134, T137;

(i) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84; 1, 2 или 3 остатка, выбранных из группы, состоящей из H109, Y111, L116; необязательно D113; и 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из М140, N141, R143 и N144;

(j) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84; 1, 2 или 3 остатка, выбранных из группы, состоящей из Н109, Y111, L116; необязательно D113; 1, 2 или 3 остатка, выбранных из группы, состоящей из S133, R134, Т137; и 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из М140, N141, R143 и N144;

(k) 1 или более остатков, выбранных из группы, состоящей из R6, N8, и 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из Е100, D101, N102, S103, Т104, R105;

(l) 1, 2, 3 или 4 остатка, выбранных из группы, состоящей из N121, Е123, Т124 и Е126, и 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из Е100, D101, N102, S103, T104, R105; или

(m) 1, 2 или 3 остатка, выбранных из группы, состоящей из S224, Н225 и D226, 1, 2 или 3 остатка, выбранных из группы, состоящей из Т227, Q228 и Q229, и один или два остатка, выбранных из группы, состоящей из W230 и D232.

Необязательно, эпитоп антитела согласно настоящему изобретению может полностью входить в состав домена α1 и/или α2 MICA. Также указанные антитела могут необязательно быть охарактеризованы как по существу связывающиеся с областью домена α3, необходимой для выделения MICA.

Согласно одному из вариантов реализации антитела согласно настоящему изобретению связывают одну или более аминокислот, находящихся на поверхности полипептида MICA, соответствующего аллелям *001, *004 и *008 (а также, необязательно, *007 и *019).

Может быть измерено связывание антител против MICA с клетками, трансфицированными мутантными MICA, и проведено сравнение со способностью антитела против MICA связывать полипептид MICA дикого типа (например, соответствующий любой одной или нескольким последовательностям SEQ ID NO: 1-5). Ослабление связывания между антителом против MICA и мутантным полипептидом MICA означает, что происходит уменьшение сродства к связыванию (например, по оценке с применением известных способов, таких как FACS-тестирование клеток, экспрессирующих конкретный мутантный вариант, или тестирование Biacore на связывание с мутантными полипептидами) и/или снижение общей связывающей способности указанного антитела против MICA (о чем свидетельствует, например, уменьшение Втах на графике концентрации антитела против MICA относительно концентрации полипептида). Значимое уменьшение связывания указывает на то, что мутантный остаток непосредственно вовлечен в связывание с антителом против MICA или располагается в непосредственной близости от связываемого белка при связывании антитела против MICA с MICA.

Согласно некоторым вариантам реализации значимое снижение связывания означает, что сродство и/или способность к связыванию антитела против MICA с мутантным полипептидом MICA снижено более чем на 40%, более чем на 50%, более чем на 55%, более чем на 60%, более чем на 65%, более чем на 70%, более чем на 75%, более чем на 80%, более чем на 85%, более чем на 90% или более чем на 95% относительно связывания антитела и полипептида MICA дикого типа. Согласно определенным вариантам реализации значения связывания опускаются ниже порога детектируемых величин. Согласно некоторым вариантам реализации значимое уменьшение связывания наблюдется, если величина связывания антитела против MICA с мутантным полипептидом MICA составляет менее чем 50% (например, менее чем 45%, 40%, 35%, 30%, 25%, 20%), 15% или 10%) относительно связывания, наблюдаемого между антителом против MICA и полипептидом MICA дикого типа.

Согласно некоторым вариантам реализации предложены антитела против MICA, демонстрирующие значимо меньшее связывание мутантного полипептида MICA, в котором остаток в сегменте, соответствующем остаткам 1-88 (необязательно 1-85), остаткам 89-181 (необязательно 86-181) или остаткам 182-274 (или их субпоследовательности) в полипептиде MICA дикого типа (например, содержащем последовательность, соответствующую последовательностям SEQ ID NO: 1-5) заменен другой аминокислотой. Согласно некоторым вариантам реализации предложены антитела против MICA, демонстрирующие значимо меньшее связывание мутантного полипептида MICA, в котором остаток в сегменте, соответствующем остаткам 1-88 (необязательно 1- 85), остатки 89-181 (необязательно 86-181), или остатки 182-274 (или их субпоследовательности) в полипептиде MICA дикого типа (например, содержащем последовательность, соответствующую последовательностям SEQ ID NO: 1-5) заменены другой аминокислотой.

Согласно некоторым вариантам реализации предложены антитела против MICA, демонстрирующие значимо меньшее связывание мутантного полипептида MICA, в котором остаток, выбранный из группы, состоящей из R6, N8, Q48, W49, Е51, D52, V53, L54, N56, K57, Т58, R61, R64, K81, D82, Q83, K84, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Н109, Ylll, D113, Е115, L116, N121, Е123, Т124, Е126, Q131, S132, S133, R134, Q136, Т137, М140, N141, R143, N144, L178, R179, R180, S224, Н225, D226, Т227, Q228, Q229, W230 и D232 заменен другой аминокислотой по сравнению с полипептидом MICA дикого типа.

Согласно некоторым вариантам реализации предложены антитела против MICA, демонстрирующие значимо меньшее связывание мутантного полипептида MICA, в котором:

(a) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из Q48, W49, E51,D52, V53 и L54;

(b) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из N56, K57, Т58, R61 и R64;

(c) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, Н109, Y111, D113, L116, S133, R134, Т137, М140, N141, R143 и N144;

(d) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из K81, D82, Q83, K84, H109, Y111, D113, L116, Q131, S132, Q136, М140, N141, R143 и N144;

(e) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из Е100, D101, N102, S103, Т104, R105, N121, Е123, Т124 и Е126;

(f) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из R6, N8, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Е115, L178, R179 и R180; или

(g) 1, 2, 3, 4 или более остатков, выбранных из группы, состоящей из S224, Н225, D226, Т227, Q228, Q229, W230 и D232, заменены другой аминокислотой по сравнению с полипептидом MICA дикого типа.

Согласно некоторым вариантам реализации предложены антитела против MICA, демонстрирующие значимо меньшее связывание мутантного полипептида MICA, в котором:

(а) остаток, выбранный из группы, состоящей из R6 и N8;

(b) остаток, выбранный из группы, состоящей из N56, K57, Т58;

(c) остаток, выбранный из группы, состоящей из R61 и R64;

(d) остаток, выбранный из группы, состоящей из K81, D82;

(e) остаток, выбранный из группы, состоящей из Q83, K84;

(f) остаток, выбранный из группы, состоящей из Е97, Н99;

(g) остаток, выбранный из группы, состоящей из Е100, D101, N102;

(h) остаток, выбранный из группы, состоящей из S103, Т104, R105;

(i) остаток, выбранный из группы, состоящей из D113, Е115;

(j) остаток, выбранный из группы, состоящей из N121, Е123;

(k) остаток, выбранный из группы, состоящей из Т124 и Е126;

(l) остаток, выбранный из группы, состоящей из Н109, Y111, L116;

(m)остаток, выбранный из группы, состоящей из Q131, S132, Q136;

(n) остаток, выбранный из группы, состоящей из S133, R134, Т137;

(о) остаток, выбранный из группы, состоящей из М140, N141, R143 и N144;

(р) остаток, выбранный из группы, состоящей из S224, Н225 и D226;

(q) остаток, выбранный из группы, состоящей из Т227, Q228 и Q229; и/или

(r) остаток, выбранный из группы, состоящей из W230 и D232, заменен другой аминокислотой по сравнению с полипептидом MICA дикого типа.

Согласно любым вариантам реализации замена R6, N8, Q48, W49, Е51, D52, V53, L54, N56, К57, Т58, R61, R64, K81, D82, Q83, K84, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Н109, Y111, D113, Е115, L116, N121, Е123, Т124, Е126, Q131, S132, S133, R134, Q136, Т137, М140, N141, R143, N144, L178, R179, R180, S194, Е195, N197, S224, Н225, D226, Т227, Q228, Q229, W230 или D232 может быть определена как замена R6A, N8A, W14A, Q48A, W49S, E51S, D52A, V53S, L54A, N56A, K57S, Т58А, R61A, R64A, К81А, D82A, Q83A, K84A, Е85А, Е97А, Н99А, Е100А, D101S, N102A, S103A, T104S, R105A, Н109А, Y111A, D113A, Е115А, L116A, N121A, E123S, Т124А, Е126А, Q131A, S132A, S133A, R134S, Q136S, Т137А, M140S, N141A, R143S, N144A, L178A, R179S, R180A, S224A, H225S, D226A, Т227А, Q228S, Q229A, W230A или D232A, соответственно.

Согласно некоторым вариантам реализации антителам против MICA не свойственно значимо меньшее связывание мутантного полипептида MICA (например, любого из мутантных вариантов 1-61 из таблицы D) или любого содержащего модифицированный остаток полипептида из мутантных вариантов 1-61 из таблицы D по сравнению с полипептидом MICA дикого типа (отличным от мутантного(ых), либо остатка(ов), с которым конкретное антитело против MICA связывается значимо слабее согласно описанию в примере 4).

Получение антител против MICA

Антитела согласно настоящему изобретению могут быть получены с помощью различных методик, известных в данной области техники. Как правило, их получают путем иммунизации не являющегося человеком животного, предпочтительно мыши, иммуногеном, содержащим полипептид MICA, предпочтительно полипептид MICA человека. Указанный полипептид MICA может содержать полноразмерную последовательность полипептида MICA человека или его фрагмент или производное, как правило, иммуногенный фрагмент, т.е. участок полипептида, содержащий эпитоп, экспонируемый на поверхности клеток, экспрессирующих полипептид MICA, предпочтительно - эпитоп, распознаваемый антителом 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4. Такие фрагменты, как правило, содержат по меньшей мере приблизительно 7 последовательных аминокислот последовательности зрелого полипептида, еще более предпочтительно - по меньшей мере приблизительно 10 последовательных аминокислот указанной последовательности. Фрагменты, как правило, получены по существу из внеклеточного домена указанного рецептора. Согласно предпочтительному варианту реализации указанный иммуноген содержит полипептид MICA дикого типа человека в липидной мембране, как правило, на поверхности клетки. Согласно конкретному варианту реализации указанный иммуноген содержит интактные клетки, в частности, интактные клетки человека, необязательно обработанные или лизированные. Согласно другому предпочтительному варианту реализации указанный полипептид представляет собой рекомбинантный полипептид MICA. Согласно конкретному варианту реализации указанный иммуноген содержит интактные опухолевые клетки.

Этап иммунизации не являющегося человеком млекопитающего антигеном может быть осуществлен любым способом, общеизвестным в данной области техники для стимуляции синтеза антител у мышей (см., например, Е. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1988), содержание которого полностью включено в настоящий документ посредством ссылки). Указанный иммуноген суспендируют или растворяют в буфере, необязательно с адъювантом, таким как полный или неполный адыовант Фрейнда. Способы определения количества иммуногена, типов буферов и количеств адъюванта хорошо известны специалистам в данной области техники и никоим образом не ограничивают настоящее изобретение. Указанные параметры могут быть разными для разных иммуногенов, но легко определяются.

Аналогичным образом, локализация и частота иммунизации, подходящие для стимуляции синтеза антител, также хорошо известны в данной области техники. Согласно типовому протоколу иммунизации не являющимся человеком животным инъецируют антиген интраперитонеально на 1 день и повторно приблизительно через неделю. Затем примерно на 20-й день следуют вторичные инъекции антигена, необязательно с адъювантом, таким как неполный адъювант Фрейнда. Вторичные инъекции осуществляют внутривенно, и они могут повторяться на протяжении нескольких последовательных дней. Затем следует бустер-инъекция на 40-й день, внутривенная или интраперитонеальная, как правило, без адъюванта. Указанный протокол приводит к получению В клеток, продуцирующих антиген-специфическое антитело, приблизительно через 40 дней. Могут также применяться другие протоколы при том условии, что они приводят к получению В-клеток, экспрессирующих антитело против антигена, применяемого для иммунизации.

Для получения поликлональных антител получают сыворотку иммунизированного не являющегося человеком животного, и присутствующие в ней антитела выделяют с помощью общеизвестных методик. Сыворотка может быть аффинно очищена с применением любого из иммуногенов, перечисленных выше, связанного с твердой подложкой, для получения антител, вступающих в реакцию с полипептидами MICA.

Согласно альтернативному варианту реализации лимфоциты от неиммунизированного не являющегося человеком млекопитающего выделяют, культивируют in vitro, и затем подвергают воздействию иммуногена в культуре клеток. Затем собирают лимфоциты и проводят этап слияния согласно описанию ниже.

Следующий этап для получения предпочтительных моноклональных антител представляет собой выделение спленоцита из иммунизированного не являющегося человеком млекопитающего и последующее слияние указанного спленоцита с иммортализованной клеткой для получения продуцирующей антитело гибридомы. Выделение спленоцита из не являющегося человеком млекопитающего общеизвестно в данной области техники и, как правило, включает извлечение селезенки анестезированного не являющегося человеком млекопитающего, измельчение на небольшие фрагменты и продавливание спленоцита из капсулы селезенки через нейлоновый клеточный фильтр в подходящий буфер для получения суспензии отдельных клеток. Клетки промывают, центрифугируют и ресуспендируют в буфере, лизирующем любые оставшиеся эритроциты. Указанный раствор повторно центрифугируют и, наконец, оставшиеся лимфоциты в осадке ресуспендируют в свежем буфере.

После выделения и приготовления суспензии отдельных клеток лимфоциты могут быть слиты с клетками иммортализованной линии. Как правило, используют клетки линии миеломы мышей, хотя в данной области техники известны и многие другие иммортализованные клеточные линии, подходящие для получения гибридом. Предпочтительные линии клеток миеломы мышей включают, не ограничиваясь перечисленными, полученные из опухолей мыши МОРС-21 и МРС-11, доступные в Salk Institute Cell Distribution Center, Сан-Диего, США, X63 Ag8653, и клетки SP-2, доступные в банке American Type Culture Collection, Роквилл, Мэриленд, США. Слияние проводят с применением полиэтиленгликоля и т.п.Полученные гибридомы затем культивируют на селективных средах, содержащих одно или несколько веществ, которые подавляют рост или жизнеспособность неслитых исходных клеток миеломы. Например, если в исходных клетках миеломы отсутствует фермент гипоксантингуанинфосфорибозилтрансфераза (ГГФТ, HGPRT или HPRT), культуральная среда для гибридом, как правило, включает гипоксантин, аминоптерин и тимидин (среда HAT) - вещества, предотвращающие рост HGPRT-дефицитных клеток.

Гибридомы, как правило, культивируют на фидерном слое макрофагов. Указанные макрофаги получают предпочтительно от животных из одного помета не являющегося человеком млекопитающего, которое используют для выделения спленоцитов, и, как правило, их примируют неполным адъювантом Фрейнда или т.п. за несколько дней до высеивания гибридом. Способы слияния описаны в пособии: Goding, «Monoclonal Antibodies: Principles and Practice» («Моноклональные антитела: теория и практика»), стр. 59-103 (Academic Press, 1986), содержание которых включено в настоящий документ посредством ссылок.

Клетки оставляют для роста на селективных средах на протяжении периода времени, достаточного для формирования колоний и синтеза антител. Обычно указанный период составляет от приблизительно 7 до приблизительно 14 дней.

Затем проводят анализ синтеза в колониях гибридом антител, специфически связывающих полипептидные продукты гена MICA, необязательно - эпитоп, специфически распознаваемый антителами 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4. Указанный анализ, как правило, представляет собой колориметрический ИФА-анализ ELISA, хотя может применяться любой анализ, который может быть модифицирован для приложения к лункам, в которых культивируют гибридомы. Другие анализы включают радиоиммунологический анализ или сортировку клеток с активацией флуоресценции. Лунки, позитивные по синтезу нужного антитела, исследуют для определения присутствия одной или нескольких отчетливых колоний. В том случае, если присутствует более чем одна колония, может быть проведено повторное клонирование и культивирование клеток, для подтверждения того, что колония, синтезирующая нужное антитело, происходит из единственной клетки.

Гибридомы, для которых подтвержден синтез моноклонального антитела согласно настоящему изобретению, можно культивировать в больших количествах в подходящей среде, такой как DMEM или RPMI-1640. Как вариант, клетки гибридомы можно культивировать в виде асцитных опухолей in vivo с применением животных.

После периода роста, достаточного для получения требуемого моноклонального антитела, ростовую среду, содержащую моноклональное антитело (или асцитную жидкость) отделяют от клеток и присутствующее в ней моноклональное антитело очищают. Очищение, как правило, достигается путем гель-электрофореза, диализа, хроматографии с применением сефарозы с белком А или белком G или антимышиного Ig, связанного с твердой подложкой, такой как агарозные или сефарозные бусы (все описания можно найти, например, в пособии Antibody Purification Handbook («Справочник по очищению антител»), Biosciences, публикация №18-1037-46, изд. АС, содержание которого включено в настоящий документ посредством ссылки). Связанное антитело, как правило, элюируют из колонок с белком А/белком G с применением буферов с низкими значениями рН (глициновый или ацетатный буферы с рН 3,0 или менее) с немедленной нейтрализацией содержащих антитело фракций. Указанные фракции по мере необходимости соединяют, диализируют и концентрируют.

Для позитивных лунок, содержащих единственную различимую колонию, как правило, проводят повторное клонирование и повторный анализ, чтобы подтвердить обнаружение и синтез только одного моноклонального антитела.

Антитела могут также быть получены отбором из комбинаторных библиотек иммуноглобулинов, согласно описанию, например, в источнике Ward et al. Nature, 341 (1989) p. 544, содержание которого полностью включено в настоящий документ посредством ссылки.

Идентифицирование одного или более антител, связывающихся с MICA, в частности, по существу с тем же эпитопом, что и моноклональные антитела 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14 В4, может быть легко осуществлено с применением любого из множества анализов с применением иммунологического скрининга, в которых оценивается конкуренция антител. Многие подобные анализы входят в рутинную практику и хорошо известны в данной области техники (см., например, патент США №5660827, выданный 26 августа 1997 г., явным образом включенный в настоящий документ посредством ссылки). Следует иметь в виду, что фактически определение эпитопа, с которым связывается антитело, описанное в настоящем документе, никоим образом не является необходимым для идентифицирования антитела, которое связывается с тем же или по существу тем же эпитопом, что и моноклональное антитело, описанное в настоящем документе.

Например, если тестируемые антитела для исследования получены из разных животных источников или даже принадлежат к разным Ig-изотипам, может быть проведен простой конкурентный анализ, в котором контрольные (6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4, например) и тестируемые антитела смешивают (или предварительно адсорбируют) и наносят на образец, содержащий полипептиды MICA. Протоколы на основе вестерн-блоттинга и анализ BIACORE подходят для применения в таких исследованиях конкурентного связывания.

Согласно определенным вариантам реализации контрольные антитела (6Е4, 20С6 или 16А8, например) предварительно смешивают с варьирующими количествами тестируемых антител (например, приблизительно 1:10 или приблизительно 1:100) в период времени до нанесения на образец антигена MICA. Согласно другим вариантам реализации контрольные и варьирующие количества тестируемых антител могут просто быть смешаны при воздействии образцом антигена MICA. При условии, что возможно отличить связанные антитела от свободных (например, с применением методик разделения или отмывки для элиминирования несвязанных антител), и 6Е4, 20С6 или 16А8 от тестируемых антител (например, с применением видоспецифических или изотип-специфических вторичных антител или специфически меченых 6Е4, 20С6 или 16А8 с детектируемой меткой), можно определить, уменьшают ли тестируемые антитела связывание 6Е4, 20С6 или 16А8 с указанными антигенами, что указывает на распознавание тестируемым антителом по существу того же эпитопа, что и 6Е4, 20С6 или 16А8. Связывание (меченых) контрольных антител в отсутствие полностью нерелевантного антитела может служить в качестве контрольного верхнего значения. Контрольное минимальное значение может быть получено путем инкубирования меченых (6Е4, 20С6 или 16А8) антител с немечеными антителами точно такого же типа (6Е4, 20С6 или 16А8), при этом будет наблюдаться конкуренция и уменьшаться связывание меченых антител. В аналитическом исследовании значимое снижение реакционной способности меченого антитела в присутствии тестируемого антитела указывает на наличие тестируемого антитела, которое распознает по существу тот же эпитоп, т.е. «перекрестно реагирует» или конкурирует с указанным меченым (6Е4, 20С6 или 16А8) антителом. Любое тестируемое антитело, которое снижает связывание 6Е4, 20С6 или 16А8 с антигенами MICA по меньшей мере приблизительно на 50%, например, по меньшей мере приблизительно на 60%, или более предпочтительно по меньшей мере приблизительно на 80% или 90% (например, приблизительно на 65-100%), при любом соотношении 6Е4, 20С6 или 16А8 и тестируемого антитела в диапазоне от приблизительно 1:10 до приблизительно 1:100, считают антителом, которое связывается по существу с тем же эпитопом или детерминантой, что и 6Е4, 20С6 или 16А8. Такое тестируемое антитело предпочтительно уменьшает связывание 6Е4, 20С6 или 16А8 с антигеном MICA по меньшей мере приблизительно на 90% (например, приблизительно на 95%).

Конкуренция может также быть оценена при тестировании с применением, например, проточной цитометрии. В таком тесте клетки, несущие определенный полипептид MICA, могут быть инкубированы сначала с 6Е4, 20С6 или 16А8, например, и затем с тестируемым антителом, меченым флуорохромом или биотином. Говорят, что антитело конкурирует с 6Е4, 20С6 или 16А8, если связывание, достигаемое при предварительном инкубировании с насыщающим количеством 6Е4, 20С6 или 16А8, составляет приблизительно 80%, предпочтительно приблизительно 50%, приблизительно 40% или менее (например, приблизительно 30%, 20% или 10%) от связывания (согласно оценке флуоресценции) указанным антителом без предварительного инкубирования с 6Е4, 20С6 или 16А8. Как вариант, говорят, что антитело конкурирует с 6Е4, 20С6 или 16А8, если связывание меченым 6Е4, 20С6 или 16А8 антителом (флуорохромом или биотином) на клетках, преинкубированных с насыщающим количеством тестируемого антитела, составляет приблизительно 80%, предпочтительно приблизительно 50%, приблизительно 40%, или менее (например, приблизительно 30%, 20% или 10%) от связывания, достигаемого без преинкубирования с тестируемым антителом.

Также может использоваться простой конкурентный анализ, в котором тестируемое антитело предварительно адсорбируют и наносят в насыщающей концентрации на поверхность, где иммобилизован антиген MICA. Поверхность для простого конкурентного анализа предпочтительно представляет собой чип BIACORE (или другую среду, подходящую для анализа методом поверхностного плазмонного резонанса). Затем контрольное антитело (например, 6Е4, 20С6 или 16А8) приводят в контакт с указанной поверхностью в MICA-насыщающей концентрации, и измеряют связывание MICA и поверхностное связывание для контрольного антитела. Указанное связывание контрольного антитела сравнивают со связыванием контрольного антитела с поверхностью, содержащей MICA, в отсутствие тестируемого антитела. В экспериментальном анализе значимое уменьшение связывания с содержащей MICA поверхностью контрольным антителом в присутствии тестируемого антитела указывает на то, что указанное тестируемое антитело распознает по существу тот же эпитоп, что и контрольное антитело; таким образом, тестируемое антитело «перекрестно реагирует» с контрольным антителом. Любое тестируемое антитело, которое снижает связывание контрольного (такие как 6Е4, 20С6 или 16А8) антитела антигеном MICA по меньшей мере приблизительно на 30% или более, предпочтительно приблизительно на 40%, может считаться антителом, которое связывается по существу с тем же эпитопом или детерминантой, что и контрольное (например, 6Е4, 20С6 или 16А8). Предпочтительно, такое тестируемое антитело уменьшает связывание контрольного антитела (например, 6Е4, 20С6 или 16А8) с антигеном MICA по меньшей мере приблизительно на 50% (например, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 70%, или более). Следует иметь в виду, что порядок использования контрольного и тестируемого антител может быть изменен: то есть сначала контрольное антитело может быть связано с поверхностью, а тестируемое антитело затем приводят в контакт с поверхностью в ходе конкурентного анализа. Предпочтительно, антитело, обладающее более высоким сродством к антигену MICA, сначала связывается с поверхностью, так как, предположительно, уменьшение связывания, наблюдаемое для второго антитела (исходя из того, что указанные антитела перекрестно реагируют) будет большим. Также примеры таких анализов предложены, например, в Saunal (1995) J. Immunol. Methods 183:33-41, содержание которого включено в настоящий документ посредством ссылки.

Предпочтительно, моноклональные антитела, которые распознают эпитоп MICA, будут вступать в реакцию с эпитопом, который присутствует на существенном проценте или даже на всех релевантных аллелях MICA. Согласно одному аспекту антитела против MICA согласно настоящему изобретению связывают MICA*004 и *008, необязательно также MICA*001, *007 и/или *0019.

Согласно предпочтительным вариантам реализации указанные антитела связываются с MICA-экспрессирующими клетками, полученными от индивидуума или индивидуумов с заболеванием, характеризующимся экспрессией положительных по MICA клеток, т.е. индивидуума, представляющего собой кандидата на лечение одним из описанных здесь способов с применением антитела против MICA согласно настоящему изобретению. Соответственно, после получения антитела, специфически распознающего MICA на клетках, оно может быть протестировано на способность связываться с положительными по MICA клетками (например, раковыми клетками). В частности, перед лечением пациента одним из описанных антител целесообразно провести тестирование способности указанного антитела к связыванию злокачественных клеток, полученных от указанного пациента, например, в образце крови или тканевой биоптате, с целью максимизации вероятности того, что указанная терапия будет эффективной для пациента.

Согласно одному из вариантов реализации антитела согласно настоящему изобретению проверяют с помощью иммунологического анализа для тестирования их способности к связыванию с MICA-экспрессирующими клетками, например, злокачественными клетками. Например, проводят биопсию опухоли и собирают опухолевые клетки. Затем оценивают способность определенного антитела связываться с клетками с применением стандартных способов, хорошо известных специалистам в данной области техники. Антитела, которые, как обнаружено, связываются с существенной долей (например, 20%, 30%, 40%, 50%>, 60%, 70%, 80% или более) клеток, которые, как известно, экспрессируют MICA, например, опухолевых клеток, полученных от значимого процента индивидуумов или пациентов (например, 5%, 10%, 20%, 30%, 40%, 50% или более), подходят для применения согласно настоящему изобретению, как для целей диагностики, для определения присутствия или уровня злокачественных клеток у пациента, так и для применения в описанных здесь способах терапии, например, для увеличения или уменьшения количества или активности злокачественных клеток. Для оценки связывания указанных антител с клетками антитела могут быть прямо или непрямо помечены. При непрямом мечении, как правило, добавляют вторичное меченое антитело.

Определение того, связывается ли антитело внутри области эпитоп, может быть осуществлено с применением способов, известных специалисту в данной области техники. Одним из примеров таких способов картирования/характеризации является возможность определения «отпечатков» эпитопа с применением химической модификация экспонированных аминов/карбоксилов в области эпитопа белка MICA, соответствующего антителу против MICA. Одним из специфических примеров использования такой техники «отпечатков» является применение HXMS (масс-спектроскопии с детектируемым водородно-дейтериевым обменом), когда происходит водородно-дейтериевый обмен протонов амидной группы белков рецептора и лиганда, связывание и обратный обмен, при этом амидные группы остова, вовлеченные в связывание белка, защищены от обратного обмена и, таким образом, остаются дейтерированными. Релевантные области могут быть идентифицированы на данном этапе с применением пептического протеолиза, быстрого разделения на микроколонке методом высокоэффективной жидкостной хроматографии и/или ионизации электроспреем с масс-спектроскопией. См., например, Ehring Н, Analytical Biochemistry, Vol. 267 (2) pp. 252-259 (1999) Engen, J.R. and Smith, D.L. (2001) Anal. Chem. 73, 256A-265A. Другим примером подходящей техники идентифицирования эпитопов является картирование эпитопов с применением ядерного магнитного резонанса (ЯМР), при котором, как правило, сравнивают положение сигналов в двумерных ЯМР-спектрах свободного антигена и антигена в комплексе с антигенсвязывающим пептидом, таким как антитело. Антиген, как правило, селективно метят изотопами 15N таким образом, что только сигналы, соответствующие указанному антигену, а не сигналы антигенсвязывающего пептида, видны на ЯМР-спектре. Положение сигналов антигена, порождаемых аминокислотами, вовлеченными во взаимодействие с антигенсвязывающим пептидом, как правило, смещается в спектре комплекса по сравнению со спектром свободного антигена; таким образом могут быть идентифицированы аминокислоты, вовлеченные в связывание. См., например, Ernst Schering Res Found Workshop.2004; (44): 149-67; Huang et al., Journal of Molecular Biology, Vol. 281 (1) pp. 61-67 (1998); и Saito and Patterson, Methods. 1996 Jun; 9 (3): 516-24.

Картирование/характеризация эпитопов также могут быть выполнены с применением масс-спектроскопических способов. См., например, Downard, J Mass Spectrom. 2000 Apr; 35 (4):493-503 и Kiselar and Downard, Anal Chem. 1999 May 1; 71 (9):1792-1801. Техники протеазного расщепления также могут подходить в контексте картирования и идентифицирования эпитопов. Соответствующие антигенным детерминантам области/последовательности могут быть определены с помощью протеазного расщепления, например, с применением трипсина в пропорции к MICA, составляющей приблизительно 1:50, или расщепления в течение ночи при рН 7-8, с последующим масс-спектроскопическим (МС) анализом для идентифицирования пептидов. Пептиды, защищенные от расщепления трипсином анти-MICA связующим агентом, могут в результате быть идентифицированы путем сравнения образцов, подвергнутых расщеплению трипсином, и образцов, инкубированных с антителом и затем подвергнутых расщеплению, например, трипсином (таким образом делая доступной область распознавания связующим агентом). Другие ферменты, такие как химотрипсин, пепсин и т.д., могут применяться в аналогичных способах характеризации эпитопов дополнительно или альтернативно. Кроме того, ферментативное расщепление может обеспечить быстрый способ анализа того, расположена ли последовательность потенциальной антигенной детерминанты в составе области полипептида MICA, не экспонируемой на поверхности и, соответственно, скорее всего не релевантной в смысле иммуногенности/антигенности.

Сайт-специфический мутагенез представляет собой еще одну методику, подходящую для обнаружения связывающего эпитопа. Например, при «аланин-сканирующем» мутагенезе каждый остаток в составе белкового сегмента заменяют остатком аланина и оценивают последствия для сродства к связыванию. Если мутация приводит к значимому снижению сродства к связыванию, скорее всего, остаток вовлечен в связывание. Могут применяться моноклональные антитела, специфические в отношении структурных эпитопов (т.е. антитела, которые не связывают несвернутый белок), для подтверждения того, что указанная замена на аланин не влияет на свертывание указанного белка в целом. См., например, Clackson and Wells, Science 1995; 267:383-386; и Wells, Proc Natl Acad Sci USA 1996; 93:1-6.

Для получения «отпечатков» эпитопов также может применяться электронная микроскопия. Например, Wang et al., Nature 1992; 355:275-278 скоординированно использовали криоэлектронную микроскопию, трехмерную реконструкцию изображений и рентгенокристаллографию для определения физических областей узнавания Fab-фрагмента на поверхности капсида нативного вируса мозаики коровьего гороха.

Другие формы анализа «без меток» для определения эпитопов включают поверхностный плазмонный резонанс (ППР, BIACORE) и рефлектометрическую интерференционную спектроскопию (RifS). См., например, Fagerstam et al., Journal Of Molecular Recognition 1990; 3:208-14; Nice et al., J. Chromatogr. 1993; 646:159-168; Leipert et al., Angew. Chem. Int. Ed. 1998; 37:3308-3311; Kroger et al., Biosensors и Bioelectronics 2002; 17:937-944.

Следует также отметить, что антитело, связывающее тот же или по существу тот же эпитоп, что и антитело согласно настоящему изобретению, может быть идентифицировано с помощью одного или нескольких типовых конкурентных анализов, описанных в настоящем документе.

При иммунизации и синтезе антител у позвоночного животного или в клетке позвоночного животного для выделения антител могут быть осуществлены конкретные этапы отбора согласно заявленным. В этом смысле согласно конкретному варианту реализации настоящее изобретение также относится к способам получения таких антител, включающим: (а) иммунизацию не являющегося человеком млекопитающего иммуногеном, содержащим полипептид MICA; и (b) получение антител от указанного иммунизированного животного; и (с) отбор антител этапа (b), способных связывать MICA.

Как правило, антитело против MICA, предлагаемое в настоящем изобретении, обладает сродством к полипептиду MICA в диапазоне от приблизительно 104 до приблизительно 1011 М-1 (например, от приблизительно 108 до приблизительно 1010 М-1). Например, согласно конкретному аспекту в настоящем изобретении предложено антитело против MICA, среднее значение константы диссоциации (KD) которого составляет менее чем 1×10-9 М в отношении MICA, согласно оценке, например, при скрининге с применением поверхностного плазмонного резонанса ППР) (например, при помощи аналитического устройства для ППР BIAcore™). Согласно более конкретному иллюстративному аспекту в настоящем изобретении предложены антитела против MICA, имеющие KD, составляющую от приблизительно 1×10-8 М до приблизительно 1×10-10 М, или от приблизительно 1×10-9 М до приблизительно 1×10-11 М, в отношении MICA.

Антитела могут характеризоваться, например, средним порядком значений значением KD не более чем приблизительно (т.е. лучшее относительное сродство) 100, 60, 10, 5, или 1 нМ, предпочтительно в субнаномолярном диапазоне или, необязательно, не более чем приблизительно 500, 200, 100 или 10 пМ. KD может быть определена, например, путем иммобилизации полученных рекомбинантным способом белков MICA человека на поверхности чипа, с последующим нанесением антитела для тестирования в растворе. Согласно одному из вариантов реализации указанный способ также включает этап (d) выбора антител из (b), способных конкурировать за связывание MICA с антителом 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4.

Согласно одному аспекту любого из вариантов реализации указанные антитела полученные в соответствии с представленными способами представляют собой моноклональные антитела. Согласно другому аспекту не являющееся человеком животное, которое используют для получения антител в соответствии со способами согласно настоящему изобретению, представляет собой млекопитающее, например, грызуна, крупный рогатый скот, свинью, домашнюю или промысловую птицу, лошадь, кролика, козу или овцу. Антитела согласно настоящему изобретению включают 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4. Кроме того, антитела согласно настоящему изобретению могут необязательно быть определены как антитела, не являющиеся любыми из антител BAMO1 или ВАМО3, описанных Salih et al. (2003) (Blood 102(4):1389-1396), антител 2С10, 3Н5, 6D4 или 6G6, описанных Groh et al. (1996) Proc. Natl. Acad. Sci USA 93:12445-12450, Groh et al. (1998) Science 279:1737-1740 или WO 2008/131406, содержание которых включено в настоящий документ посредством ссылок, или их производными, например, включающими области CDR или антигенсвязывающую область, полностью или частично.

В соответствии с альтернативным вариантом реализации ДНК, кодирующая антитело, связывающее эпитоп, присутствующий на полипептидах MICA, выделяют из гибридомы согласно настоящему изобретению и помещают в подходящий экспрессионный вектор для трансфекции подходящего хозяина. Затем указанный хозяин используется для рекомбинантного получения указанного антитела или его вариантов, таких как гуманизированный вариант указанного моноклонального антитела, активные фрагменты указанного антитела, гибридные антитела, содержащие участок распознавания антигена указанного антитела, или варианты, содержащие детектируемый фрагмент.

ДНК кодирующая моноклональные антитела согласно настоящему изобретению, например, антитело 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14 В4, может быть легко выделена и секвенирована с применением обычных процедур (например, с применением олигонуклеотидных зондов, способных специфически связываться с генами, кодирующими тяжелые и легкие цепи антител мыши). После выделения указанная ДНК может быть введена в экспрессионные векторы, которыми затем трансфицируют хозяйские клетки, такие как клетки Е. coli, клетки COS обезьян, клетки яичника китайского хомячка (СНО), или клетки миеломы, в иных случаях не продуцирующие иммуноглобулин, для обеспечения синтеза моноклональных антител в указанных рекомбинантных хозяйских клетках. Согласно описанию в тексте настоящего документа такие последовательности ДНК могут быть модифицированы для любой из множества целей, например, для гуманизации антител, получения их фрагментов или производных, или для модификации последовательности указанного антитела, например, антигенсвязывающего сайта, для оптимизации специфичности связывания указанного антитела. Согласно одному из вариантов реализации настоящее изобретение включает выделение последовательности нуклеиновой кислоты, кодирующей легкую цепь и/или тяжелую цепь антитела (например, 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14 В4), а также рекомбинантную клетку-хозяина, содержащую (например, в геноме) такую нуклеиновую кислоту.

Рекомбинантная экспрессия ДНК, кодирующей антитело, в бактериях хорошо известна в данной области техники (см., например, Skerra et al., Curr. Opinion in Immunol., 5, pp. 256 (1993); и Pluckthun, Immunol. 130, p. 151 (1992).

Оценка активности

После получения антигенсвязывающего соединения обычно проводят оценку его способности блокировать взаимодействие NKG2D и MICA (например, sMICA или мембраносвязанного MICA), блокировать выделение MICA из клетки, подавлять индуцированное sMICA понижающее модулирование NKG2D, приводить к гибели MICA-экспрессирующей клетки, индуцировать АЗКЦ или КЗЦ в отношении MICA-экспрессирующих целевых клеток, и/или подавлять пролиферацию, и/или вызывать элиминацию MICA-экспрессирующих целевых клеток.

Оценка способности антигенсвязывающего соединения уменьшать связывание или блокировать взаимодействие между MICA и NKG2D может осуществляться на любой подходящей стадии указанного способа, например, согласно описанию в примерах, приведенных в настоящем документе. Например, опухолевые клетки экспрессирующие MICA на поверхности могут быть приведены в контакт с клетками (например, эффекторными клетками), экспрессирующими NKG2D на поверхности, с добавлением или без добавления кандидатного антитела против MICA. Может быть проведена оценка связывания MICA-экспрессирующих клеток с NKG2D-экспрессирующими клетками, и отобрано антитело, которое не уменьшает связывание. Другая возможность включает приведение в контакт выделенного полипептида MICA с выделенным полипептидом NKG2D, или клеткой, экспрессирующей полипептид NKG2D на поверхности, и оценку связывания MICA с полипептидами NKG2D или с клетками, экспрессирующими NKG2D. Другая возможность включает приведение в контакт выделенного полипептида NKG2D с клеткой, экспрессирующей полипептид MICA на поверхности, и оценку связывания с полипептидом MICA или с клеткой, экспрессирующей MICA.

Например, для определения того, блокирует ли агент взаимодействия MICA с NKG2D, проводят следующий тест: Клетки линии C1R или RMA, трансфицированные MICA, инкубируют с растворимым гибридным белком NKG2D-Fc, в присутствии или в отсутствие возрастающих концентраций тестируемого моноклонального антитела против MICA. Клетки промывают, а затем инкубируют с вторичным антителом, которое распознает Fc-часть гибридного белка NKG2D-Fc, повторно промывают и анализируют на проточном цитометре (FACScalibur, Beckton Dickinson) с применением стандартных способов. В отсутствие моноклональных антител против MICA указанный белок NKG2D-Fc хорошо связывается с клетками C1R или RMA. В присутствии моноклонального антитела против MICA, которое блокирует связывание MICA с NKG2D, происходит уменьшение связывания NKG2D-Fc с клетками.

Предпочтительно, оценка способности антигенсвязывающего соединения уменьшать связывание или блокировать взаимодействие между MICA и NKG2D может быть также проведена путем оценки влияния указанного антитела против MICA на функцию NKG2D-экспрессирующих клеток (например, НК-клетки или Т-клетки). Предпочтительно используют НК-клетки или Т-клетки, которые экспрессируют NKG2D, но не CD16, чтобы избежать влияния каких-либо опосредованных CD16 эффектов АЗКЦ. В тех случаях, когда антитело против MICA снижает или блокирует взаимодействие MICA-NKG2D, оно, предположительно, будет сдерживать опосредованную NKG2D активацию НК-клеток или Т-клеток. Антитело, не уменьшающее связывание или не блокирующее взаимодействие между MICA и NKG2D, таким образом, по существу не уменьшает или не блокирует NKG2D-опосредованную активацию НК-клеток или Т-клеток. Это можно определить с помощью типового анализа цитотоксичности, примеры которого описаны в настоящем документе. Для оценки активности NKG2D может применяться любое количество анализов на основе клеток, включая анализ активности на основе генной экспрессии, анализы на основе цитотоксичности и пролиферативный анализ. Согласно одному аспекту для in vitro анализов используют НК-клетки или Т-клетки пациентов-людей, или, например, Т-клеточные линии, трансфицированные кодирующим NKG2D трансгеном, при условии, что экспрессия указанного рецептора изменяет активность клеток поддающимся обнаружению образом, например, делает их активируемыми лигандом NKG2D. Любое подходящее физиологическое изменение, отражающее активность NKG2D, может быть использовано для оценки полезности тестируемого соединения или антитела. Например, могут оцениваться разнообразные эффекты, такие как изменение генной экспрессии, синтез цитокинов, рост клеток, пролиферация клеток, рН, внутриклеточные вторичные посредники, например, Са2+, IP3, цГМФ или цАМФ, или активность, такая как цитотоксическая активность или способность активировать другие Т-клетки. Согласно одному из вариантов реализации активность рецептора оценивают путем обнаружения экспрессии NKG2D-чувствительных генов, например, CD25, ИФН-гамма или ФНО-альфа (см., например, Groh et al. (2003) PNAS 100: 9452-9457; André et al. (2004) Eur. J. Immunol 34: 1-11). Согласно одному из вариантов реализации активность NKG2D оценивают путем инкубирования NKG2D+Т- клеток или НК-клеток в присутствии MICA-экспрессирующих клеток и антитела против MICA, и оценки способности соединения или тестируемого антитела подавлять высвобождение ФНО-альфа или ИФН-гамма Т-клетками или НК-клетками.

Типовые анализы на цитотоксичность описаны также в примерах в настоящем документе, где оценивают NKG2D-опосредованный киллинг целевых клеток. В настоящем изобретении способность антител против MICA уменьшать или подавлять клетки NKG2D+CD16- NK92 используют для оценки опосредованного НК-клетками киллинга BaF/3, трансфицированных MICA*019, посредством измерения высвобождения 51Cr из целевых клеток. Анализ цитотоксичности in vitro проводят с помощью стандартных методов, хорошо известных в данной области техники, согласно описанию, например, в источнике: Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993). MICA-экспрессирующие целевые клетки метят 51Cr до добавления НК-клеток, а затем оценивают киллинг, исходя из того, что он пропорционален высвобождению 51Сr из указанных клеток в среду в результате киллинга. Добавление агента, который снижает связывание или блокирует взаимодействие между MICA и NKG2D, приводит к предотвращению инициации и передачи активирующих сигналов через NKG2D. Соответственно, добавление таких агентов приводит к уменьшению НК-опосредованного киллинга целевых клеток.

Антигенсвязывающее соединение, которое не уменьшает или не блокирует (например, снижение отсутствует или составляет менее чем 5%, 10%, 20% или 30%) NKG2D-активацию клеток (например, синтез цитокинов, рост клеток, пролиферацию клеток, рН, внутриклеточные вторичные посредники, НК-опосредованный киллинг MICA-экспрессирующих клеток), называют «неблокирующим» моноклональным антителом. Антигенсвязывающее соединение, которое снижает или блокирует обусловленную NKG2D активацию клеток, называют «блокирующим» моноклональным антителом.

Оценка способности антигенсвязывающего соединения блокировать выделение MICA из MICA-экспрессирующей клетки может быть проведена на любой подходящей стадии способа, например, согласно приведенным в настоящем документе примерам. Согласно одному примеру получают образец клеток и обнаруживают растворимый внеклеточный MICA с применением ИФА ELISA. Согласно одному примеру антигенсвязывающее соединение согласно настоящему изобретению вводят млекопитающему и оценивают присутствие или отсутствие, или измеряют уровни циркулирующего sMICA. Примеры in vitro анализов на обнаружение описаны у Nolting et al. (2010) Virology 406(1):12-20. Вкратце, может быть использован коммерчески доступный набор для ИФА-анализа MICA Elisa Kit (Bamomab, Мюнхен, Германия). Планшеты покрывают в течение ночи захватывающим моноклональным антителом ВАМО-1 против MICA в концентрации 2 мкг/мл в ФСБ, затем блокируют добавлением 100 мкл 15% БСА в течение 2 ч при 37°С, и промывают.Добавляют стандарты и образцы, и планшеты инкубируют в течение 2 ч при 37°С. Планшеты промывают и добавляют моноклональное антитело для детекции ВАМО-3 в концентрации 5 мкг/мл в 7,5% БСА-ФСБ в течение 2 ч при 37°С. Затем планшеты промывают и добавляют антимышиный IgG2a-HRP (1:8000 в 7,5% БСА-ФСБ) в течение 1 ч при 37°С. Затем планшеты промывают и проявляют с применением системы с субстратом пероксидазы на основе тетраметилбензидина (KPL, Гейтерсберг, Мэриленд). Поглощение измеряют на 450 нм.

Оценка способности антигенсвязывающего соединения индуцировать АЗКЦ, КЗЦ или т.д. (например, путем доставки токсичного агента), приводящие к элиминированию или ингибированию активности MICA-экспрессирующих целевых клеток, может проводиться на любой подходящей стадии указанного способа, например, согласно приведенным в настоящем документе примерам. Проведение указанной оценки может быть целесообразным на одном или нескольких этапах идентификации, получения и/или выработки антитела (или другого соединения), предназначающегося для терапевтического применения. Например, активность может оцениваться в контексте способа скрининга для идентификации кандидатных антигенсвязывающих соединений, или в контексте способа отбора антигенсвязывающего соединения и придания ему свойств, позволяющих применение у человека (например, получения гибридных или гуманизированных антител в случае антитела), в тех случаях, когда получают клетку, экспрессирующую указанное антигенсвязывающее соединение (например, клетку-хозяина, экспрессирующую рекомбинантное антигенсвязывающее соединение), и оценивают ее способность продуцировать функциональные антитела (или другие соединения), и/или в случае получения определенного количества антигенсвязывающего соединения, активность которого необходимо оценить (например, для тестирования партий или серий продукта). Обычно выявляют специфическое связывание антигенсвязывающего соединения с полипептидом MICA. Указанный этап может включать тестирование множества (например, очень большого количества, с применением способов высокопроизводительного скрининга, или меньшего количества) антигенсвязывающих соединений.

Тестирование на КЗЦ и АЗКЦ может проводиться с помощью различных анализов, описанные в экспериментальных примерах в настоящем документе. Тестирование на АЗКЦ, как правило, включает оценку клеточноопосредованной цитотоксичности, при которой MICA-экспрессирующая целевая клетка (например, раковая или другая MICA-экспрессирующая клетка) со связанным антителом против MICA распознается эффекторной клеткой (например, лейкоцитом, несущим Fc-рецепторы), без участия комплемента. Клетка, которая не экспрессирует антиген MICA, может необязательно применяться в качестве контроля. Активацию цитотоксичности НК-клеток оценивают путем измерения повышения синтеза цитокинов (например, синтеза ИФН-γ) или маркеров цитотоксичности (например, мобилизации CD107). Антитело согласно настоящему изобретению предпочтительно будет индуцировать повышение синтеза цитокинов, экспрессии маркеров цитотоксичности или лизиса целевых клеток по меньшей мере на 20%, 50%, 80%, 100%, 200%) или 500% в присутствии целевых (MICA-экспрессирующих) клеток относительно контрольного антитела (например, антитела, не связывающегося с MICA, MICA-антитела с константными областями мыши). В другом примере лизис целевых клеток обнаруживают, например, в анализе с высвобождением хрома; антитело согласно настоящему изобретению предпочтительно будет индуцировать лизис по меньшей мере 10%, 20%, 30%, 40% или 50% целевых клеток.

Последовательности CDR антител

Антитело 6Е4

Последовательность аминокислот вариабельной области тяжелой цепи антитела 6Е4 представлена последовательностью SEQ ID NO: 7, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 8. Аминокислотные последовательности вариабельной области тяжелой и легкой цепей антитела 6Е4, слитые с константной областью цепи человека (тяжелой и легкой, соответственно) представлены последовательностями SEQ ID NO: 9 и 10, соответственно. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 6Е4; указанное антитело необязательно содержит антигенсвязывающую область антитела 6Е4. Согласно любому из представленных в настоящем документе вариантов реализации антитело 6Е4 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 6Е4. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 6Е4. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 6Е4. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 6Е4 или одну, две или три CDR вариабельной области легкой цепи 6Е4. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре, пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 6Е4, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SYYAMS, последовательность аминокислот GFTFSY или последовательность аминокислот GFTFSYYAMS, представленные в последовательностях SEQ ID NO: 11-13, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот TISRGGNYIYYTDSVKG или последовательность аминокислот TISRGGNYIY, представленные в последовательностях SEQ ID NO: 14-15, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот ISDYDGAWLAY, представленную в последовательности SEQ ID NO: 16, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RSSQSIIHTNGNTYLE, представленную в последовательности SEQ ID NO: 17, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот KISNRFS, представленную в последовательности SEQ ID NO: 18, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот FQGSHVPWT, представленную в последовательности SEQ ID NO: 19, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 7, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 8, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) вариабельную область тяжелой цепи последовательности SEQ ID NO: 7, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; и вариабельную область легкой цепи последовательности SEQ ID NO: 8, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2) согласно представленным в SEQ ID NO: 11-16, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 17, 18 и 19, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 11-16, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 17, 18 и 19, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(g) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 7, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(h) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%), 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 8, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-h).

Антитело 20С6

Последовательность аминокислот вариабельной области тяжелой цепи антитела 20С6 представлена в последовательности SEQ ID NO: 20, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 21. Аминокислотные последовательности вариабельных областей тяжелой и легкой цепей антитела 20С6, слитых с константной областью тяжелой цепи (последовательности тяжелой и легкой цепей, соответственно, представлены последовательностями SEQ ID NO: 22 и 23, соответственно. Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональное антитело 20С6; указанное антитело необязательно содержит антигенсвязывающую область антитела 20С6. Согласно любому из представленных в настоящем документе вариантов реализации антитело 20С6 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 20С6. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 20С6. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 20С6. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 20С6 или одну, две или три CDR вариабельной области легкой цепи 20С6. Необязательно любая одна или более из указанных CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 16А8 слиты с константной областью иммуноглобулина IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот TSGMGVG, последовательность аминокислот GFSLSTSG или последовательность аминокислот GFSLSTSGMGVG, представленные в последовательностях SEQ ID NO: 24-26, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот HIWWDDDKYYNPSLK или последовательность аминокислот HIWWDDDK, представленные в последовательностях SEQ ID NO: 27-28, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот RTQGYFDY, представленную в последовательности SEQ ID NO: 29, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RASQSISDYLH, представленную в последовательности SEQ ID NO: 30, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот YASQSIS, представленную в последовательности SEQ ID NO: 31, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; и/или область LCDR3, содержащую последовательность аминокислот QNGHSFPWT, представленную в последовательности SEQ ID NO: 32, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой, или где указанная последовательность может содержать вставку из одной или большего числа аминокислот.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 20, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 21, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(с) вариабельную область тяжелой цепи последовательности SEQ ID NO: 20, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и вариабельную область легкой цепи последовательности SEQ ID NO: 21, при этом одна или несколько аминокислот могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 24-29, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 30, 31 и 32, соответственно, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 24-29, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 30, 31 и 32, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(g) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 20, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(h) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 21, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90%, или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-h).

Антитело 16А8

Последовательность аминокислот вариабельной области тяжелой цепи антитела 16А8 представлена в последовательности SEQ ID NO: 33, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 34. Аминокислотные последовательности вариабельных областей тяжелой и легкой цепей антитела 16А8, слитых с константной областью тяжелой цепи (последовательности тяжелой и легкой, цепей, соответственно, представлены последовательностями SEQ ID NO: 35 и 36, соответственно. Согласно одному из вариантов реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 16А8; указанное антитело необязательно содержит антигенсвязывающую область антитела 16А8. Согласно любому из представленных в настоящем документе вариантов реализации антитело 16А8 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 16А8. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 16А8. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 16А8. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 16А8 или одну, две или три CDR вариабельной области легкой цепи 16А8. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать один, два, три, четыре или пять модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 16А8 слиты с константной областью иммуноглобулина IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот RYAMS, последовательность аминокислот GFTFSR или последовательность аминокислот GFTFSRYAMS, представленные в последовательностях SEQ ID NO: 37-39, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот TIFSGGSYTYYPDSV или последовательность аминокислот TIFSGGSY, представленные в последовательностях SEQ ID NO: 40-41, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот PNWERTFDY, представленную в последовательности SEQ ID NO: 42, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот KSSQSLLNSSNQKNYL, представленную в последовательности SEQ ID NO: 43, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот FASTRES, представленную в последовательности SEQ ID NO: 44, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; и/или область LCDR3, содержащую последовательность аминокислот QQHYSTPPT, представленную в последовательности SEQ ID NO: 45, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой, или где указанная последовательность может содержать вставку из одна или более аминокислот.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 33, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 34, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) вариабельную область тяжелой цепи последовательности SEQ ID NO: 33, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и вариабельную область легкой цепи последовательности SEQ ID NO: 34, при этом одна или более аминокислот могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 37-42, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 43, 44 и 45, соответственно, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 37-42, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 43, 44 и 45, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(g) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 33, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(h) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90%, или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 34, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-h).

Антитело 19Е9

Последовательность аминокислот вариабельной области тяжелой цепи антитела 19Е9 представлена последовательностью SEQ ID NO: 46, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 47.

Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 19Е9; указанное антитело необязательно содержит антигенсвязывающую область антитела 19Е9. Согласно любому из представленных в настоящем документе вариантов реализации антитело 19Е9 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 19Е9. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 19Е9. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 19Е9. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 19Е9 или одну, две или три CDR вариабельной области легкой цепи 19Е9. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 19Е9, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SDYAWN, последовательность аминокислот GYSITSD или последовательность аминокислот GYSITSDYAWN, представленные в последовательностях SEQ ID NO: 48-50, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот FVSYSGTTKYNPSLKS или последовательность аминокислот FVSYSGTTK, представленные в последовательностях SEQ ID NO: 51-52, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот GYGFDY, представленную в последовательности SEQ ID NO: 53, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот SATSSISSIYFH, представленную в последовательности SEQ ID NO: 54, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот RTSNLAS, представленную в последовательности SEQ ID NO: 55, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQGTTIPFT, представленную в последовательности SEQ ID NO: 56, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 46, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 47, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 48-53, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 54, 55 и 56, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 48-53, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 54, 55 и 56, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 46, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 47, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 9С10

Последовательность аминокислот вариабельной области тяжелой цепи антитела 9С10 представлена последовательностью SEQ ID NO: 57, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 58. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 9С10; указанное антитело необязательно содержит антигенсвязывающую область антитела 9С10. Согласно любому из представленных в настоящем документе вариантов реализации антитело 9С10 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 9С10. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 9С10. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 9С10. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 9С10 или одну, две или три CDR вариабельной области легкой цепи 9С10. Необязательно любой одна или более указанных CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 9С10, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот RYWMN, последовательность аминокислот GYSFTR или последовательность аминокислот GYSFTRYWMN, представленные в последовательностях SEQ ID NO: 59-61, или последовательность, включающую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот MIHPSDSETRLNQKFKD или последовательность аминокислот MIHPSDSETR, представленные в последовательностях SEQ ID NO: 62-63, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот GNFFYVMDY, представленную в последовательности SEQ ID NO: 64, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RASQSIGTSIH, представленную в последовательности SEQ ID NO: 65, или последовательность, соджержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот ASESISG, представленную в последовательности SEQ ID NO: 66, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQSNFWPFT, представленную в последовательности SEQ ID NO: 67, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 67, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 68, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 59-64, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 65, 66 и 67, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 59-64, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 65, 66 и 67, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95%) идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 57, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 58, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95%о последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 12А10

Последовательность аминокислот вариабельной области тяжелой цепи антитела 12А10 представлена последовательностью SEQ ID NO: 68, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 69. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 12А10; указанное антитело необязательно содержит антигенсвязывающую область антитела 12А10. Согласно любому из представленных в настоящем документе вариантов реализации антитело 12А10 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 12А10. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 12А10. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 12А10. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 12А10 или одну, две или три CDR вариабельной области легкой цепи 12А10. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 12А10, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот NYWMN, последовательность аминокислот GYSFTN или последовательность аминокислот GYSFTNYWMN, представленные в последовательностях SEQ ID NO: 70-72, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот MIHPSDSETRLNQKFKD или последовательность аминокислот MIHPSDSETR, представленные в последовательностях SEQ ID NO: 73-74, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот DDFFTMDY, представленную в последовательности SEQ ID NO: 75, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RASQNIVTSIH, представленную в последовательности SEQ ID NO: 76, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот YASESIS, представленную в последовательности SEQ ID NO: 77, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQSNIWPLT, представленную в последовательности SEQ ID NO: 78, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(а) вариабельную область тяжелой цепи последовательности SEQ ID NO: 68, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 69, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 70-75, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 76, 77 и 78, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 70-75, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 76, 77 и 78, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 68, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 69, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90%) или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 10А7

Последовательность аминокислот вариабельной области тяжелой цепи антитела 10А7 представлена последовательностью SEQ ID NO: 79, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 80. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 10А7; указанное антитело необязательно содержит антигенсвязывающую область антитела 10А7. Согласно любому из представленных в настоящем документе вариантов реализации антитело 10А7 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 10А7. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 10А7. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 10А7. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 10А7 или одну, две или три CDR вариабельной области легкой цепи 10А7. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 10А7, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот TSGMGVG, последовательность аминокислот GFSLSTSG или последовательность аминокислот GFSLSTSGMGVG, представленные в последовательностях SEQ ID NO: 81-83, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот HIWWDDDRYYNPSLKS или последовательность аминокислот HIWWDDDRY, представленные в последовательностях SEQ ID NO: 84-85, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот RLNGYFDY, представленную в последовательности SEQ ID NO: 86, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RASQSISDYLH, представленную в последовательности SEQ ID NO: 87, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот YASQSIS, представленную в последовательности SEQ ID NO: 88, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QNGHSFPFT, представленную в последовательности SEQ ID NO: 89, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 79, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 80, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 81-86, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 87, 88 и 89, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 81-86, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 87, 88 и 89, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 79, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 10%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 80, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95%) последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 18Е8

Последовательность аминокислот вариабельной области тяжелой цепи антитела 18Е8 представлена последовательностью SEQ ID NO: 90, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 91. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 18Е8; указанное антитело необязательно содержит антигенсвязывающую область антитела 18Е8. Согласно любому из представленных в настоящем документе вариантов реализации антитело 18Е8 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 18Е8. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 18Е8. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 18Е8. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 18Е8 или одну, две или три CDR вариабельной области легкой цепи 18Е8. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 18Е8, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SDYSWH, последовательность аминокислот GYSITSD или последовательность аминокислот GYSITSDYSWH, представленные в последовательностях SEQ ID NO: 92-94, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот NIHYSGRINYNPSLRS или последовательность аминокислот NIHYSGRIN, представленные в последовательностях SEQ ID NO: 95-96, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот RRTFGNFEDY, представленную в последовательности SEQ ID NO: 97, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RSSSSVNYMH, представленную в последовательности SEQ ID NO: 98, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот ATSTLAS, представленную в последовательности SEQ ID NO: 99, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQWSSNPLT, представленную в последовательности SEQ ID NO: 100, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 90, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 91, при этом одна, две, три или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 92-97, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 98, 99 и 100, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 92-97, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 98, 99 и 100, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 90, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 91, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 10F3

Последовательность аминокислот вариабельной области тяжелой цепи антитела 10F3 представлена последовательностью SEQ ID NO: 101, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 102. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 10F3; указанное антитело необязательно содержит антигенсвязывающую область антитела 10F3. Согласно любому из представленных в настоящем документе вариантов реализации антитело 10F3 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 10F3. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 10F3. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 10F3. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 10F3 или одну, две или три CDR вариабельной области легкой цепи 10F3. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 10F3, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SYTMH, GYTFTS или последовательность аминокислот GYTFTSYTMH, представленные в последовательностях SEQ ID NO: 103-105, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот YINPSSGYTEYNQKFKD или последовательность аминокислот YINPSSGYTE, представленные в последовательностях SEQ ID NO: 106-107, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот GGDWDVDWFVY, представленную в последовательности SEQ ID NO: 108, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот SASSSISYMH, представленную в последовательности SEQ ID NO: 109, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот STSKLAS, представленную в последовательности SEQ ID NO: 110, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QHRSTYPFT, представленную в последовательности SEQ ID NO: 111, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 101, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 102, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 103-108, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 109, 110 и 111, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 103-108, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 109, 110 и 111, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 101, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 102, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 15F9

Последовательность аминокислот вариабельной области тяжелой цепи антитела 15F9 представлена последовательностью SEQ ID NO: 112, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 113. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональное антитело 15F9; указанное антитело необязательно содержит антигенсвязывающую область антитела 15F9. Согласно любому из представленных в настоящем документе вариантов реализации антитело 15F9 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот.Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 15F9. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 15F9. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три области CDR вариабельной области тяжелой цепи 15F9. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 15F9 или одну, две или три CDR вариабельной области легкой цепи 15F9. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 15F9 слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SGYSWH, GYSITSG или последовательность аминокислот GYSITSGYSWH, представленные в последовательностях SEQ ID NO: 114-116, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот FIHYSGSTDYNPSLKS или последовательность аминокислот FIHYSGSTD, представленные в последовательностях SEQ ID NO: 117-118, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот DYGHWYFDV, представленную в последовательности SEQ ID NO: 119, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот KASQSVSYDVA, представленную в последовательности SEQ ID NO: 120, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот YASNRYT, представленную в последовательности SEQ ID NO: 121, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQDYSSLT, представленную в последовательности SEQ ID NO: 122, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(а) вариабельную область тяжелой цепи последовательности SEQ ID NO: 112, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 113, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 114-119, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 120, 121 и 122, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 114-119, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 120, 121 и 122, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 112, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 113, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

Антитело 14В4

Последовательность аминокислот вариабельной области тяжелой цепи антитела 14 В4 представлена последовательностью SEQ ID NO: 123, последовательность аминокислот вариабельной области легкой цепи представлена последовательностью SEQ ID NO: 124. Согласно конкретному варианту реализации в настоящем изобретении предложено антитело, связывающее по существу тот же эпитоп или детерминанту, что и моноклональные антитела 14В4; указанное антитело необязательно содержит антигенсвязывающую область антитела 14В4. Согласно любому из представленных в настоящем документе вариантов реализации антитело 14В4 может быть охарактеризовано последовательностью аминокислот и/или кодирующей ее последовательностью нуклеиновых кислот. Согласно одному предпочтительному варианту реализации указанное моноклональное антитело содержит участок Fab или F(ab')2 14В4. Также предложено моноклональное антитело, которое содержит вариабельную область тяжелой цепи 14В4. Согласно одному из вариантов реализации указанное моноклональное антитело содержит три CDR вариабельной области тяжелой цепи 14В4. Также предложено моноклональное антитело, которое содержит дополнительно вариабельную область легкой цепи 14В4 или одну, две или три CDR вариабельной области легкой цепи 14В4. Необязательно любая одна или более указанных областей CDR легкой или тяжелой цепей могут содержать одну, две, три, четыре или пять или более модификаций аминокислот (например, замен, вставок или удалений). Как вариант, предложено антитело, в котором любые из вариабельных областей легкой и/или тяжелой цепей, содержащих некоторые или все антигенсвязывающие области антитела 14В4, слиты с константной областью иммуноглобулина человека IgG-типа, необязательно константной областью человека, необязательно изотипа IgG1 или IgG3 человека.

Согласно другому аспекту в настоящем изобретении предложен очищенный полипептид, кодирующий антитело, отличающийся тем, что указанное антитело содержит: область HCDR1, содержащую последовательность аминокислот SYWMN, последовательность аминокислот GYSFTS или последовательность аминокислот GYSFTSYWMN, или G, представленные в последовательностях SEQ ID NO: 125-127, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR2, содержащую последовательность аминокислот MIHPSDSETRLNQKFKD или последовательность аминокислот MIHPSDSETR, представленные в последовательностях SEQ ID NO: 128-129, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область HCDR3, содержащую последовательность аминокислот EMGPYTLDY, представленную в последовательности SEQ ID NO: 130, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR1, содержащую последовательность аминокислот RASQNIDTSIH, представленную в последовательности SEQ ID NO: 131, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR2, содержащую последовательность аминокислот YASESIS, представленную в последовательности SEQ ID NO: 132, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть заменены другой аминокислотой; область LCDR3, содержащую последовательность аминокислот QQSNYWPLT, представленную в последовательности SEQ ID NO: 133, или последовательность, содержащую по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанной последовательности, при этом одна или более указанных аминокислот могут быть удалены или заменены другой аминокислотой.

Согласно другому аспекту в настоящем изобретении предложено антитело, связывающее MICA человека, содержащее:

(a) вариабельную область тяжелой цепи последовательности SEQ ID NO: 123, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(b) вариабельную область легкой цепи последовательности SEQ ID NO: 124, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(c) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 125-130, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(d) аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 131, 132 и 133, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(e) аминокислотные последовательности CDR 1, 2 и 3 тяжелой цепи (HCDR1, HCDR2, HCDR3) согласно представленным в SEQ ID NO: 125-130, при этом одна или более аминокислот в CDR могут быть заменены другой аминокислотой; и аминокислотные последовательности CDR 1, 2 и 3 легкой цепи (LCDR1, LCDR2, LCDR3) согласно представленным в SEQ ID NO: 131, 132 и 133, при этом одна, две, три или более аминокислот в CDR могут быть заменены другой аминокислотой; и/или

(f) вариабельную область тяжелой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 123, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой; и/или

(g) вариабельную область легкой цепи, по меньшей мере на 60%, 70%, 80%, 85%, 90% или 95% идентичную вариабельной области, имеющей последовательность аминокислот SEQ ID NO: 124, при этом одна, две, три или более аминокислот могут быть заменены другой аминокислотой.

Согласно другому аспекту любого из вариантов реализации настоящего изобретения любые из областей CDR 1, 2 и 3 тяжелой и легкой цепей могут характеризоваться последовательностью из по меньшей мере 4, 5, 6, 7, 8, 9 или 10 смежных аминокислот указанных последовательностей, и/или как имеющие последовательность аминокислот, идентичную по меньшей мере на 50%, 60%, 70%, 80%, 85%о, 90% или 95% последовательности(ям) конкретной области CDR или ряда CDR, представленной(ых) в соответствующей последовательности SEQ ID NO.

Согласно другому аспекту в настоящем изобретении предложено антитело, конкурирующее за связывание MICA с моноклональным антителом согласно приведенным выше пп. (a-g).

В любых антителах согласно настоящему изобретению, например, 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14 В4, указанные последовательности вариабельной области и CDR могут содержать консервативные модификации (1, 2, 3, 4, 5, 6, 7, 8 или больше модификаций последовательности). Под консервативной модификацией последовательности понимают модификацию аминокислоты, существенно не влияющую на связывание или не изменяющую характеристики связывания антитела, содержащего указанную последовательность аминокислот.Такие консервативные модификации включают замены, добавления и удаления аминокислот. Модификации могут быть введены в антитело согласно настоящему изобретению с помощью применения стандартных техник, известных в данной области техники, таких как сайт-специфический мутагенез и ПЦР-опосредованный мутагенез. Консервативные замены аминокислот, как правило, представляют собой такие замены, при которых аминокислотный остаток заменен аминокислотным остатком, содержащим боковую цепь с аналогичными физико-химическими свойствами. Конкретные последовательности вариабельной области и CDR могут содержать одну, две, три, четыре или более вставок, удалений или замен аминокислот. При осуществлении замен предпочтительными заменами являются консервативные модификации. Семейства аминокислотных остатков, содержащих аналогичные боковые цепи, определены в данной области техники. Указанные семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серии, треонин, тирозин, цистеин, триптофан), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин). Соответственно, один или более аминокислотных остатков в составе областей CDR антитела согласно настоящему изобретению могут быть замещены другими аминокислотными остатками из того же семейства боковых цепей, и указанное измененное антитело может быть протестировано на предмет сохранения функции (т.е. представленных в настоящем документе свойств) с помощью анализов, описанных в настоящем документе.

Термин «идентичность» или «идентичный» в отношении последовательностей двух или большего числа полипептидов, относится к степени сходства последовательностей полипептидов, определяемой количеством совпадений между последовательностями двух или более аминокислотных остатков. «Идентичность» соответствует проценту идентичных совпадений между меньшей из двух или более последовательности с выравниванием пропусков (при их наличии), задаваемой конкретной математической моделью или компьютерной программой (т.е. «алгоритмами»). Идентичность родственных полипептидов может быть легко рассчитана с применением известных способов. Такие способы включают, не ограничиваясь перечисленными, описанные в источниках: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; и Carillo et al., SIAM J. Applied Math. 48, 1073 (1988).

Разработаны предпочтительные способы определения идентичности, позволяющие максимально выявить совпадение между тестируемыми последовательностями. Способы определения идентичности описаны в общедоступных компьютерных программах. Предпочтительные программные способы определения степени идентичности двух последовательностей включают программный пакет GCG, в том числе GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, Университет Висконсина, Мэдисон, Висконсин), BLASTP, BLASTN и FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). Открытый доступ к программе BLASTX предоставляется Национальным центром биотехнологической информации (National Center for Biotechnology Information, NCBI) и другими источниками (BLAST Manual, Altschul et al. NCB/NLM/NIH Бетесда, Мэриленд. 20894; Altschul et al., выше). Для определения идентичности может также применяться хорошо известный алгоритм Смита-Ватермана.

Последовательности областей CDR, в соответствии с АbМ (определение согласно программному обеспечению АbМ для моделирования антител от Oxford Molecular) и системами определения Kabat и Chothia обобщены в таблице А ниже. Хотя для обозначения областей CDR может использоваться любая подходящая система нумерации, с случае каких-либо дополнительных указаний в настоящем документе используется нумерация Abm. Указанная нумерация была реализована с соблюдением следующих условий: CDR-L1: Начало: прибл. остаток 24, остаток до: всегда Cys, остаток после: всегда Tip (как правило, Trp-Tyr-Gln, но также и Trp-Leu-Gln, Trp-Phe-Gln, Trp-Tyr-Leu), длина: 10-17 остатков; CDR-L2: Начало: всегда 16 остатков после конца L1, Остатки до: обычно Ile-Tyr (но также и Val-Tyr, Ile-Lys, Ile-Phe), Длина: всегда 7 остатков; CDR-L3, Начало: всегда 33 остатка после конца L2, Остаток до: всегда Cys, Остатки после: всегда Phe-Gly-Xaa-Gly, Длина: 7-11 остатков; CDR-H1, Начало: прибл. остаток 26 (всегда 4 после Cys) (определение Chothia / AbM, согласно определению по Kabat начало сдвинуто на 5 остатков), Остатки до: всегда Cys-Xaa-Xaa-Xaa, Остатки после: всегда Trp (как правило, Trp-Val, но также и Trp-Ile, Trp-Ala), Длина: 10-12 остатков (определение по АbМ; определение по Chothia исключает последние 4 остатка); CDR-H2, Начало: всегда 15 остатков после конца CDR-H1 согласно определению по Kabat/AbM, Остатки до: как правило, Leu-Glu-Trp-Ile-Gly (но в некоторых вариантах остатки после Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala), Длина: определение по Kabat: 16-19 остатки; определение по АbМ (и Chothia): короче на 7 остатков; CDR-H3, Начало: всегда 33 остатка после конца CDR-H2 (всегда 2 после Cys), Остатки до: всегда Cys-Xaa-Xaa (как правило, Cys-Ala-Arg), Остатки после: всегда Trp-Gly-Xaa-Gly, Длина: от 3 до 25 остатков.

Последовательности вариабельных цепей антител согласно настоящему изобретению приведены в таблице В ниже; лидерная последовательность подчеркнута в начале каждой последовательности (любая цепь антитела может быть задана начиная с аминокислоты, расположенной непосредственно за концом лидерной последовательности), и подчеркнута каждая область CDR. Согласно любому варианту реализации настоящего изобретения последовательность VL или VH может быть уточнена или пронумерована таким образом, чтобы содержать или не содержать сигнальный пептид или любую его часть.

Согласно одному из вариантов реализации антитела согласно настоящему изобретению принадлежат к изотипу IgG1 или IgG3 человека. Согласно одному из вариантов реализации антитела согласно настоящему изобретению представляют собой фрагменты антитела, сохраняющие свойственные им связывающие и/или функциональные свойства.

Согласно одному аспекту любого из вариантов реализации настоящего изобретения любое антитело согласно настоящему изобретению может содержать тяжелую и/или легкую цепь, содержащую последовательности CDR1, 2 и/или 3 в соответствии с соответствующей формулой, выбранной из формул (I)-(VIII). В любом варианте реализации настоящего изобретения конкретная область HCDR1-3 или LCDR-1-3 может быть уточнена как имеющая последовательность формул (I)-(VIII). Согласно одному предпочтительному варианту реализации указанное антитело содержит легкую цепь, содержащую указанные три LCDR, и тяжелую цепь, содержащую указанные три HCDR.

Согласно одному из вариантов реализации HCDR1 содержит последовательность аминокислот формулы (I):

G-Xaa1-Хаа2-Хаа3-Хаа4-Хаа5 (SEQ ID NO: 261),

где Xaai может представлять собой Phe или Tyr, Хаа2 может представлять собой Thr или Ser, Хаа3 может представлять собой Ile, Leu или Phe, Хаа4 может представлять собой Ser или Thr и Xaa5 может представлять собой Asn, Tyr, Ser, Thr или Arg. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-5 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации HCDR1 содержит последовательность аминокислот формулы (II):

Xaa1-Хаа2-Хаа3-Хаа4-Хаа5 (SEQ ID NO: 262),

где Xaai может представлять собой Asn, Ser, Thr или Arg, Хаа2 может представлять собой Gly, Asp, Ser или Tyr, Хаа3 может представлять собой Thr, Tyr, Ala, Gly, Trp, Хаа4 может представлять собой Ser, Ala или Met, и Xaa5 может представлять собой His, Trp, Gln, Ser или Asn. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-5 может(ут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации HCDR1 содержит последовательность аминокислот формулы (III):

Хаа1-Y-Хаа2-М-Хаа3 (SEQ ID NO: 263),

где каждый из Xaa1-3 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку, где Xaa1 может представлять собой Asn, Ser, Thr или Arg, Хаа2 может представлять собой Thr, Tyr, Ala, Gly, Trp, и Хаа3 может представлять собой His, Trp, Gln, Ser или Asn.

Согласно одному из вариантов реализации HCDR2 содержит последовательность аминокислот формулы (IV):

Xaa1-Хаа2-Хаа3-Хаа4-Хаа5-Хаа6-Хаа7-Xaa8-Хаа9-Хаа10 (SEQ ID NO: 264),

где Xaa1 может представлять собой Phe, Thr, His, Asn, Tyr или Met, Хаа2 может представлять собой Val или Ile, Хаа3 может представлять собой Ser, Phe, His, Asn или Trp, Хаа4 может представлять собой Arg, Tyr, Ser, Trp или Pro, Xaa5 может представлять собой Gly, Asp или Ser, Хаа6 может представлять собой Thr, Gly, Asp или Ser, Хаа7 может представлять собой Asn, Thr, Ser, Asp, Arg или Gly, Xaa8 может представлять собой Tyr, Lys, Glu, Arg, Ile или Thr, Xaa9 может представлять собой Ile, Thr, Tyr, Asn или Asp, и Хаа10 может представлять собой Tyr, Arg или Glu. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-10 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации HCDR3 содержит последовательность аминокислот формулы (V):

Xaa1-Хаа2-Хаа3-Хаа4-Хаа5-Хаа6-Хаа7-Xaa8-Хаа9 (SEQ ID NO: 265),

где Xaa1 может представлять собой Ile, Pro, Arg, Gly, Asp или Glu, Xaa2 может представлять собой Ser, Tyr, Thr, Asn, Asp, Leu, Arg, Glu или Met, Xaa3 может представлять собой Asp, Glu, Trp, Gln, Phe, Asn или Thr, Xaa4 может представлять собой Tyr, Glu, Gly, Phe, Trp, His или Pro, Xaa5 может представлять собой Asp, Arg, Tyr, Thr, Gly или Trp, Xaa6 может представлять собой Gly, Tyr, Thr, Phe, Val, Met или Asn, Xaa7 может представлять собой Ala, Phe, Asp, Met или Leu, Xaa8 может представлять собой Trp, Tyr, Asp или Glu, и Xaa9 может представлять собой Leu, Tyr, Asp, Phe или Val. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-9 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации LCDR1 содержит последовательность аминокислот формулы (VI):

Xaa1-Хаа2-Хаа3-Хаа4-Xaa5-Хаа6-Хаа7-Xaa8-Xaa9-Хаа10-Хаа11 (SEQ ID NO: 266),

где Xaa1 может представлять собой Ser, Lys или Arg, Хаа2 может представлять собой Ser или Ala, Хаа3 может представлять собой Thr или Ser, Хаа4 может представлять собой Ser или Gin, Xaas может представлять собой Asn или Ser, Хаа6 может представлять собой Val, Leu или Ile, Хаа7 может представлять собой Asp, Asn, Val, Leu, Gly или Ser, Xaa8 может представлять собой Tyr, Ser, Asn, Thr или Asp, Xaa9 может представлять собой Asp, Met, Ile, Ser или Tyr, Хаа10 может представлять собой Val, His, Tyr, Ser, Ile, или Leu, и Хаа11 может представлять собой Ala, Phe, Asn или His. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-11 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации LCDR2 содержит последовательность аминокислот формулы (VII):

Xaa1-Хаа2-Хаа3-Хаа4-Хаа5-Хаа6-Хаа7 (SEQ ID NO: 267),

где Xaa1 может представлять собой Ser, Lys, Arg, Phe, Tyr или Ala, Хаа2 может представлять собой Ile, Thr, Ala или Ser, Хаа3 может представлять собой Ser или Glu, Хаа4 может представлять собой Lys, Glu, Asn, Thr, Gin или Ser, Xaa5 может представлять собой Leu, Arg, Ser или Ile, Хаа6 может представлять собой Tyr, Phe, Ala, Glu, Ile или Ser, и Xaa7 может представлять собой Thr, Ser или Gly. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-7 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации LCDR3 содержит последовательность аминокислот формулы (VIII):

Xaa1-Хаа2-Хаа3-Хаа4-Хаа5-Xaa6-Хаа7-Xaa8-Хаа9 (SEQ ID NO: 268),

где Xaa1 может представлять собой Phe или Gln, Хаа2 может представлять собой His, Asn или Gln, Хаа3 может представлять собой Ser, Gly, His, Trp или Arg, Xaa4 может представлять собой Asn, His, Tyr, Thr или Ser, Xaa5 может представлять собой Phe, Ser, Thr, His, Ile или Tyr, Хаа6 может представлять собой Trp, Phe, Thr, Ile, Val, Asn или Try, Хаа7 представляет собой Pro, Xaa8 может представлять собой Phe, Trp, Pro или Leu, и Хаа9 представляет собой Thr. Необязательно любой(ые) 1, 2 или 3 из указанных Xaa1-9 может(гут) представлять собой консервативную или неконсервативную замену любой из указанных аминокислот, либо удаление или вставку.

Согласно одному из вариантов реализации антитело согласно настоящему изобретению может содержать легкую цепь, содержащую:

a) CDR1 легкой цепи (LCDR1), содержащую последовательность аминокислот SEQ ID NO: 266; и/или

b) CDR2 легкой цепи (LCDR2), содержащую последовательность аминокислот SEQ ID NO: 267; и/или

с) CDR3 легкой цепи (LCDR3), содержащую последовательность аминокислот SEQ ID NO: 268.

Согласно одному из вариантов реализации антитело согласно настоящему изобретению может содержать тяжелую цепь, содержащую:

d) CDR1 тяжелой цепи (HCDR1), содержащую последовательность аминокислот, выбранную из последовательностей SEQ ID NO: 261, 262 и 263; и/или

е) CDR2 тяжелой цепи (HCDR2), содержащую последовательность аминокислот SEQ ID NO: 264; и/или

f) CDR3 тяжелой цепи (HCDR3), содержащую последовательность аминокислот SEQ ID NO: 265.

Фрагменты и производные

Фрагменты и производные антител согласно настоящему изобретению (охваченные термином «антитело» или «антитела» в настоящей заявке, если не указано иное или если это явным образом не противоречит контексту), предпочтительно 6Е4, 20С6, 16А8, 9С10, 19Е9, 12А10, 10А7, 18Е8, 10F3, 15F9 или 14В4-подобное антитело, могут быть получены при помощи методик, известных в данной области техники. «Фрагменты» содержат участок интактного антитела, обычно антигенсвязывающий участок или вариабельную область. Примеры фрагментов антитела включают Fab, Fab', Fab'-SH, F(ab')2, и Fv-фрагменты; диатела; любой фрагмент антитела, который представляет собой полипептид с первичной структурой, состоящей из одной непрерывной последовательности смежных аминокислотных остатков (называемый здесь «одноцепочечный фрагмент антитела» или «одноцепочечный полипептид»), включая без ограничений (1) одноцепочечные Fv-молекулы (2) одноцепочечные полипептиды, содержащие только один вариабельный домен легкой цепи, или его фрагмент, который содержит три области CDR вариабельного домена легкой цепи, без связанного фрагмента тяжелой цепи и (3) одноцепочечные полипептиды, содержащие только одну вариабельную область тяжелой цепи, или ее фрагмент, содержащий три области CDR вариабельной области тяжелой цепи, без связанного фрагмента легкой цепи; и мультиспецифические антитела, образованные фрагментами антител. Включены, в том числе, нанотело, доменное антитело, однодоменное антитело, или «dAb».

Фрагменты представленных антител могут быть получены с применением стандартных способов. Например, фрагменты Fab или F(ab')2 могут быть получены протеазным расщеплением выделенных антител, в соответствии с общепринятыми техниками. Следует иметь в виду, что иммунореактивные фрагменты могут быть модифицированы с применением известных способов, например, для снижения скорости клиренса in vivo и получения более предпочтительного фармакокинетического профиля указанный фрагмент может быть модифицирован полиэтиленгликолем (ПЭГ).

Как вариант, ДНК гибридомы, продуцирующей антитело согласно настоящему изобретению, может быть модифицирована таким образом, чтобы кодировать фрагмент согласно настоящему изобретению. Указанную модифицированную ДНК затем встраивают в экспрессионный вектор и применяют для трансформации или трансфекции подходящей клетки, которая затем экспрессирует требуемый фрагмент.

Согласно определенным вариантам реализации ДНК гибридомы, продуцирующей антитело согласно настоящему изобретению, может быть модифицирована до встраивания в экспрессионный вектор, например, заменой на кодирующую последовательность константных доменов тяжелой и легкой цепей человека гомологичной последовательности не являющегося человеком вида, или путем ковалентного связывания с кодирующей последовательностью иммуноглобулина всей или части кодирующей последовательности неиммуноглобулинового полипептида. Таким образом получают «химерные» или «гибридные» антитела, обладающие специфичностью связывания исходного антитела. Как правило, такие неиммуноглобулиновые полипептиды заменяют константные домены антитела согласно настоящему изобретению.

Соответственно, в соответствии с другим вариантом реализации антитело согласно настоящему изобретению гуманизировано. «Гуманизированные» формы антител в соответствии с настоящим изобретением представляют собой специфические гибридные иммуноглобулины, иммуноглобулиновые цепи или их фрагменты (такие как Fv, Fab, Fab', F(ab')2, или другие антигенсвязывающие субпоследовательности антител), которые содержат минимальную последовательность, полученную из иммуноглобулина мыши. В основном гуманизированные антитела представляют собой иммуноглобулины человека (реципиентное антитело), в которых остатки определяющей комплементарность области (CDR) реципиента заменены остатками из CDR исходного антитела (донорного антитела), с сохранением требуемой специфичности, аффинности и активности исходного антитела.

В некоторых случаях каркасные остатки Fv иммуноглобулина человека могут быть заменены соответствующими остатками, не принадлежащими человеку. Кроме того, гуманизированные антитела могут содержать остатки, отсутствующие как в реципиентном антителе, так и во встраиваемых CDR или каркасных последовательностях.

Указанные модификации вносят также для коррекции и оптимизации активности антитела. В целом, гуманизированное антитело содержит по существу все из по меньшей мере одного, а как правило, двух вариабельных доменов, в котором все или по существу все области CDR соответствуют таких областям исходного антитела, и все или по существу все каркасные области представляют собой каркасные области консенсусной последовательности иммуноглобулина человека. В оптимальном варианте гуманизированное антитело также содержит по меньшей мере часть константной области иммуноглобулина (Fc), как правило, иммуноглобулина человека. Дополнительную информацию можно найти в источниках: Jones et al., Nature, 321, pp. 522 (1986); Reichmann et al., Nature, 332, pp. 323 (1988); Presta, Curr. Op.Struct. Biol., 2, pp.593 (1992); Verhoeyen et Science, 239, pp. 1534; и патенте США №4816567, все содержание которых полностью включено в настоящий документ посредством ссылки.)

Выбор вариабельных доменов человека, как тяжелой, так и легкой цепей, для применения при получении гуманизированных антител, очень важен для снижения антигенности. В соответствии с так называемым методом «наилучшей подгонки» проводят скрининг последовательности вариабельного домена антитела согласно настоящему изобретению по всему объему библиотеки известных последовательностей вариабельных доменов человека. Последовательность человека, максимально близкую последовательности мыши, отбирают в качестве каркасной области человека (FR) гуманизированного антитела (Sims et al., J. Immunol. 151, pp. 2296 (1993); Chothia и Lesk, J. Mol. 196, 1987, pp. 901). В другом способе используется конкретная каркасная область консенсусной последовательности всех антител человека конкретной подгруппы легких или тяжелых цепей. Один и тот же каркасный участок может быть использован для нескольких разных гуманизированных антител (Carter et al., PNAS 89, pp. 4285 (1992); Presta et al., J. Immunol., 151, p. 2623 (1993)).

Важно также, чтобы при гуманизации указанных антител сохранялось высокое сродство к рецепторам MICA и другие благоприятные биологические свойства. Для достижения указанной цели гуманизированные антитела получают в соответствии с предпочтительным способом посредством анализа исходных последовательностей и различных концептуальных гуманизированных продуктов, с использованием трехмерных моделей исходных и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов общедоступны и известны специалистам в данной области техники. Доступны компьютерные программы, которые иллюстрируют и отображают возможные трехмерные структуры отобранных кандидатных последовательностей иммуноглобулинов. Изучение указанных изображений позволяет проанализировать вероятную роль остатков в функционировании указанной кандидатной последовательности иммуноглобулина, т.е. проанализировать остатки, которые влияют на способность кандидатного иммуноглобулина связывать соответствующий ему антиген. Таким образом, остатки каркасных областей могут быть отобраны из консенсусных и встраиваемых последовательностей и скомбинированы таким образом, что достигается требуемая характеристика антитела, такая как повышенное сродство к целевому(ым) антигену(ам). В целом, остатки CDR непосредственным и наиболее существенным образом влияют на связывание антигена.

Другой способ получения «гуманизированных» моноклональных антител предполагает использование XenoMouse (Abgenix, Фримонт, Калифорния) в качестве мыши для иммунизации. XenoMouse представляет собой мышь-хозяина в соответствии с настоящим изобретением, гены иммуноглобулинов которой заменены функциональными иммуноглобулиновыми генами человека. Соответственно, антитела, продуцируемые такой мышью или гибридомами, полученными из В-клеток указанной мыши, уже являются гуманизированными. XenoMouse описывается в патенте США №6162963, полностью включенном в настоящий документ посредством ссылки.

Антитела человека могут также получены в соответствии с различными другими методиками, например, с использованием, путем иммунизации, других трансгенных животных, сконструированных для экспрессирования репертуара антител человека (Jakobovitz et al., Nature 362 (1993) 255), или путем отбора репертуаров антител с применением методов фагового дисплея. Такие методики известны специалистам и могут быть реализованы на основе моноклональных антител согласно описанию в настоящей заявке.

Антитела согласно настоящему изобретению могут также дериватизированы до «гибридных» антител (иммуноглобулинов), в которых участок тяжелой/легкой цепи(ей) идентичен или гомологичен соответствующей последовательности исходного антитела, а оставшаяся часть цепи(ей) идентична или гомологична соответствующей последовательности антител, полученных от другого вида или принадлежащих к другому классу или подклассу антител, а также фрагментов таких антител, при условии, что они проявляют нужную биологическую активность и специфичность связывания (Cabilly et al., выше; Morrison et al., Proc. Natl. Acad. Sci. U.S.A., pp. 6851 (1984)).

В настоящем изобретении предложено антитело против молекул MICA, направленное на клетки, и, согласно вариантам реализации, интернализируемое клетками.

Они способны доставлять терапевтические агенты или детектируемые агенты в клетки или на клетки, экспрессирующие MICA, но не в клетки или на клетки, не экспрессирующие полипептиды MICA. Соответственно, в настоящем изобретении также предложены иммуноконъюгаты против MICA, содержащие антитело против MICA согласно описанию в настоящем документе, которое конъюгировано с терапевтическим агентом или детектируемым агентом (или любой другой фрагмент, который служит в качестве представляющего интерес груза для доставки к MICA-экспрессирующей клетке. Согласно вариантам реализации сродство анти-MICA иммуноконъюгата к MICA составляет по меньшей мере 10, 25, 50, 75, 80, 90, или 95% от сродства неконъюгированного антитела. Это может быть определено с применением MICA клеточной поверхности или выделенного MICA.

Подходящие детектируемые агенты, которыми может быть дериватизировано (или помечено) антитело или участок антитела согласно настоящему изобретению включают флуоресцентные соединения, различные ферменты, простетические группы, люминесцентные материалы, биолюминесцентные материалы, испускающие флуоресценцию атомы металла, например, европий (Eu) и другие лантаноиды, и радиоактивные материалы (описанные выше). Типовые флуоресцентные детектируемый агенты включают флуоресцеин, изотиоцианат флуоресцеина, родамин, 5-диметиламин-L-нафталинсульфонилхлорид, фикоэритрин и т.п. Антитело может также быть дериватизировано детектируемыми ферментами, такими как щелочная фосфатаза, пероксидаза хрена, (3-галактозидаза, ацетилхолинэстераза, глюкозооксидаза и т.п. После дериватизации антитела детектируемым ферментом его обнаруживают путем добавления дополнительных реагентов, которые фермент задействует для синтеза детектируемого продукта реакции. Например, при наличии детектируемого агента - пероксидазы хрена добавление перекиси водорода и диаминобензидина приводит к образованию окрашенного реакционного продукта, который поддается детекции. Антитело может также дериватизировано простетической группой (например, стрептавидин/биотин и авидин/биотин). Например, антитело может быть дериватизировано биотином, и быть обнаружено путем непрямого измерения связывания авидина или стрептавидина. Примеры подходящих флуоресцентных материалов включают умбеллиферон, флуоресцеин, изотиоцианат флуоресцеина, родамин, дихлортриазиниламина флуоресцеин, дансилхлорид или фикоэритрин; пример люминесцентного материала включает люминол; примеры биолюминесцентных материалов включают люциферазу, люциферин и экворин. Как вариант, антитело против MICA может быть связано с вторым антителом, которое связывается с указанным антителом против MICA, при этом второе антитело дериватизировано детектируемой меткой; при приведении указанного второго антитела в контакт с антителом против MICA, in vitro или in vivo, указанное антитело против MICA будет функционировать как меченое антитело.

Конъюгирование с детектируемым фрагментом полезно, в том числе, в тех случаях, когда антитело согласно настоящему изобретению используют в целях диагностики. Такие цели включают, не ограничиваясь перечисленными, анализ биологических образцов, например, образца крови или тканевого биоптата, на присутствие MICA-экспрессирующих клеток, и обнаружение присутствия, уровня или активности MICA-экспрессирующих клеток у индивидуума. Такой анализ и способы обнаружения могут применяться в способах диагностики/терапии согласно настоящему изобретению, например, включающих определение экспрессии MICA в клетках пациента, и последующее введение MICA-модулирующего антитела согласно настоящему изобретению в том случае, если определено, что клетки пациента экспрессируют MICA.

Согласно определенным вариантам реализации указанные антитела применяют для очищения MICA-экспрессирующих клеток из биологического образца. Биологические образцы могут быть получены от пациента, например, для целей диагностики или ex vivo терапевтических целей, либо от индивидуумов или не являющихся человеком приматов для получения источника таких клеток для исследовательских целей.

Согласно одному такому варианту реализации меченые антитела согласно настоящему изобретению могут применяться при сортировке с активацией флуоресценции для очищения или выделения MICA-экспрессирующих клеток из биологического образца. Как вариант, согласно некоторым вариантам реализации конъюгирование антитела согласно настоящему изобретению с твердой подложкой может подходить в качестве инструмента аффинной очистки клеток, несущих на поверхности рецептор MICA, из биологического образца, такого как образец крови, или клеток биоптата ткани индивидуума. Указанный способ очищения представляет собой еще один альтернативный вариант реализации настоящего изобретения, как и полученная очищенная популяция клеток.

Независимо от способа выделения или очищения MICA-экспрессирующих клеток эта возможность полезна для решения разнообразных задач, например, для диагностики связанного с MICA расстройства путем оценки количества или активности MICA-экспрессирующих клеток, например, перед введением антител против MICA согласно описанию в настоящем документе. Кроме того, очищенные MICA-экспрессирующие клетки подходят для применения в контексте исследований, например, для более полного изучения клеток, различных их свойств и поведения, а также для идентификации соединений или способов, которые могут применяться для модулирования их поведения, активности, выживаемости или пролиферации.

Модифицированные константные области

В свете способности антител против MICA согласно настоящему изобретению индуцировать АЗКЦ и КЗЦ, могут также быть получены антитела согласно настоящему изобретению, содержащие модификации, усиливающие их способность к связыванию Fc-рецепторов, которые могут влиять на эффекторные функции, такие как антителозависимая цитотоксичность, дегрануляция тучных клеток и фагоцитоз, а также иммуномодулирующие сигналы, такие как регуляция пролиферации лимфоцитов и секреции антител. Типовые модификации включают модифицированные человека константные области IgG1, содержащие по меньшей мере одну модификацию аминокислоты (например, замену, удаления, вставки) и/или измененные типы гликозилирования, например, гипофукозилирование. Такие модификации могут влиять на взаимодействие с Fc-рецепторами: FcγRI (CD64), FcγRII (CD32) и FcγRIII (CD16). FcγRI (CD64), FcγRIIA (CD32A) и FcγRIII (CD 16) представляют собой активирующие (т.е. стимулирующие иммунную систему) рецепторы, a FcγRIIB (CD32B) представляет собой ингибирующий (т.е. уменьшающий активность иммунной системы) рецептор. Модификация может, например, увеличивать связывание Fc-домена с FcγRIIIa на эффекторных (например, НК) клетках.

Антитела против MICA предпочтительно содержат Fc-домен (или его участок) изотипа IgG1 или IgG3 человека, необязательно модифицированный. Последовательность аминокислот в положениях 230-447 последовательности Fc-области IgG1 человека (№ доступа GenBank: J00228) приведена ниже:

PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 134);

Остатки 230-341 (Kabat EU) составляют СН2-область Fc. Остатки 342-447 (Kabat EU) составляют СН3-область Fc. Антитела против MICA могут содержать вариант Fc-области с одной или несколькими модификациями аминокислот (например, замены, удаления, вставки) в одной или нескольких частях; указанные модификации увеличивают аффинность и авидность указанного варианта Fc-области в отношении FcγR (включая активирующие и ингибирующие FcγR). Согласно некоторым вариантам реализации указанная(ые) одна или более модификаций аминокислот повышают сродство вариантной Fc-области к FcγRIIIA и/или FcγRIIA. Согласно другому варианту реализации вариантная Fc-область также специфически связывает FcγRIIB с меньшим сродством по сравнению с Fc-областыо сопоставимого исходного антитела (т.е. антитела, имеющего ту же последовательность аминокислот, что и антитело согласно настоящему изобретению, за исключением одной или нескольких модификаций аминокислот в Fc-области). Так, один или оба остатка гистидин в положениях 310 и 435 могут быть заменены, например, на лизин, аланин, глицин, валин, лейцин, изолейцин, пролин, метионин, триптофан, фенилаланин, серии или треонин (см., например, публикацию РСТ № WO 2007/080277); такие содержащие замены константные области обеспечивают уменьшение связывания с ингибирующим FcγRIIB без снижения связывания с активирующим FcγRIIIA. Согласно некоторым вариантам реализации такие модификации повышают сродство вариантной Fc-области к FcγRIIIA и/или FcγRIIA, а также повышают сродство вариантных Fc-областей к FcγyRIIB относительно исходного антитела. Согласно другим вариантам реализации указанная одна или более модификаций аминокислот увеличивают сродство вариантных Fc-областей к FcγRIIIA и/или FcγRIIA, но не изменяют сродство вариантных Fc-областей к FcγRIIB относительно Fc-области исходного антитела. Согласно другому варианту реализации указанная одна или более модификаций аминокислот повышает(ют) сродство вариантных Fc-областей к FcγRIIIA и FcγRIIA, но уменьшает(ют) сродство к FcγRIIB относительно исходного антитела. Повышенное сродство и/или авидность приводят к детектируемому связыванию с FcγR или связанной с FcγR активности в клетках, которые экспрессируют низкие уровни FcγR, если связывающая активность исходной молекулы (без модификации Fc-области) не обнаруживается в указанных клетках.

Согласно одному из вариантов реализации указанная(ые) одна или более модификаций аминокислот Fc-области уменьшают аффинность и авидность антитела к одному или большему числу рецепторов FcγR. Согласно конкретному варианту реализации настоящим изобретением охвачены антитела, содержащие вариант Fc-области, отличающиеся тем, что указанный вариант Fc-области содержит по меньшей мере одну модификацию аминокислоты относительно Fc-области дикого типа, и указанный вариант Fc-области связывает только один FcγR, при этом указанный FcγR представляет собой FcγRIIIA или FcγRIIA.

Характеристики аффинности и связывания молекул согласно настоящему изобретению, например, антител, с FcγR могут быть определены с применением известных в данной области техники анализов in vitro (биохимических или иммунологических) для определения взаимодействий антитело-антиген или Fc-FcγR, т.е. специфического связывания антигена с антителом или специфического связывания Fc-области с FcγR, соответственно, включая, но не ограничиваясь перечисленными, ИФА ELISA, поверхностный плазмонный резонанс, иммунопреципитационный анализ.

Согласно некоторым вариантам реализации молекулы согласно настоящему изобретению, содержащие вариант Fc-области, содержат по меньшей мере одну модификацию аминокислоты (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или больше модификаций аминокислот) в СН3-домене Fc-области. Согласно другим вариантам реализации молекулы согласно настоящему изобретению, содержащие вариант Fc-области, содержат по меньшей мере одну модификацию аминокислоты (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или больше модификаций аминокислот) в СН2-домене Fc-области, которые определен как захватывающий аминокислоты 231-341. Согласно некоторым вариантам реализации молекулы согласно настоящему изобретению содержат по меньшей мере две модификации аминокислот (например, 2, 3, 4, 5, 6, 7, 8, 9 или более модификаций аминокислот), при этом по меньшей мере одна такая модификация содержится в СН3 области, и по меньшей мере одна такая модификация содержится в СН2 области. Настоящее изобретение также охватывает модификацию аминокислот в области шарнира. Согласно конкретному варианту реализации настоящим изобретением охвачены модификация аминокислоты в СН1-домене Fc-области, который определен как начинающийся за аминокислотами 216-230.

Может быть осуществлена любая комбинация модификаций Fc, например, любая комбинация разных модификации из раскрытых в патентах США №№ US 7632497; 7521542; 7425619; 7416727; 7371826; 7355008; 7335742; 7332581; 7183387; 7122637; 6821505 и 6737056; в РСТ-публикациях WO2011/109400; WO 2008/105886; WO 2008/002933; WO 2007/021841; WO 2007/106707; WO 06/088494; WO 05/1 15452; WO 05/110474; WO 04/1032269; WO 00/42072; WO 06/088494; WO 07/024249; WO 05/047327; WO 04/099249 и WO 04/063351; и у Presta, L.G. et al. (2002) Biochem. Soc. Trans. 30(4):487-490; Shields, R.L. et al. (2002) J. Biol. Chem. 26; 277(30):26733-26740 и Shields, R.L. et al. (2001) J. Biol. Chem. 276(9):6591-6604).

Настоящим изобретением охвачены антитела против MICA, которые содержат вариант Fc-области, отличающиеся тем, что указанный вариант Fc-области содержит по меньшей мере одну модификацию аминокислоты (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или более модификаций аминокислот) относительно Fc-области дикого типа, такую(ие), что эффекторная функция указанной молекулы повышена относительно молекулы, содержащей Fc-область дикого типа, необязательно отличающиеся тем, что указанный вариант Fc-области включает замену в любом одном или нескольких положениях из 221, 243, 247, 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 308, 309, 310, 311, 312, 316, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 370, 373, 376, 378, 392, 396, 399, 402, 404, 416, 419, 421, 430, 434, 435, 437, 438 и/или 439.

Настоящим изобретением охвачены антитела против MICA, которые содержат вариант Fc-области, отличающиеся тем, что указанный вариант Fc-области содержит по меньшей мере одну модификацию аминокислоты (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или более модификаций аминокислот) относительно Fc-области дикого типа, такую(ие), что эффекторная функция указанной молекулы повышена относительно молекулы, содержащей Fc-область дикого типа, необязательно отличающиеся тем, что указанный вариант Fc-области включает замену в любом одном или нескольких положениях из 329, 298, 330, 332, 333 и/или 334 (например, замены S239D, S298A, A330L, I332E, Е333А и/или K334A).

Согласно одному из вариантов реализации антитела, содержащие вариантные Fc-области или Fc-области дикого типа, могут иметь измененные паттерны гликозилирования, увеличивающие связывающую способность антител в отношении Fc-рецептора. Такие углеводные модификации могут быть осуществлены путем, например, экспрессирования антитела в хозяйской клетке с измененными механизмами гликозилирования. Клетки с измененными механизмами гликозилирования описаны в данной области техники и могут применяться в качестве клеток-хозяев для экспрессирования рекомбинантных антител согласно настоящему изобретению для получения антитела с измененным гликозилированием. См., например, источники: Shields, R.L. et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech. 17:176-1, а также европейский патент №EP1176195; РСТ-публикации WO 06/133148; WO 03/035835; WO 99/54342, каждый из которых полностью включен в настоящий документ посредством ссылки.

Как правило, такие антитела с измененным гликозилированием «глико-оптимизированы» таким образом, что антитело содержит конкретную структуру N-гликанов, обеспечивающую определенные нужные свойства, включая, но не ограничиваясь перечисленными, повышенные АЗКЦ и связывающую активность в отношении рецепторов эффекторных клеток по сравнению с немодифицированными антителами или антителами, содержащими встречающуюся в природе константную область и продуцируемыми клетками мышиной миеломы NSO и клетками яичника китайского хомячка (СНО) (Chu and Robinson, Current Opinion Biotechnol. 2001, 12:180-7), антителами экспрессируемыми в HEK293T согласно описанию в разделе «Примеры» настоящего документа или хозяйскими клетками других клеточных линий млекопитающих, общеупотребительных для получения рекомбинантных терапевтических антител.

Моноклональные антитела, синтезированные в хозяйских клетках млекопитающих, содержат участок N-связанного гликозилирования в положении Asn297 каждой тяжелой цепи. Гликаны на антителах представляют собой, как правило, комплексные биантенарные структуры, содержащие очень незначительное количество или не содержащие N-ацетилглюкозамин в точках ветвления (GlcNAc в точках ветвления) и высокие уровни корового фукозилирования. Концы гликанов содержат очень незначительное количество концевой сиаловой кислоты, либо вообще не содержат концевой сиаловой кислоты, и варьирующее количество галактозы. Обзор влияния гликозилирования на функции антител можно найти, например, в источнике Wright&Morrison, Trend Biotechnol.15:26-31(1997). В значительном количестве работ показано, что изменения состава Сахаров гликановой структуры указанного антитела могут менять эффекторные функции Fc. Важными углеводными структурами, вносящими вклад в активность антитела, предположительно являются остатки фукозы, присоединенные посредством альфа-1,6-связи к внутренним остаткам N-ацетилглюкозамина (GlacNAc) N-связанных олигосахаридов Fc-области (Shields et al., 2002).

Для связывания FcγR необходимо присутствие олигосахаридов, ковалентно связанных с консервативным Asn297 Fc-области IgG1, IgG2 или IgG3 человека. Нефукозилированные олигосахаридные структуры недавно были ассоциированы с существенно повышенной АЗКЦ-активностыо in vitro. «Asn 297» согласно настоящему изобретению означает аминокислоту аспарагин, расположенную приблизительно в положении 297 Fc-области; во второстепенных вариантах последовательностей антител Asn297 может также быть расположен выше (как правило, не более чем +3 аминокислоты) или ниже на несколько аминокислот.

По имеющимся сведениям, приблизительно от 2 до 6% популяции антител, продуцируемых клетками СНО, не фукозилированы. Сообщалось, что клетки линии YB2/0 (миелома крысы) и Lecl3 (мутантная по лектину линия СНО, дефицитная по GDP-манноза-4,6-дегидратазе, что приводит к дефициту GDP-фукозы или промежуточных продуктов GDP-сахаров, которые являются субстратом альфа-6-фукозилтрансферазы) продуцируют антитела, 78-98% из которых являются нефукозилированными формами. Согласно другим примерам могут применяться РНК- интерференция (RNAi) или нокаутные техники для конструирования клеток либо для уменьшения уровней транскрипции иРНК FUT8, либо полного нокаутирования экспрессии гена; сообщалось, что такие антитела содержат до 70% нефукозилированного гликана.

Настоящее изобретение включает гликозилированное цепью сахара в положении Asn297 связывающееся с MICA антитело, причем указанное антитело демонстрирует повышенное сродство к связыванию Fc-участка с FcγRIII. Согласно одному варианту реализации настоящего изобретения антитело содержит константную область, содержащую по меньшей мере одну измененную аминокислоту в Fc-области, улучшающую связывание антитела с FcγRIIIa и/или повышающую АЗКЦ.

Согласно одному аспекту антитела согласно настоящему изобретению гипофукозилированы в константной области. Такие антитела могут содержать модификацию аминокислоты или могут не содержать модификаций аминокислот, но быть получены или обработаны в условиях, обеспечивающих такое гипофукозилирование. Согласно одному аспекту композиция с антителом согласно настоящему изобретению содержит гибридное антитело, антитело человека или гуманизированное антитело, описанные в настоящем документе, причем по меньшей мере 20, 30, 40, 50, 60, 75, 85, 90, 95% или по существу все указанные формы антитела в композиции содержат константную область, содержащую коровую углеводную структуру (например, комплексные, гибридные и высокоманнозные структуры), в которой отсутствует фукоза. Согласно одному из вариантов реализации предложена композиция с антителом, которая не содержит антител, содержащих коровую углеводную структуру с фукозой в составе. Указанный коровый углевод предпочтительно представляет собой цепь сахара на Asn297.

Согласно одному из вариантов реализации настоящее изобретение включает композицию с антителом согласно настоящему изобретению, например, композицию, содержащую антитела, которые связываются с MICA, гликозилированы цепью сахара в положении Asn297, отличающиеся тем, что указанные антитела частично фукозилироваиы. Частично фукозилированные антитела характеризуются тем, что доля антител против MICA в композиции, в которых отсутствует фукоза в составе сахарной цепи в положении Asn297, составляет от 20% до 90%, предпочтительно от 20% до 80%, предпочтительно от 20% до 50%, 55%, 60%, 70% или 75%, от 35% до 50%, 55%, 60%, 70% или 75%, или от 45% до 50%, 55%, 60%, 10% или 75%. Указанное антитело предпочтительно относится к типу IgG1 или IgG3 человека.

Указанная цепь сахара также может обладать любыми свойствами (например, наличие и относительное содержание комплексных, гибридных и высокоманнозных структур), в том числе содержать N-связанные гликаны, присоединенные к Asn297 антитела клетки человека, или антитела, рекомбинантно экспрессируемого в клетке грызуна, клетке мыши (например, клетке СНО) или клетке птицы.

Согласно одному из вариантов реализации указанное антитело экспрессируют в клетке, в которой отсутствует фермент фукозилтрансфераза, так что клетки указанной линии продуцируют белки без фукозы в коровых углеводах. Например, ген фукозилтрансферазы FUT8 (альфа-(1,6)-фукозилтрансфераза) отсутствует у клеточных линий Ms704, Ms705, и Ms709, таким образом, антитела, экспрессируемые в клетках линий Ms704, Ms705 и Ms709, не содержат фукозы на коровых углеводах. Указанные клеточные линии были получены путем направленного разрушения гена FUT8 в клетках CHO/DG44 с применением двух векторов замещения (см. патентную публикацию США №20040110704, Yamane et al.; и Yamane-Ohnuki et al. (2004) Biotechnol Bioeng 87:614-22, содержание которых включено в настоящий документ посредством ссылок). Другие примеры включали применение антисмыслового подавления, РНК-интерференции двуцепочечной РНК (дцРНК), РНК-интерференции шпилечной РНК (шРНК) или РНК-интерференции интрон-содержащей шпилечной РНК (ишРНК) для разрушения функции гена FUT8. Согласно одному из вариантов реализации указанное антитело экспрессируют в клеточной линии с функционально разрушенным геном FUT8, который кодирует фукозилтрансферазу, таким образом, что антитела, экспрессируемые в такой клеточной линии, гииофукозилироваиы за счет уменьшения количества или элиминирования фермента, ассоциированного с альфа-1,6-связями.

Согласно одному из вариантов реализации указанное антитело экспрессируют в клетках линий, сконструированных для экспрессии модифицирующих гликопротеины гликозилтрансфераз (например, бета(1,4)-N-ацетилглюкозаминил-трансферазы III (GnTHI)), так что в антителах, экспрессируемых в указанных сконструированных клеточных линиях, присутствуют большие количества GlcNac-структур в точках ветвления, что приводит к увеличению АЗКЦ-активности указанных антител (РСТ-публикация WO 99/54342, Umana et al.; и Umana et al. (1999) Nat. Biotech. 17:176-180, содержание которых включено в настоящий документ посредством ссылок).

Согласно другому варианту реализации указанное антитело экспрессируют и фукозильный остаток(s) расщепляют с применением фермента фукозидазы. Например, альфа-L-фукозидаза удаляет фукозильные остатки с антител (Tarentino, et al. (1975) Biochem. 14:5516-5523). В других примерах клетки линии, синтезирующей антитело, могут быть обработаны ингибитором гликозилирования; у Zhou et al., Biotech, and Bioengin. 99:652-665 (2008), описана обработка клеток СНО ингибитором альфа-маннозидазы I кифунензином, обеспечивающая синтез антител, содержащих нефукозилироваипые N-глюканы олигоманнозного типа.

Согласно одному из вариантов реализации антитело экспрессируют в клеточной линии, которой в естественных условиях свойственна низкая ферментативная активность в отношении присоединения фукозила к N-ацетилглюкозамину, который связывается с Fc-областыо указанного антитела, или не свойственная указанная ферментативная активность, например, в клеточной линии YB2/0 миеломы крыс (АТСС CRL 1662). Другой пример клеточных линий включает вариант клеточной линии СНО, клетки Led 3, с пониженной способностью к присоединению фукозила к Asn(297)-связанным углеводам, что также приводит к гипофукозилированию антител, экспрессируемых такой клеткой-хозяином (WO 03/035835 (Presta et al.); и Shields, RX. et al. (2002) J. Biol. Chem. 277:26733-26740, содержание которых включено в настоящий документ посредством ссылок). Согласно другому варианту реализации указанное антитело экспрессируют в клетке птицы, предпочтительно в клетке ЕВх® cell (Vivalis, Франция), которая в естественных условиях продуцирует антитела с низким содержанием фукозы, см., например, WO 2008/142124. Гипофукозилированные гликаны могут также быть получены в клетках линий растительного происхождения, см., например, WO 07/084926А2 (Biolex Inc.), WO 08/006554 (Greenovation Biotech GMBH), содержание которых включено в настоящий документ посредством ссылок.

Применение для диагностики и терапии

Согласно определенным вариантам реализации предложенные антитела применяют для очищения или идентифицирования положительных по MICA клеток из биологического образца. Биологические образцы могут быть получены от пациента, например, для диагностики, или ex vivo для терапевтических целей, или от индивидуумов или не являющихся человеком приматов для получения источника таких клеток для исследовательских целей.

Положительные по MICA клетки могут быть очищены или идентифицированы с применением предложенных антител с помощью любого из ряда стандартных способов. Например, клетки периферической крови могут быть отсортированы с помощью FACS-сканера с применением меченых антител, специфических в отношении MICA, и необязательно других молекул клеточной поверхности, как правило, присутствующих на клетках.

Кроме того, антитела согласно настоящему изобретению могут быть конъюгированы или ковалентно связаны с твердой подложкой и использованы для очищения или идентифицирования положительных по MICA клеток или любых клеток, экспрессирующие MICA, из биологического образца, например, из образца крови или биоптата ткани, полученного от пациента или другого индивидуума. В частности, биологический образец приводят в контакт с указанными антителами в условиях, позволяющих клеткам в составе образца связываться с антителом, и затем указанные клетки элюируют со связанного с твердой подложкой антитела.

Независимо от используемого способа выделения, очищения или идентификации положительных по MICA клеток, такая возможность полезна для решения разнообразных задач, например, для диагностики расстройства, характеризующегося патогенной размножением MICA-экспрессирующих клеток, путем оценки количества или активности, либо других характеристик положительных по MICA клеток, полученных от пациента, или для оценки способности антител согласно настоящему изобретению, их фрагментов или производных к модулированию активности или поведения клеток пациента, например, перед одним из описанных в настоящем документе способов лечения с применением указанных антител. Далее, очищенные положительные по MICA клетки подходят в контексте исследования, например, для более полного изучения клеток, различных их свойств и поведения, а также для идентификации соединений или способов, которые могут применяться для модулирования их поведения, активности или пролиферации. Антитела согласно настоящему изобретению также могут подходить для применения в способах диагностики, например, способах обнаружения полипептидов MICA на клетках, например, пораженных заболеванием клетках пациента.

В настоящем изобретении также предложены фармацевтические композиции, содержащие антигенсвязывающий агент (например, антитело) согласно настоящему изобретению, которое специфически связывается с полипептидами MICA на поверхности клеток. Указанное антитело предпочтительно подавляет рост или активность указанных клеток и/или вызывает элиминацию указанных положительных по MICA клеток, предпочтительно через индуцирование КЗЦ и/или АЗКЦ. Указанная композиция также содержит фармацевтически приемлемый носитель.

В настоящем изобретении также предложен способ подавления роста или активности, и/или истощения положительных по MICA клеток у нуждающегося в этом пациента, включающие этап введения указанному пациенту композиции согласно настоящему изобретению. Такие способы могут применяться для лечения ряда расстройств, в том числе лечения раковых заболеваний, но не ограничиваясь ими.

Как было показано в настоящем документе, неблокирующие антитела против MICA эффективны, в частности, для индуцирования лизиса MICA-экспрессирующих клеток эффекторными клетками. Указанные антитела обладают двойным механизмом действия; связывают MICA и задействуют активирующие Fcγ рецепторы на эффекторных клетках, они индуцируют лизис эффекторными клетками; за счет отсутствия блокирования NKG2D-сигнализации они предотвращают нейтрализацию опосредованной NKG2D активации реакционной способности НК-клеток; либо блокируют NKG2D сигнализацию и уменьшая sMICA-индуцированное понижающее модулирование NKG2D. Указанные антитела предпочтительно содержат последовательности константных областей тяжелых цепей человека, обуславливающие истощение MICA-экспрессирующих клеток (например, опухолевых клеток), с которыми они связаны, и предпочтительно содержат Fc-участок, который индуцирует КЗЦ и/или АЗКЦ. Указанная композиция также содержит фармацевтически приемлемый носитель. Такие композиции также называют «композиции с антителами» согласно настоящему изобретению. Согласно одному из вариантов реализации композиции с антителами согласно настоящему изобретению содержат антитело, описанное в вариантах реализации антител выше.

Согласно одному аспекту способы лечения согласно настоящему изобретению включают введение индивидууму композиции, содержащей антигенсвязывающее соединение, связывающее MICA, в терапевтически эффективном количестве. Терапевтически эффективное количество может быть, например, достаточным для того, чтобы стимулировать истощение MICA-клеток in vivo, или увеличение частоты встречаемости активированных реакционноспособных, цитотоксических NKG2D+ эффекторных клеток, и/или синтез ИФНγ NKG2D+ эффекторными клетками (например, НК-клетками) в отношении MICA-экспрессирующих опухолевых клеток.

Способы согласно настоящему изобретению применяют предпочтительно для лечения раковых заболеваний и других пролиферативных заболеваний, включая, но не ограничиваясь перечисленными, карциному, включая карциному мочевого пузыря, молочной железы, толстой кишки, почки, печени, легкого, яичника, предстательной железы, поджелудочной железы, желудка, шейки (матки), щитовидной железы и кожи, включая плоскоклеточную карциному; опухоли кроветворной ткани лимфоидного ряда, включая лейкоз, острый лимфоцитарный лейкоз, острый лимфобластный лейкоз, В-клеточную лимфому, Т-клеточную лимфому, лимфому Ходжкина, неходжскинскую лимфому, лимфому ворсистых клеток и лимфому Беркитта; опухоли кроветворной ткани миелоидного ряда, включая острые и хронические миелобластные лейкозы и промиелолейкоз; опухоли мезснхимального происхождения, включая фибросаркому и рабдомиосаркому; другие опухоли, включая нейробластому и глиому; опухоли центральной и периферической нервной системы, включая астроцитому, нейробластому, глиому и шваиномы; опухоли мезенхимального происхождения, включая фибросаркому, рабдомиосаркому и остеосаркому; и другие опухоли, включая меланому, пигментную ксеродерму, кератоакантому, семиному, фолликулярный рак щитовидной железы и тератокарциному. Другие примеры расстройств, лечение которых может проводиться согласно настоящему изобретению, включают опухоли кроветворной ткани лимфоидного ряда, например, Т-клсточные и В-клеточные опухоли, включая, но не ограничиваясь перечисленными, расстройств Т-клеток, такие как Т-клеточный пролимфоцитарный лейкоз (T-PLL), включая мелкоклеточный и медуллярный; лейкоз больших гранулярных лейкоцитов (БГЛ) предпочтительно Т-клеточного типа; синдром Сезари (SS); Т-клеточный лсйкоз/лимфома взрослых (ATLL); альфа/дельта-Т-клеточная неходжкинская лимфома печени и селезенки; периферическая/поеттимусная Т-клеточная лимфома (плеоморфный и иммунобластный подтипы); Т-клеточная ангиоиммунобластная лимфома; аш иоцентрическая (назальная) Т-клеточная лимфома; анапластическая (Ki 1+) крупноклеточпая лимфома; Т-клеточная лимфома желудочно-кишечного тракта; Т-лимфобластная; и лимфома/лейкоз (T-Lbly/T-ALL).

Согласно некоторым вариантам реализации до введения указанного антитела или композиции с антителом против MICA оценивают присутствие MICA на клетках (например, опухолевых клетках) пациента, например, для определения относительного уровня и активности положительных по MICA клеток у пациента, а также для подтверждения эффективности указанных антител для связывания с клетками пациента. Пациент, опухолевые клетки которого экспрессируют MICA, может в этом случае получать лечение анти-MICA антителом или композицией. Это может быть осуществлено путем получения образца ЛПК или опухолевых клеток из участка локализации указанного расстройства, и тестирования, например, с применением иммунологического анализа, для определения относительного поверхностного расположения MICA и необязательно также других маркеров на указанных клетках. Для обнаружения экспрессии MICA и других генов могут также применяться другие способы, такие как способы на основе РНК, например, ПЦР с обратной транскрипцией или нозерн-блоттинг.

Согласно одному из вариантов реализации в тех случаях, когда требуется подавление активности или роста, или истощение положительных по MICA клеток пациента, оценивают способность указанного антитела против MICA подавлять пролиферацию или истощать положительные по MICA клетки пациента. В том случае, если положительные по MICA клетки истощают с применением антитела или композиции против М1СЛ, отвечает ли пациент на терапию антителом против MICA или анти-MICA композицией, и указанный пациент необязательно получает лечение антителом или композицией против MICA.

Указанное лечение может включать несколько циклов введения антитела или соединения. Например, после начального цикла введения, уровень и/или активность MICA-экспрессирующих клеток (например, злокачественных опухолевых клеток), у пациента обычно повторно измеряют, и в том случае, если уровни все еще повышены, может быть проведен дополнительный цикл введения. Таким образом может быть проведено несколько циклов обнаружения MICA и введения антитела или соединения, например, до тех пор, пока не будет достигнут контроль над расстройством.

Согласно некоторым вариантам реализации указанный способ может включать дополнительный этап введения указанному пациенту подходящего дополнительного (второго) терапевтического агента, выбранного из иммуномодулирующего агента, гормонального агента, химиотерапевтического агента или второго антитела (например, истощающего антитела), которое связывается с полипептидом, присутствующим на MICA-экспрессирующей клетке. Такие дополнительные агенты могут вводиться указанному пациенту в составе одной лекарственной формы совместно с указанным антителом, или в виде отдельной лекарственной формы. Дозировка указанного антитела (или антитела и дополнительного терапевтического агента в совокупности) достаточна для детектируемого индуцирования, стимуляции и/или усиления терапевтического ответа у пациента. При раздельном введении указанное антитело, фрагмент или производное и дополнительный терапевтический агент предпочтительно вводят в условиях (например, в отношении времени, количества доз и т.д.), обеспечивающих детектируемый совокупный благоприятный терапевтический эффект у пациента.

При лечении опухолей (например, солидных опухолей) введение композиции согласно настоящему изобретению может применяться, например, в комбинации с классическими методами, такими как хирургические, радиологические, химиотерапевтические и т.п. Таким образом, в настоящем изобретении предложена комбинированная терапия, при которой описанные антитела применяют одновременно, до или после хирургического лечения или лучевой терапии; или вводят пациентам при введении, до введения или после введения стандартных химиотерапевтических, радиотерапевтических или антиангиогенных агентов, иммунотоксинов с направленным действием или коагулигандов.

Примеры противораковых антиангиогенных агентов подавляют сигнализацию через рецепторные тирозинкиназы, включая, но не ограничиваясь перечисленными, FGFR (рецептор фактора роста фибробластов, FGF-1,2), PDGFR (рецептор тромбоцитарного фактора роста), рецепторы ангиопоэтинов (Ang-1,2), HGFR (рецептор гепатоцитарыого фактора роста), эфриновый рецептор (Eph), VEGFR1, VEGFR-2,3 PDGFR-α, PDGFR-β, CSF-1R, MET, Flt-3, c-kit, BCR/ABL, р38-альфа и FGFR-1. Также антиангиогенные агенты могут включать агенты, которые ингибируют один или более различных регуляторов экспрессии и синтеза фактора роста эндотелия сосудов VEGF, таких как EGFR, flt-1, KDR, HER-2, СОХ-2 или HIF-1α. Другой предпочтительный класс агентов включает IMiD (иммуномодулирующие лекарственные средства), аналоги, полученные из талидомида, с широким спектром действия, включая связанные и не связанные с иммунитетом эффекты. К представителям класса IMiD относятся СС-5013 (леналидомид, Revlimid™), СС-4047 (Actimid™) и ENMD-0995. Другой класс антиангиогенных агентов включает циленгитид (EMD 121974, ингибитор интегрина), металлопротеиназы (МРР), такие как маримастат (ВВ-251). Другой класс антиангиогенных агентов включает ингибиторы фарнесилирования, такие как лонафарниб (Sarasar™), типифарниб (Zarnestra™). Также могут подходить другие антиангиогенные агенты, такие как бевацизумаб (моноклональное антитело, подавляющее VEGF-A (ФРЭС-А), Genentech); IMC-1121B (моноклональное антитело, подавляющее VEGFR-2, ImClone Systems); CDP-791 (пегилированный DiFab, VEGFR-2, Celltech); 2C3 (моноклональное антитело, VEGF-A, Peregrine Pharmaceuticals); VEGF-TRAP (растворимый гибридный рецептор VEGF-A, P1GF (фактор роста плаценты) Aventis/Regeneron). Другой предпочтительный класс агентов включает ингибиторы тирозинкиназ (TKI), в том числе, например, РТК-787 (TKI, VEGFR-1,-2, ваталаниб, Novartis); АЕЕ788 (TKI, VEGFR-2 и EGFR, Novartis); ZD6474 (TKI, VEGFR-1,-2,-3, EGFR, зактима, AstraZeneca); AZD2171 (TKI, VEGFR-1,-2, AstraZeneca); SU11248 (TKI, VEGFR-1,- 2, PDGFR, сунитиниб, Pfizer); AG13925 (TKI, VEGFR-1,-2, Pfizer); AG013736 (TKI, VEGFR-1, -2, Pfizer); CEP-7055 (TKI, VEGFR-1,-2,-3, Cephalon); CP-547,632 (TKI, VEGFR-1,-2, Pfizer); GW786024 (TKI, VEGFR-1,-2,-3, GlaxoSmithKline); GW786034 (TKI, VEGFR-1,-2,-3, GlaxoSmithKline); сорафениб (TKI, Bay 43-9006, VEGFR-1,-2, PDGFR Bayer/Onyx); SU4312 (TKI, VEGFR, PDGFR, Pfizer), AMG706 (TKI, VEGFR-1,-2,-3, Amgen), XL647 (TKI, EGFR, HER2, VEGFR, ErbB4, Exelixis), XL999 (TKI, FGFR, VEGFR, PDGFR, Flt-3, Exelixis), PKC412 (TKI, KIT, PDGFR, PKC, FLT3, VEGFR-2, Novartis), AEE788 (TKI, EGFR, HER2, VEGFR, Novartis), OSI-930 (TKI, c-kit, VEGFR, OSI Pharmaceuticals), OSI-817 (TKI, c-kit, VEGFR, OSI Pharmaceuticals), DMPQ (TKI, ERGF, PDGFR, erbB2, p56, pkA, pkC), MLN518 (TKI, FLT3, PDGFR, c-kit, CT53518, Millennium Pharmaceuticals), лестауриниб (TKI, FLT3, CEP-701, Cephalon), ZD1839 (TKI, EGFR, гефитиниб, Иресса, AstraZeneca), OSI-774 (TKI, EGFR, эрлотиниб, Тарцева, OSI Pharmaceuticals), лапатиниб (TKI, ErbB-2, EGFR, GD-2016, Тайкерб, GlaxoSmithKline). Наиболее предпочтительными являются ингибиторы тирозинкиназ, подавляющие одну или более рецепторных тирозинкиназ, выбранных из группы, состоящей из VEGFR-1, VEGFR-2, VEGFR-3, PDGFR-α, β, Flt-3, c-kit, р38-альфа, MET, c-RAF, b-RAF, bcr/abl и FGFR-1.

Согласно одному из вариантов реализации второй агент представляет собой естественный лиганд активирующего рецептора эффекторной клетки (например, НК-клетки) или антитело, которое связывает и активирует активирующий рецептор НК-клетки, представляющий собой не NKG2D. Согласно одному варианту реализации указанный агент представляет собой агент, который увеличивает содержание естественного лиганда активирующего рецептора НК-клетки, не являющегося NKG2D, на поверхности целевой клетки (например, инфицированных клеток, опухолевых клеток, провоспалительных клеток). Активирующие рецепторы НК-клеток включают, например, естественные рецепторы цитотоксичности, такие как NKp30, NKp46, NKp44 или активирующие рецепторы KIR (рецепторы KIR2DS, KIR2DS2, KIR2DS4). В настоящем документе термин «активирующий НК-рецептор» относится к любой молекуле на поверхности НК-клеток, при стимуляции вызывающей измеримое увеличение любого известного в данной области техники свойства или активности, связанного с активностью НК, например, синтеза цитокинов (например, ИФН-γ и ФНО-α)), увеличение внутриклеточных уровней свободного кальция, способности нацеливания на клетки в анализе перенаправленного киллинга согласно описанию, например, где-либо в тексте настоящего документа, или способности стимулировать пролиферацию НК-клеток.

Термин «активирующий НК-рецептор» включает, не ограничиваясь перечисленными, активирующие формы или белки KIR (например, белки KIR2DS), NKp30, NKp46, NKp44, NKG2D, HJI-2R, HJI-12R, HH-15R, HJI-18R и HJ1-21R.

Согласно одному из вариантов реализации указанный противораковый агент представляет собой химиотерапевтический агент или облучение, повышающе регулирующий(ее) экспрессирование лигандов NKG2D на поверхности опухолевых клеток, включая хорошо известные химиотерапевтические препараты, в том числе ионизирующее и ультрафиолетовое излучение, ингибиторы репликации ДНК, ингибиторы ДНК-полимеразы, хроматин-модифицирующие процедуры, а также индуцирующие апоптоз агенты, такие как ингибиторы HDAC трихостатин А и вальпроевая кислота. Предпочтительной терапией является терапия, активирующая путь ответа на повреждения ДНК, более предпочтительно - активирующая протеинкиназы ATM (активируемой мутациями атаксии-телеангиэктазии, «Ataxia-Telangiectasia-Mutated»), ATR (ATM и Rad3-связанная) или СНК1, или даже СНК2 или р53. Примерами последнего варианта являются ионизирующее излучение, ингибиторы репликации ДНК, ингибиторы ДНК-полимеразы и модифицирующие хроматин агенты, или лечение, задействующее ингибиторы HDAC. Композиции, которые повышающе регулируют лиганды NKG2D, описаны также у Gasser et al. (Gasser et al. (2005) Nature 436(7054):1186-90). NKG2D представляет собой активирующий рецептор, взаимодействующий с ГКГС класса I-связанными гликопротеинами MICA и MICB, помимо других лигандов. MICA и MICB (Bauer et al. (1999) Science 285:727-729, содержание которого включено в настоящий документ посредством ссылки) не играют роли в презентации антигена, обычно обнаруживаются только в кишечном эпителии, и могут быть индуцированы стрессом в пермиссивных типах клеток при вирусных и бактериальных инфекциях, злокачественной трансформации и пролиферации. NKG2D представляет собой лектиноподобный активирующий рецептор С-типа, передающий сигнал через сопряженный адаптерный белок DAP 10, сходный с CD28. Он экспрессируется на большинстве естественных киллеров (НК-клеток), NKT-клетках, γδ Т-клетках, CD8 Т-клетках и Т-клетках, но, как правило, не на CD4 Т-клетках. Другие лиганды NKG2D включают белки ULBP, например, ULBP-1, -2, и -3, изначально идентифицированные как лиганды гликопротеина UL16 цитомегаловируса человека (Cosman et al., (2001) Immunity 14: 123-133, содержание которого включено в настоящий документ посредством ссылки). Также лиганды NKG2D включают RAE1TG, являющийся представителем ULBP-подобного семейства белков (Bacon et al. (2004) J. Immunol. 173:1078-1084).

Также противораковые агенты включают алкилирующие агенты, цитотоксические антибиотики, такие как ингибиторы топоизомеразы I, ингибиторы топоизомеразы II, растительные производные, РНК/ДНК-антиметаболиты и антимитотические агенты. Предпочтительные примеры могут включать, например, цисплатин (CDDP), карбоплатин, прокарбазин, мехлорэтамин, циклофосфамид, камптотецин, ифосфамид, мелфалан, хлорамбуцил, бусульфан, нитрозомочевину, дактиномицин, даунорубицин, доксорубицин, блеомицин, пликамицин, митомицин, этопозид (VP 16), тамоксифен, ралоксифен, таксол, гемцитабин, навелбин, трансплатину, 5-фторурацил, винкристин, винбластин и метотрексат, или любой аналогичный вариант или производное перечисленных агентов.

Алкилирующие агенты представляют собой вещества, образующие соединения, которые обладают высокой химической реакционноспособностыо и быстро образуют ковалентные связи с подходящими веществами. Одной из таких мишеней является ДНК, не в обычном состоянии, а при распаривании двойной спирали хеликазами. Это делает доступной «внутреннюю» поверхность ДНК, подверженной алкилированию. Большинство алкилирующих агентов являются биполярными, т.е. содержат две группы, способные вступать в реакцию с ДНК. Они могут, соответственно, образовывать «мостики» между двумя участками одной цепи ДНК или двумя отдельными цепями; при любом из этих вариантов нарушается работа ферментов, вовлеченных в процесс репликации, которые не способны осуществить свою функцию. Впоследствии клетка погибает либо ввиду физической неспособности к делению, либо ввиду стимуляции апоптоза аномальной ДНК. Примеры включают азотистые иприты (например, хлорамбуцил, циклофосфамид), нитрозомочевины (например, кармустин, ломустин), соли металлов (например, цисплатин, карбоплатин, оксалиплатин), производные этиленамина (например, тиотепа), алкилсульфонаты (например, бусульфан) и триазены (например, дакарбазин).

Антиметаболиты представляют собой группу химических веществ, аналогичных по структуре или функциям встречающимся в природе метаболитам, необходимым для синтеза нуклеиновых кислот.Молекулы антиметаболитов имитируют обычные метаболиты и либо блокируют ферменты, ответственные за синтез нуклеиновых кислот, либо встраиваются в ДНК, что приводит к появлению ошибочного генетического кода и апоптозу. Существует три основных класса антиметаболитов. Фолат представляет собой вещество, необходимое для синтеза молекул пурина. Аналоги фолатов (например, метотрексат, ралтитрексед) схожи с молекулами фолата - такие вещества, как метотрексат, могут применяться для подавления фермента дигидрофолатредуктазы, приводя к недостаточному синтезу пурина тимина. Аналоги пиримидина (например, цитарабин, фторацил (5-FU), гемцитабин) напоминают молекулы пиримидина и действуют либо путем ингибирования синтеза нуклеиновых кислот (например, фторурацил), либо встраиваясь в ДНК (например, цитарабин). Аналоги пуринов (например, меркаптопурин, тиогуанин, кладрибин, флюдарабин) функционируют сходным с аналогами пиримидина образом, однако могут иметь дополнительные (неблагоприятные) механизмы действия.

Цитотоксические антибиотики имеют такое название, поскольку все они происходят из природного источника, группы бактерий Streptomyces. Они влияют на функции и синтез нуклеиновых кислот различным образом. Антрациклиновая группа включает доксорубицин, даунорубицин и идарубицин. Они интеркалируют с ДНК и действуют на фермент топоизомеразу II. Данная ДНК-гираза расщепляет двойную спираль ДНК и воссоединяет ее при высвобождении скручивающих сил; антрациклины стабилизируют комплекс ДНК-топоизомераза II и, соответственно, предотвращают воссоединение цепей. У дактиномицина и митоксантрона аналогичный механизм действия. Блеомицин вызывает фрагментацию цепей ДНК. Митомицин функционирует сходным с алкилирующими агентами образом, вызывая поперечное сшивание ДНК.

Растительные производные включают алкалоиды барвинка, такие как винкристин и винбластин, которые связываются с предшественниками микротрубочек, предотвращая их образование. Это подавляет процесс митоза. Таксаны (паклитаксел и доцетаксел) также действуют на микротрубочки. Они стабилизируют их в полимеризованном состоянии, что тоже приводит к остановке митоза. Производные подофиллума (Podophyllum), такие как этопозид и тенипозид, предположительно подавляют топоизомеразу II, тогда как иринотекан и топотекан подавляют топоизомеразу I.

При лечении инфекционных заболеваний может быть задействована композиция согласно настоящему изобретению, отдельно или в комбинации с другой терапией и/или терапевтическими агентами, которые, как известно, подходят для лечения таких заболеваний, включая противовирусные агенты, противогрибковые агенты, антибактериальные агенты, антибиотики, противопаразитические агенты и антипротозойные агенты. Если указанные способы включают дополнительное лечение дополнительными терапевтическими агентами, указанные агенты могут вводиться совместно с антителами согласно настоящему изобретению либо в виде единой лекарственной формы, либо в виде нескольких отдельных лекарственных форм. При введении в виде отдельной лекарственной формы дополнительный агент может вводиться до, во время или после введения антитела согласно настоящему изобретению.

Также может быть целесообразным применение способов и антител согласно настоящему изобретению, в частности, неистощающих антител, блокирующих взаимодействие между MICA и NKG2D и/или подавляющих MICA-индуцированную активность NKG2D, для лечения воспалительных и аутоиммунных расстройств. Примеры аутоиммунных или воспалительных состояний или расстройств, для лечения которых подходят полипептиды, антитела и другие соединения согласно настоящему изобретению, включают, не ограничиваясь перечисленными, системную красную волчанку, ревматоидный артрит, ювенильный хронический артрит, псориатический артрит, остеоартрит, спондилоартропатии (анкилозирующий спондилит), системный склероз (склеродермию), идиопатические воспалительные миопатии (дерматомиозит, полимиозит), синдром Шегрена, васкулит, системный васкулит, височный артериит, атеросклероз, саркоидоз, миастению гравис, аутоиммунную гемолитическую анемию (иммунную панцитопению, пароксизмальную ночную гемоглобинурию), пернициозную анемию, аутоиммунную тромбоцитопению (идиопатическую тромбоцитопеническую пурпуру, иммуноопосредованную тромбоцитопению), тиреоидит (болезнь Грейвса, тиреоидит Хашимото, ювенильный лимфоцитарный тиреоидит, атрофический тиреоидит), сахарный диабет, иммуноопосредованное заболевание почек (гломерулонефрит, тубулоинтерстициальный нефрит, аутоиммунный оофорит), аутоиммунный орхит, аутоиммунный увеит, антифосфолипидный синдром, демиелинизирующие заболевания центральной и периферической нервной системы, такие как рассеянный склероз, идиопатическая демиелинизирующая полинейропатия или синдром Гийена-Барре, хроническая воспалительная демиелинизирующая полинейропатия, заболевания гепатобилиарной системы, такие как инфекционный гепатит (гепатит А, В. С, D, Е и другие негепатотропные вирусы), аутоиммунный хронический активный гепатит, вирусный гепатит, первичный билиарный цирроз, гранулематозный гепатит, гранулематоз Вегенера, болезнь Бехчета и склерозирующий холангит, воспалительные заболевания кишечника, такие как язвенный колит или болезнь Крона, глютеновая болезнь, глютензависимая энтеропатия и синдром Уипла, аутоиммунное или иммуноопосредованные заболевания кожи, включая буллезные заболевания кожи, мультиформную эритему, контактный дерматит, герпетиформный дерматит, псориаз, обыкновенную пузырчатку, витилиго (лейкодерму), аллергические заболевания, такие как астма, аллергический ринит, атопический дерматит, пищевая гиперчувствительность и крапивница, иммунологические заболевания легких, такие как эозинофильная пневмония, идиопатический легочный фиброз и гиперчувствительный пневмонит, хроническая обструктивная болезнь легких, и связанные с трансплантацией заболевания, включая отторжение трансплантата и реакции «трансплантат против хозяина».

При лечении воспалительных или аутоиммунных заболеваний антителом против MICA способы лечения согласно настоящему изобретению могут также включать лечение индивидуума вторым терапевтическим агентом, включая агенты, обычно используемые с конкретной терапевтической целью, для которой вводят указанное антитело. Указанный второй терапевтический агент обычно вводят в количествах, как правило, используемых для такого агента при монотерапии конкретного заболевания или состояния, лечение которого проводится. Согласно одному из вариантов реализации второй терапевтический агент вводят в меньшей дозе, чем обычно принимаемая за эффективную; например, согласно различным вариантам реализации, композиция содержит дозу, составляющую менее чем приблизительно 10-75% от обычно принимаемой за эффективную. Указанный второй терапевтический агент предпочтительно представляет собой агент, снижающий уровень протеолитических ферментов, медиатор воспаления или провоспалительный цитокин, такой как ФНО-α и/или интерлейкин-1 (ИЛ-1). Второй терапевтический агент предпочтительно представляет собой БПРП или МБП, необязательно также при этом второй терапевтический агент представляет собой метотрексат (Ревматрекс (Rheumatrex™), Трексалл (Trexall™)), гидроксихлорохин (Плаквенил, Plaquenil™), сульфасалазин (Азулфидин, Azulfidine®), лефлуномид (Арава, Arava™), ингибитор фактора некроза опухоли (например, растворимый рецептор ФНОα, такой как этанерцепт (Энбрел, Enbrel®), нейтрализующее (предпочтительно неистощающее) антитело против ФНОα, такое как адалимумаб (Хумира, Humira™) или цертолизумаб пегол (Цимзиа, Cimzia™)), блокирующий костимулирующие сигналы Т-клеток агент (например, абатацепт (Оренсия, Orencia™)), терапевтический антагонист рецептора интерлейкина-1 (ИЛ-1) (анакинра (Кинерет, Kineret™)), антитело против BlyS (Бенлиста, Benlysta™), ингибитор протеосомы (например, бортезомиб), ингибитор тирозинкиназ, внутримышечное золото или другой иммуномодулирующий или цитотоксичный агент (например, азатиоприн (Имуран, Imuran™), циклофосфамид, циклоспорин А (Неорал (Neoral™), Сандиммун (Sandimmune™)) или ингибитор киназ (например, ингибитор SYK-киназы, такой как фостаматиниб (R788) или JAK1, ингибиторы JAK2, такие как INCB28050, танезумаб или тазоцитиниб (СР-690,550)).

При лечении с применением способов согласно настоящему изобретению антигенсвязывающее соединение согласно настоящему изобретению и второй терапевтический агент могут вводиться отдельно, совместно или последовательно, или в виде коктейля. Согласно некоторым вариантам реализации антигенсвязывающее соединение согласно настоящему изобретению вводят до введения второго терапевтического агента. Например, антигенсвязывающее соединение согласно настоящему изобретению может вводиться приблизительно за 0-30 дней до введения второго терапевтического агента. Согласно некоторым вариантам реализации антигенсвязывающее соединение согласно настоящему изобретению вводят от приблизительно 30 минут до приблизительно 2 недель, от приблизительно 30 минут до приблизительно 1 недели, от приблизительно 1 часа до приблизительно 2 часов, от приблизительно 2 часов до приблизительно 4 часов, от приблизительно 4 часов до приблизительно 6 часов, от приблизительно 6 часов до приблизительно 8 часов, от приблизительно 8 часов до 1 дня, или от приблизительно 1 до 5 дней до введения второго терапевтического агента. Согласно некоторым вариантам реализации антигенсвязывающее соединение согласно настоящему изобретению вводят одновременно с введением указанных терапевтических агентов. Согласно некоторым вариантам реализации антигенсвязывающее соединение согласно настоящему изобретению вводят после введения второго терапевтического агента. Например, антигенсвязывающее соединение согласно настоящему изобретению может вводиться приблизительно через 0-30 дней после введения второго терапевтического агента. Согласно некоторым вариантам реализации антигенсвязывающее соединение согласно настоящему изобретению вводят от приблизительно 30 минут до приблизительно 2 недель, от приблизительно 30 минут до приблизительно 1 неделя, от приблизительно 1 часа до приблизительно 2 часов, от приблизительно 2 часов до приблизительно 4 часов, от приблизительно 4 часов до приблизительно 6 часов, от приблизительно 6 часов до приблизительно 8 часов, от приблизительно 8 часов до 1 дня, или от приблизительно 1 до 5 дней после введения второго терапевтического агента.

Антигенсвязывающие соединения согласно настоящему изобретению могут быть включены в состав наборов. Указанные наборы могут необязательно также содержать любое число антител и/или другие соединений, например, 1, 2, 3, 4, или любое другое число антител против MICA и/или другие соединения. Следует иметь в виду, что настоящее описание состава наборов не является каким-либо образом ограничивающим. Например, указанный набор может включать другие типы терапевтических или диагностических агентов. Предпочтительно, указанные наборы также включают инструкции для применения указанных антител и/или агентов, например, подробное описание представленных в настоящем документе способов.

Фармацевтические составы

Фармацевтически приемлемые носители, подходящие для применения в указанных композициях включают, не ограничиваясь перечисленными, ионообменные вещества, окись алюминия, стеарат алюминия, лецитин, сывороточные белки, такие как сывороточный альбумин человека, буферные вещества, такие как фосфаты, глицин, сорбиновая кислота, сорбат калия, смеси неполных глицеридов насыщенных растительных жирных кислот, воду, соли или электролиты, такие как протаминсульфат, вторичный гидрофосфат натрия, гидрофосфат калия, хлорид натрия, соли цинка, коллоидный диоксид кремния, трисиликат магния, поливинилпирролидон, вещества на основе целлюлозы, полиэтиленгликоль, натрия карбоксиметилцеллюлоза, полиакрилаты, воски, полиэтилен-полиоксипропилен-блокирующие полимеры, полиэтиленгликоль и ланолин. Антитела согласно настоящему изобретению могут применяться в способе модулирования, например, подавления активности MICA-экспрессирующих клеток у пациента. Указанный способ включает этап приведения указанной композиции в контакт с указанным пациентом. Такой способ подходит как для профилактических, так и для терапевтических целей.

Для применения у пациента композицию вводят в состав для введения пациенту. Композиции согласно настоящему изобретению могут вводиться перорально, парентерально, в виде ингаляционного спрея, местно, ректально, назально, буккально, вагинально или через имплантированный резервуар. Применение согласно настоящему документу включает техники подкожного, внутривенного, внутримышечного, внутрисуставного, интрасиновиального, интрастернального, интратекального, внутрипеченочного, внутриочагового и внутричерепного инъецирования или инфузирования. Антитело может присутствовать в однократной дозе в количестве, например, от приблизительно 25 мг до 500 мг.

Стерильные инъецируемые формы композиций согласно настоящему изобретению могут быть представлены водной или масляной суспензией. Указанные суспензии могут быть получены в соответствии с методиками, известными в данной области техники, с применением подходящих диспергирующих или смачивающих агентов и суспендирующих агентов. Стерильные составы для инъекций также могут представлять собой стерильный(ую) раствор или суспензию для инъекций в нетоксичном приемлемом для парентерального применения разбавителе или растворителе, например, раствор в 1,3-бутандиоле. Среди приемлемых основ и растворителей, которые могут применяться, могут быть названы вода, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, общепринято применение в качестве растворителя или суспендирующей среды стерильных нелетучих масел. С этой целью может применяться любое мягкое нелетучее масло, включая синтетические моно- или диглицериды. Жирные кислоты, такие как олеиновая кислота и ее глицериды подходят для получения составов для инъекций, как и природные фармацевтически приемлемые масла, такие как оливковое масло или касторовое масло, в частности, их полиоксиэтилированные варианты. Указанные масляные растворы или суспензии могут также содержать длинноцепочечный спиртовой разбавитель или диспергирующий агент, такой как карбоксиметилцеллюлоза или аналогичные диспергирующие агенты, общеупотребительные при получении фармацевтически приемлемых лекарственных форм, в том числе эмульсий и суспензий. Другие общеупотребительные поверхностно-активные вещества, такие как твины, спаны и другие эмульгирующие агенты или повышающие биодоступность вещества, общеупотребительные при получении фармацевтически приемлемых твердых, жидких или других лекарственных форм, могут также применяться для получения составов.

Композиции согласно настоящему изобретению могут вводиться перорально в виде любой приемлемой для перорального применения лекарственной формы, включая, но не ограничиваясь перечисленными, капсулы, таблетки, водные суспензии или растворы. В случае таблеток для перорального применения общеупотребительные носители включают лактозу и кукурузный крахмал. Также, как правило, добавляют смазывающие агенты, такие как стеарат магния. Подходящие разбавители для перорального введения в форме капсул включают, например, лактозу. При получении водных суспензий для перорального применения активный ингредиент комбинируют с эмульгирующими и суспендирующими агентами. При необходимости могут добавляться также определенные подслащивающие, вкусоароматические или подкрашивающие агенты.

Как вариант, композиции согласно настоящему изобретению могут вводиться в форме суппозиториев для ректального введения. Последние могут быть получены путем смешивания агента с подходящим нераздражающим вспомогательным веществом, твердым при комнатной температуре, но жидким при ректальной температуре и, таким образом, расплавляющимся в прямой кишке с высвобождением лекарственного средства. Такие материалы включают масло какао, пчелиный воск и полиэтиленгликоли.

Композиции согласно настоящему изобретению могут также вводиться местно, в частности, когда мишени лечения включают области или органы, к которым имеется простой доступ для местного применения, в том числе при заболеваниях глаз, кожи или нижних отделов кишечника. Могут быть легко получены подходящие составы для местного применения для каждой(ого) из указанных областей или органов. Для местного применения указанные композиции могут быть введены в состав подходящей мази, содержащий активный компонент, суспендированный или растворенный в одном или нескольких носителях. Носители для местного нанесения соединений согласно настоящему изобретению включают, не ограничиваясь перечисленными, минеральное масло, жидкий вазелин, белый вазелин, пропиленгликоль, полиоксиэтилен, соединение полиоксипропилена, эмульгирующий воск и воду. Как вариант, указанные композиции могут входить в состав подходящего лосьона или крема, содержащего активные компоненты, суспендированные или растворенные в одном или нескольких фармацевтически приемлемых носителях. Подходящие носители включают, не ограничиваясь перечисленными, минеральное масло, сорбитан моностеарат, полисорбат 60, воск цетиловых сложных эфиров, цетеариловый спирт, 2-октилдодеканол, бензиловый спирт и воду.

Представленные антитела могут быть включены в состав наборов. Указанные наборы могут необязательно также содержать любое количество антител и/или других соединений, например, 1, 2, 3, 4 или любое другое количество терапевтических антител и/или соединений. Следует иметь в виду, что указанное описание состава наборов не является каким-либо образом ограничивающим. Например, указанный набор может включать другие типы терапевтических соединений. Указанные наборы предпочтительно также включают инструкции для применения антител, например, подробное описание представленных в настоящем документе способов.

Лекарственные формы

Терапевтические составы с антагонистами, применяемые в соответствии с настоящим изобретением, подготавливают для хранения путем смешивания антагониста нужной степени чистоты с необязательными фармацевтически приемлемыми носителями, вспомогательными веществами или стабилизаторами в форме лиофилизированных составов или водных растворов. Общую информацию по составам можно найти, например, в источниках: Gilman et al. (eds.), The Pharmacological Bases of Therapeutics, 8th Ed. (Pergamon Press, 1990); Gennaro (ed.), Remington's Pharmaceutical Sciences, 18th Edition (Mack Publishing Co., Easton, Pa., 1990); Avis et al. (eds.), Pharmaceutical Dosage Forms: Parenteral Medications (Dekker, New York, 1993); Lieberman et al. (eds.), Pharmaceutical Dosage Forms: Tablets (Dekker, New York, 1990); Lieberman et al. (eds.) Pharmaceutical Dosage Forms: Disperse Systems (Dekker, New York, 1990); и Walters (ed.), Dermatological and Transdermal Formulations (Drugs and the Pharmaceutical Sciences), Vol 119 (Dekker, New York, 2002).

Приемлемые носители, вспомогательные вещества или стабилизаторы нетоксичны для реципиентов в используемых дозировках и концентрациях и включают буферы, такие как фосфат, цитрат и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как хлорид октадецилдиметилбензиламмония; хлорид гексаметония; хлорид бензалкония, хлорид бензетония; феноловый, бутиловый или бензиловый спирт; алкилпарабены, такие как метилпарабен или пропилпарабен; катехин; резорцин; циклогексанол; 3-пентанол; и м-крезол); полипептиды с низким молекулярным весом (менее чем приблизительно 10 остатков); такие белки, как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин, или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие агенты, такие как этилендиаминтетрауксусная кислота (ЭТДК); сахара, такие как сахароза, маннит, трегалоза или сорбит; солеобразующие противоионы, например, натрия; металлокомплексы (например, комплексы Zn-белок); и/или неионные поверхностно-активные вещества, такие как Твин (TWEEN™), плюроники (PLURONICS™) или ПЭГ.

Примеры составов с антителами приведены, например, в WO 1998/56418, где описан жидкий многодозовый состав с антителом против CD20, содержащий 40 мг/мл ритуксимаба, 25 мМ ацетат, 150 мМ трегалозу, 0,9% бензилового спирта и 0,02% полисорбата 20™ при рН 5,0, с минимальным сроком годности 2 года при хранении при температуре 2-8°С. Другой представляющий интерес airra-CD20 состав содержит 10 мг/мл ритуксимаба в 9,0 мг/мл хлорида натрия, 7,35 мг/мл дигидрата цитрата натрия, 0,7 мг/мл полисорбата 80™ и стерильную воду для инъекций, рН 6,5.

Лиофилизированные составы, предназначенные для подкожного введения, описаны, например, в патенте США №6267958 (Andya et al.). Такие лиофилизированные составы могут быть восстановлены подходящим разбавителем до составов с высокой концентрацией белка, и указанный восстановленный состав может быть введен подкожно получающему лечение согласно настоящему изобретению млекопитающему.

Предложенный здесь состав может также содержать несколько активных соединений (второй медикамент, как отмечалось выше), предпочтительно обладающих дополнительными функциями, не влияющие друг на друга неблагоприятным образом. Тип и эффективные количества таких медикаментов зависят, например, от количества и типа В-клеточного антагониста присутствующего в составе, и от клинических показателей субъектов. Предпочтительные дополнительные медикаменты были перечислены выше.

Активные ингредиенты могут также быть заключены в микрокапсулы, полученные, например, с применением методик коацервации или межфазной полимеризации, например, гидроксиметилцеллюлозные или желатиновые микрокапсулы и поли-(метилметакрилатные) микрокапсулы, соответственно, в коллоидных системах доставки лекарств (например, липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсиях. Такие методики описаны, например, в пособии Remington's Pharmaceutical Sciences, см. выше.

Могут быть получены составы для пролонгированного высвобождения. Подходящие примеры составов для пролонгированного высвобождения включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащие антагонист; указанные матрицы выполнены в определенной форме, например, в виде пленки или микрокапсул. Примеры матриц для пролонгированного высвобождения включают полиэфиры, гидрогели (например, поли(2-гидроксиэтил-метакрилат) или поли(виниловый спирт)), полилактиды (патент США №3773919), сополимеры L-глутаминовой кислоты и γ-этил-b-глутамата, неразлагаемый этиленвинилацетат, разлагаемые сополимеры молочной кислоты - гликолевой кислоты, такие как Lupron Depot™ (инъецируемые микросферы, состоящие из сополимера молочной кислоты-гликолевой кислоты и ацетата лейпролида), и поли-D-(-)-3-гидроксимасляную кислоту.

Составы для применения при введении in vivo должны быть стерильными. Это легко достигается фильтрацией через стерильные фильтрационные мембраны. Фармацевтически приемлемые носители, подходящие для применения в указанных композициях, включают, не ограничиваясь перечисленными, ионообменные вещества, окись алюминия, стеарат алюминия, лецитин, сывороточные белки, такие как сывороточный альбумин человека, буферные вещества, такие как фосфаты, глицин, сорбиновая кислота, сорбат калия, смеси неполных глицеридов насыщенных растительных жирных кислот, вода, соли или электролиты, такие как протаминсульфат, вторичный гидрофосфат натрия, гидрофосфат калия, хлорид натрия, соли цинка, коллоидный диоксид кремния, трисиликат магния, поливинилпирролидон, вещества на основе целлюлозы, полиэтиленгликоль, натрия карбоксиметилцеллюлоза, полиакрилаты, воски, полиэтилен-полиоксипропилен- блокирующие полимеры, полиэтиленгликоль и ланолин.

Также аспекты и преимущества настоящего изобретения будут раскрыты в нижеследующем экспериментальном разделе, который должен рассматриваться как иллюстративный и не ограничивающий объем настоящего изобретения.

ПРИМЕРЫ

Пример 1: Получение антител против MICA

Иммунизация №1

Для получения антител против MICA человека мышей Balb/c иммунизировали рекомбинантным белком Fc внеклеточного домена рекомбинантного MICA человека (аллель MICA*019, поставляемая R&D Systems). Проводили одну первичную иммунизацию мышей эмульсией 50 мкг белка MICA и полного адъюванта Фрейнда, интраперитонеально, вторую иммунизацию эмульсией 50 мкг белка MICA и неполного адъюванта Фрейнда, интраперитонеально, и, наконец, вводили бустерную дозу, 10 мкг белка MICA внутривенно. Клетки иммунной селезенки через 3 дня после бустерной иммунизации сливали с иммортализованными В-клетками X63.Ag8.653 и культивировали в присутствии облученных клеток селезенки.

Скрининг первого уровня: Супернатант (SN) растущих клонов тестировали при скрининге первого уровня посредством проточной цитометрии с применением клеток линии Baf/3, трансфицированных конструкцией MICA*019. Отбирали позитивные супернатанты и тестировали на отсутствие связывания посредством проточной цитометрии с нетрансфицированными клетками линии Baf/3. Вкратце, для FACS-скрининга присутствие реакционноспособных антител в супернатантах определяли с применением козьего антимышиного поликлонального антитела (pAb), меченого ФЭ.

Скрининг второго уровня: Супернатанты клонов также тестировали с применением ИФА-анализа ELISA для оценки способности блокировать взаимодействие между рекомбинантным Fc-белком внеклеточного домена MICA (R&D Systems) и рекомбинантным Fc-белком внеклеточного домена NKG2D. Представляющие потенциальные интерес гибридомы, выбранные во время начального скрининга, клонировали методом предельных разведений в 96-луночных планшетах. Получали супернатант антител 9С10 изотипа IgG2b и 6Е4, 20С6 и 19Е9 изотипа IgG1.

Иммунизация #2

Для получения антител против MICA человека мышей Balb/c иммунизировали рекомбинантным His-белком внеклеточного домена рекомбинантного MICA человека (аллель MICA*001). Проводили одну первичную иммунизацию мышей эмульсией 50 мкг белка MICA и полного адъюванта Фрейнда, интраперитонеально, вторую иммунизацию эмульсией 50 мкг белка MICA и неполного адъюванта Фрейнда, интраперитонеально, и вводили одну бустерную дозу с 10 мкг белка MICA, внутривенно. Клетки иммунной селезенки сливали с иммортализованными В-клетками X63.Ag8.653, и культивировали в присутствии облученных клеток селезенки.

Скрининг первого уровня: Супернатант (SN) растущих клонов тестировали при скрининге первого уровня посредством проточной цитометрии с применением смеси клеток разных клеточных линий на основе C1R, при этом каждая клеточная линия была трансфицирована разной конструкцией (каким-либо из MICA*001, MICA*004, MICA*007 или MICA*008). Вкратце, для FACS-скрининга присутствие реакционноспособных антител в супернатантах определяли с применением козьего антимышиного поликлонального антитела (pAb), меченого ФЭ.

Скрининг второго уровня: Супернатанты клонов также тестировали с применением ИФА-анализа ELISA для оценки способности к связыванию внеклеточного домена α3 рекомбинантного белка MICA без связывания с полным рекомбинантным His-белком внеклеточного домена рекомбинантного MICA человека (аллель MICA*001). Представляющие потенциальный интерес гибридомы, отобранные при первичном скрининге, клонировали методом предельных разведений в 96-луночных планшетах.

Получали антитела к внеклеточному домену α3МIСА, включая клон 16А8 изотипа IgG2a.

Иммунизация #3

Для получения антител против MICA человека, Balb/c мышей иммунизировали смесью 10 млн клеток C1R, трансфицированных MICA*01, MICA*04, MICA*07 или MICA*08 в пропорции 1:1:1:1 (по 2,5 млн клеток-трансфектантов каждого типа). Проводили одну первичную иммунизацию мышей введением клеток-трансфектантов в общем количестве 10 млн и полного адъюванта Фрейнда, интраперитонеально; вторую иммунизацию введением 10 млн клеток-трансфектантов (по 2,5 млн клеток-трансфектантов каждого типа) и неполного адъюванта Фрейнда, интраперитонеально; и вводили одну бустерную дозу 1 млн клеток-трансфектантов (по 0,25 млн клеток-трансфектантов каждого типа), внутривенно. Клетки иммунной селезенки сливали с иммортализованными В-клетками X63.Ag8.653 и культивировали в присутствии облученных клеток селезенки.

Скрининг первого уровня: Супернатант (SN) растущих клонов тестировали при скрининге первого уровня посредством проточной цитометрии с применением смеси клеток разных клеточных линий на основе C1R и клеточной линии Baf/3, причем каждую клеточную линию трансфицировали разной конструкцией (либо MICA*001, MICA*004, MICA*007, либо MICA*008 для C1R, и MICA*019 для Baf/3). Вкратце, при скрининге с сортировкой флуоресцентно-активированных клеток (FACS-скрининге) присутствие вступающих в реакцию антител в супернатантах определяли с применением козьего антимышиного поликлонального антитела (рАb), меченых ФЭ.

Скрининг второго уровня: Супернатанты клонов также тестировали с применением ИФА ELISA для оценки способности к связыванию рекомбинантного белка внеклеточного домена α3 MICA, не связываясь с полным рекомбинантным Fc-белком внеклеточного домена рекомбинантного MICA человека (аллель MICA* 019). Представляющие потенциальный интерес гибридомы, выбранные при начальном скрининге, клонировали методом предельных разведений в 96-луночных планшетах.

Получали супернатант антител 12А10, 10А7, 18Е8, 10F3 и 15F9 изотипа IgG1 и 14В4 изотипа IgM.

Антитела 9С10, 19Е9, 6Е4, 20С6, 16А8, 12А10, 10А7, 18Е8, 10F3, 15F9 и 14 В4 затем гибридизовали с изотипом IgG1 человека (также называемым CHG1 - M-MIA-9C10, CHG1 - M-MIA-19E9, CHG1 - M-MIA-6E4, CHG1 - M-MIA-20C6, CHG1 - M-MIA-16A8, CHG1 - M-MIA-12A10, CHG1 - M-MIA-10A7, CHG1 - M-MIA-18E8, CHG1 - M-MIA-10F3, CHG1 - M-MIA-15F9 и CHG1 - M-MIA-14B4, соответственно).

Пример 2 - Связывание с иммобилизованными белками MICA

Связывание 6Е4, 20С6 и 16А8 либо с мономерами, либо с дим ерами рекомбинантного белка внеклеточного домена рекомбинантного MICA человека (Fc-белка аллеля MICA*019 или белка MICA*001-His), а также другими лигандами NKG2D, MICB и ULBP1-2, анализировали с помощью поверхностного плазмонного резонанса (ППР) с применением аппарата Biacore Т100 для получения моновалентного и бивалентного сродства, соответственно.

Для иммобилизации белка рекомбинантные белки: MICA-Fc MICB-Fc (R&D Systems 1599-MB, № доступа CAI 18747, SEQ ID NO: 6), ULBP1-Fc, ULBP2-Fc ковалентно иммобилизовали на карбоксильных группах декстранового слоя на Sensor Chip СМ5 (чип). Поверхность чипа активировали EDC/NHS (N-этил-N'-(3-диметиламинопропил)карбодиимидгидрохлорид/N-гидроксисукцинимид (Biacore GE Healthcare)). Белки разводили до 10 мкг/мл в связывающем буфере (10 мМ ацетат, рН 5,6) и впрыскивали до достижения подходящей степени иммобилизации (т.е. 1000-1600 единиц ответа (RU) для исследования связывания). Деактивацию оставшихся активированных групп проводили с применением 100 мМ этаноламина с рН 8 (Biacore GE Healthcare).

Анализ связывания антител проводили с применением HBS-EP+ (нейтральный рН). Указанные антитела против MICA (разбавленные до концентрации 10 мкг/мл подвижным буфером) впрыскивали в течение 2 мин при постоянной скорости потока 10 мкл/мин на слои декстрана, содержащие иммобилизованные рекомбинантные целевые белки, и оставляли для диссоциирования в течение 2 мин до регенерирования повторным впрыскиванием восстанавливающего буфера (10 мМ NaOH, 500 мМ NaCl) при скорости потока 40 мкл/мин.

Для измерения бивалентного сродства белок MICA-His иммобилизовали путем Ni2+/NTA хелатирования на чипе Sensor Chip NTA (карбоксиметилированный декстран, преиммобилизованный нитрилотриуксусной кислотой (NTA)). Антитела против MICA разводили до серийных концентраций (0,01-100 нМ) в подвижном буфере HBS-P и впрыскивали на иммобилизованный антиген.

Каждый цикл состоял из трех этапов. Во-первых, чип NTA активировали NiSO4 (500 мМ). Во-вторых, белок MICA-His (разбавленный до 10 мкг/мл подвижным буфером HBS-P) иммобилизовали на поверхности путем 2-минутного впрыскивания с постоянной скоростью 10 мкл/мин. Затем на иммобилизованный антиген в течение 2 мин впрыскивали антитело при скорости потока 40 мкл/мин, после чего в течение 5 мин со скоростью 40 мкл/мин впрыскивали подвижный буфер для анализа диссоциирования антитела. После каждого цикла поверхность регенерировали 60-секундным впрыскиванием 0,5М EDTA, рН 8,3, для полного очищения поверхности от оставшихся антигена и антитела.

Полученные сенсограммы анализировали посредством глобальной аппроксимации с применением подходящей модели.

Для измерения сродства к моновалентному связыванию гибридные антитела против MICA захватывали на чипе с белком G.

Показатели аффинности определяли с применением SCK-метода («single cycle kinetics»). Использовали следующие циклы SCK: последовательное 120-секундное введение со скоростью 30 мкл/мин 5 серийных разведений (0,01-100 нМ) MICA-His или MICA-BirA в порядке возрастания (или буфера для холостого ввода, вычитаемого при анализе). После введения в последней концентрации комплексу позволяли диссоциировать в течение 600 секунд до регенерации 10-секундным впрыскиванием подходящего восстанавливающего буфера со скоростью 40 мкл/мин. После регенерации чип оставляли для стабилизации в течение 60 секунд в подвижном буфере. Кривые аппроксимировали с применением аналитического программного обеспечения Biacore Т100.

Среднее Kd бивалентного связывания (М) при рН 7,4 MICA для конъюгированного с биотином антитела мыши 6Е4 (на MICA*001-His) составило 3,099-11 М), в то время как сродство к моновалентному связыванию составило 2,0*10-9 М. Среднее KD (М) бивалентного связывания при рН 7,4 для конъюгированного с биотином антитела мыши 20С6 (на MICA*001-His) составило 3,3*10-10 М, в то время как сродство к моновалентному связыванию составило 6,5*10-9 М.

Среднее KD бивалентного связывания (М) при рН 7,4 MICA для конъюгированного с биотином антитела мыши 9С10 (на MICA*001-His) составило 6,2*10-13 М. Среднее KD бивалентного связывания (М) при рН 7,4 MICA для конъюгированного с биотином антитела мыши 19Е9 (на MICA*001-His) составило 3,2*10-13 М, в то время как сродство к моновалентному связыванию составило 7,8*10-10 М.

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-19E9 составило 6,5*10-9 М (n=3)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-20C6 составило 4*10-8 М (n=3)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-6E4 составило 8,9*10-9 М (n=4)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA2-16A8 составило 1,15*10-8 М (n=4)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-15F9 составило 6,1*10-8 М (n=1)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-12A10 составило 5,3*10-8 М (n=1)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-18E8 составило 5,4*10-8 М (n=1)

Сродство к моновалентному связыванию (среднее KD) при рН 7,4 на MICA-BirA для антитела CHG1-M-MIA-10F3 составило 8,3*10-9 М (n=1)

Пример 3 - связывание с аллелями MICA

Связывающие антитела, полученные в первом, втором и третьем цикле иммунизации (в том числе CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6, CHG1-M-MIA-16A8, CHG1-M-MIA-12A10, CHG1-M-MIA-10A7, CHG1-M-MIA-18E8, CHG1-M-MIA-10F3, CHG1-M-MIA-15F9 и CHG1-M-MIA-14B4) тестировали на связывание с MICA-экспрессирующими CR1 клетками-трансфектантами C1R-MICA*001, C1R-MICA*004, C1R-MICA*007 и C1R-MICA*008 (Проф. А. Штейнле, Университет Эберхарда и Карла (Eberhard-Karls University), Тюбинген, Германия), описанными у Salih et al. (2003) Blood 102(4):1389-91396. Связывание анализировали посредством проточной цитометрии.

Проточная цитометрия. Клетки собирали и окрашивали в буфере ФСБ 1X / БСА 0,2% / ЭДТК 2 мМ в течение 30 минут при 4°С с применением диапазона доз моноклональных антител против MICA. После двукратной отмывки в окрашивающем буфере клетки окрашивали в течение 30 минут при 4°С моноклональными ФЭ-мечеными антителами мыши против IgG1 человека (1/11). После двукратной отмывки окрашивание регистрировали на BD FACS Canto II и анализировали с применением программного обеспечения FlowJo.

Результаты. Антитела CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6Е4, C1IG1-M-MIA-20C6, CHG1-M-MIA-12A10, CHG1-M-MIA-10A7, CHG1-M-MIA-18E8, CHG1-M-MIA-10F3 и CHG1-M-MIA-15F9 связывались с каждым из типов клеток C1R-MICA*001, C1R-M1CA*004, C1R-M1CA*007 и C1R-MICA*008 (см. фиг. 1А: антитела CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6, CHG1-M-MIA-I2A10, CHG1-M-MIA-10F3, и фиг. 1В: антитела CHG1-M-MIA-18E8, CHG1-M-MIA-15F9, CIIG1-M-M1A-10A7). При этом другие протестированные антитела были аллелеспецифичны и не распознавали все из MICA*001,*004, *007 и *008. Примеры антител, которые не распознают все из протестированных аллелей MICA, два антитела против домена альфа-3, CHG1-M-MIA-16A8 и CHG1-M-MIA-14B4, представлены на фиг. 1В. Значения ЕС50 приведены в таблице С в мкг/мл (рассчитаны путем аппроксимации 4-параметрической логистической функцией).

Пример 4: Картирование эпитопов

Также тестировали связывание антител с различными мутантными MICA*001. Мутантные MICA получали с помощью ПЦР (см. таблицу D ниже). Все Mx-R праймеры использовали со следующим 5'-праймером:

TACGACTCACAAGCTTACCGCCACCATGGGGCT GGGACCGGTCTTC (SEQ ID NO: 135). Все Mx-F праймеры использовали со следующим 3'-праймером: CCGCCCCGACTCTAGATTACTAGGCGCCCTCAGTGGAGC (SEQ ID NO: 136). Амплифицированные последовательности проводили через агарозный гель, затем очищали с применением набора для очистки и экстракции из геля продуктов ПЦР от Macherey Nagel (позиция 740609). Для получения мутантного варианта 3 необходимо было провести третью ПЦР. Для указанной ПЦР использовали праймеры: праймер M3a-F (5'-ACGGTGCTGTCCGCGGATGGATCTGTGCAGTCAG-3') (SEQ ID NO: 137) с праймером M3b-R (5'-CCTGCTTTCTGGTCCTTGATATGAGCCAGGGTC-3') (SEQ ID NO: 138). Два или три продукта ПЦР, полученные для каждого мутанта, затем лигировали в вектор SELEXIS pSUREtech 192 (HYGRO), расщепляли рестрикционными ферментами Hindlll и XBal в системе ClonTech InFusion (позиция 639644) в соответствии с инструкциями производителя.

После секвенирования векторы, содержащие мутантные последовательности, получали в виде Miniprep с применением системы Promega PureYield™ Plasmid Miniprep System (позиция A1222). Затем векторы использовали для трансфицирования клеток CHOK1SV с применением набора для трансфекции HYPE-5TM Transfection Kit от OZ BIOSCIENCES (позиция HYR10003) в соответствии с инструкциями производителя. Трансфекцию проводили с 300 нг ДНК в пропорции HYPE-5:flHK 1:8.

Потери способности к связыванию антител с немутированным MICA дикого типа не наблюдалась, но антитела утрачивали способность связываться с одним или более мутантных форм; таким образом был идентифицирован ряд эпитопов.

Антитело 6Е4 утрачивало способность к связыванию с мутантными формами 10 и 11 с заменами Q48A, W49S, E51S, D52A, V53S и L54A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 6Е4, таким образом, содержит один или более остатков из Q48 и W49, и/или один или более остатков из Е51, D52, V53 и L54. Указанные остатки находятся в составе домена α1 MICA (указанный эпитоп может также содержать остатки в составе доменов α2 или α3).

На фиг. 2А изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию антител. Участок связывания NKG2D связывание в верхней части полипептида MICA выделен серым (а также показан на ленточной диаграмме, связанный с MICA). Видно, что 6Е4 связывается с доменом α1 на боковой стороне MICA в отдалении от связывающей поверхности NKG2D, что согласуется с обнаруженным отсутствием блокирования антителом 6Е4 взаимодействия MICA с NKG2D.

Антитела 9С10 и 12А10 утрачивали способность к связыванию с мутантными формами 12 и 13 с заменами N56A, K57S, Т58А, R61A и R64A, но не утрачивали способность к связыванию с любыми другими мутантными формами. Основной эпитоп 9С10 и 12А10, таким образом, содержит один или более остатков из N56 и K57, и/или один или более остатков из Т58, R61 и R64. Указанные остатки находятся в составе домена MICA α1 (указанный эпитоп может также содержать остатки в составе доменов α2 или α3).

На фиг. 2В изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 9С10 и 12А10. Видно, что 9С10 и 12А10 связываются с доменом α1 на боковой стороне MICA возле связывающей поверхности NKG2D, возможно, частично перекрываясь с ней, что согласуется с обнаружением того, что 9С10 и 12А10 блокируют взаимодействие MICA с NKG2D.

Антитело 20С6 утрачивало способность к связыванию с каждой из мутантных форм 16, 17, 21, 60, 27 и 28 с заменами К81А, D82A, Q83A, K84A, Н109А, Y111A, D113A, L116A, S133A, R134S, Т137А, M140S, N141A, R143S, N144A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 20С6, таким образом, содержит один или более остатков из К81 и D82, один или более остатков из Q83 и K84, один или более остатков из H109, Y111 и L116, остаток D113, один или более остатков из S133, R134 и Т137, и/или один или более остатков из М140, N141, R143 и N144. Указанные остатки находятся в составе доменов α1 и α2 MICA (указанный эпитоп может также содержать остатки в составе доменов α3).

Эпитоп для антитела 10А7 частично перекрывается с эпитопом для 20С6. Антитело 10А7 утрачивало способность к связыванию с каждой из мутантных форм 16, 17, 21, 60, 26 и 28 с заменами K81A, D82A, Q83A, K84A, Н109А, Y111A, D113A, L116A, Q131A, S132A, Q136S, M140S, N141A, R143S и N144A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 10А7, таким образом, содержит один или более остатков из K81 и D82, один или более остатков из Q83 и K84, один или более остатков из Н109, Y111 и L116, остаток D113, один или более остатков из Q131, S132 и Q136, и/или один или более остатков из М140, N141, R143 и N144. Указанные остатки находятся в составе доменов α1 и α2 MICA (указанный эпитоп может также содержать остатки в составе доменов α3).

На фиг. 2С изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 20С6. На фиг. 2D изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 10А7. Видно, что 20С6 и 10А7 связываются с доменами α1 и α2 на боковой стороне MICA возле связывающей поверхности NKG2D, возможно, частично перекрываясь с ней. Это согласуется с обнаружением блокирования антителом 20С6 взаимодействия MICA с NKG2D.

Антитела 19Е9, 18Е8 и 10F3 утрачивали способность к связыванию с мутантными формами 19, 20, 23 и 24 с заменами Е100А, D101S, N102A, S103A, T104S, R105A, N121A, E123S, Т124А и Е126А, но не утрачивали способности к связыванию с любыми другими мутантными формами. Основной эпитоп 19Е9, 18Е8 и 10F3, таким образом, содержит один или более остатков из Е100, D101 и N102, один или более остатков из S103, Т104, и R105, один или более остатков из N121, и Е123, и/или один или более остатков из Т124 и Е126. Указанные остатки находятся в составе домена α2 MICA (указанный эпитоп может также содержать остатки в составе доменов α1 или α3).

На фиг. 2Е изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 19Е9, 18Е8 и 10F3. Видно, что 19Е9, 18Е8 и 10F3 связываются с доменом α2 на боковой стороне MICA возле связывающей поверхности NKG2D, что согласуется с обнаружением блокирования антителами 19Е9, 18Е8 и 10F3 взаимодействий MICA с NKG2D.

Антитело 15F9 утрачивало способность к связыванию с мутантными формами 1, 18, 19, 20, 61 и 36 с заменами R6A, N8A, Е97А, Н99А, Е100А, D101S, N102A, S103A, T104S, R105A, Е115А, L178A, R179S и R180A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 15F9, таким образом, содержит один или более остатков из R6 и N8, один или более остатков из Е97 и Н99, один или более остатков из Е100, D101 и N102, один или более остатков из S103, Т104 и R105, остаток Е115, и/или один или более остатков из L178, R179 и R180. Указанные остатки находятся в составе домена α2 MICA (указанный эпитоп может также содержать остатки в составе доменов α1 или α3).

На фиг. 2F изображен полипептид MICA, включая выделенные черным мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 15F9. Видно, что 15F9 связывается с домен α2 на боковой стороне MICA, ниже связывающей поверхности NKG2D. 15F9 блокирует взаимодействие sMICA с NKG2D.

Антитело 16А8 утрачивало способность к связыванию с мутантными формами, 45, 46, и 47, с заменами S224A, H225S, D226A, Т227А, Q228S, Q229A, W230A и D232A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 16А8, таким образом, содержит один или более остатков из W230 и/или D232, один или более остатков из Т227, Q228 и Q229, один или более остатков из S224, Н225 и D226. Эпитоп для 16А8 расположен преимущественно в домене α3 MICA.

На фиг. 2G изображен полипептид MICA, включая выделенные черным цветом мутированные аминокислотные остатки, которые обуславливали (в различных комбинациях) утрату способности к связыванию 16А8. Видно, что 16А8 связывается с доменом α3 в отдалении от связывающей поверхности NKG2D.

Антитело 14В4 утрачивало способность к связыванию с мутантом 46, содержащим замены Т227А, Q228S, и Q229A, но не утрачивало способности к связыванию с любыми другими мутантными формами. Основной эпитоп 14В4, таким образом, включает один или более остатков из Т227, Q228 и Q229, и частично перекрывается с эпитопом антитела 16А8. Эпитоп для 14В4 расположен преимущественно в домене α3 MICA. Видно, что 14В4 связывается с доменом α3 в отдалении от связывающей поверхности NKG2D (однако 14В4 представляет собой функционально блокирующее антитело).

Пример 5 - Способность антител против MICA блокировать взаимодействия NKG2D-MICA

A. Связывание MICA*001-His с NKG2D-Fc в присутствии антител против MICA по оценке посредством поверхностного плазмонного резонанса

Измерения ППР проводили на аппарате Biacore Т100 (Biacore GE Healthcare) при 25°C. Во всех экспериментах Biacore использовали буфер HBS-EP+ (Biacore GE Healthcare) в качестве подвижного буфера, 10 мМ NaOH, 500 мМ NaCl использовали в качестве восстанавливающего буфера, и сенсограммы анализировали с применением программного обеспечения Biaevaluation 4.1 и Biacore Т100 Evaluation.

Для экспериментов с конкурентным связыванием в растворе рекомбинантные белки NKG2D-Fc человека (R&D Systems) иммобилизовали ковалентиым связыванием на сенсорном чипе СМ5. Растворимые рекомбинантные белки MICA*01-BirA человека или MICA*019-Fc человека (R&D Systems) при постоянной концентрации 10 мкг/мл преинкубировали с 5-10 молярными эквивалентами избытка антител и впрыскивали в течение 2 минут при скорости потока 10 мкл/мин на чип NKG2D-Fc. После каждого цикла сенсорные чипы регенерировали пятью повторными впрысками подходящего восстанавливающего буфера. На фиг. 3 приведен репрезентативный пример результатов; результаты обобщены в таблице Е.

B. Способность антител против MICA блокировать NKG2D-зависимый лизис клеток-трансфектантов Raji-MICA*08 НК-клетками линией NK92.

Оценивали способность антител против MICA блокировать взаимодействие NKG2D-MICA. Антитела тестировали на способность уменьшать или подавлять опосредованный NKG2D+CD16-клетками NK92 киллинг трансфицированных MICA*008 клеток Raji путем измерения высвобождения 51Cr из целевых клеток. Анализ цитотоксичности in vitro проводили с помощью стандартных методов, хорошо известных в данной области техники, согласно описанию, например, в источнике: Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993). В MICA-экспрессирующие целевые клетки вводили метку 51Сг до добавления клеток НК-линии, и затем оценивали киллинг, считая, что он пропорционален высвобождению 51Сг из клеток в среду в результате киллинга. Добавление агента, снижающего связывание или блокирующего взаимодействие между MICA и NKG2D приводило к предотвращению инициации и передачи активирующих сигналов через NKG2D. Таким образом, добавление подобных агентов приводит к снижению НК-опосредованного киллинга целевых клеток. F(ab')2-фрагмент коммерчески доступного блокирующего антитела против NKG2D используют в качестве позитивного контроля блокирования NKG2D-MICA, Ритуксимаб (гибридное человека IgG1 против CD20) используют в качестве негативного контроля для подтверждения того, что лизис не опосредован АЗКЦ, и дополнительно используют негативный контроль в форме нерелевантного гибридного IgG1 человека, полученного в тех же условиях, что и антитела против MICA. Примеры результатов представлены на фиг. 4 и обобщены в таблице Е.

CHG1-M-MIA-20C6, CHG1-M-MIA-10A7 действительно блокируют взаимодействие рекомбинантного негликозилированного MICA*001-BirA с бивалентным рекомбинантным белком NKG2D-Fc, в то же время не блокируя NKG2D-опосредованный киллинг Raji-MICA*08 клетками NK92. Первая гипотеза заключается в том, что указанные два анти-MICA агента обладают самым низким моновалентным сродством к рекомбинантному MICA*001, что, соответственно, приводит к необходимости использования больших, чем протестированные, количеств антител для блокирования взаимодействия NKG2D с MICA в анализе цитотоксичности «от клетки к клетке» («cell-to-cell»). Интересно, что это подразумевает, что при использовании in vivo при лечении опухоли указанные антитела могут проявлять некоторую блокирующую способность в высокой дозе (а именно, в момент времени, когда АЗКЦ/КЗЦ является доминирующим активным механизмом, поскольку концентрация моноклонального антитела достаточна для обеспечения значимого истощения MICA+-клеток за счет АЗКЦ/КЗЦ), но по мере того как концентрация антитела in vivo снижается спустя дни/недели после введения (высокой) дозы, указанные антитела становятся неблокирующими, что позволяет оптимально функционировать эндогенным NKG2D-рецепторам пациента. С другой стороны, блокирующая способность, оцениваемая с применением рекомбинантных белков в анализе Biacore, может не обладать прогностической значимостью в отношении сложного молекулярного NKG2D-MICA взаимодействия между нативными полностью гликозилированными белками, присутствующими на клеточной мембране.

Рекомбинантные белки, как NKG2D-Fc, так и MICA, могут находиться не в нативной конформации во время тестирования. Наконец, могут существовать определенные отдельные аллельные особенности в отношении четвертичной структуры, которые могут обуславливать различия блокирующей способности, наблюдаемые при использовании двух экспериментальных процедурах.

Кроме того, на основе эпитопов невозможно прогнозировать способность к блокаде взаимодействия NKG2D-MICA, так как, например, CHG1-M-MIA-19E9 является блокирующим антителом против MICA в обоих анализах, при этом его эпитоп не расположен непосредственно в участке связывания NKG2D (фиг. 2Е). CHG1-M-MIA-14B4 при связывании с тестируемым аллелем блокирует NKG2D-MICA взаимодействие, хотя его эпитоп расположен на домене α3, что указывает на то, что конформация MICA изменяется при связывании с CHG1-M-MIA-14B4. Эпитоп для CHG1-M-MIA-20C6 расположен возле участка связывания NKG2D, но не перекрывается с ним (фиг. 2С, 2D и 2F), и, предположительно, не является функционально блокирующим для MICA*008.

Пример 6 - Перекрестная реакция антител против MICA с MICB, ULBP1, ULBP2 и ULBP3 человека

Для исследования перекрестного связывания рекомбинантные белки ULBP-1-Fc (R&D Systems*), MICB-Fc (*), ULBP-2-Fc (*) и ULBP-3-Fc (*) человека иммобилизовали ковалентным связыванием на проточных ячейках 1-4, соответственно, сенсорного чипа СМ5. Антитела против MICA (в постоянной концентрации 10 мкг/мл) впрыскивали в течение 2 минут при скорости потока 10 мкл/мин на 4 проточные ячейки параллельно. После каждого цикла сенсорный чип регенерировали пятью повторными впрыскиваниями подходящего восстанавливающего буфера.

На фиг. 5А показано отсутствие перекрестной реакции CHG1-M-MIA-20C6 и CHG1-M-MIA-9C10c MICB и ULPB-1, ULPB-2 и ULPB-3. На фиг. 5В видно, что CHG1-M-MIA-6E4 и CHG1-M-MIA-19E9 связываются с MICB, но не с ULBP-1, -2 и -3. На фиг. 5С видно, что CHG1-M-MIA-16A8 связывается слабо, но значимо с MICB, но не с ULBP-1, -2 и -3. Антитела, тестирование которых не проводили, предположительно будут иметь профили, аналогичные другим антителам с теми же областями эпитопов.

В таблице F обобщены результаты для всех протестированных антител против MICA.

Пример 7: Перекрестная реакция антител против MICA с белками MIC Масаса fascicularis

Связывающие антитела, полученные в первом, втором и третьем циклах иммунизации (в том числе CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6, CHG1-M-MIA-16A8, CHG1-M-MIA-12A10, CHG1-M-MIA-18E8, CHG1-M-MIA-10F3, CHG1-M-MIA-15F9 и CHG1-M-MIA-14B4) тестировали на связывание с гомологичными белками MIC Масаса fascicularis (яванский макак). 3 последовательности были успешно клонированы из кДНК Масаса fascicularis, включая MIC#9-1, MIC#9-2 и MIC#2-7, и трансфицированы в клетки мыши линии Baf/3. Связывание анализировали посредством проточной цитометрии, NKG2D-Fc рекомбинантный белок использовали в качестве контроля для обнаружения поверхностного экспрессирования MIC-белков Масаса fascicularis.

Проточная цитометрия. Клетки собирали и окрашивали в буфере ФСБ 1X / БСА 0,2% / ЭДТК 2 мМ в течение 30 минут при 4°С с применением диапазона доз моноклональных антител против MICA или с рекомбинантным белком NKG2D-Fc (R&D Systems). После двукратной отмывки в окрашивающем буфере клетки, инкубированные с антителами против MICA, окрашивали в течение 30 минут при 4°С моноклональными ФЭ-мечеными антителами мыши против IgG1 человека (1/11). Клетки инкубировали с NKG2D-Fc, окрашивали в течение 30 минут при 4°С козьими поликлопальными антителами против IgG человека (1/200). После двукратной отмывки окрашивание регистрировали на BD FACS Canto II и анализировали с применением программного обеспечения BD FACSDiva.

Антитела CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6, CHG1-M-MIA-16A8, CHG1-M-MIA-12A10, CHG1-M-MIA-10F3, CHG1-M-MIA-15F9 и CHG1-M-MIA-14B4 связываются с белком MIC#2-7 Масаса fascicularis. MIC#2-7 на 99,6%, 97,8%, 95,6% и 86,9% гомологичен белкам MICA*019, MICA*044, MICA*001 и MICB*002, соответственно. Помимо MIC#2-7, с MIC#9-1 также связывается CHG1-M-MIA-6E4. CHG1-M-MIA-16A8 связывается с белком MIC#9-2 в протестированных экспериментальных условиях. Результаты представлены на фиг. 6.

Пример 8 - Ингибирование выделения MICA

Сравнивали способность блокировать выделение MICA антитела 16А8 против домена α3 и коммерчески доступного ВАМ03 (см. Salih et al. (2003), выше). Смесь клеток C1R-MICA*01 и C1R-MICA*04 промывали в ФСБ IX для удаления присутствующего в культуре растворимого MICA, а затем культивировали в течение ночи на полной среде в присутствии или в отсутствие 16А8 или ВАМ03 в диапазоне доз (0/1/3/10/30 мкг/мл). Затем собирали супернатанты клеточной культуры и тестировали с помощью ИФА ELISA на присутствие растворимого MICA. Ни 16А8, ни ВАМ03 не взаимодействуют с указанными антителами против MICA, используемыми в ИФА ELISA (данные не приведены). Инкубирование клеток с ВАМ03 в течение ночи приводит к уменьшению концентрации растворимого MICA в супернатанте, тогда как 16А8 не индуцирует уменьшение содержания растворимого MICA. Результаты, демонстрирующие ингибирование выделения MICA, опосредованное ВАМ03, но не 16А8, представлены на фиг. 7.

Пример 9 - Эффект антител против MICA на понижающее модулирование NKG2D

Поступали сообщения, что NKG2D на НК-клетках понижающе регулируется sMICA (Groh et al. (2002) Nature; Arreygue-Garcia (2008) BMC; Jinushi et al. (2005) J. Hepatol.), что приводит к меньшей реакционноспособности НК-клетки. Для имитации понижающей регуляции, индуцируемой растворимым MICA, проводили следующие эксперименты.

Размороженные МКПК от четырех здоровых доноров обогащали лимфоцитами после неспецифического удаления моноцитов с применением холодовой агрегации (Rubinstien (1989) J. Clin. Lab. Immunol.). Клетки (по 1,10E5 клеток на лунку) инкубировали в 96-луночном планшете в присутствии возрастающих концентраций растворимого MICA*019-Fc (R&D Systems) в присутствии или в отсутствие антител против MICA (CHG1-M-MIA-9C10, CHG1-M-MIA-19E9, CHG1-M-MIA-20C6 в концентрации 10 мкг/мл) в течение 24 ч при 4°С или 37°С. Понижающее модулирование NKG2D, индуцированное растворимым MICA, и его блокаду антителами против MICA оценивали посредством проточной цитометрии. Клетки окрашивали следующими специфическими антителами мыши против человека: меченые ФИТЦ против CD14, меченые Pacific blue против CD3 (Becton Dickinson), меченые ФЭ-Сай7 против CD56 (BioLegend), меченые ФЭ против NKG2D (Beckman Coulter), и анализировали экспрессирование NKG2D на гейтированных CD3-CD56+ НК-клетках.

В указанных экспериментальных условиях понижающая регуляция приводит к уменьшению уровня NKG2D на 30-40% от начального уровня в присутствии возрастающих доз рекомбинантного бивалентного белка MICA*019*Fc (R&D Systems) (фиг. 8). Указанный эффект наблюдается при концентрациях в культуральной среде от 2 до 10 мкг/мл, что значительно превышает описанные уровни растворимого MICA в сыворотке пациентов с раковыми заболеваниями (диапазон составляет от 30 до 1557 пг/мл при злокачественных расстройствах, n=296, Holdenrieder (2006) Int. J. Cancer). Понижающее модулирование NKG2D не наблюдается в указанных экспериментальных условиях при применении моновалентного рекомбинантного белка MICA*01-His (данные не показаны). Антитела против MICA CHG1-M-MIA-9C10 и CHG1-M-MIA-19E9, блокирующие взаимодействие NKG2D-MICA в анализе цитотоксичности согласно примеру 5В (таблица Е), блокируют взаимодействие NKG2D, экспрессируемого на НК-клетках, с MICA*019-Fc, и, соответственно, инвертируют понижающее модулирование NKG2D, индуцированное белком MICA*019-Fc (фиг. 8). Антитело CHG1-M-MIA-20C6 против MICA не инвертирует опосредованное MICA*019-Fc понижающее модулирование NKG2D (фиг. 8). Несмотря на то, что указанное антитело блокирует связывание NKG2D-Fc/MICA*019-Fc по оценке с помощью поверхностного плазмонного резонанса (таблица Е), оно не блокирует NKG2D/MICA*08 в анализе клеточной цитотоксичности согласно примеру 5В (таблица Е), и не инвертирует понижающее модулирование NKG2D на первичных клетках, подчеркивая тот факт, что эксперименты по блокированию взаимодействия NKG2D/MICA с применением рекомбинантных белков могут не подходить для прогнозирования биологической функции, по крайней мере, в протестированных экспериментальных условиях.

Пример 10 - Антитела против MICA способны опосредовать киллинг MICA-экспрессирующих мишеней через КЗЦ CHG1-M-MIA-9C10, CHG1-M-MIA-19E9, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6 и CHG1-M-MIA-16A8 тестировали на способность опосредовать КЗЦ в отношении опухолевых клеток Raji человека, трансдуцированных лентивирусом, кодирующим полный белок MICA*001. Указанные клетки Raji-MICA*01 экспрессируют на поверхности MICA*01.

Вкратце, 100 ООО клеток Raji-MICA*01 инкубировали в течение 1 ч с заданными дозами антител против MICA при 4°С. Затем добавляли к клеткам культуральную среду, содержащую 20% (конечная концентрация) сыворотки человека с компонентами комплемента (Quidel) и инкубировали при 37°С на протяжении 3 часов. Клетки промывали и инкубировали с 7-AAD для окрашивания мертвых клеток. Клетки захватывали посредством проточной цитометрии на BD FACS Canto II и анализировали с применением программного обеспечения BD FACSDiva. Результаты выражены как процент 7-ААВ-позитивных клеток в указанном состоянии.

Результаты представлены на фиг.9. Данные результаты демонстрируют жизнеспособность указанных клеток Raji-MICA*01 в присутствии комплемента человека. Эти результаты показывают что CHG1-M-MIA-20C6, CHG1-M-MIA-9C10, CHG1-M-MIA-6Е4, и CHG1-M-MIA-19E9 вызывают увеличение числа мертвых клеток (со значениями ЕС50, составляющими 0,97, 2, 1,01 и 2,35 мкг/мл, соответственно) (фиг.9). Максимальный процент мертвых клеток варьирует при использовании разных протестированных анти-MICA агентов (фиг.9). В частности, CHG1-M-MIA-16A8 не опосредует комплемент-зависимую цитотоксичность. Так как значения ЕС50 для окрашивания C1R-MICA*01 указанных 5 антител против MICA располагаются в том же порядке (таблица С), комплемент-опосредованная цитотоксичность предположительно является эпитоп-зависимой (9С10>20С6=6Е4>19Е9>>16А8).

Пример 11 - Антитела способны к киллингу MICA-экспрессирующих мишеней, опосредованному АЗКЦ

CHG1-M-MIA-19E9, CHG1-M-MIA-9C10, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6, 30 CHG1-M-MIA-16A8, CHG1-M-MIA-12A10, CHG1-M-MIA-18E8, CHG1-M-MIA-10F3, CHG1-M-MIA-15F9 и CHG1-M-MIA-14B4 тестировали на способность опосредовать АЗКЦ в отношении опухолевых клеток C1R, трансфицированных MICA*008 (C1R-MICA*008).

Вкратце, оценивали цитолитическую активность линии KHYG-1 НК-клеток человека, трансфицированных CD16 человека (изоформа V) с применением 4 ч анализа выделения 31Cr в V-образных 96-луночных планшетах от Greiner. Вкратце, клетки C1R-MICA*008 метили 51Cr (100 мкКи (3,7 МБк)/1×106 клеток), затем смешивали с KHYG-, трансфицированными hCD16V (для связывания IgG1 человека) в пропорции эффекторных клеток/целевых клеток, равной 20, в присутствии антитела в заданных концентрациях и 10 мкг/мл F(ab')2 ON-72 для блокирования любой NKG2D-опосредованной цитотоксичности). После непродолжительного центрифугирования и 4 часов инкубирования при 37°С извлекали 50 мкл супернатанта и измеряли выделение 51Cr с помощью детектора бета-излучения TopCount NXT (PerkinElmer Life Sciences, Бостон, Массачусетс). Все экспериментальные группы анализировали в трех повторностях; процент специфического лизиса определяли следующим образом: 100× (среднее выделение в эксперименте, ц/мин - среднее спонтанное выделение, ц/мин)/ (среднее общее выделение, ц/мин - среднее спонтанное выделение, ц/мин). Процент общего выделения в результате лизиса целевых клеток с применением 2% Triton X100 (Sigma).

Результаты представлены на фиг. 10А. Каждое из CHG1-M-MIA-9C10, CHG1-M-MIA-19E9, CHG1-M-MIA-6E4, CHG1-M-MIA-20C6 и CHG1-M-MIA-16A8 индуцировало специфический лизис клеток C1R-MICA*008 НК-клетками линии человека KHYG-1hCD16V по сравнению с негативным контролем (контрольным антителом изотипа IgG1 человека), показывая таким образом, что указанные антитела индуцируют АЗКЦ в отношении MICA*008-экспрессирующих целевых клеток. Степень лизиса целевой клетки коррелирует со связыванием антител с указанной клеткой (фиг. 10B).

Пример 12 - Гибридные антитела против MICA 9С10, 19Е9, 6Е4, 20С6 и 16А8 демонстрируют противоопухолевую эффективность в модели ксенотрансплантата RAJI-MICA*01High на мышах

Антитела тестировали в долгосрочной модели опухоли RAJI-MICA*01 на мышах, в которой клетки RAJI экспрессировали высокие уровни антигена MICA*01. Мышам Nod SCID внутривенно (IV) трансплантировали по 15.106 RAJI-MICA*01High клеток и проводили лечение либо антителом контрольного изотипа (КИ), либо гибридными антителами CHG1-M-MIA-9C10, CHG1-M-MIA-19E9, CHG1-M-MIA-6E4, CHG1-M-MIA-20С6 или CHG1-M-MIA-16A8 в дозировке 300 мкг/мышь, интраперитонеально два раза в неделю на протяжении 3 недель, начиная с дня трансплантации опухолевых клеток.

Клетки RAJI-MICA*01High до инъецирования мышам культивировали на полной культуральной среде RPMI 1640 с добавлением 10% инактивированной нагреванием эмбриональной бычьей сыворотки, 1% L-глутамина, 1% пирувата натрия и без антител.

Мышей взвешивали дважды в неделю. Строили кривые выживаемости Каплана-Мейера для оценки выживаемости получавших лечение мышей.

Результаты представлены на фиг. 11. Все гибридные антитела проявляли противоопухолевую активность. Медиана выживаемости животных, получавших контрольный изотип, составила 27 дней, а медиана выживаемости мышей, получавших лечение наименее эффективным гибридным антителом (16А8), составила 77 дней. При использовании любых других антител более чем 50% животных были живы на 100-й день, что не позволяло рассчитать медиану выживаемости и указывало на очень сильный противоопухолевый эффект.

Все заголовки и подзаголовки, используемые в настоящем документе, предназначены исключительно для удобства чтения и не должны трактоваться как каким-либо образом ограничивающие настоящее изобретение. Любая комбинация описанных выше элементов во всех возможных для них вариантах охвачена настоящим изобретением, если иное прямо не указано или если это явным образом не противоречит контексту. Указанные в настоящем документе диапазоны значений предназначены исключительно для краткого индивидуального обозначения каждого из значений, попадающих в указанный диапазон, если в настоящем документе не указано иное; каждое отдельное значение включено в настоящее описание в той же степени, как если бы оно было индивидуально указано в настоящем документе. Если не указано иное, все приводимые здесь точные значения представляют соответствующие приблизительные значения (например, все приведенные примеры точных значений, касающихся конкретного фактора или измерения, могут считаться также указывающими на соответствующий приблизительный показатель, с модификацией при необходимости путем добавления термина «приблизительно»).

Все описанные в настоящем документе способы могут быть реализованы в любом подходящем порядке, если иное прямо не указано или если это иным образом явно не противоречит контексту.

Все и любые из примеров или касающихся примеров формулировок (например, «такие как») в настоящем документе предназначены исключительно для лучшего освещения изобретения и не накладывает ограничений на объем настоящего изобретения, если иное не указано. Никакие используемые в настоящем описании формулировки не должны толковаться как указывающие на незаменимость какого-либо элемента при реализации настоящего изобретения, если только явным образом не указано иное.

Цитирование и включение в настоящий документ патентных документов имеет целью исключительно удобство и никоим образом не отражает валидность, патентоспособность и/или правоприменимость таких патентных документов. Описание в настоящем документе любого аспекта или варианта реализации настоящего изобретения с применением формулировок, например, с отсылками на элемент или элементы, предназначается для подтверждения аналогичного аспекта или варианта реализации настоящего изобретения, который «состоит из», «состоит по существу из» или «по существу содержит» указанный конкретный элемент или элементы, если не указано иное или если это явным образом не противоречит контексту (например, следует понимать, что композиция, описанная в настоящем документе как содержащая конкретный элемент, также может подразумевать композицию, состоящую из указанного элемента, если не указано иное или если это явным образом не противоречит контексту).

Настоящее изобретение включает все модификации и эквиваленты предмета изобретения, изложенного в описании аспектов или в формуле изобретения, представленных в настоящем документе, в пределах, допускаемых применимым законодательством.

Все публикации и патентные заявки, цитируемые в настоящем описании, включены в настоящий документ посредством ссылки полностью, в той же мере, как если бы каждая отдельная публикация или патентная заявка была конкретным образом индивидуально включена посредством ссылки.

Хотя настоящее изобретение и было довольно подробно описано на наглядных примерах для ясности понимания, любому специалисту в данной области техники будет также вполне понятно, что в свете принципов настоящего изобретения в него могут быть внесены определенные изменения и модификации без отступления от сущности или объема, определяемых прилагаемой формулой изобретения.

1. Моноклональное антитело, которое связывается с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 1, с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 2, и с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 4, причем указанное антитело выбрано из группы, состоящей из:

(a) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 7, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 8;

(b) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 20, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 21;

(c) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 46, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 47;

(d) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 57, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 58;

(e) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 68, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 69;

(f) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 79, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 80;

(g) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 90, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 91;

(h) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 101, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 102; и

(i) моноклонального антитела, содержащего (i) тяжелую цепь, содержащую области CDR 1, 2 и 3 вариабельной области тяжелой цепи последовательности SEQ ID NO: 112, и (ii) легкую цепь, содержащую области CDR 1, 2 и 3 вариабельной области легкой цепи последовательности SEQ ID NO: 113.

2. Антитело по п. 1, отличающееся тем, что указанное антитело характеризуется ЕС50, определенной методом проточной цитометрии, составляющей не более чем 2 мкг/мл, для связывания с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 1, клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 2, клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 3, и клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, содержащего последовательность аминокислот SEQ ID NO: 4.

3. Антитело по п. 1, отличающееся тем, что указанное антитело имеет KD моновалентного связывания меньше 10-9 М для связывания с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 1, с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 2, с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 3, с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 4.

4. Антитело по п. 1, отличающееся тем, что указанное антитело дополнительно связывается с полипептидом MICB, содержащим последовательность аминокислот SEQ ID NO: 6.

5. Антитело по п. 1, отличающееся тем, что указанное антитело связывается с доменом альфа-1 и/или альфа-2 полипептида MICA, соответствующего последовательности SEQ ID NO: 1.

6. Антитело по п. 1, отличающееся тем, что указанное антитело блокирует взаимодействие MICA с NKG2D.

7. Антитело по п. 1, отличающееся тем, что указанное антитело обладает пониженной способностью к связыванию с мутантным MICA полипептидом, содержащим мутацию по:

(a) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из Q48, W49, Е51, D52, V53 и L54;

(b) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из N56, K57, Т58, R61 и R64;

(c) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из K81, D82, Q83, K84, Н109, Y111, D113, L116, S133, R134, Т137, М140, N141, R143 и N144;

(d) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из K81, D82, Q83, K84, Н109, Y111, D113, L116, Q131, S132, Q136, М140, N141, R143 и N144;

(e) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из Е100, D101, N102, S103, Т104, R105, N121, Е123, Т124 и Е126; или

(f) 1, 2, 3, 4 или более остаткам, выбранным из группы, состоящей из R6, N8, Е97, Н99, Е100, D101, N102, S103, Т104, R105, Е115, L178, R179 и R180;

в каждом случае по отношению к связи между указанным антителом и полипептидом MICA дикого типа, соответствующим последовательности SEQ ID NO: 1.

8. Антитело по любому из пп. 1-7, отличающееся тем, что указанное антитело связывается с полипептидом MICA, содержащим О-связанные и/или N-связанные гликаны, необязательно отличающееся тем, что указанное антитело связывается с гликозилированным полипептидом MICA, экспрессируемым опухолевой клеткой.

9. Антитело по пп. 1-3, отличающееся тем, что указанное антитело содержит константную область тяжелой цепи человека, связывающую рецептор FcγIIIA человека.

10. Антитело по пп. 1-3, отличающееся тем, что указанное антитело конъюгировано или ковалентно связано с токсичным агентом.

11. Фармацевтическая композиция для лечения или предотвращения рака, содержащая дозу от 25 мг до 500 мг антитела по любому из предшествующих пунктов и фармацевтически приемлемый носитель.

12. Способ лечения или предотвращения рака у нуждающегося в этом пациента, включающий введение указанному пациенту эффективного количества композиции по п. 11.

13. Способ лечения или профилактики рака у пациента, нуждающегося в этом, включающий введение указанному пациенту эффективного количества моноклонального антитела, которое связывается с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 1, с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 2, с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 3, и с полипептидом MICA, содержащим последовательность аминокислот SEQ ID NO: 4, на поверхности клеток.



 

Похожие патенты:

Изобретение относится к измерительной технике и может быть использовано в составе системы контроля состояния почвы на агрономическом объекте. Устройство для дистанционного контроля влажности и температуры почвы включает блок питания, блок обработки данных и подключенные к нему датчики параметров окружающей среды и передающий блок.

Изобретение относится к области медицины и может быть использовано в контрольно-аналитических лабораториях для стандартизации и контроля качества лекарственных средств.

Изобретение относится к области медицины, в частности к медицинской генетике, и предназначено для ранней генетической диагностики риска развития сахарного диабета (СД) 2 типа.

Настоящее изобретение относится к устройству, применяемому для детектирования аффинностей связывания, а также способу детектирования аффинностей связывания согласно соответствующему независимому пункту.

Изобретение относится к физико-химическим способам анализа природных вод. Способ определения жесткости природных вод включает этапы, на которых осуществляют определение концентрации мг⋅экв/л ионов Са2+, Mg2+, при этом процесс определения концентрации ионов кальция, магния предусматривает измерение удельной электропроводности от 3 до 20 мкА/см3 сильно разбавленных природных вод с содержанием ионов кальция, магния меньше 0,3 мг⋅экв/л с использованием градуировочного графика, с которого считывается концентрация ионов кальция, магния по численному значению удельной электропроводности природных вод.

Изобретение относится к способу количественного анализа состава газовой смеси, в частности атмосферы гермооболочки (4) ядерной установки. Согласно предложенному изобретению предусмотрено измерительное устройство (2), содержащее детектор (16) теплопроводности с первым измерительным мостом, детектор (14) тепловыделения реакции со вторым измерительным мостом и общий блок (26) обработки результатов.

Изобретение относится к нефтяной промышленности и может быть использовано для проведения исследований по оценке влияния химического реагента на свойства продукции скважин.

Изобретение относится к области медицины, биологии и биотехнологии и предназначено для определения генотипа человека по полиморфизму в гене цитохрома Р450 CYP2D6*6 (1707delT) rs5030655.

Изобретение относится к медицине, биологии, биотехнологии, фармакологии и может быть использовано для оценки цитотоксичности компонентов, входящих в состав скаффолдов, используемых в тканевой инженерии, а именно при пластике или замещении дефектов тканей организма с обеспечением стимуляции их регенерации.

Группа изобретений относится к пищевой промышленности и может быть использована для определения сроков хранения плодов и ягод, способов их транспортирования и хранения.

Изобретение относится к области биохимии, в частности к антителу или его антигенсвязывающему фрагменту, которое связывается с рецептором PD-1 человека. Также раскрыты: молекула нуклеиновой кислоты, кодирующая указанное антитело, экспрессионный вектор, содержащий указанную молекулу нуклеиновой кислоты, клетка-хозяин, экспрессирующая указанное антитело, фармацевтическая композиция, содержащая указанное антитело.

Группа изобретений относится к области биотехнологии, в частности к вариантам антитела, которое специфически связывается с человеческим интерлейкином-6 (IL6), а также к композиции и комбинации для лечения заболевания, ассоциированного с IL6, и фармацевтической композиции для применения при лечении заболевания, ассоциированного с IL6, его содержащим.

Изобретение относится к области биотехнологии, конкретно к получению анти-HER2 антитела и конъюгата анти-HER2 антитела и низкомолекулярного медицинского средства, и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к получению антител против интерлейкина-6, и может быть использовано в медицине. Полученное антитело или его антигенсвязывающий фрагмент используют в составе фармацевтической композиции, а также для приготовления лекарственных средств для лечения или диагностики заболеваний или для облегчения симптомов, опосредованных интерлейкином-6.

Изобретение относится к области биохимии, в частности к мыши, содержащей в своей зародышевой линии нереаранжированную геномную последовательность человека, содержащую единственный генный сегмент VH человека, который представляет собой VH1-2, VH1-69, один или несколько генных сегментов DH человека и один или несколько генных сегментов JH человека, и вставленную последовательность, которая кодирует белок ADAM6a мыши и белок ADAM6b мыши, к клетке, полученной из нее, а также к способу получения реаранжированной последовательности вариабельной области тяжелой цепи иммуноглобулина человека, способу получения антитела и способу получения антигенсвязывающего белка человека с использованием вышеуказанной мыши.

Группа изобретений относится к области биотехнологии. Предложены рекомбинантная плазмидная ДНК pBiPr-ABIgA1FI6-ht, кодирующая человеческое антитело к гемагглютинину вируса гриппа А человека изотипа IgA1, и способ получения указанного человеческого антитела, а также линия эукариотических клеток, содержащая указанную рекомбинантную плазмидную ДНК, и способ получения указанной линии клеток.

Изобретение относится к биотехнологии. Описаны конструкции гетеромультимера с уменьшенной или подавленной эффекторной функцией.

Изобретение относится к области биохимии, в частности к способу получения биспецифического антитела, который включает получение первого и второго половинных антител, доведение значения рН первого и второго половинных антител до рН 5-9; смешивание первого и второго половинных антител с образованием смеси для сборки белка, в которую добавляют избыток глутатиона, и инкубацию полученной смеси для сборки белка с образованием биспецифического антитела.

Изобретение относится к области биохимии, в частности к водной композиции для лечения TNFα-ассоциированного заболевания у млекопитающего, включающей эффективное количество антитела или его антигенсвязывающего фрагмента, специфически связывающегося с человеческим TNFα, а также к способу лечения TNFα-ассоциированного заболевания у млекопитающего с ее использованием.

Изобретение относится к биотехнологии. Описано биспецифическое антитело, которое специфично связывается с HER2 человека или яванского макака и HER3, включающее: вариабельный домен тяжелой цепи VHH, который специфично связывается с HER3, где вариабельный домен тяжелой цепи VHH содержит аминокислотные последовательности, по меньшей мере на 75% гомологичные последовательностям SEQ ID NO: 1-3, и антитело или его антигенсвязывающий домен, которые специфично связываются с HER2 человека или яванского макака.

Изобретение относится к области биохимии, в частности к антителу или его антигенсвязывающему фрагменту, которое связывается с рецептором PD-1 человека. Также раскрыты: молекула нуклеиновой кислоты, кодирующая указанное антитело, экспрессионный вектор, содержащий указанную молекулу нуклеиновой кислоты, клетка-хозяин, экспрессирующая указанное антитело, фармацевтическая композиция, содержащая указанное антитело.

Изобретение относится к области биохимии и биотехнологии, а именно к моноклональному антителу, которое связывается с клетками-трансфектантами C1R, модифицированными для экспрессии на их поверхности полипептида MICA, и содержащей его фармацевтической композиции. Изобретение также относится к способу лечения или предотвращения рака у нуждающегося в этом пациента с помощью вышеуказанной композиции, а также способу лечения или профилактики рака у пациента с помощью вышеуказанного моноклонального антитела. Изобретение позволяет эффективно лечить рак у пациента благодаря новому подходу к направленному воздействию на MICA терапевтическими агентами. 4 н. и 9 з.п. ф-лы, 11 ил., 6 табл., 12 пр.

Наверх