Композиции и способы для лечения активной инфекции mycobacterium tuberculosis

Группа изобретений относится к медицине, а именно к фтизиатрии, и может быть использована для лечения активной туберкулезной инфекции. Способы по изобретению включают введение млекопитающему иммунологически эффективного количества терапевтической вакцины, содержащей выделенный слитый полипептид, содержащий комбинацию антигенов Rv1813, Rv3620, Rv3619 и Rv2608 в сочетании с химиотерапевтическими агентами. Использование изобретений позволяет пролонгировать выживание при лечении активной туберкулезной инфекции и сократить продолжительность химиотерапии. 3 н. и 38 з.п. ф-лы, 4 табл., 32 ил., 6 пр.

 

Перекрестная ссылка на родственные заявки

По этой заявке испрашивается приоритет предварительных заявок США No. 61/679612, поданной 3 августа 2012 и 61/791213, поданной 15 марта 2013, все из которых полностью включены в данный документ посредством ссылки.

ПРЕДСТАВЛЕНИЕ СПИСКА ПОСЛЕДОВАТЕЛЬНОСТЕЙ В ТЕКСТОВОМ ФАЙЛЕ ASCII

Содержание следующего представления текстового файла ASCII полностью включено в данный документ посредством ссылки: считываемая компьютером форма (CRF) списка последовательностей (название файла: 712192000940SeqList.txt, дата записи: 31 июля, 2013 размер: 36 KB).

Предшествующий уровень техники

Область техники, к которой относится изобретение

Данное раскрытие относится к способам и композициям для лечения первичной активной инфекции M. tuberculosis или активной инфекции, являющейся следствием реактивации латентной инфекции у млекопитающего и к способам и композициям для улучшения эффективности химиотерапевтических режимов против активной инфекции M. tuberculosis.

Описание родственного уровня техники

Туберкулез (ТБ) является хроническим инфекционным заболеванием, вызванным инфекцией Mycobacterium tuberculosis и другими видами Mycobacterium. ТБ является значимым пандемическим заболеванием в развивающихся странах, а также является усиливающейся проблемой в развитых районах мира, уносящей между 1,7 и 2 миллионами жизней ежегодно. Хотя инфекция может быть бессимптомной в течение существенного промежутка времени, заболевание наиболее часто проявляется в виде острого воспаления легких, приводя в результате к жару и непродуктивному кашлю. При отсутствии лечения, как правило, результатом являются серьезные осложнения и смерть. Появление ТБ с множественной лекарственной устойчивостью (МЛУ-ТБ) дополнительно усугубляет это лечение (Dye, Nat Rev Microbiol 2009; 7:81-7).

Ход развития инфекции M. tuberculosis происходит по существу через 3 фазы. Во время острой или активной фазы бактерии пролиферируют или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органах, пока иммунный ответ не увеличивается до состояния, при котором он может контролировать инфекцию, после чего бактериальная нагрузка достигает пика и начинает снижаться. Хотя механизм не является полностью понятым, считается, что сенсибилизированные Τ лимфоциты CD4+ совместно с интерфероном гамма (IFN-gamma, γ-IFN) опосредуют контроль инфекции. Когда активный иммунный ответ снижает бактериальную нагрузку и сохраняет ее под контролем в устойчивом и низком уровне, устанавливается латентная фаза. Ранее в исследованиях сообщали о том, что во время латентного состояния M. tuberculosis переходит от активного размножения в неактивное состояние, главным образом становясь нереплицирующимся и оставаясь внутри гранулемы. Однако недавние исследования продемонстрировали, что даже в латентном состоянии, стадия инфекции характеризуется постоянными низкими количествами бактерий, по меньшей мере часть бактериальной популяции остается в состоянии активного метаболизма (Talaat et al. 2007, J of Bact 189, 4265-74).

Эти бактерии вследствие этого выживают, поддерживают активный метаболизм и минимально реплицируются ввиду сильного иммунного ответа. У инфицированного индивидуума во время латентного состояния вследствие этого имеет место баланс между нереплицирующимися бактериями (которые могут представлять большую сложность для детектирования иммунной системой, так как они расположены внутриклеточно) и медленно реплицирующимися бактериями. В некоторых случаях, латентная инфекция начинает реактивацию, когда дремлющие бактерии начинают реплицироваться снова, однако со скоростями несколько более низкими, чем при первичной инфекции. Было предположено, что переход M. tuberculosis от первичной инфекции в латентное состояние сопровождается изменениями в экспрессии генов (Honer zu Bentrup, 2001). Также вероятно, что изменения в антигенной специфичности иммунного ответа происходят потому, что бактерия модулирует экспрессию генов во время ее перехода от активной репликации в неактивное состояние. Подробная природа иммунного ответа, который контролирует латентную инфекцию, и факторы, которые ведут к реактивации, по большому счету неизвестны. Однако имеют место свидетельства того, что за это ответственен сдвиг в доминирующих клеточных типах. Исследования предполагают, что тогда как Τ-клетки CD4 являются основными и их достаточно для контроля инфекции во время острой фазы, Τ клеточные ответы CD8 являются более важными в латентной фазе. Бактерии в этой стадии, как правило, не являются мишенью для большинства профилактических вакцин, которые находятся в разработке в области ТБ, что иллюстрируется недостатком активности, когда традиционные профилактические вакцины вводят латентно инфицированным экспериментальным животным (Turner et al. 2000 Infect Immun. 68:6:3674-9).

Хотя ТБ в целом может подвергаться контролю посредством применения продолжительной антибиотической терапии, такого лечения не достаточно для предотвращения распространения заболевания. Инфицированные индивидуумы могут являться бессимптомными, но контагиозными в течение некоторого времени. Современная клиническая практика для латентного ТБ (бессимптомный и неконтагиозный) является лечением с от 6 до 9 месяцев изониазида или другого антибиотика или альтернативно с 4 месяцами рифампицина. Активный ТБ лечат комбинацией 4 лекарственных препаратов в течение от 6 до 8 недель, во время которых, как предполагается, большинство бацилл подвергаются умерщвлению, с последующими двумя лекарственными средствами с общей продолжительностью от 6 до 9 месяцев. Продолжительность лечения зависит от количества доз, вводимых каждую неделю. В добавление, несмотря на то, что соблюдение режима лечения является критичным, поведение пациента трудно контролировать. Некоторые пациенты не завершают курс лечения или из-за побочных эффектов или из-за чрезмерной продолжительности лечения (6-9 месяцев), что, как показали исследования, может привести к неэффективному лечению и развитию устойчивости к лекарственному средству.

Для того, чтобы контролировать распространение туберкулеза, имеют большое значение как эффективная профилактическая вакцинация, так и точное раннее диагностирование активного заболевания с последующими более эффективными терапевтическими режимами, включая терапевтические вакцины и затратоэффективные и приемлемые для пациента химиотерапевтические средства. В настоящее время профилактическая вакцинация с живыми бактериями, такими как бацилла Кальмета-Герена (БКГ), авирулентный штамм M. bovis, является наиболее эффективным способом для индуцирования защитного иммунитета. Однако безопасность и эффективность БКГ является предметом дискуссий, и в некоторых странах, таких как Соединенные штаты, не вакцинируют основную часть населения этим агентом. Развитие молекулярных адъювантов, комбинированных с отобранными рекомбинантными белками, позволило развитие нового поколения вакцин, которые могут быть применены профилактически, а также терапевтически для лечения, а также предотвращения инфекционных заболеваний. См., например, EP 2457926. Таким образом необходима терапевтическая вакцина, которая эффективна в стимулировании иммунного ответа на активное заболевание ТБ даже несмотря на высокую бактериальную нагрузку, для того чтобы предоставить вспомогательное средство для химиотерапевтических средств для уменьшения времени лечения, очистки от бацилл, ограничить легочную патологию, ассоциированную с заболеванием и потенциально ограничить распространение МЛУ-ТБ.

Таким образом, имеет место срочная потребность в новых более эффективных терапевтических режимах для активных инфекций M. tuberculosis, которые увеличивают приверженность лечению уменьшением времени лечения, для того чтобы уменьшить передачу ТБ.

Сущность изобретения

Данное изобретение относится к способам лечения активной инфекции M. tuberculosis или активной инфекции, являющейся следствием реактивации латентной инфекции у млекопитающего и к способам улучшения эффективности химиотерапевтических режимов против активной инфекции M. tuberculosis.

Данное изобретение основано на неожиданном открытии того, что активная инфекция M. tuberculosis может быть эффективно вылечена режимом лечения, включающим терапевтическую композицию Mtb, такую как терапевтическая вакцина Mtb, и химиотерапевтический агент, эффективный против инфекции M. tuberculosis, посредством этого сокращая время химиотерапии, необходимое для защиты, уменьшая бактериальную нагрузку и/или увеличивая время выживания. Более того, неожиданно, авторы изобретения обнаружили, что терапевтическая композиция Mtb при доставке во время активной ТБ инфекции в качестве вспомогательного средства к антибиотической терапии может вырабатывать преимущественный иммунный ответ к M. tuberculosis, который улучшает эффективность химиотерапевтического режима по отношению к заболеванию ТБ. Авторы изобретения дополнительно обнаружили, что введение терапевтической композиции Mtb, такой как терапевтическая вакцина во время активной ТБ инфекции в качестве вспомогательного средства с химиотерапевтическим агентом, эффективным против инфекции M. tuberculosis, стимулировало значительно более сильный, высококачественный (полифункциональный) и долговременный Τ-клеточный ответ CD4+ типа TH1.

Вследствие этого, в одном варианте предоставлен способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадию введения млекопитающему, имеющему активную туберкулезную инфекцию (например, M. tuberculosis) химиотерапевтического агента и иммунологически эффективного количества терапевтической вакцины, в котором вакцина содержит фармацевтическую композицию, содержащую антиген Mtb или его иммуногенный фрагмент видов Микобактерий туберкулезного комплекса и адъювант.

Будет принято во внимание, что в этом и родственных способах изобретения по меньшей мере одна стадия введения терапевтической вакцины, как правило, первая стадия введения терапевтической вакцины, будет происходить, когда млекопитающее является активно инфицированным M. tuberculosis и/или проявляет по меньшей мере один клинический симптом или положительный результат исследования, ассоциированный с активной инфекцией. Также будет принято во внимание, что способы по данному изобретению могут дополнительно включать дополнительные стадии введения той же или другой терапевтической вакцины по данному изобретению в одной или более дополнительных временных точек впоследствии, безотносительно к тому, имеет ли все еще место активная инфекция или ее симптомы у млекопитающего и безотносительно к тому, является ли результат исследования, ассоциированный с активной инфекцией, все еще положительным, для того чтобы улучшить эффективность режимы химиотерапии. Также будет принято во внимание, что способы по данному изобретению могут включать введение терапевтической вакцины или отдельно, или в сочетании с другими агентами, и сама по себе терапевтическая вакцина может являться одним из множества компонентов лечения в виде части более обширного режима терапевтического лечения. Соответственно, способы по данному изобретению преимущественным образом улучшают эффективность химиотерапевтического режима лечения для лечения активной туберкулезной инфекции.

В некоторых вариантах осуществления терапевтическая вакцина содержит выделенный слитый полипептид, содержащий комбинацию двух или более ковалентно связанных антигенов M. tuberculosis или их иммуногенные фрагменты, где антигены выбраны из группы, состоящей из Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv0655, Rv0831, Rv1009, Rv1099, Rv1240, Rv1288, Rv1410, Rv1569, Rv1789, Rv1818, Rv1860, Rv1886, Rv1908, Rv2220, Rv2032, Rv2623, Rv2875, Rv3044, Rv3310, Rv3881, Rv0577, Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv1511 и Rv3875 и антигенов, имеющих по меньшей мере 90% идентичности с любой из вышеприведенных последовательностей.

В конкретном варианте осуществления терапевтическая вакцина содержит слитый полипептид ID93, который содержит антигены Rv2608, Rv3619, Rv3620 и Rv1813.

В другом конкретном варианте осуществления терапевтическая вакцина содержит слитый полипептид ID93, который содержит антигены Rv2608, Rv3619, Rv3620 и Rv1813, где последовательности антигенов происходят от M. tuberculosis. В более конкретном варианте осуществления слитый полипептид ID93 содержит последовательность, приведенную в SEQ ID NO:1, или последовательности, имеющие по меньшей мере 90% идентичности с ней.

Также в данном документе представлен способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадию введения млекопитающему, имеющему активную инфекцию туберкулезом, иммунологически эффективного количества терапевтической вакцины в сочетании с одним или более химиотерапевтическими агентами, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, в котором слитый полипептид содержит (a) комбинацию антигена Rv3620 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или (b) последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов.

Также в данном документе представлен способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадии введения млекопитающему, имеющему активную инфекцию туберкулезом, иммунологически эффективного количества терапевтической вакцины в сочетании с одним или более химиотерапевтическими агентами, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, в котором слитый полипептид содержит (a) комбинацию антигена Rv1813, Rv3620 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или (b) последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов.

В некоторых вариантах осуществления активная инфекция, которая будет подвергаться лечению в соответствии с раскрытыми способами, является активной инфекцией, которая вызывает у млекопитающего клинический симптом активного ТБ, выбранный из группы, состоящей из слабости, жара, простуд, потери веса, анорексии и ночной потливости. В других вариантах осуществления активная инфекция вызывает клинические симптомы легочного ТБ у млекопитающего, выбранные из группы, состоящей из непрекращающегося кашля, густой слизи, боли в груди и кровохарканья. В других вариантах осуществления активная инфекция характеризуется бактериями Mtb, которые пролиферируют, репродуцируются, распространяются или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органе млекопитающего. В других более конкретных вариантах осуществления активную инфекцию идентифицируют с применением анализа, выбранного из группы, состоящей из анализа кислотоустойчивого окрашивания (AFS); анализа бактериальной культуры, такого как анализ BACTEC MGIT 960; тест IGR, такой как тест QFT®-Gold или ТБ тест QFT®-Gold In-tube Τ SPOT™; кожный тест, такой как кожный тест TST Mantoux (TST); и внутриклеточное цитокиновое окрашивание цельной крови или выделенных МКПК после антигенной стимуляции.

Будет очевидно, что в некоторых вариантах осуществления активная инфекция будет активной первичной инфекцией M. tuberculosis, тогда как в других она будет результатом реактивации латентной инфекции M. tuberculosis. В некоторых вариантах осуществления млекопитающее будет инфицировано штаммом M. tuberculosis с множественной лекарственной устойчивостью (МЛУ). В других вариантах осуществления млекопитающее ранее иммунизировано с бациллой Кальмета-Герена (БКГ).

Некоторые варианты осуществления раскрытых способов включают введение одного или более химиотерапевтических агентов, эффективных в лечении инфекции M. tuberculosis, таких как изониазид и/или рифампицин. В некоторых ситуациях млекопитающему сначала вводят один или более химиотерапевтических агентов в течение промежутка времени и затем вводят терапевтическую вакцину. В других ситуациях млекопитающему сначала вводят терапевтическую вакцину и затем вводят один или более химиотерапевтических агентов в течение промежутка времени. В еще одном виде ситуаций введение одного или более химиотерапевтических агентов и терапевтической вакцины инициируют в одно и то же время. Дополнительно будет принято во внимание, что при воплощении на практике раскрытых способов может быть желательно вводить фармацевтическую композицию и/или терапевтическую вакцину млекопитающему в нескольких интервалах времени, например, один или более последующих интервалов времени после первого введения.

В некоторых вариантах осуществления терапевтическая вакцина дополнительно содержит адъювант. В некоторых вариантах осуществления адъювант, применяемый в терапевтической вакцине, представляет собой адъювант GLA, такой как адъювант GLA, имеющий следующую структуру:

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C12-C20 алкил или C9-C20 алкил.

В более конкретном варианте осуществления при применении GLA, имеющего вышеприведенную структуру, R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил. В еще более конкретном варианте осуществления GLA вышеприведенной структуры является таким, в котором Rl, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C13 алкил. В еще более конкретном варианте осуществления GLA вышеприведенной структуры является таким, в котором R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C9 алкил.

В другом варианте композиции применяют в способах для уменьшения времени курса химиотерапии при активной туберкулезной инфекции у индивида, который включает стадию введения млекопитающему с активной инфекцией Mycobacterium tuberculosis иммунологически эффективного количества терапевтической вакцины, как описано в данном документе, например, содержащей слитый белок или полипептид или иммуногенный фрагмент из видов микобактерий туберкулезного комплекса и адъювант в качестве вспомогательного средства с одним или более химиотерапевтическими агентами, эффективными против инфекции M. tuberculosis, посредством этого снижая время курса химиотерапии против инфекции M. tuberculosis. В другом варианте в данном документе представлен способ для уменьшения времени курса химиотерапии против активной туберкулезной инфекции, при этом способ содержит введение млекопитающему, имеющему активную инфекцию туберкулезом, иммунологически эффективного количества терапевтической вакцины в сочетании с химиотерапией, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, в котором слитый полипептид содержит (a) комбинацию антигена Rv1813, Rv3620 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или (b) последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов, и в котором вакцина индуцирует иммунный ответ против туберкулеза, посредством этого обеспечивая уменьшенное время курса химиотерапии против активной туберкулезной инфекции. В некоторых вариантах время курса терапии укорочено до приблизительно 3, 4, 5, 6 или 7 месяцев, например, не более чем приблизительно 3, 4, 5, 6 или 7 месяцев. Посредством сокращения времени курса химиотерапии против инфекции M. tuberculosis способы по данному изобретению также эффективны в усилении приверженности индивидуума, подвергающегося лечению от инфекции M. tuberculosis, к завершению полного курса лечения.

В дополнительном варианте композиции применяют в способах стимулирования полифункционального, долговременного Τ-клеточного ответа CD4+ типа TН1 при активной туберкулезной инфекции у индивида, где способ включает стадию введения млекопитающему с активной инфекцией Mycobacterium tuberculosis иммунологически эффективного количества терапевтической вакцины, как описано в данном документе, например, содержащей слитый белок или его иммуногенный фрагмент из видов микобактерий туберкулезного комплекса и адъювант в качестве вспомогательного средства с одним или более химиотерапевтическими агентами, эффективными против инфекции M. tuberculosis, посредством этого стимулируя полифункциональный, долговременный Τ-клеточный ответ CD4+ типа TH1-типа. Посредством сокращения времени курса химиотерапии против инфекции M. tuberculosis, способы по данному изобретению также эффективны для усиления приверженности индивидуума, подвергающегося лечению от инфекции M. tuberculosis, к завершению полного курса лечения.

В любом из вышеупомянутых вариантов осуществления млекопитающее может быть человеком.

Краткое описание рисунков

Файл патента или заявки содержит по меньшей мере один рисунок, выполненный в цвете. Копии этого патента или публикации патентной заявки с цветным(и) рисунком(ами) будут предоставлены организацией при запросе и оплате требуемой пошлины.

Фигура 1 демонстрирует бактериальную нагрузку и выживаемость мышей SWR/J и C57BL/6, инфицированных Mycobacterium tuberculosis (Mtb) и подвергаемых лечению с антибиотиками. Мышей SWR/J и C57BL/6 инфицировали с низкой дозой (50-100 бактерии) аэрозоля (LDA) Mtb H37Rv (ATCC #27294). (фиг. 1A) Количество жизнеспособных бактерий в легких (5 мышей/группу) определяли через 15, 30 и 100 дней после инфекции. Обозначения указывают среднее +/- стандартное отклонение. (фиг. 1B) За выживаемостью мышей SWR/J и C57BL/6 наблюдали на животных (8 мышей/группу), инфицированных с Mtb H37Rv и подвергаемых лечению имитационно или с 90-дневным антибиотическим режимом (Rx 90 д), состоящим из INH и RIF, вводимыми в дни 30-120. (фиг. 1C) Мышей SWR/J инфицировали с LDA Mtb H37Rv и подвергали лечению с 30, 60 или 90 днями антибиотиков, начиная с дня 15 (Rx 30 д, 60 д, 90 д) или с дня 30 (Rx 90 д (30)). Продемонстрирована выживаемость мышей SWR/J (7 мышей/группу). (фиг. 1D) Количество жизнеспособных бактерий в легких животных (5 мышей/группу) подвергаемых лечению имитационно или с 90-дневным режимом INH/RIF (Rx 90 д), вводимым в дни 30-120, определяли через 30, 60, 90, 120 и 150 дней после инфекции. * Ρ<0,05 (однофакторный ANOVA с последующим критерием множественного сравнения Даннетта или логарифмический ранговый критерий) считали значимым. Продемонстрирован один репрезентативный эксперимент из двух.

Фигура 2 демонстрирует количества колониеобразующих единиц и выживаемость мышей SWR/J, инфицированных с LDA Mtb и подвергаемых лечению с антибиотиками и ID93/GLA-SE. Мышей SWR/J инфицировали с LDA Mtb (день 0). Через пятнадцать дней (день 15) мышей подвергали лечению имитационно или с антибиотиками в течение 90 дней (Rx 90 д). Подгруппу подвергаемых антибиотическому лечению мышей в каждой группе также иммунизировали 3×3 отдельных недели от ID93/GLA-SE или во время (ВТЛ; дни 15, 36, 57), или после антибиотического терапевтического лечения (ПТЛ; дни 107, 128, 149). (фиг. 2A) Схема иммунотерапевтических экспериментов. (фиг. 2B) Количество жизнеспособных бактерий в легких животных (6 или 7 мышей/группу) определяли через 177 дней после инфекции. * Ρ<0,05 считали значимыми. (фиг. 2C) Защиту оценивали посредством наблюдения за смертями животных (9 или 10 мышей/группу), вызванными Mtb с течением времени. Продемонстрирован один репрезентативный эксперимент из четырех. Ρ<0,05 (логарифмический ранговый критерий) считали значимым.

Фигура 3 демонстрирует выживаемость мышей SWR/J, инфицированных с Mtb и подвергаемых лечению с вакциной ID93/GLA-SE и сниженной антибиотической химиотерапией. Мышей SWR/J инфицировали c LDA Mtb H37Rv. Через пятнадцать дней мышей подвергали лечению в течение 60 или 90 дней с антибиотиками (Rx 60 д и Rx 90, соответственно). После завершения 60 дневного антибиотического режима мышей иммунизировали 3×3 отдельные недели с ID93/GLA-SE. (фиг. 3A) Защиту оценивали наблюдениям за смертями животных (7 мышей/группу), вызванным Mtb с течением времени. Ρ<0,05 (логарифмический ранговый критерий) считали значимым. (фиг. 3B-3M) Гистопатологическая оценка легочных тканей после стимулирования с Mtb H37Rv. Воспалительные ответы и образование гранулемы (г) продемонстрированы в секциях H и E (фиг. 3B-3I) и наличие оценивали AFB (стрелки) (фиг. 3J-3M). (фиг. 3B, 3F, 3J) Имитационно-подвергаемые лечению мыши, день 106; (фиг. 3C, 3J и 3K) 90-дневная антибиотическая терапия, день 106; (фиг. 3D, 3H, 3L) 90-дневная антибиотическая терапия + ID93/GLA-SE, день 241; (фиг. 3E, 3I и 3M) 60-дневная антибиотическая терапия + ID93/GLA-SE, день 295. Представленные данные являются репрезентативными для 5 мышей/группу. Продемонстрирован один репрезентативный эксперимент из трех.

Фигура 4 демонстрирует ID93-специфичные цитокиновые ответы у мышей SWR после иммунотерапии. Мышей SWR инфицировали с LDA Mtb H37Rv и подвергали лечению в течение 90 дней или с антибиотиками отдельно или с антибиотиками с последующей иммунизацией с ID93/GLA-SE 3×3 отдельные недели. (фиг. 4A) Цитокиновый профиль ID93-стимулированных спленоцитов регистрировали или в день 177, или 241 после инфекции. Клетки инкубировали в течение 24 часов в присутствии антигена или контроля среды и супернатанты собирали и анализировали посредством мультиплексного гранулярного блока на IFN-γ, IL-2, TNF, IL-5, IL-10, IL-13 и IL-17. Коробчатые диаграммы демонстрируют серединный и интерквартильный диапазон после вычитания фона. P-величины из критерия суммы рангов Уилкоксона. (фиг. 4B-4D) Внутриклеточное цитокиновое окрашивание на ID93-специфичные T-клеточные ответы в дни 149 и 177 после инфекции. Клетки стимулировали с ID93 или контролем среды в присутствии брефелдина A в течение 8-12 часов, окрашивали коньюгированными с флуорохромом антителами против CD3, CD4, CD8, CD44, IFN-γ, IL-2 и TNF. (фиг. 4B и 4C) Панели демонстрируют схему пропускания для анализа FACS. (фиг. 4D) Коробчатые диаграммы в нижней панели демонстрируют серединный и интерквартильный диапазон после вычитания фона. P-величины из критерия суммы рангов Уилкоксона. Продемонстрирован один репрезентативный эксперимент из двух.

Фигура 5 демонстрирует выживаемость, клинические параметры и бактериальную нагрузку приматов кроме человека (Non-Human Primates, NHP) инфицированных с Mtb и подвергаемых лечению с антибиотиками и ID93/GLA-SE. Яванских макак инокулировали внутритрахеально с 1000 КОЕ вирулентной M. tuberculosis (штамм Эрдмана). Передоставляли инфекции возможность протекать в течение 60 дней с последующим лечением с 30 днями антибиотиков INH/RIF, доставляемыми гаважем: или солевого раствора (имитация). Обезьян (7 в расчете на группу) инъецировали ID93/GLA-SE (Rx + ID93/GLA-SE), вводимыми 3 раза в 2 отдельных недели, или они не получали дополнительное лечение (имитация, Rx). (фиг. 5A) Схема иммунотерапевтического эксперимента NHP. (фиг. 5B) За выживаемостью наблюдали в течение 50 недель после воздействия. (фиг. 5C) Изменения CYR также оценивали ежемесячно в течение 50 недель после воздействия. (фиг. 5D) Бактерии определяли количественно подсчетом бактериологической нагрузки (КОЕ) в легких обезьян. (фиг. 5E) Гистологический вид окрашенных H&E срезов легочных тканей, полученных из NHP.

Фигура 6 демонстрирует log10 количества КОЕ в легком после 6 недель (фиг. 6A) и 12 недель (фиг. 6B) лечения.

Фигура 7 демонстрирует бактериальный рост после прекращения терапии.

Подробное описание изобретения

Как описано в данном документе, данное изобретение в целом относится к композициям и способам для лечения активной ТБ инфекции с применением терапевтических ТБ вакцин в комбинации с химиотерапевтическими агентами против ТБ, что может привести к укороченным продолжительностям лечения, устранению бацилл ТБ и потенциально к ограничению распространения МЛУ-ТБ.

Терапевтические вакцинные композиции по данному изобретению в целом содержат по меньшей мере два гетерологичных полипептида видов Mycobacterium (микобактерии) tuberculosis (туберкулезного) комплекса. Виды Mycobacterium туберкулезного комплекса включают в себя виды, которые, как традиционно считается, вызывают заболевание туберкулез, а также окружающие Mycobacterium и условно-патогенные виды, которые вызывают туберкулез и легочное заболевание у пациентов со сниженным иммунитетом, таких как пациенты с ВИЧ, например, Mycobacterium tuberculosis (Mtb), Mycobacterium bovis или Mycobacterium africanum, БКГ, Mycobacterium avium, Mycobacterium intracellulare, Mycobacterium celatum, Mycobacterium genavense, Mycobacterium haemophilum, Mycobacterium kansasii, Mycobacterium simiae, Mycobacterium vaccae, Mycobacterium fortuitum и Mycobacterium scrofulaceum (см., например, Harrison's Principles of Internal Medicine, том 1, стр. 1004-1014 и 1019-1020). В предпочтительном варианте осуществления виды Mycobacterium для подвергания профилактике, лечению или диагнозу в соответствии с изобретением представляют собой Mycobacterium tuberculosis (Mtb). Последовательности антигенов из видов Mycobacterium являются легкодоступными. Например, последовательности Mycobacterium tuberculosis можно найти в Cole et al., Nature 393:537 (1998) и можно найти на интернет-сайтах, таких как поддерживаемые Wellcome Trust, институтом Сэнгера и институтом Пастера.

В некоторых вариантах осуществления терапевтическая вакцина содержит слитый полинуклеотид, слитый полипептид или композицию, как описано в публикации патентной заявки США No. 2010/0129391 (содержание которой особым образом полностью включено в данный документ посредством ссылки).

Например, в некоторых конкретных вариантах осуществления терапевтическая вакцина содержит выделенный слитый полипептид или белок или полинуклеотид, кодирующий его, содержащий комбинацию двух или более ковалентно связанных антигенов Mycobacterium tuberculosis или их иммуногенных фрагментов, где антигены выбраны из группы, состоящей из Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv0655, Rv0831, Rv1009, Rv1099, Rv1240, Rv1288, Rv1410, Rv1569, Rv1789, Rv1818, Rv1860, Rv1886, Rv1908, Rv2220, Rv2032, Rv2623, Rv2875, Rv3044, Rv3310, Rv3881, Rv0577, Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv1511 и Rv3875, и антигенов, имеющих по меньшей мере 90% идентичности с любой из вышеприведенных последовательностей, как описано в публикации патентной заявки США No. 2010/0129391.

В некоторых вариантах осуществления терапевтическая вакцина содержит выделенный слитый полипептид, содержащий (a) комбинацию антигена Rv3620 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или (b) последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов. В некоторых вариантах осуществления терапевтическая вакцина содержит выделенный слитый полипептид, содержащий (a) комбинацию антигена Rv1813, Rv3620 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными или (b) последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов. В некоторых вариантах осуществления терапевтическая вакцина содержит слитый полипептид, содержащий комбинацию антигенов микобактерий Rv2608, Rv3619, Rv3620 и Rv1813 или последовательности, имеющие по меньшей мере 90% идентичности с комбинацией антигенов. В некоторых вариантах осуществления антигены микобактерий Rv2608, Rv3619, Rv3620 и Rv1813 представляют собой антигены M. tuberculosis Rv2608, Rv3619, Rv3620 и Rv1813. В некоторых вариантах осуществления слитый полипептид содержит последовательность, приведенную в SEQ ID NO:1, или последовательность, имеющую по меньшей мере 90% идентичности с ней. В некоторых вариантах осуществления слитый полипептид содержит последовательность, приведенную в SEQ ID NO:2, или последовательность, имеющую по меньшей мере 90% идентичности с ней. В некоторых вариантах осуществления терапевтическая вакцина содержит слитый полипептид, содержащий комбинацию антигенов микобактерий Rv2608, Rv3620 и Rv 1813 или последовательность, имеющую по меньшей мере 90% идентичностис комбинацией антигенов. В некоторых вариантах осуществления антигены микобактерий Rv2608, Rv3620 и Rv1813 представляют собой антигены M. tuberculosis Rv2608, Rv3620 и Rv1813. В некоторых вариантах осуществления слитый полипептид содержит последовательность, приведенную в SEQ ID NO:3 или 4, или последовательность, имеющую по меньшей мере 90% идентичности с SEQ ID NO:3 или SEQ ID NO:4. В некоторых вариантах осуществления антиген Rv1813 содержит аминокислотную последовательность SEQ ID NO:5. В некоторых вариантах осуществления антиген Rv3620 содержит аминокислотную последовательность SEQ ID NO:6. В некоторых вариантах осуществления антиген Rv2608 содержит аминокислотную последовательность SEQ ID NO:7. В некоторых вариантах осуществления антиген Rv3619 содержит аминокислотную последовательность SEQ ID NO:8. Специалист в данной области поймет, что одна или более N-терминальных аминокислот (таких как сигнальная последовательность) может быть удалена.

В более конкретном варианте осуществления терапевтическая вакцина содержит слитый белок ID93 или полинуклеотид, кодирующий его же, который содержит четыре антигена, принадлежащих к семействам белков Mtb, ассоциированных с вирулентностью (Rv2608, Rv3619, Rv3620) или латентным состоянием (Rv1813), как описано в публикации патентной заявки США No. 2010/0129391 (особым образом полностью включенной в данный документ посредством ссылки).

В некоторых конкретных дополнительных вариантах осуществления слитый белок, например, слитый белок ID93, составлен в виде вакцины. В дополнительных конкретных вариантах осуществления терапевтическая вакцина содержит устойчивую эмульсию масло-в-воде (SE) и GLA, синтетический агонист TLR-4 (GLA), как описано в публикации патентной заявки США No. 2008/0131466 (особым образом полностью включенной в данный документ посредством ссылки). Как поймет специалист в данной области, в некоторых вариантах осуществления терапевтическая вакцина содержит выделенный полипептид, выделенный слитый полипептид или фрагмент (например, антигенный/иммуногенный участок) из видов микобактерий туберкулезного комплекса, известных в данной области. Полипептиды Mtb по изобретению, их антигенные/иммуногенные фрагменты и другие варианты могут быть приготовлены с применением общепринятых рекомбинантных и/или синтетических технологий.

В некоторых вариантах осуществления молекулу нуклеиновой кислоты или слитый белок вводят с одним или более химиотерапевтическими агентами, эффективными против инфекции M. tuberculosis. Примеры таких химиотерапевтических агентов включают, но не ограничены ими, амикацин, аминосалициловую кислоту, капреомицин, циклосерин, этамбутол, этионамид, изониазид, канамицин, пиразинамид, рифамицины (т.е., рифампицин, рифапентин и рифабутин), стрептомицин, офлоксацин, ципрофлоксацин, кларитромицин, азитромицин и фторхинолоны. Такая химиотерапия определяется оценкой лечащего врача с применением предпочтительных лекарственных комбинаций. Химиотерапевтические агенты "первой линии", применяемые для лечения инфекции M. tuberculosis, которая не является устойчивой к лекарственному средству, включают в себя изониазид, рифампицин, этамбутол, стрептомицин и пиразинамид. Химиотерапевтические агенты "второй линии", применяемые для лечения инфекции M. tuberculosis, которая продемонстрировала устойчивость к лекарственному средству по отношению к одному или более лекарственных средств "первой линии", и включают в себя, но не ограничены ими, офлоксацин, ципрофлоксацин, этионамид, аминосалициловую кислоту, циклосерин, амикацин, канамицин и капреомицин.

В некоторых вариантах осуществления терапевтическую вакцину вводят млекопитающему с активным ТБ перед, совместно с или после введения одного или более химиотерапевтических агентов, эффективных против инфекции M. tuberculosis. В некоторых вариантах осуществления химиотерапевтическое средство вводят конкурентно в то же самое время. Альтернативно, химиотерапевтическое средство вводят в пределах минут, таких как приблизительно 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50 минут, часов, таких как приблизительно 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 или даже дней, таких как приблизительно 1, 2, 3, 4, 5 или 6 дней. В некоторых вариантах осуществления химиотерапевтическое средство вводят приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12 недель перед терапевтической вакциной. В одном варианте осуществления молекулу нуклеиновой кислоты или слитый белок вводят приблизительно 2 недели после начала введения одного или более химиотерапевтических агентов. Один или более химиотерапевтических агентов вводят в целом в течение промежутка времени, например, в течение приблизительно 1, 2, 3 или 4 недель или приблизительно 2, 3, 4, 5, 6 или 8 месяцев или приблизительно 1 года или дольше.

В некоторых вариантах осуществления за первым введением млекопитающему с активной инфекцией ТБ терапевтической композиции для стимулирования иммунного ответа, содержащей молекулу нуклеиновой кислоты, слитый полипептид или вакцину, следует одно или более последующих введений нуклеиновой кислоты, слитого полипептида или вакцины. К примеру, за первым введением с молекулой нуклеиновой кислоты или слитого полипептида следует одно или более последующих введений молекулы нуклеиновой кислоты или слитого белка. В одном варианте осуществления за первым введением с молекулой нуклеиновой кислоты или слитого полипептида следует одно или более последующих введений слитого полипептида. В одном варианте осуществления за первым введением с молекулой нуклеиновой кислоты или слитого полипептида следует одно или более последующих введений молекулы нуклеиновой кислоты. Обычно первое или второе или последующие введения предоставляют через приблизительно 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12 отдельных недель или вплоть до приблизительно 4, 5 или 6 отдельных месяцев. Дополнительно введения предоставляют приблизительно 6 отдельных месяцев или в течение отдельных 1, 2, 3, 4 или 5 лет.

В другом варианте композиции применяют в способах уменьшения или сокращения времени курса химиотерапии против инфекции M. tuberculosis, при этом способ включает введение млекопитающему, уже инфицированному Mycobacterium tuberculosis, одного или более химиотерапевтических агентов, эффективных против инфекции M. tuberculosis, и иммунологически эффективного количества фармацевтической композиции, содержащей слитый полипептид, например, ID93, или его иммуногенный фрагмент из видов микобактерий туберкулезного комплекса и адъювант, где указанный слитый полипептид ID93 индуцирует иммунный ответ против M. tuberculosis, посредством этого предоставляя возможность уменьшения или сокращения времени курса химиотерапии против инфекции M. tuberculosis. Обычно, введение молекулы нуклеиновой кислоты, слитого полипептида или вакцины будет предоставлять возможность эффективного химиотерапевтического лечения против инфекции M. tuberculosis в пределах 6 месяцев, 5 месяцев, 4 месяцев, 3 месяцев или менее.

Композиции и способы по данному изобретению обычно вводят людям, но они эффективны для других млекопитающих, включая домашних млекопитающих (т.е., собак, кошек, кроликов, крыс, мышей, морских свинок, хомяков, шиншил) и сельскохозяйственных млекопитающих (т.е., коров, свиней, овец, коз, лошадей).

Определения

В данном описании термины "приблизительно" и "состоящий главным образом из" обозначают ±20% указанного диапазона, величины или структуры, если не указано иное. Необходимо понимать, что термины в единственном числе, как они применены в данном документе, относятся к "одному или более" перечисленных компонентов. Применение альтернативы (например, "или") необходимо понимать как обозначение или одного, обеих или любой комбинации альтернатив. В применяемом в данном документе значении термины "включает в себя", "имеет" и "содержит" применяются синонимично, что подразумевает, что термины и их варианты должны считаться неограничивающими.

"Химиотерапевтическое средство", "химиотерапевтические агенты" или "режим химиотерапии" представляют собой лекарственное средство или комбинацию лекарственных средств, применяемые для лечения или в лечении пациентов, инфицированных или подвергнувшихся воздействию любых видов M. tuberculosis, и включают, но не ограничены ими, амикацин, аминосалициловую кислоту, капреомицин, циклосерин, этамбутол, этионамид, изониазид (INH), канамицин, пиразинамид, рифамицины (т.е., рифампицин, рифапентин и рифабутин), стрептомицин, офлоксацин, ципрофлоксацин, кларитромицин, азитромицин и фторхинолоны и другие производные аналоги или биоэквиваленты в данной области. Химиотерапевтические агенты "первой линии" представляют собой химиотерапевтические агенты, применяемые для лечения инфекции M. tuberculosis, которая не является устойчивой к лекарственному средству, и включают, но не ограничены ими, изониазид, рифампицин, этамбутол, стрептомицин и пиразинамид и другие производные аналоги или биоэквиваленты в данной области. Химиотерапевтические агенты "второй линии", применяемые для лечения инфекции M. tuberculosis, которая продемонстрировала устойчивость к лекарственному средству по отношению к одному или более лекарственных средств "первой линии", включают, без ограничения, офлоксацин, ципрофлоксацин, этионамид, аминосалициловую кислоту, циклосерин, амикацин, канамицин и капреомицин и другие производные аналоги или биоэквиваленты в данной области.

В применяемом в данном документе значении "улучшение эффективности режимов химиотерапии" относится к сокращению продолжительности терапии, требуемой для достижения желательного клинического исхода, уменьшению количества различных химиотерапевтических средств, требуемых для достижения желательного клинического исхода, уменьшению дозировки химиотерапевтических средств, требуемой для достижения желательного клинического исхода, снижению патологии носителя или органов носителя, ассоциированных с активной клинической инфекцией, улучшению жизнеспособности носителя или органов носителя, подвергаемых лечению по способам, уменьшению развития или частоты возникновения штаммов МЛУ-ТБ и/или увеличению приверженности пациента к режимам химиотерапии.

"Терапевтическая(ие) композиция(и) Mtb", как это применено в данном документе, относится(ятся) к композиции(ям), способной(ым) к установлению преимущественного иммунного ответа на M. tuberculosis при введении носителю с активной ТБ инфекцией. "Преимущественный иммунный ответ " является таким, который сокращает признаки или симптомы активного заболевания ТБ, снижает количество бацилл, снижает патологию, ассоциированную с активным заболеванием ТБ, вызывает соответствующий цитокиновый профиль, ассоциированный с регрессией заболевания, увеличивает антиген специфичные Τ-клетки CD4+ и CD8+ или улучшает эффективность режимов химиотерапии. Терапевтические композиции Mtb изобретения включают, без ограничения, полинуклеотиды, которые кодируют полипептиды, полипептиды, антигенные фрагменты, пептиды, доставляемые в фармацевтически приемлемых составах способами, известными в данной области, и включают в себя вакцинные составы.

"Носитель", "пациент", "млекопитающее" или "индивидуум" применяются в данном документе взаимозаменяемо.

"M. tuberculosis", "Mtb", "Mycobacterium tuberculosis", "бактерии", "бактерия", "бацилла", как они применены в данном документе, относятся к бактериям, ответственным за вызывание заболевания ТБ у млекопитающего.

"Устойчивая к лекарственному средству" инфекция M. tuberculosis относится к инфекции M. tuberculosis, в которой инфицирующий штамм не удерживается в статическом или умерщвленном состоянии (является устойчивым к) одним или более так называемых химиотерапевтических агентов "передовой линии", эффективных в лечении инфекции M. tuberculosis (например, изониазид, рифампицин, этамбутол, стрептомицин и пиразинамид).

Инфекция M. tuberculosis "с множественной лекарственной устойчивостью средству", "МЛУ-ТБ" относится к инфекции M. tuberculosis, в которой инфицирующий штамм является устойчивым к двум или более из химиотерапевтических агентов "передовой линии", эффективных в лечении инфекции M. tuberculosis. Инфекции M. tuberculosis с множественной лекарственной устойчивостью, как они применены в данном документе, также относятся к "туберкулезу со значительной лекарственной устойчивостью" ("ЗЛУ-ТБ"), как определено World Health Global task Force в октябре 2006 как ТБ с множественной лекарственной устойчивостью с устойчивость по отношению к любому из фторхинолонов (FQ) и по меньшей мере одному из инъецируемых лекарственных средств, таких как канамицин, амикацин и капреомицин.

"Активный туберкулез", "активный TB", "заболевание ТБ", "ТБ" или "активная инфекция", как они применены в данном документе, относится к болезни, положению или состоянию у млекопитающего (например, примата, такого как человек), при котором бактерии Mtb активно размножаются и поражают органы млекопитающего и вызывают симптомы или скорее всего вызовут признаки, симптомы или другие клинические проявления наиболее часто в легких (легочный активный ТБ) или могут быть обусловлены первичной инфекцией носителя. Клинические симптомы активного ТБ могут включать в себя слабость, утомление, жар, простуды, потерю веса, потерю аппетита, анорексию или ночную потливость. Симптомы легочного активного ТБ включают в себя кашель, продолжающийся в течение нескольких недель (например, по меньшей мере 3 недели), густую слизь, боль в груди и кровохарканье. "Реактивированный туберкулез", как это применено в данном документе, относится к активному ТБ, который развивается у индивидуума, имеющего ЛТБИ, и у которого активация дремлющих очагов инфекции приводит в результате к активному размножению бактерий Mtb. "Активное размножение", как это применено в данном документе, относится к бактериям Mtb, которые пролиферируют, репродуцируются, распространяются или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органах инфицированного хозяина. В некоторых вариантах осуществления инфицированное млекопитающее (например, человек) имеет подавленную иммунную систему. Иммунное подавление может быть обусловлено возрастом (например, очень молодой или более старый) или другими факторами (например, наркотическая зависимость, трансплантат органа) или другими состояниями, такими как другая инфекция (например, инфекция ВИЧ), диабет (например, сахарный диабет), силикоз, рак головы и шеи, лейкемия, болезнь Ходжкина, заболевание почек, низкая масса тела, кортикостероидное лечение или лечения артрита (например, ревматоидный артрит) или болезнь крона или им подобное.

Тесты для определения наличия активного ТБ или состояния, вызванного активным размножением бактерий Mtb известны в данной области и включают, но не ограничены ими, кислотоустойчивое окрашивание (AFS) и прямое микроскопическое исследование мокроты, бронхоальвеолярный лаваж, плевральную эффузию, биопсию ткани, эффузию спинномозговой жидкости; бактериальную культуру, такие как BACTEC MGIT 960 (Becton Dickinson, Franklin Lakes, NJ, USA); тесты IGR, включая QFTO-Gold или QFT®-Gold In-tube Τ SPOT™.TB, кожные пробы, такие как кожный тест TST Mantoux (TST); и внутриклеточное цитокиновое окрашивание цельной крови или выделенных МКПК после антигенной стимуляции.

"Латентная инфекция туберкулезом", "ЛТБИ", "латентность" или "латентное заболевание", "дремлющая инфекция", как они применены в данном документе, относится к инфекции M. tuberculosis (MTB), которую иммунная система носителя переводит в неактивное состояние, которое характеризуется постоянными низкими количествами бактерий, но может также содержать по меньшей мере часть бактериальной популяции, которая остается в состоянии активного метаболизма, включая размножение в состоянии устойчивой стабилизации. Латентную инфекцию ТБ определяют клинически посредством положительных TST или IGRA без признаков, симптомов или радиографических свидетельств активного заболевания ТБ. Латентно инфицированные млекопитающие не являются "контагиозными" и не могут распространять заболевание из-за очень низкого количества бактерий, ассоциированных с латентными инфекциями. Латентную инфекцию туберкулезом (ЛТБ) лечат лекарственным препаратом или лекарственными препаратами для умерщвления дремлющих бактерий. Лечение ЛТБИ значительно снижает риск того, что инфекция разовьется в активный туберкулез (TB) в более позднем возрасте (т.е., оно предоставляется для предотвращения реактивации).

"Виды микобактерий туберкулезного комплекса" включают в себя виды, традиционно рассматриваемые как вызывающие заболевание туберкулез, а также окружающие Mycobacterium и условно-патогенные виды, которые вызывают туберкулез и легочное заболевание у пациентов со сниженным иммунитетом, таких как пациенты со СПИДом, например, M. tuberculosis, M. bovis или M. africanum, БКГ, M. avium, M. intracellulare, M. celatum, M. genavense, M. haemophilum, M. kansasii, M. simiae, M. vaccae, M. fortuitum и M. scrofulaceum (см., например, Harrison's Principles of Internal Medicine, глава 150, стр. 953-966 (16-е издание., Braunwald, et al., eds., 2005).

"Прогрессирующий первичный туберкулез", как это применено в данном документе, относится к заболеванию ТБ, которое развивается в пределах первых нескольких лет после первичного воздействия и инфекции Mtb, из-за неспособности иммунной системы носителя сдерживать в достаточной мере первичную инфекцию.

"Способ лечения", как раскрыто в данном документе, относится в основном к способу лечения активной туберкулезной инфекции у млекопитающего с применением терапевтической вакцины в сочетании с режимом лечения с химиотерапевтическим средством. Будет принято во внимание в этом и родственных способах изобретения, что по меньшей мере одна стадия введения терапевтической вакцины, как правило, первая стадия введения терапевтической вакцины, будет происходить когда млекопитающее является активно инфицированным M. tuberculosis и/или проявляет по меньшей мере один клинический симптом или положительный результат исследования, ассоциированный с активной инфекцией. Также будет принято во внимание, что способы по данному изобретению могут дополнительно содержать дополнительные стадии введения той же или другой терапевтической вакцины по данному изобретению в одной или более дополнительных временных точках впоследствии, безотносительно к тому, присутствует ли активная инфекция или ее симптомы у млекопитающего, и безотносительно к тому, является ли результат исследования, ассоциированный с активной инфекцией, все еще положительным, для того чтобы улучшить эффективность режимов химиотерапии. Также будет принято во внимание, что способы по данному изобретению могут включать введение терапевтической вакцины или отдельно или в сочетании с другими агентами и, сама по себе терапевтическая вакцина может являться одним из множества компонентов лечения в виде части обширного терапевтического режима лечения. Соответственно, способы по данному изобретению преимущественным образом улучшают эффективность режима лечения с химиотерапевтическим средством для лечения активной туберкулезной инфекции.

Полипептидные композиции

Как отмечено, данное изобретение в одном варианте предоставляет выделенные полипептиды Mycobacterium, как описано в данном документе, включая слитые полипептиды и композиции, содержащие то же самое, и их применение в комбинации с химиотерапевтическими агентами для лечения активных инфекций ТБ. Обычно, полипептид по изобретению будет представлять собой выделенный полипептид и может являться фрагментом (например, антигенным/иммуногенным участком) из аминокислотной последовательности, раскрытой в данном документе, или может содержать полную аминокислотную последовательность, раскрытую в данном документе. Полипептиды по изобретению, их антигенные/иммуногенные фрагменты и другие варианты могут быть приготовлены с применением общепринятых рекомбинантных и/или синтетических технологий.

В некоторых вариантах осуществления полипептиды по изобретению являются антигенными/иммуногенными, т.е., они реагируют детектируемо в рамках иммуноанализа (такого как ELISA или анализ Τ-клеточной стимуляции) с антисывороткой и/или Τ клетками инфицированного индивида. Скринирование на иммуногенную активность может быть выполнено с применением технологии, хорошо известной опытному специалисту. Например, такие скринирования могут быть выполнены с применением способов, таких как описанные в Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988. В одном иллюстративном примере, полипептид может быть иммобилизирован на твердой подложке и подвергнуться контакту с сыворотками пациента для позволения связывания антител в сыворотках с иммобилизированным полипептидом. Несвязанные сыворотки могут быть затем удалены и связанные антитела детектированы с применением, например, меченого 125I белка A.

Как распознает опытный специалист, иммуногенные участки полипептидов, раскрытых в данном документе, также являются охватываемыми данным изобретением. "Иммуногенный участок" в применяемом в данном документе значении представляет собой фрагмент иммуногенного полипептида по изобретению, который сам по себе является иммунологически реактивным по отношению к (т.е., особым образом связывается) B-клеткам и/или Τ-клеточным поверхностным антигенным рецепторам, которые распознают полипептид. Иммуногенные участки обычно могут быть идентифицированы с применением хорошо известных технологий, таких как обозреваемые в in Paul, Fundamental Immunology, 3rd ed., 243-247 (Raven Press, 1993) и приведенных там источниках. Такие технологии включают в себя скринирование полипептидов на способность реагировать с антиген-специфичными антителами, антисыворотками и/или Τ-клеточными линиями или клонами. В применяемом в данном документе значении, антисыворотки и антитела являются "антиген-специфичными", если они особым образом связывают антиген (т.е., они реагируют с белком в иммуноанализе и не реагируют детектируемо с неродственными белками). Такие антисыворотки и антитела могут быть получены, как описано в данном документе и с применением хорошо известных технологий.

В конкретном варианте осуществления антигенный/иммуногенный участок полипептида по данному изобретению является участком, который реагирует с антисыворотками и/или Τ клетками с уровнем, который не является существенно меньшим, чем реактивность полноразмерного полипептида (например, в ELISA и/или анализе Τ-клеточной реактивности). Предпочтительно, уровень иммуногенной активности антигенного/иммуногенного участка составляет по меньшей мере приблизительно 50%, предпочтительно по меньшей мере приблизительно 70% и наиболее предпочтительно более чем приблизительно 90% иммуногенности по отношению к полноразмерному полипептиду. В некоторых случаях будут идентифицированы предпочтительные иммуногенные участки, которые имеют уровень иммуногенной активности больше чем у соответствующего полноразмерного полипептида, например, имеют подобную или большую чем приблизительно 100% или 150% или более иммуногенную активность.

Полипептидная композиция по изобретению может также содержать один или более полипептидов, которые иммунологически реактивны по отношению к Τ клеткам и/или антителам, генерированным против полипептида по изобретению, в особенности полипептида, имеющего аминокислотную последовательность, раскрытую в данном документе, или иммуногенному фрагменту или его варианту.

В другом варианте осуществления изобретения предоставлены полипептиды, которые содержат один или более полипептидов, которые являются способными к стимулированию Τ клеток и/или антител, которые являются иммунологически реактивными по отношению к одному или более полипептидов, описанных в данном документе, или одному или более полипептидов, кодируемых смежной полинуклеотидной последовательностью, содержащейся в полинуклеотидной последовательности, раскрытой в данном документе, или иммуногенным фрагментам или их вариантам или к одной или более полинуклеотидных последовательностей, которые гибридизуются с одной или более из этих последовательностей при состояниях от умеренной до высокой жесткости.

Данное изобретение также предоставляет полипептидные фрагменты, включая антигенные/иммуногенные фрагменты, содержащие по меньшей мере приблизительно 5, 10, 15, 20, 25, 50 или 100 смежных аминокислот или более, включая все промежуточные длины полипептидной композиции, как установлено далее в данном документе, или фрагменты, кодируемые полинуклеотидной последовательностью, как установлено далее в данном документе.

В другом варианте данное изобретение предоставляет варианты полипептидных композиций, описанных в данном документе. Полипептидные варианты (например, любых антигенов и слитых полипептидов, описанных в данном документе), в целом охватываемые данным изобретением, будут, как правило, проявлять меньшей мере приблизительно 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% или более идентичности (определяемой как описано ниже) по их длине с полипептидной последовательностью, как установлено далее в данном документе.

Полипептидный "вариант" в качестве термина, применяемого в данном документе, является полипептидом, который, как правило, отличается от полипептида особым образом раскрытого в данном документе, по одной или более замен, делеций, добавлений и/или вставок. Такие варианты могут являться встречающимися в природе или могут быть генерированными синтетически, например, модифицированием одной или более из вышеприведенных полипептидных последовательностей изобретения и оценки их иммуногенной активности, как описано в данном документе, с применением любой из ряда технологий, хорошо известных в данной области.

Например, некоторые иллюстративные варианты полипептидов по изобретению включают те, в которых один или более участков, таких как N-терминальная лидерная последовательность или трансмембранный домен, был удален. Другие иллюстративные варианты включает варианты, в которых маленький участок (например, приблизительно 1-30 аминокислот) был удален из N- и/или C-конца зрелого белка.

Во многих случаях вариант будет содержать консервативные замены. "Консервативная замена" является заменой, при которой аминокислота замещается на другую аминокислоту, которая имеет подобные свойства, такие при которых специалист в области пептидной химии может ожидать, что вторичная структура и гидрофобная природа полипептида будет в значительной степени неизмененной. Как описано выше, модификации могут быть внесены в структуру полинуклеотидов и полипептидов по данному изобретению и все еще будет получена функциональная молекула, которая кодирует вариант или производный полипептид с желательными свойствами, например, с иммуногенными свойствами. Когда желательно изменить аминокислотную последовательность полипептида для создания эквивалента или даже улучшенного иммуногенного варианта или участка полипептида по изобретению, специалист в данной области будет, как правило, изменять один или более кодонов кодирующей последовательности ДНК в соответствии с таблицей A.

Например, некоторые аминокислоты могут быть замещены на другие аминокислоты в белковой структуре без заметной потери взаимодействующей связывающей способности со структурами такими как, например, антигенсвязывающие области антител или сайты связывания на молекулах субстрата. Так как взаимодействующая способность и природа белка, которая определяет биологическую функциональную активность белка, некоторые замены в аминокислотной последовательности могут быть внесены в белковые последовательности, и, естественно, его основополагающую кодирующую последовательность ДНК, и, тем не менее, будет получен белок с подобными свойствами. Таким образом, предполагается, что различные изменения могут быть внесены в пептидную последовательность раскрытых композиций или соответствующие последовательности ДНК, которые кодируют указанные пептиды без заметной потери их биологической пригодности или активности.

Таблица A
Аминокислоты Кодоны
Аланин Ala A GCA GCC GCG GCU
Цистеин Cys C UGC UGU
Аспарагиновая кислота Asp D GAC GAU
Глутаминовая кислота Glu Ε GAA GAG
Фенилаланин Phe F UUC UUU
Глицин Gly G GGA GGC GGG GGU
Гистидин His Η CAC CAU
Изолейцин Ile I AUA AUC AUU
Лизин Lys Κ AAA AAG
Лейцин Leu L UUA UUG CUA CUC CUG CUU
Метионин Met Μ AUG
Аспарагин Asn Ν AAC AAU
Пролин Pro Ρ CCA CCC CCG CCU
Глутамин Gln Q CAA CAG
Аргинин Arg R AGA AGG CGA CGC CGG CGU
Серин Ser S AGC AGU UCA UCC UCG UCU
Треонин Thr Τ ACA ACC ACG ACU
Валин Val V GUA GUC GUG GUU
Триптофан Trp W UGG
Тирозин Tyr Y UAC UAU

При осуществлении таких изменений может быть учтен индекс гидрофобности аминокислот. Значимость гидрофобного аминокислотного индекса в предоставлении взаимодействующей биологической функции белку в целом в данной области является ясной (Kyte and Doolittle, 1982, включен в данный документе посредством ссылки). Приемлемо, чтобы относительный гидрофобный характер аминокислоты вносил вклад во вторичную структуру получающегося в результате белка, что в свою очередь определяет взаимодействие белка с другими молекулами, например, ферментами, субстратами, рецепторами, ДНК, антителами, антигенами и им подобным. Каждой аминокислоте был присвоен индекс гидрофобности на основе ее гидрофобности и свойств заряда (Kyte and Doolittle, 1982). Эти величины: изолейцин (+4,5); валин (+4,2); лейцин (+3,8); фенилаланин (+2,8); цистеин/цистин (+2,5); метионин (+1,9); аланин (+1,8); глицин (-0,4); треонин (-0,7); серин (-0,8); триптофан (-0,9); тирозин (-1,3); пролин (-1,6); гистидин (-3,2); глутамат (-3,5); глутамин (-3,5); аспартат (-3,5); аспарагин (-3,5); лизин (-3,9); и аргинин (-4,5).

В данной области известно, что некоторые аминокислоты могут быть замещены другими аминокислотами, имеющими подобный индекс или оценку гидрофобности, и тем не менее приводить в результате к белку с подобной биологической активностью, т.е., тем не менее получать биологически функционально эквивалентный белок. При осуществлении таких изменений замена аминокислот, гидрофобные индексы которых находятся в пределах 2, являются предпочтительной, индексы в пределах 1 являются особенно предпочтительными и индексы в пределах 0,5 являются даже более предпочтительными. Также в данной области известно, что замена подобных аминокислот может быть эффективно осуществлена на основе гидрофильности.

Как подробно описано в патенте США 4554101, следующие величины гидрофильности были присвоены аминокислотным остаткам: аргинин (+3,0); лизин (+3,0); аспартат (+3,01); глутамат (+3,01); серин (+0,3); аспарагин (+0,2); глутамин (+0,2); глицин (0); треонин (-0,4); пролин (-0,5,1); аланин (-0,5); гистидин (-0,5); цистеин (-1,0); метионин (-1,3); валин (-1,5); лейцин (-1,8); изолейцин (-1,8); тирозин (-2,3); фенилаланин (-2,5); триптофан (-3,4). Ясно, что аминокислота может быть замещена на другую, имеющую подобную величину гидрофильности и, тем не менее, будет получен биологически эквивалентный и в частности иммунологически эквивалентный белок. При таких изменениях замена аминокислот, величины гидрофильности которых находятся в пределах 2, является предпочтительной, величины в пределах 1 являются особенно предпочтительными и величины в пределах 0,5 являются даже более предпочтительными.

Как отмечено выше, аминокислотные замены в целом вследствие этого основаны на относительной подобности заместителей в боковой цепи аминокислот, например, их гидрофобности, гидрофильности, заряда, размера и им подобного. Иллюстративные замены, при которых приняты во внимание различные из вышеприведенных свойств, хорошо известны специалисту в данной области, и включают в себя: аргинин и лизин; глутамат и аспартат; серин и треонин; глутамин и аспарагин; и валин, лейцин и изолейцин.

В добавление любой полинуклеотид может быть дополнительно модифицирован для увеличения стабильности in vivo. Возможные модификации включают в себя, но не ограничены ими, добавление фланкирующей последовательности на 5' и/или 3' концы; применение фосфотиоата или 2'-O-метил в большей степени, чем фосфодиэстеразные связи в остове; и/или включение нестандартных оснований, таких как инозин, квеуозин и вибутозин, а также ацетил- метил-, тио- и другие модифицированные формы аденина, цитидина, гуанина, тимина и уридина.

Аминокислотные замены могут дополнительно быть осуществлены на основе подобности в полярности, заряда, растворимости, гидрофобности, гидрофильности и/или амфипатической природы остатков. Например, отрицательно заряженные аминокислоты включают в себя аспарагиновую кислоту и глутаминовую кислоту; положительно заряженные аминокислоты включают в себя лизин и аргинин; и аминокислоты с незаряженными полярными головными группами, имеющие подобные величины гидрофильности, включают в себя лейцин, изолейцин и валин; глицин и аланин; аспарагин и глутамин; и серин, треонин, фенилаланин и тирозин. Другие группы аминокислот, которые могут представлять консервативные изменения, включают в себя: (1) ala, pro, gly, glu, asp, gln, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; и (5) phe, tyr, trp, his. Вариант может также или альтернативно содержать неконсервативные изменения. В предпочтительном варианте осуществления вариант полипептидов отличается от природной последовательности заменой, делецией или добавлением пяти аминокислот или менее. Варианты могут также (или альтернативно) быть модифицированы, например, делецией или добавлением аминокислот, которые имеют минимальное влияние на иммуногенность, вторичную структуру и гидрофобную природу полипептида.

Как отмечено выше, полипептиды могут содержать сигнальную (или лидерную) последовательность на N-терминальном конце белка, который котрансляционно или посттрансляционно направляет перенос белка. Полипептид может также быть коньюгирован с линкерной или другой последовательностью для облегчения синтеза, очистки или идентификации полипептида (например, poly-His) или для усиления связывания полипептида с твердой подложкой. Например, полипептид может быть коньюгирован с Fc-областью иммуноглобулина.

При сравнении полипептидных последовательностей две последовательности указывают как "идентичные", если последовательность аминокислот в двух последовательностях является такой же при выравнивании на максимальное соответствие, как описано ниже. Сравнения между двумя последовательностями, как правило, выполняют сравнением последовательностей на протяжении окна сравнения для идентификации и сравнения локальных областей подобия последовательностей. "Окно сравнения" в применяемом в данном документе значении, относится к сегменту из по меньшей мере приблизительно 20 смежных положений, обычно от 30 до приблизительно 75, от 40 до приблизительно 50, в котором последовательность может быть сравнена с референсной последовательностью с таким же количеством смежных положений после того, как две последовательности оптимально выровнены.

Оптимальное выравнивание последовательности для сравнения может быть проведено с применением программы Megalign в комплекте LaSergene биоинформатического программного обеспечения (DNASTAR, Inc., Madison, WI), с применением параметров по умолчанию. Эта программа заключает в себе несколько схем выравнивания, описанных в следующих источниках: Dayhoff, M.O. (1978) A model of evolutionary change in proteins - Matrices for detecting distant relationships. In Dayhoff, M.O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington DC Vol. 5, Suppl. 3, pp. 345-358; Hein J. (1990) Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in Enzymology vol. 183, Academic Press, Inc., San Diego, CA; Higgins, D.G. and Sharp, P.M. (1989) CABIOS 5:151-153; Myers, E.W. and Muller W. (1988) CABIOS 4: 11-17; Robinson, E.D. (1971) Comb. Theor 11: 105; Santou, N. Nes, M. (1987) Mol. Biol. Evol. 4:406-425; Sneath, P.H.A. and Sokal, R.R. (1973) Numerical Taxonomy - the Principles and Practice of Numerical Taxonomy, Freeman Press, San Francisco, CA; Wilbur, W.J. and Lipman, D.J. (1983) Proc. Nat'l Acad., Sci. USA 80:726-730.

Альтернативно, оптимальное выравнивание последовательностей для сравнения может быть проведено алгоритмом локальной идентичности Smith and Waterman (1981) Add. APL. Math 2:482, алгоритмом выравнивания идентичности Needleman and Wunsch (1970) J. Mol. Biol. 48:443, способами поиска подобности Pearson and Lipman (1988) Proc. Natl Acad. Sci. USA 85: 2444, компьютеризированной реализаций этих алгоритмов (GAP, BESTFIT, BLAST, FASTA и TFASTA в пакете программного обеспечения Wisconsin Genetics Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, WI) или проверкой.

Одним предпочтительным примером алгоритмов, которые являются пригодными для определения процента идентичности последовательности и подобности последовательности, являются алгоритмы BLAST и BLAST 2.0, которые описаны в Altschul et al. (1977) Nucl. Acids Res. 25:3389-3402 и Altschul et al. (1990) J. Mol. Biol. 215:403-410, соответственно. BLAST и BLAST 2.0 могут быть применены, например, с параметрами, описанными в данном документе, для определения процента идентичности последовательности для полинуклеотидов и полипептидов по изобретению. Программное обеспечение для выполнения анализов BLAST общедоступно в Национальном центре биотехнологической информации. Для аминокислотной последовательности может быть применена матрица оценивания для расчета кумулятивной оценки. Распространение совпадений групп в каждом направлении прекращают, когда: кумулятивная оценка выравнивание выпадает по количеству X от его максимальной достижимой величины; кумулятивная оценка опускается до нуля или ниже, из-за накопления одного или более выравниваний остатка с негативной оценкой; или достигнут конец любой последовательности. Параметры W, Τ и X алгоритма BLAST определяют чувствительность и скорость выравнивания.

В одном предпочтительном подходе "процент идентичности последовательности" определяют сравнением двух оптимально выровненных последовательностей на протяжении окна сравнения по меньшей мере из 20 положений, где участок полипептидной последовательности в окне сравнения может содержать добавления или делеции (т.е., гэпы) из 20 процентов или менее, обычно от 5 до 15 процентов или от 10 до 12 процентов, по сравнению с референсной последовательностью (которая не содержит добавления или делеции) для оптимального выравнивания двух последовательностей. Процент рассчитывают определением количества положений, в которых идентичный аминокислотный остаток встречается в обеих последовательностях с получением количества совпадающих положений, получая посредством деления количества совпадающих положений на общее количество положений в референсной последовательности (т.е., размер окна) и умножения результатов на 100 процента идентичности последовательности.

В некоторых предпочтительных вариантах осуществления изобретения предоставлены слитые полипептиды Mycobacterium tuberculosis и полинуклеотиды, кодирующие слитые полипептиды. Слитый полипептид и слитые белки относятся к полипептиду, имеющему по меньшей мере два гетерологичных полипептида видов Mycobacterium, такие как полипептиды Mycobacterium tuberculosis, ковалентно связанных или напрямую, или через аминокислотный линкер. Полипептиды, образующие слитый белок, как правило, соединены C-концом к N-концу, хотя они также могут быть соединены C-концом к C-концу, N-концом к N-концу или N-концом к C-концу. Полипептиды слитого белка могут быть расположены в любом порядке. Слитые полипептиды или слитые белки могут также включать в себя консервативно модифицированные варианты, полиморфные варианты, аллели, мутанты, субпоследовательность, межвидовые гомологи и иммуногенные фрагменты антигенов, которые составляют слитый белок. Антигены Mycobacterium tuberculosis описаны в Cole et al., Nature 393:537 (1998), который раскрывает весь геном Mycobacterium tuberculosis. Могут быть идентифицированы антигены из других видов Mycobacterium, которые соответствуют антигенам Mycobacterium tuberculosis, например, с применением алгоритмов сравнения последовательностей, как описано в данном документе или других способов, известных специалисту в данной области, например, анализы гибридизации и анализы связывания антител.

Слитые полипептиды по изобретению в целом содержат по меньшей мере два антигенных полипептида, как описано в данном документе, и могут дополнительно содержать другие неродственные последовательности, такие как последовательность, которая содействует предоставлению Τ-хелперного эпитопа (партнер по иммунологическому слиянию), предпочтительно, Τ-хелперного эпитопа, распознаваемого людьми или который содействует экспрессированию белка (усилитель экспрессии) с более высокими выходами, чем у природного рекомбинантного белка. Некоторые предпочтительные партнеры по слиянию являются как иммунологическими, так и партнерами по слиянию для усиления экспрессии. Другие партнеры по слиянию могут быть выбраны так, чтобы они увеличивали растворимость белка или позволяли, чтобы белок был направлен в требуемые внутриклеточные компартменты. Тем не менее, дополнительно партнеры по слиянию включают в себя аффинные маркеры, которые облегчают очистку белка.

Слитые белки в целом могут быть получены с применением стандартных технологий. Предпочтительно, слитый белок экспрессируют в виде рекомбинантного белка. Например, последовательность ДНК, кодирующая полипептидные компоненты требуемого слияния, может быть собрана отдельно и лигирована в соответствующий экспрессионный вектор. 3'-конец последовательности ДНК, кодирующий один полипептидный компонент, лигирован с или без пептидного линкера с 5'-концом последовательности ДНК, кодирующей второй полипептидный компонент так, что рамки считывания последовательностей находятся в фазе. Это позволяет трансляцию в индивидуальный слитый белок, который сохраняет биологическую активность всех компонентов полипептидов.

Последовательность пептидного линкера может быть применена для отделения первого и второго полипептидных компонентов расстоянием, достаточным для обеспечения того, чтобы каждый полипептид, если требуется, укладывался в его вторичную и третичную структуры. Такую пептидную линкерную последовательность встраивают в слитый белок с применением стандартных технологий, хорошо известных в данной области. Некоторые пептидные линкерные последовательности могут быть выбраны на основании следующих факторов: (1) их способность принимать гибкую удлиненную конформацию; (2) их неспособность принимать вторичную структуру, которая могла бы взаимодействовать с функциональным эпитопом в первом и втором полипептидах; и (3) недостаток гидрофобных или заряженных остатков, которые должны реагировать с функциональным эпитопом полипептида. Предпочтительные пептидные линкерные последовательности содержат остатки Gly, Asn и Ser. Другие почти нейтральные аминокислоты, такие как Thr и Ala, могут также быть применены в линкерных последовательностях. Аминокислотные последовательности, которые могут быть эффективно применены в качестве линкеров, включают в себя раскрытые в Maratea et al., Gene 40:39 46 (1985); Murphy et al., Proc. Natl. Acad. Sci. USA 83:8258 8262 (1986); патенте США No. 4935233 и патенте США No. 4751180. Линкерная последовательность обычно может иметь от 1 до приблизительно 50 аминокислот в длину. Линкерные последовательности не требуются, когда первый и второй полипептиды имеют несущественные N-терминальные аминокислотные области, которые могут быть применены для разделения функциональных доменов и предотвращают стерическое влияние.

Лигированные последовательности ДНК функционально соединены с подходящими транскрипционными или трансляционными регулятивными элементами. Регулятивные элементы, ответственные за экспрессию ДНК, расположены только в 5' к последовательности ДНК, кодирующей первые полипептиды. Подобным образом стоп кодоны, требуемые для сигналов окончания трансляции и прекращения транскрипции, представлены только в 3' к последовательности ДНК, кодирующей второй полипептид.

В пределах предпочтительных вариантов осуществления партнер для иммунологического слияния для применения в слитом полипептиде по изобретению получен из белка D, поверхностного белка грамотрицательной бактерии Haemophilus influenza Β (WO 91/18926). Предпочтительно, производное белка D содержит примерно первую треть белка (например, первые 100-110 N-терминальных аминокислот) и производное белка D может быть липидировано. В пределах некоторых предпочтительных вариантов осуществления первые 109 остатков партнера по слиянию липопротеина D включены в N-конец для предоставления полипептида с дополнительным экзогенным Τ-клеточным эпитопом и для увеличения уровня экспрессии в E. coli (таким образом функционирующего в качестве усилителя экспрессии). Липидный хвост обеспечивает оптимальное представление антигена антиген представляющим клеткам. Другие партнеры по слиянию включают в себя неструктурный белок вируса influenzae, NS 1 (гемаглютинин). Как правило, применяют 81 N-терминальную аминокислоту, хотя могут быть применены различные фрагменты, которые включают в себя T-хелперный эпитоп.

В другом варианте осуществления партнер для иммунологического слияния содержит аминокислотную последовательность, полученную из белка, известного как LYTA или его участка (предпочтительно, C-концевого участка). LYTA получают из Streptococcus pneumoniae, который синтезирует N-ацетил-L-аланин амидазу, известную как амидаза LYTA (кодируемая геном LytA; Gene 43:265-292 (1986)). LYTA представляет собой аутолизин, который особым образом разрушает некоторые связи в пептидогликановом остове. C-концевой домен белка LYTA ответственен за аффинность к холину или к некоторым аналогам холина, таким как DEAE. Это свойство использовали для создания экспрессирующих C-LYTA плазмид E. coli, пригодных для экспрессии слитых белков. Была описана очистка гибридных белков, содержащих фрагмент C-LYTA на амино конце (см. Biotechnology 70:795-798 (1992)). В пределах предпочтительного варианта осуществления повторный участок LYTA может быть встроен в слитый белок. Повторный участок обнаружен в C-концевой области, начиная с остатка 178. Особенно предпочтительный повторный участок вмещает в себя остатки 188-305.

Обычно полипептиды и слитые полипептиды (а также кодирующие их полинуклеотиды) являются выделенными. "Выделенный" полипептид или полинуклеотид является таким, который удален из его исходного окружения. Например, встречающийся в природе белок является выделенным, если он отделен от какого-либо или всех сосуществующих в природной системе материалов. Предпочтительно, такие полипептиды являются по меньшей мере на приблизительно 90% чистыми, более предпочтительно по меньшей мере на приблизительно 95% чистыми и наиболее предпочтительно по меньшей мере на приблизительно 99% чистыми. Полинуклеотид считается выделенным, если, например, он клонирован в вектор, который не является частью природного окружения.

Полинуклеотидные композиции

В другом варианте данное изобретение также предоставляет выделенные полинуклеотиды, в частности, кодирующие слитые полипептиды по данному изобретению (например, ID93), а также композиции, содержащие такие полинуклеотиды. В применяемом в данном документе значении термины "ДНК" и "полинуклеотид" и "нуклеиновая кислота" относятся к молекуле ДНК, которая была выделена свободной от общей геномной ДНК конкретных видов. Вследствие этого сегмент ДНК, кодирующий полипептид, относится к сегменту ДНК, который содержит одну или более кодирующих последовательностей все еще существенным образом отделенных или очищенных от общей геномной ДНК видов, из которых получен сегмент ДНК. В термины включены "сегмент ДНК" и "полинуклеотид" сегменты ДНК и меньшие фрагменты таких сегментов и также рекомбинантные векторы, включая, например, плазмиды, космиды, фагмиды, фаги, вирусы и им подобное.

Как поймут специалисты в данной области, полинуклеотидная последовательность по данному изобретению может включать геномную последовательность, экстрагеномные и кодируемые плазмидой последовательности и меньшие сконструированные генные сегменты, которые экспрессируют или могут быть приспособлены для экспрессирования белков, полипептидов, пептидов и им подобного. Такие сегменты могут являться выделенными природными или модифицированными синтетически человеком.

Как признает опытный специалист, полинуклеотиды могут быть одноцепочечными (кодирующими или антисмысловыми) или двухцепочечными и могут представлять собой ДНК (геномную, кДНК или синтетическую) или молекулы РНК. Дополнительные кодирующие или некодирующие последовательности могут, но не обязательно, быть представленными в полинуклеотиде данного изобретения, и полинуклеотид может, но не обязательно, быть соединен с другими молекулами и/или несущими материалами. Полинуклеотиды могут содержать природную последовательность (т.е., эндогенную последовательность, которая кодирует антиген Mycobacterium или его участок) или могут содержать вариант или биологический или антигенный функциональный эквивалент такой последовательности. Полинуклеотидные варианты могут содержать одну или более замен, добавлений, делеций и/или вставок, как дополнительно описано ниже, предпочтительно таких, что иммуногенность кодируемого полипептида не является сниженной относительно природного белка. Эффект на иммуногенность кодируемого полипептида может в целом быть оценен, как описано в данном документе. Термин "варианты" также охватывает гомологичные гены ксеногенного происхождения.

Дополнительные варианты осуществления данного изобретения предоставляют выделенные полинуклеотиды, содержащие различные длины смежных отрезков последовательности, идентичной или комплементарной одной или более последовательностей, раскрытых в данном документе. Например, данным изобретением предоставлены полинуклеотиды, которые содержат по меньшей мере приблизительно 15, 20, 30, 40, 50, 75, 100, 150, 200, 300, 400, 500 или 1000 или более смежных нуклеотидов одной или более последовательностей, раскрытых в данном документе, а также все промежуточные длины между ними. Будет без труда понято, что "промежуточные длины", в данном контексте означают любую длину между приведенными величинами, такую как 16, 17, 18, 19 и т.д.; 21, 22, 23 и т.д.; 30, 31, 32 и т.д.; 50, 51, 52, 53 и т.д.; 100, 101, 102, 103 и т.д.; 150, 151, 152, 153 и т.д.; включая все целочисленные значения вплоть до 200, 500, 500, 1000 и им подобные.

Полинуклеотиды по данному изобретению или их фрагменты независимо от длины самой кодирующей последовательности могут быть комбинированы с другими последовательностями ДНК, такими как промоторы, сигналы полиаденилирования, дополнительные сайты ферментов рестрикции, сайты множественного клонирования, другие кодирующие сегменты и им подобное, такие что их общая длина может значительно варьироваться. Вследствие этого предполагается, что может быть применен полинуклеотидный фрагмент почти любой длины, при этом общая длина предпочтительно ограничена легкостью приготовления и применения предполагаемого рекомбинантного протокола ДНК.

Кроме того, средний специалист в данной области признает, что в результате вырожденности генетического кода имеют место много нуклеотидных последовательностей, которые кодируют полипептид, как описано в данном документе. Некоторые из этих полинуклеотидов несут минимальную гомологию с нуклеотидной последовательностью любого природного гена. Тем не менее, полинуклеотиды, которые сильно отличаются из-за различий в применении кодона, особым образом предусмотрены данным изобретением, например, полинуклеотиды, которые оптимизированы для отбора кодона человека и/или примата. Дополнительно, аллели генов, содержащих полинуклеотидные последовательности, предоставленные в данном документе, попадают в пределы объема данного изобретения. Аллели являются эндогенными генами, которые являются измененными в результате одной или более мутаций, таких как делеции, добавления и/или замены нуклеотидов. Полученные в результате мРНК и белок могут, но не обязательно, иметь измененную структуру или функцию. Аллели могут быть идентифицированы с применением стандартных технологий (такая как гибридизация, амплификация и/или сравнение последовательностей в базе данных).

Полинуклеотиды Mycobacterium и их слияния могут быть получены, манипулированы и/или экспрессированы с применением любого из множества хорошо разработанных технологий, известных и доступных в данной области.

Например, полинуклеотидные последовательности или их фрагменты, которые кодируют полипептиды по изобретению или слитые белки или их функциональные эквиваленты, могут быть применены в рекомбинантных молекулах ДНК для прямой экспрессии полипептида в соответствующих клетках носителя. Из-за присущей вырожденности генетического кода, другие последовательности ДНК, которые кодируют по существу такую же или функционально эквивалентную аминокислотную последовательность могут быть продуцированы, и эти последовательности могут быть применены для клонирования и экспрессирования данного полипептида.

Как поймет специалист в данной области, может быть выгодно в некоторых случаях генерировать кодирующие полипептиды нуклеотидные последовательности, несущие невстречающиеся в природе кодоны. Например, могут быть выбраны кодоны, предпочтительные для конкретного прокариотического или эукариотического носителя, для увеличения скорости экспрессии белка или для продуцирования рекомбинантного транскрипта РНК, имеющего желательные свойства, такие как время полужизни, которое длиннее, чем время полужизни транскрипта, генерированного из природной последовательности.

Кроме того, полинуклеотидные последовательности по данному изобретению могут быть сконструированы с применением способов, в целом известных в данной области, для того чтобы изменить кодирующие полипептиды последовательности по разнообразным причинам, включая, но без ограничения ими, изменения, которые модифицируют клонирование, процессинг, экспрессию и/или иммуногенность генетического продукта.

Для того, чтобы экспрессировать требуемый полипептид, нуклеотидная последовательность, кодирующая полипептид или функциональный эквивалент, может быть встроена в соответствующий экспрессионный вектор, т.е., вектор, который содержит требуемые элементы для транскрипции и трансляции встроенной кодирующей последовательности. Способы, которые хорошо известны специалистам в данной области, могут быть применены для конструирования экспрессионных векторов, содержащих последовательности, кодирующие целевой полипептид и соответствующие элементы транскрипционного и трансляционного контроля. Эти способы включают рекомбинантные ДНК технологии in vitro, синтетические технологии и генетическую рекомбинацию in vivo. Такие технологии описаны в Sambrook et al., Molecular Cloning, A Laboratory Manual (1989) и Ausubel et al., Current Protocols in Molecular Biology (1989). Множество систем экспрессионный вектор/носитель известны и могут быть использованы для того, чтобы встраивать и экспрессировать полинуклеотидные последовательности. Они включают, но не ограничены ими, микроорганизмы, такие как бактерии, трансформированные рекомбинантным бактериофагом, плазмидными или космидными экспрессионными ДНК векторами; дрожжи, трансформированные дрожжевыми экспрессионными векторами; системы клеток насекомых, инфицированных с вирусными экспрессионными векторами (например, бакуловирус); растительные клеточные системы, трансформированные вирусными экспрессионными векторами (например, вирус мозаики цветной капусты, CaMV; вирус табачной мозаики, TMV) или бактериальными экспрессионными векторами (например, плазмиды Ti или pBR322) или животные клеточные системы.

"Контролирующие элементы" или "регулятивные последовательности", представленные в экспрессионном векторе, являются теми нетранслируемыми областями энхансеров вектора, промоторов, 5' и 3' нетранслируемыми областями, которые взаимодействуют с клеточными белками носителя для осуществления транскрипции и трансляции. Такие элементы могут варьироваться по их силе и специфичности. В зависимости от используемой векторной системы и носителя может быть применено любое количество подходящих транскрипционных и трансляционных элементов, включая конститутивные и индуцируемые промоторы. Например, когда клонирование осуществляется в бактериальных системах, могут быть применены индуцируемые промоторы, такие как гибридный промотор lacZ фагмиды PBLUESCRIPT (Stratagene, La Jolla, Calif.) или плазмиды PSPORT1 (Gibco BRL, Gaithersburg, Md.) и им подобные. В млекопитающих клеточных системах промоторы из генов млекопитающих или из вирусов млекопитающих в целом являются предпочтительными. Если требуется генерировать клеточную линию, которая содержит множественные копии последовательности, кодирующей полипептид, векторы, основанные на SV40 или EBV, могут быть преимущественным образом применены с соответствующим селектируемым маркером.

В бактериальных системах количество экспрессионных векторов может быть выбрано в зависимости от предполагаемого применения экспрессированного полипептида. Например, когда требуются большие количества, могут быть применены векторы, которые направляют высокий уровень экспрессии слитых белков, которые могут быть легко очищены. Такие векторы включают, но не ограничены ими, мультифункциональные клонирования E. coli и экспрессионные векторы, такие как BLUESCRIPT (Stratagene), в которых последовательность, кодирующая целевой полипептид может быть лигирована в вектор в рамке с последовательностью для аминоконцевого Met и последующих 7 остатков β-галактозидазы так, что продуцируется гибридный белок; векторы pIN (Van Heeke & Schuster, J. Biol. Chem. 2(54:5503 5509 (1989)) и им подобные. Векторы pGEX (Promega, Madison, Wis.) могут также быть применены для экспрессирования инородных полипептидов, в качестве слитых белков с глутатион S-трансферазой (GST). В целом такие слитые белки являются растворимыми и могут быть легко очищены из лизированных клеток адсорбцией к глутатион-агарозным гранулам с последующим элюированием в присутствии свободного глутатиона. Белки, полученные в таких системах, могут быть сконструированы так, чтобы они включали в себя гепарин, тромбин или сайты расщепления фактора XA протеазой так, чтобы клонированный целевой полипептид по желанию был освобожден от группы GST.

В дрожжах Saccharomyces cerevisiae может быть применен ряд векторов, содержащих конститутивные или индуцируемые промоторы, таких как альфа фактор, алкогольоксидаза и PGH. Для обзора см. Ausubel et al. (ранее) и Grant et al., Methods Enzymol. 153:516-544 (1987).

В случаях, когда применяют растительные экспрессионные векторы, экспрессия последовательностей, кодирующих полипептиды, может быть направлена любым из ряда промоторов. Например, могут быть применены вирусные промоторы, такие как промоторы 35S и 19S CaMV, отдельно или в комбинации с лидерной последовательностью омега из TMV (Takamatsu, EMBO J. 6:307-311 (1987)). Альтернативно могут быть применены растительные промоторы, такие как малая субъединица RUBISCO или промоторы теплового шока (Coruzzi et al., EMBO J. 3:1671-1680 (1984); Broglie et al., Science 224:838-843 (1984); и Winter et al., Results Probl. Cell Differ. 17:85-105 (1991)). Эти конструкции могут быть введены в растительные клетки прямой трансформацией ДНК или патоген-опосредованной трансфекцией. Такие технологии описаны в ряде в целом доступных обзоров (см., например, Hobbs in McGraw Hill, Yearbook of Science and Technology, pp. 191-196 (1992)).

Система насекомых также может быть применена для экспрессирования целевого полипептида. Например, в одной такой системе вирус ядерного полиэдроза Autographa californica (AcNPV) применяется в качестве вектора для экспрессирования инородных генов в клетках Spodoptera frugiperda или в Trichoplusia larvae. Последовательность, кодирующая полипептид, может быть клонирована в несущественную область вируса, такую как ген полиэдрина и помещена контроль промотора полиэдрина. Успешная инсерция кодирующей полипептид последовательности будет делать ген полиэдрина неактивным и вырабатывать недостаток белка оболочки рекомбинантного вируса. Рекомбинантные вирусы затем могут быть применены для инфицирования, например, клеток S. frugiperda или Trichoplusia larvae, в которых целевой полипептид может быть экспрессирован (Engelhard et al., Proc. Natl. Acad. Sci. U.S.A. 97:3224-3227 (1994)).

В клетках носителя-млекопитающего в целом доступен ряд систем экспрессии на основе вирусов. Например, в случаях, когда аденовирус применяется в качестве экспрессионного вектора, последовательность, кодирующая целевой полипептид, может быть лигирована в аденовирусный транскрипционный/трансляционный комплекс, состоящий из позднего промотора и тройной лидерной последовательности. Инсерция в несущественную область E1 или E3 вирусного генома может быть применена для получения жизнеспособного вируса, который способен к экспрессированию полипептида в инфицированных клетках носителя (Logan & Shenk, Proc. Natl. Acad. Sci. U.S.A. 81:3655-3659 (1984)). В добавление энхансеры транскрипции, такие как энхансер вируса саркомы Рауса (RSV), могут быть применены для увеличения экспрессии в клетках носителя-млекопитающего.

Специфичные сигналы инициации могут также быть применены для достижения более эффективной трансляции последовательностей, кодирующих целевой полипептид. Такие сигналы включают в инициаторный кодон ATG и смежные последовательности. В случаях, когда последовательности, кодирующие полипептид, его инициаторный кодон и расположенные ранее последовательности, встроены в соответствующий экспрессионный вектор, могут не требоваться дополнительные сигналы транскрипционного или трансляционного контроля. Однако в случаях, когда встроена только кодирующая последовательность или ее участок, должны быть обеспечены экзогенные трансляционные контрольные сигналы, включая инициаторный кодон ATG. Кроме того, инициаторный кодон должен быть в корректной рамке считывания для обеспечения трансляции всей вставки. Экзогенные трансляционные элементы и инициаторные кодоны могут иметь различные происхождения, как природное, так и синтетическое. Эффективность экспрессии может быть увеличена посредством включения энхансеров, которые являются соответствующими для конкретной применяемой клеточной системы, такой как описанные в литературе (Scharf. et al., Results Probl. Cell Differ. 20:125-162 (1994)).

В добавление, клеточный штамм носителя может быть выбран по его способности модулировать экспрессию встроенных последовательностей или процессировать экспрессированный белок требуемым образом. Такие модификации полипептида включают в себя, но не ограничены ими, ацетилирование, карбоксилирование, гликозилирование, фосфорилирование, липидирование и ацилирование. Также может быть применен пост-трансляционный процессинг, который расщепляет "prepro" форму белка для облегчения корректной инсерции, укладки и/или функционирования. Могут быть выбраны различные клетки носителя, такие как CHO, HeLa, MDCK, HEK293 и W138, которые имеют специфичный клеточный аппарат и характерные механизмы для таких посттрансляционных активностей, для обеспечения корректной модификации и процессинга инородного белка.

Для устойчивой экспрессии в течение длительного периода в целом предпочтительна выработка рекомбинантных белков с высоким выходом. Например, клеточные линии, которые стабильно экспрессируют целевой полинуклеотид, могут быть трансформированы с применением экспрессионных векторов, которые могут содержать вирусные точки начала репликации и/или элементы эндогенной экспрессии и селектируемый маркер гена в том же или в отдельном векторе. После введения вектора клеткам может быть предоставлена возможность расти в течение 1-2 дней в обогащенных средах, перед тем как они будут заменены на селективные среды. Целью селектируемого маркера является придание устойчивости к отбору, и его наличие позволяет рост и восстановление клеток, которые успешно экспрессируют введенную последовательность. Резистентные клоны стабильно трансформированных клеток могут быть пролиферированы с применением технологий тканевой культуры, соответствующей клеточному типу.

Любое количество систем селекции может быть применено для регенерирования трансформированных клеточных линий. Они включают в себя, но не ограничены ими, гены тимидинкиназы вируса простого герпеса (Wigler et al., Cell 11:223-232 (1977)) и аденинфосфорибозилтрансферазы (Lowy et al., Cell 22:817-823 (1990)) которые могут быть применены в клетках tk- или aprt-, соответственно. Также антиметаболитная, антибиотическая или гербицидная устойчивость может быть применена в качестве основы для отбора; например, dhfR, который придает устойчивость к метотрексату (Wigler et al., Proc. Natl. Acad. Sci. U.S.A. 77:3567-70 (1980)); npt, который придает устойчивость к аминогликозидам, неомицину и G-418 (ColbereGarapin et al., J. Mol. Biol. 750:1-14 (1981)); и als или pat, которые придают устойчивость к хлорсульфурону и фосфинотрицин ацетилтрансферазе, соответственно (Murry, ранее). Дополнительными селектируемыми генами, которые были описаны, являются, например, trpB, который позволяет клеткам использовать индол вместо триптофана, или hisD, который позволяет клеткам использовать гистинол вместо гистидина (Hartman & Mulligan, Proc. Natl. Acad. Sci. U.S.A. 85:8047-51 (1988)). Применение видимых маркеров имеет повышенную популярность для таких маркеров как антоцианины, β-глюкуронидаза и ее субстрат GUS и люцифераза и ее субстрат люциферин, при этом их широко используют не только для идентификации трансформантов, но также для определения количества неустановившейся или устойчивой экспрессии белка, присущей конкретной векторной системе (Rhodes et al., Method Mol. Biol. 55:121-131 (1995)).

В данной области известно множество протоколов для детектирования и измерения экспрессии кодируемых полинуклеотидами продуктов с применением или поликлональных или моноклональных антител, специфичных к продукту. Примеры включают в себя фермент-связанный иммуносорбентный анализ (ELISA), радиоиммуноанализ (RIA) и ативируемое флуоресценцией клеточное сортирование (FACS). Эти и другие анализы описаны помимо прочих источников в Hampton et al., Serological Methods, a Laboratory Manual (1990) и Maddox et al., J. Exp. Med. 758:1211-1216 (1983).

Обширное множество технологий меток и конъюгирования известны специалистам в данной области и могут быть применены в различных анализах нуклеиновых кислот и аминокислот. Средства для продуцирования меченой гибридизации или зондов для ПЦР для детектирования последовательностей, родственных полинуклеотидам, включают в себя олигомечение, Ник-трансляцию, концевое мечение или ПЦР амплификацию с применением меченого нуклеотида. Альтернативно, последовательности или любые их участки могут быть клонированы в вектор для выработки зонда мРНК. Такие векторы известны в данной области, являются коммерчески доступными и могут быть применены для синтезирования РНК зондов in vitro добавлением соответствующей РНК полимеразы, такие как T7, T3 или SP6 и меченые нуклеотиды. Эти процедуры могут быть проведены с применением множества коммерчески доступных наборов. Подходящие репортерные молекулы или метки, которые могут быть применены, включают в себя радионуклиды, ферменты, флуоресцентные, хемилюминесцентные или хромогенные агенты, а также субстраты, кофакторы, ингибиторы, магнитные частицы и им подобное.

Клетки носителя, трансформированные целевой полинуклеотидной последовательностью, могут подвергаться культивированию при условиях, подходящих для экспрессии и регенерирования белка из клеточной культуры. Белок, выработанный рекомбинантной клеткой, может быть секретирован или содержаться внутри клетки в зависимости от применяемой последовательности и/или вектора. Как поймет специалист в данной области, экспрессионные векторы, содержащие полинуклеотиды по изобретению, могут быть сконструированы так, чтобы они содержали сигнальные последовательности, которые направляют секрецию кодируемого полипептида через мембрану прокариотической или эукариотической клетки. Другие рекомбинантные конструкции могут быть применены для присоединения последовательности, кодирующей целевой полипептид к нуклеотидной последовательности, кодирующей полипептидный домен, который облегчит очистку растворимых белков.

В добавление к способам рекомбинантного получения полипептиды по изобретению и их фрагменты могут быть продуцированы посредством прямого пептидного синтеза с применением твердофазных технологий (Merrifield, J. Am. Chem. Soc. 85:2149-2154 (1963)). Синтез белка может быть выполнен с применением ручных технологий или автоматизацией. Автоматизированный синтез может быть выполнен, например, с применением пептидного синтезатора Applied Biosystems 43 1 A (Perkin Elmer). Альтернативно, различные фрагменты могут быть химически синтезированы отдельно и в комбинации с применением химических способов для выработки полноразмерной молекулы.

Фармацевтические и вакцинные композиции

В другом варианте данное изобретение относится к составам одного или более из полинуклеотида, полипептида или других композиций, раскрытых в данном документе, в фармацевтически приемлемых или физиологически приемлемых растворах для введения в клетку или животное или отдельно, или в комбинации с одним или более других способов терапии. Такие фармацевтические композиции особенно предпочтительны для применения в качестве вакцины при составлении состава с подходящей системой иммуностимулятор/адъювант. Композиции также подходят для применения в диагностическом контексте.

Также будет принято во внимание, что, если требуется, композиции по изобретению также могут быть введены в комбинации с другими агентами, такими как, например, другие белки или полипептиды или различные фармацевтически активные агенты. В сущности, не существует ограничений для других компонентов, которые могут также быть включены, при условии, что дополнительные агенты не вызывают значимых побочных эффектов для целей в соответствии с изобретением.

В некоторых предпочтительных вариантах осуществления композиции по изобретению применяются в качестве вакцины и составлены в рецептуру в комбинации с одним или более иммуностимуляторов. Иммуностимулятор может быть любым веществом, которое увеличивает или усиливает иммунный ответ (опосредованный антителом и/или клеткой) на экзогенный антиген. Примеры иммуностимуляторов включают в себя адъюванты, биодеградируемые микросферы (например, полимолочный галактид) и липосомы (в которые встроено соединение; см., например, Fullerton, патент США No. 4235877). Вакцинные препараты в общем описаны, например, в Powell & Newman, eds., Vaccine Design (the subunit and adjuvant approach) (1995).

Любой из множества иммуностимуляторов может быть применен в вакцинах по данному изобретению. Например, может быть включен адъювант. Многие адъюванты содержат вещество, сконструированное для защиты антигена от быстрого катаболизма, такое как гидроксид алюминия или минеральное масло и стимулятор иммунных ответов, такой как липид A (природный или синтетический), полученные из Bortadella pertussis, или видов Mycobacterium или Mycobacterium белки. Подходящие адъюванты коммерчески доступны как, например, неполный адъювант и полный адъювант Фрейнда (Difco Laboratories, Detroit, Mich.); Адъювант 65 Merck (Merck and Company, Inc., Rahway, N.J.); AS-2 и их производные (SmithKline Beecham, Philadelphia, Pa.); CWS, TDM, Leif, соли алюминия, такие как гель гидроксид алюминия (алюм) или фосфат алюминия; соли кальция, железа или цинка; нерастворимые суспензии ацилированного тирозина; ацилированные сахара; катионо или анионо дериватизированные полисахариды; полифосфазены; биодеградируемые микросферы; монофосфорильный липид A и quil A. Цитокины, такие как GM-CSF или интерлейкин-2, -7 или -12, могут также быть применены в качестве адъювантов.

Другие иллюстративные адъюванты, пригодные в контексте изобретения, включают агонисты Toll-подобного рецептора, такие как агонисты TLR7, агонисты TLR7/8 и им подобные. Другие иллюстративные адъюванты включают в себя имиквимод, гардиквимод, резиквимод и родственные соединения.

В некоторых предпочтительных вакцинах применяют адъювантные системы, разработанные для индуцирования предоминтно иммунного ответа типа Th1. Высокие уровни цитокинов Th1-типа (например, IFN-γ, TNF-αβ, IL-2 и IL-12) имеют склонность к содействию индукции опосредованных клетками иммунных ответов на вводимый антиген. В отличие от этого высокие уровни цитокинов Th2-типа (например, IL-4, IL-5, IL-6 и IL-10) имеют склонность к содействию индукции гуморальных иммунных ответов. После применения вакцины, представленной в данном документе, пациент будет поддерживать иммунный ответ, который включает в себя ответы типа Th1 и Th2. В пределах предпочтительных вариантов осуществления, в которых ответ предоминантно является Th1-типа, уровень цитокинов Th1-типа будет возрастать до большей степени, чем уровень цитокинов Th2-типа. Уровни из этих цитокинов могут быть быстро оценены с применением стандартных анализов. Для обзора семейства цитокинов см. Mossman & Coffman, Ann. Rev. Immunol. 7:145-173 (1989).

Некоторые адъюванты для применения в проявлении предоминантно ответа типа Th1 включают, например, комбинацию монофосфорил липида A, предпочтительно 3-ди-O-ацилированного монофосфорил липида A (3D-MPLTM), вместе с солью алюминия (патенты США No. 4436727; 4877611; 4866034; и 4912094). CpG-содержащие олигонуклеотиды (в которых динуклеотид CpG деметилирован) также индуцируют предоминантно Th1 ответ. Такие олигонуклеотиды хорошо известны и описаны, например, в WO 96/02555, WO 99/33488 и патентах США No. 6008200 и 5856462. Иммуностимулирующие последовательности ДНК также описаны, например, Sato et al., Science 273:352 (1996). Другой иллюстративный адъювант содержит сапонин, такой как Quil A или его производные, включая QS21 и QS7 (Aquila Biopharmaceuticals Inc., Framingham, Mass.); Эсцин; Дигитонин или сапонины Гипсофилы или Chenopodium quinoa. Другие иллюстративные составы включают в себя более чем один сапонин в адъювантных комбинациях по данному изобретению, например, комбинации по меньшей мере двух из следующих групп, содержащих QS21, QS7, Quil A, β-эсцин или дигитонин.

В других вариантах осуществления адъювант является адъювантом глюкопиранозил липидом A (GLA), как описано в публикации патентной заявки США No. 2008/0131466, раскрытие которой полностью включено в данный документ посредством ссылки. Например, в одном варианте осуществления адъювант GLA, применяемый в контексте по данному изобретению, имеет следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C12-C20 алкил.

В более конкретном варианте осуществления GLA имеет формулу, приведенную выше, в которой R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил.

В более конкретном варианте осуществления GLA имеет формулу, приведенную выше, в которой R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C13 алкил.

В некоторых вариантах осуществления адъювант представляет собой адъювант GLA (например, синтетический), имеющий следующую структуру:

В некоторых вариантах осуществления вышеприведенной структуры GLA, R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил. В более конкретном варианте осуществления R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C13 алкил. В другом более специфичном варианте осуществления R1, R3, R5 и R6 представляют собой C10 алкил; и R2 и R4 представляют собой C8 алкил. В некоторых вариантах осуществления вышеприведенной GLA структуры R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил. В некоторых вариантах осуществления R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C9 алкил.

В некоторых вариантах осуществления адъювант представляет собой адъювант GLA (например, синтетический), имеющий следующую структуру:

В некоторых вариантах осуществления вышеприведенной GLA структуры, R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил. В некоторых вариантах осуществления R1, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C9 алкил.

В некоторых вариантах осуществления адъювант представляет собой синтетический адъювант GLA, имеющий следующую структуру:

В некоторых вариантах осуществления вышеприведенной структуры GLA, R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил. В некоторых вариантах осуществления R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C9 алкил.

В некоторых вариантах осуществления адъювант представляет собой синтетический адъювант GLA, имеющий следующую структуру:

В некоторых вариантах осуществления вышеприведенной структуры GLA, R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил. В некоторых вариантах осуществления R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C9 алкил.

В некоторых вариантах осуществления адъювант представляет собой синтетический адъювант GLA, имеющий структуру:

В некоторых вариантах осуществления адъювант представляет собой синтетический адъювант GLA, имеющий следующую структуру:

В некоторых вариантах осуществления адъювант представляет собой синтетический адъювант GLA, имеющий следующую структуру:

В конкретном варианте осуществления адъювантная система включает комбинацию монофосфорильного липида A и производного сапонина, такую как комбинация QS21 и 3D-MPLTM. Адъювант, как описано в WO 94/00153, или менее реакционоспособная композиция, где QS21 является погашенным с холестерином, как описано в WO 96/33739. Другие составы содержат эмульсию вода в масле и токоферол. Другой адъювантный состав с применением QS21, адъюванта 3DMPLTM и токоферола в эмульсии вода в масле описан в WO 95/17210.

Другая улучшенная адъювантная система содержит комбинацию CpG-содержащего олигонуклеотида и производное сапонина, как раскрыто в WO 00/09159. Другие иллюстративные адъюванты включают Montanide ISA 720 (Seppic, France), SAF (Chiron, Calif., United States), ISCOMS (CSL), MF-59 (Chiron), серии SBAS адъювантов (например, SBAS-2, AS2’, AS2", SBAS-4 или SBAS6, доступные у SmithKline Beecham, Rixensart, Belgium), Detox, RC-529 (Corixa, Hamilton, Mont.) и другие аминоалкил глюкозаминид 4-фосфаты (AGP), такие как описанные в находящихся на рассмотрении заявках на патент США No. 08/853826 и 09/074720, раскрытия которых полностью включены в данный документ посредством ссылки, и адъюванты эфира полиоксиэтилена, такие как описаны в WO 99/52549A1.

Композиции по изобретению могут также или альтернативно содержать Τ-клетки, специфичные к антигену Mycobacterium. Такие клетки в целом могут быть получены in vitro или ex vivo с применением стандартных процедур. Например, Τ-клетки могут быть выделены из костного мозга, периферической крови или фракций костного мозга или периферической крови пациента. Альтернативно, Τ-клетки могут быть получены у родственных или неродственных людей, млекопитающих кроме человека, клеточных линий или культур.

Τ-клетки могут быть простимулированы с полипептидом по изобретению, полинуклеотидом, кодирующим такой полипептид и/или представляющую антиген клетку (APC), которая экспрессирует такой полипептид. Такую стимуляцию выполняют при условиях и в течение промежутка времи, достаточных для обеспечения поколения Τ клеток, которые являются специфичными к полипептиду. Предпочтительно, полипептид или полинуклеотид представлен внутри доставляющего носителя, такого как микросфера, для облегчения генерирования специфичных Τ клеток.

Τ-клетки считаются специфичными к полипептиду по изобретению, если Τ-клетки особым образом пролиферируют, секретируют цитокины или уничтожают целевые клетки, покрытые полипептидом или экспрессирующие ген, кодирующий полипептид. Τ-клеточная специфичность может быть оценена с применением любой из множества стандартных технологий. Например, в анализе с радиоактивным хромом или анализе пролиферации, стимуляционный индекс более чем двукратного увеличения лизиса и/или пролиферации по сравнению с отрицательными контролями указывает на Τ-клеточную специфичность. Такие анализы могут быть выполнены, например, как описано в Chen et al., Cancer Res. 54:1065-1070 (1994)). Альтернативно, детекция пролиферации Τ клеток может быть выполнена посредством множества известных технологий. Например, Τ-клеточная пролиферация может быть детектирована измерением увеличенной скорости синтеза ДНК (например, импульсным мечением культур Τ клеток меченым тритием тимидином и измерением количества меченого тритием тимидина, включенного в ДНК). Контакт с полипептидом по изобретению (100 нг/мл-100 мкг/мл, предпочтительно, 200 нг/мл-25 мкг/мл) в течение 3-7 дней должен привести в результате к по меньшей мере двухкратному увеличению пролиферации Τ-клеток. Контакт, как описано выше, в течение 2-3 часов должен привести в результате к активации Τ-клеток, как измерено с применением стандартных цитокиновых анализов, в которых двукратное увеличение уровня высвобождения цитокинов (например, TNF или IFN-γ) указывает на Τ-клеточную активацию (см. Coligan et al., Current Protocols in Immunology, vol. 1 (1998)). Τ-клетки, которые были активированы в ответ на полипептид, полинуклеотид или полипептид-экспрессирующие APC, могут представлять собой CD4+ и/или CD8+. Белок-специфичные Τ-клетки могут быть размножены с применением стандартных технологий. В пределах предпочтительных вариантов осуществления Τ-клетки получают у пациента, родственного донора или неродственного донора и вводят пациенту после стимуляции и размножения.

В фармацевтических композициях по изобретению, состав фармацевтически приемлемых вспомогательных веществ и несущих растворов хорошо известен специалисту в данной области, как и развитие подходящих режимов дозирования и лечения с применением конкретных композиций, описанных в данном документе, во множестве режимов лечения, включая, например, пероральное, парентеральное, внутривенное, внутриносовое и внутримышечное введение и состав.

В некоторых применениях фармацевтические композиции, раскрытые в данном документе, могут быть доставлены индивиду посредством перорального введения. В этом качестве эти композиции могут быть составлены с инертным разбавителем или с усваиваемым съедобным носителем или они могут быть заключены в желатиновую капсулу с твердой или мягкой оболочкой или могут быть спрессованы в таблетки или они могут быть включены непосредственно в пищу диеты.

В некоторых обстоятельствах будет желательно доставлять фармацевтические композиции, раскрытые в данном документе, парентерально, внутривенно, внутримышечно или даже внутрибрюшинно, как описано, например, в патенте США No. 5543158; патенте США No. 5641515 и патенте США No. 5399363 (каждый особым образом полностью включен в данный документ посредством ссылки). Растворы активного соединения в виде свободного основания или фармакологически приемлемых солей могут быть приготовлены в воде, соответствующим образом смешанной с поверхностно-активным веществом, таким как гидроксипропилцеллюлоза. Дисперсии могут также быть приготовлены в глицерине, жидких полиэтиленгликолях и их смеси и в маслах. При обычных условиях хранения и использования, эти препараты содержат консервант для предотвращения роста микроорганизмов.

Фармацевтические формы, подходящие для инъецируемого применения, включают в себя стерильные водные растворы или дисперсии и стерильные порошки для приготавливаемых для немедленного приема препаратов стерильных инъецируемых растворов или дисперсий (патент США No. 5466468, особым образом полностью включенный в данный документ посредством ссылки). Во всех случаях форма должна быть стерильной и должна быть текучей в степени, при которой существует возможность легкого введения через шприц. Она должна быть устойчивой при условиях производства и хранения и должна быть защищена от заражающего действия микроорганизмов, таких как бактерии и грибы. Носитель может быть растворяющей или дисперсионной средой, содержащей, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и им подобное), их подходящие смеси и/или растительные масла. Надлежащую текучесть можно поддерживать, например, применением покрытия, такого как лецитин, поддержанием требуемого размера частиц в случае дисперсии и применением поверхностно-активных веществ. Предотвращение действия микроорганизмов может быть облегчено различными противобактериальными и противогрибковыми агентами, например, парабены, хлорбутанол, фенол, сорбиновая кислота, тимеросал и им подобное. Во многих случаях будет предпочтительно включать в состав изотонические агенты, например, сахара или хлорид натрия. Пролонгированная абсорбция инъецируемых композиций может быть осуществлена применением в композициях агентов, замедляющих абсорбцию, например, моностеарата алюминия и желатина.

Для парентерального введения, например, в водном растворе раствор должен быть соответствующим образом буферизован, если требуется, и жидкий разбавитель сначала переводят в изотоническое состояние с достаточным количеством солевого раствора или глюкозы. Эти конкретные водные растворы особенно подходят для внутривенного, внутримышечного, подкожного и внутрибрюшинного введения. В этой связи, стерильная водная среда, которая может быть применена, будет известна специалисту в данной области в свете данного изобретения. Например, одна дозировка может быть растворена в 1 мл изотонического раствора NaCl и или добавлена к 1000 мл жидкой среды для гиподермоклизиса или инъецирована в предполагаемое место вливания (см., например, Remington’s Pharmaceutical Sciences, 15th Edition, pp. 1035-1038 и 1570-1580). Некоторое изменение в дозировке обязательно произойдет в зависимости от состояния индивида подвергаемого лечению. Человек, ответственный за введение, будет в любом случае, определять соответствующую дозу для индивидуального индивида. Кроме того, для введения человеку препараты должны удовлетворять стандартам стерильности, пирогенности и общей безопасности и чистоты, как требует Office of Biologies standards FDA.

Стерильные инъецируемые растворы приготовлены включением активных соединений в требуемом количестве в соответствующий растворитель с различными другими ингредиентами, перечисленными выше, в соответствии с указаниями, с последующей стерилизацией фильтрованием. В основном дисперсии приготовлены включением различных стерилизованных активных ингредиентов в стерильный наполнитель, который содержит основную дисперсионную среду и требуемые другие ингредиенты из перечисленных выше. В случае стерильных порошков для приготовления препаратов стерильных инъецируемых растворов предпочтительными способами приготовления являются вакуумная сушка и технологии лиофилизации, в результате которых получается порошок активного ингредиента плюс любой дополнительный требуемый ингредиент из его предварительно стерильно отфильтрованного раствора.

Композиции, раскрытые в данном документе, могут быть составлены в нейтральной форме или в форме соли. Фарамацевтически приемлемые соли включают в себя соли кислотного добавления (образованные со свободными аминогруппами белка) и образованные с неорганическими кислотами, такими как, например, хлористоводородная или ортофосфорная кислоты, или органическими кислотами, такими как уксусная, щавелевая, винная, миндальная и им подобные. Соли, образованные со свободными карбоксильными группами, могут также быть получены из неорганических оснований таких как, например, натрий, калий, аммоний, кальций или гидроксиды железа и таких органических оснований, как изопропиламин, триметиламин, гистидин, прокаин и им подобное. При составлении растворы будут введены образом, совместимым с составом дозировки и в таком количестве, которое терапевтически эффективно. Составы могут быть легко введены различными формами дозировки, такими как инъецируемые растворы, высвобождающие лекарственное средство капсулы и им подобное.

В применяемом в данном документе значении "носитель" включает в себя любой и все растворители, дисперсионные среды, наполнители, покрытия, разбавители, противобактериальные и противогрибковые агенты, изотонические и замедляющие абсорбцию агенты, буферы, рабочие растворы, суспензии, коллоиды и им подобное. Применение таких сред и агентов для фармацевтических активных веществ хорошо известно в данной области. Кроме случаев, когда какие-либо общепринятые среды или агент являются несовместимыми с активным ингредиентом, предполагается их применение в терапевтических композициях. Добавочные активные ингредиенты могут также быть включены в композиции.

Фраза "фармацевтически приемлемый" относится к молекулярным индивидам и композициям, которые не продуцируют аллергическую или подобную неблагоприятную реакцию при введении человеку. Препараты водной композиции, которая содержит белок в качестве активного ингредиента, хорошо известны в данной области. Как правило, такие композиции приготовлены в виде инъецируемых или в виде жидких растворов или суспензий; также могут быть приготовлены твердые формы, подходящие для растворения или суспендирования в жидкости перед инъекцией. Препараты также могут быть эмульгированы.

В некоторых вариантах осуществления фармацевтические композиции могут быть доставлены посредством внутриносовых распылений, ингаляций и/или других средств для аэрозольной доставки. Способы доставки генов, полинуклеотидов и пептидных композиций напрямую в легкие посредством назальных аэрозольных распылений были описаны, например, в патенте США No. 5756353 и патенте США No. 5804212 (каждый особым образом полностью включен в данный документ посредством ссылки). Подобным образом, доставка лекарственных средств с применением интраназальных смол в виде микрочастиц (Takenaga et al., 1998) и соединений лизофосфатидил-глицерина (патент США No. 5725871, особым образом полностью включен в данный документ посредством ссылки) также хорошо известна в области фармацевтики. Подобным образом, трансмукозальная доставка лекарственного средства в форме политетрафторэтиленовой матрицы-подложки описана в патенте США No. 5780045 (особым образом полностью включенном в данный документ посредством ссылки).

В некоторых вариантах осуществления доставка может происходить посредством применения липосом, нанокапсул, микрочастиц, микросфер, липидных частиц, везикул и им подобного, для введения композиций по данному изобретению в подходящие клетки носителя. В частности, композиции по данному изобретению могут быть составлены для доставки инкапсулированными в липидной частице, липосоме, везикуле, наносфере, наночастице или им подобном. Состав и применение таких средств для доставки может быть осуществлено с применением известных и общепринятых технологий.

Иллюстративные варианты осуществления

1. Способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадию введения млекопитающему, имеющему активную инфекцию туберкулезом, химиотерапевтического агента и иммунологически эффективного количества терапевтической вакцины, в котором вакцина содержит фармацевтическую композицию, содержащую антиген Mtb или его иммуногенный фрагмент из видов микобактерий туберкулезного комплекса.

2. Способ по варианту осуществления 1, в котором терапевтическая вакцина содержит выделенный слитый полипептид, содержащий комбинацию двух или более ковалентно связанных антигенов Mycobacterium tuberculosis или их иммуногенные фрагменты, где антигены выбраны из группы, состоящей из Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv0655, Rv0831, Rv1009, Rv1099, Rv1240, Rv1288, Rv1410, Rv1569, Rv1789, Rv1818, Rv1860, Rv1886, Rv1908, Rv2220, Rv2032, Rv2623, Rv2875, Rv3044, Rv3310, Rv3881, Rv0577, Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv1511 и Rv3875 и антигенов, имеющих по меньшей мере 90% идентичности с любой из вышеприведенных последовательностей.

3. Способ по варианту осуществления 1, где терапевтическая вакцина содержит слитый полипептид ID93, в котором слитый полипептид ID93 содержит антигены Mycobacterium Rv2608, Rv3619, Rv3620 и Rv1813.

4. Способ по варианту осуществления 3, где антигены микобактерий Rv2608, Rv3619, Rv3620 и Rv1813 представляют собой антигены M. tuberculosis Rv2608, Rv3619, Rv3620 и Rv1813.

5. Способ по варианту осуществления 3, где слитый полипептид ID93 содержит последовательность, приведенную в SEQ ID NO: 1, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

6. Способ по варианту осуществления 1, где активная туберкулезная инфекция ассоциирована с клиническим симптомом слабости, утомлением, жаром, простудами, потерей веса, потерей аппетита, анорексией, ночной потливостью или любой их комбинацией.

7. Способ по варианту осуществления 1, где активная туберкулезная инфекция представляет собой легочную активную ТБ инфекцию.

8. Способ по варианту осуществления 7, где легочная активная туберкулезная инфекция ассоциирована с клиническим симптомом непрекращающего кашля, густой слизью, болью в груди, кровохарканьем или любой их комбинацией.

9. Способ по варианту осуществления 1, где активная туберкулезная инфекция характеризуется бактериями Mtb, которые пролиферируют, репродуцируются, распространяются или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органе млекопитающего.

10. Способ по варианту осуществления 1, где активную инфекцию туберкулезом идентифицируют с применением анализа, выбранного из группы, состоящей из анализа кислотоустойчивого окрашивания (AFS); анализа бактериальной культуры, такого как анализ BACTEC MGIT 960; теста IGR, такой как тест QFT®-Gold или тест QFT®-Gold In-tube Τ SPOTTM.TB; кожного теста, такого как кожный тест TST Mantoux (TST); и внутриклеточного цитокинового окрашивания цельной крови или выделенных МКПК после антигенной стимуляции.

11. Способ по варианту осуществления 1, где активная туберкулезная инфекция представляет собой активную первичную инфекцию M. tuberculosis.

12. Способ по варианту осуществления 1, где активная туберкулезная инфекция представляет собой реактивированную туберкулезную инфекцию.

13. Способ по варианту осуществления 1, где млекопитающее инфицировано M. tuberculosis с множественной лекарственной устойчивостью (МЛУ).

14. Способ по варианту осуществления 1, где млекопитающее было ранее иммунизировано с бациллой Кальмета-Герена (БКГ).

15. Способ по варианту осуществления 1, где млекопитающее является человеком.

16. Способ по варианту осуществления 1, дополнительно содержащий введение одного или более химиотерапевтических агентов, эффективных в лечении инфекции M. tuberculosis.

17. Способ по варианту осуществления 16, где один или более из химиотерапевтических агентов представляет собой изониазид, рифампицин или их комбинацию.

18. Способ по варианту осуществления 16, где млекопитающему сначала вводят один или более химиотерапевтических агентов в течение промежутка времени и впоследствии вводят терапевтическую вакцину.

19. Способ по варианту осуществления 16, где млекопитающему сначала вводят терапевтическую вакцину и впоследствии вводят один или более химиотерапевтических агентов в течение промежутка времени.

20. Способ по варианту осуществления 16, где введение одного или более химиотерапевтических агентов и терапевтической вакцины осуществляется одновременно.

21. Способ по варианту осуществления 1, дополнительно включающий введение терапевтической вакцины млекопитающему один или более раз последовательно, где туберкулезная инфекция, остающаяся у млекопитающего при одном или более последующих введений может являться или не являться активной инфекцией туберкулезом.

22. Способ по варианту осуществления 1, где вакцина дополнительно содержит адъювант.

23. Способ по варианту осуществления 22, где адъювант представляет собой GLA, имеющий следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C12-C20 алкил.

24. Способ по варианту осуществления 23, где R1, R3, R5 и R6 представляют собой C11-C14 алкил; и R2 и R4 представляют собой C12-15 алкил.

25. Способ по варианту осуществления 23, где R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C13 алкил.

26. Способ уменьшения времени курса химиотерапии против активной туберкулезной инфекции, включающий введение млекопитающему, имеющему активную инфекцию туберкулезом, одного или более химиотерапевтических агентов, эффективных против M. tuberculosis, и иммунологически эффективного количества терапевтической вакцины, где вакцина содержит фармацевтическую композицию, содержащую слитый полипептид или его иммуногенный фрагмент видов микобактерий туберкулезного комплекса и, где слитый полипептид индуцирует иммунный ответ против M. tuberculosis, посредством этого обеспечивая сниженное время курса химиотерапии против активной инфекции M. tuberculosis.

27. Способ по варианту осуществления 26, где слитый полипептид содержит комбинацию двух или более ковалентно связанных антигенов Mycobacterium tuberculosis или их иммуногенные фрагменты, в котором антигены выбраны из группы, состоящей из Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv0655, Rv0831, Rv1009, Rv1099, Rv1240, Rv1288, Rv1410, Rv1569, Rv1789, Rv1818, Rv1860, Rv1886, Rv1908, Rv2220, Rv2032, Rv2623, Rv2875, Rv3044, Rv3310, Rv3881, Rv0577, Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv1511 и Rv3875 и антигенов, имеющих по меньшей мере 90% идентичности с любой из вышеприведенных последовательностей.

28. Способ по варианту осуществления 27, где слитый полипептид содержит слитый полипептид ID93, который содержит антигены Rv2608, Rv3619, Rv3620 и Rv1813.

29. Способ по варианту осуществления 28, где слитый полипептид ID93 содержит последовательность, приведенную в SEQ ID NO: 1, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

30. Способ по варианту осуществления 26, где время курса химиотерапии укорочено до не более, чем приблизительно 3 месяцев, приблизительно 5 месяцев или приблизительно 7 месяцев.

31. Способ по варианту осуществления 26, где вакцина дополнительно содержит адъювант.

32. Способ по варианту осуществления 31, где адъювант представляет собой GLA, имеющий следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C12-C20 алкил.

33. Способ по варианту осуществления 32, где R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил.

34. Способ по варианту осуществления 32, где R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C13 алкил.

35. Способ лечения пациента с диагностированной активной инфекцией туберкулезом, при этом способ включает введение пациенту химиотерапевтического агента и иммунологически эффективного количества терапевтической вакцины, в котором вакцина содержит фармацевтическую композицию, содержащую антиген Mtb или его иммуногенный фрагмент из видов микобактерий туберкулезного комплекса.

36. Способ по варианту осуществления 35, где пациент является человеком.

37. Способ по варианту осуществления 35, где терапевтическая вакцина содержит выделенный слитый полипептид, содержащий комбинацию двух или более ковалентно связанных антигенов Mycobacterium tuberculosis или их иммуногенные фрагменты, где антигены выбраны из группы, состоящей из Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv0655, Rv0831, Rv1009, Rv1099, Rv1240, Rv1288, Rv1410, Rv1569, Rv1789, Rv1818, Rv1860, Rv1886, Rv1908, Rv2220, Rv2032, Rv2623, Rv2875, Rv3044, Rv3310, Rv3881, Rv0577, Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv1511 и Rv3875 и антигенов, имеющих по меньшей мере 90% идентичности с любой из вышеприведенных последовательностей.

38. Способ по варианту осуществления 35, где терапевтическая вакцина содержит слитый полипептид ID93, в котором слитый полипептид ID93 содержит антигены Rv2608, Rv3619, Rv3620 и Rv1813 Mycobacterium.

39. Способ по варианту осуществления 38, где антигены микобактерий Rv2608, Rv3619, Rv3620 и Rv 1813 представляют собой антигены Rv2608, Rv3619, Rv3620 и Rv1813 M. tuberculosis.

40. Способ по варианту осуществления 38, где слитый полипептид ID93 содержит последовательность, приведенную в SEQ ID NO: 1, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

41. Способ по варианту осуществления 35, где активная туберкулезная инфекция ассоциирована с клиническим симптомом слабости, утомлением, жаром, простудами, потерей веса, потерей аппетита, анорексией, ночной потливостью или любой их комбинацией.

42. Способ по п.35, где активная туберкулезная инфекция представляет собой легочную активную ТБ инфекцию.

43. Способ по варианту осуществления 42, где легочная активная туберкулезная инфекция ассоциирована с клиническим симптомом непрекращающего кашля, густой слизью, болью в груди, кровохарканьем или любой их комбинацией.

44. Способ по варианту осуществления 35, где активная туберкулезная инфекция характеризуется бактериями Mtb, которые пролиферируют, репродуцируются, распространяются или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органе пациента.

45. Способ по варианту осуществления 35, где активную инфекцию туберкулезом идентифицируют с применением анализа, выбранного из группы, состоящей из анализа кислотоустойчивого окрашивания (AFS); анализа бактериальной культуры, такого как анализ BACTEC MGIT 960; теста IGR, такого как тест QFT®-Gold или тест QFT®-Gold In-tube Τ SPOTTM.TB; кожного теста, такого как кожный тест TST Mantoux (TST); и внутриклеточного цитокинового окрашивания цельной крови или выделенных МКПК после антигенной стимуляции.

46. Способ по варианту осуществления 35, где активная туберкулезная инфекция представляет собой активную первичную инфекцию M. tuberculosis.

47. Способ по варианту осуществления 35, где активная туберкулезная инфекция представляет собой реактивированную туберкулезную инфекцию.

48. Способ по варианту осуществления 35, где пациент инфицирован с M. tuberculosis с множественной лекарственной устойчивостью (МЛУ).

49. Способ по варианту осуществления 35, где пациент был ранее иммунизирован с бациллой Кальмета-Герена (БКГ).

50. Способ по варианту осуществления 35, где пациент является млекопитающим.

51. Способ по варианту осуществления 35, дополнительно включающий введение одного или более химиотерапевтических агентов, эффективных в лечении инфекции M. tuberculosis.

52. Способ по варианту осуществления 51, где один или более из химиотерапевтических агентов представляет собой изониазид, рифампицин или их комбинацию.

53. Способ по варианту осуществления 51, где пациенту сначала вводят один или более химиотерапевтических агентов в течение промежутка времени и впоследствии вводят терапевтическую вакцину.

54. Способ по варианту осуществления 51, где пациенту сначала вводят терапевтическую вакцину и впоследствии вводят один или более химиотерапевтических агентов в течение промежутка времени.

55. Способ по варианту осуществления 51, где введение одного или более химиотерапевтических агентов и терапевтической вакцины осуществляется одновременно.

56. Способ по варианту осуществления 35, дополнительно включающий введение терапевтической вакцины пациенту один или более раз последовательно, где туберкулезная инфекция, остающаяся у пациента при одном или более последующих введений, может являться или не являться активной туберкулезной инфекцией.

57. Способ по варианту осуществления 35, где вакцина дополнительно содержит адъювант.

58. Способ по варианту осуществления 57, где адъювант представляет собой GLA, имеющий следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C12-C20 алкил.

59. Способ по варианту осуществления 58, где R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил.

60. Способ по варианту осуществления 58, где R1, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C13 алкил.

Следующие примеры предоставлены в качестве иллюстрации и не в качестве ограничения.

Пример 1

Разработка мышиной SWR/J модели рецидива ТБ и реактивации активной инфекции ТБ.

Самок выровненных по возрасту (4-6 недели) мышей SWR/J и C57BL/6 приобретали у Jackson and Charles RiveR Laboratories соответствующим образом. Мышей инфицировали низкой дозой (50-100 бактерий) аэрозоля (LDA) Mtb H37Rv (ATCC #35718) с применением аэрозольной камеры UW-Madison. Количество бацилл, представленных у мышей с активной инфекцией, количество жизнеспособных бактерий в легких (5 мышей/группу) определяли через 15, 30 и 100 дней после инфекции способами, известными в данной области. Обозначения указывают среднее +/- стандартное отклонение. Мышей штаммов SWR/J и C57BL/6 с активной ТБ инфекцией инфицировали Mtb H37Rv, как описано (8 мышей/группу), и контролировали выживаемость. Для достижения эффекта химиотерапевтических средств в модели через пятнадцать дней после инфекции в подгруппе мышей начинали лекарственный режим из изониазида (INH) (с 85 мг/л питьевой воды) и рифампицина (RIF) (с 50 мг/л питьевой воды), вводимыми в течение 30, 60 или 90 последовательных дней (Rx 30 д, Rx 60 д, Rx 90 д). Для дополнительной группы мышей начинали лекарственный режим из изониазида (INH) (с 85 мг/л питьевой воды) и рифампицина (RIF) (с 50 мг/л питьевой воды) (совместно называемых в данном документе химиотерапевтическое лечение) через 30 дней после инфекции, вводимой в течение 90 последовательных дней. По оценкам самки мышей пили между 0,15 и 0,37 мл/г (Bachmanov AA et.al, 2002) Минимальные ингибирующие концентрации для Mtb H37Rv составляли 0,25 мкМ для RIF и 1,0 мкМ для INH.

В отличие от мышей C57BL/6 (Russell, et. al., 2010) и в соответствии с предыдущими наблюдениями (Baldwin et al., J of Immunоlogy 2012) мыши SWR/J не могли перейти к хроническому состоянию после Mtb инфекции, на что указывало увеличение вирусных титров в SWR/J по сравнению с мышами C57BL/6 (фиг. 1A), и являлись репрезентативными для модели активной инфекции MTB. Имитационно-подвергаемые лечению мыши SWR/J подвергались летальной инфекции Mtb со средним временем выживаемости (СВВ) 116,5 дней, тогда как подвергаемые лечению химиотерапевтическими средствами (RIF/INH) в течение 90 дней имели СВВ 247,5 дней (P<0,001; логарифмический ранговый критерий) по сравнению с имитацией или подвергаемыми химиотерапевтическому лечению мышами C57/BL/6 (фиг. 1B).

Для определения оптимальной длины химиотерапевтического лечения на мышах SWR/J животных подвергали лечению с RIF/INH, начиная с дня 15 после инфекции в течение или 30, 60 или 90 дней, или в дополнительной группе, которая получала химиотерапию, начиная с дня 30 после воздействия в течение 90 дней. Наблюдали за кривыми выживаемости. Наблюдали значимые различия в выживаемости и регенерируемыми легочными КОЕ между животными, которые подвергались лечению имитационно или с лекарственным средством, в течение 30 (P<0,0005; логарифмический ранговый критерий), 60 (P<0,05; логарифмический ранговый критерий) или 90 дней (P<0,005; логарифмический ранговый критерий) (фиг. 1C). Изменение инициирующей химиотерапии с 15 на 30 дней после инфекции не меняло значительно долговременную эффективность лечения (P>0,50; логарифмический ранговый критерий) (фиг. 1C). Несмотря на то, что 60 или 90 дней химиотерапии было достаточно для уменьшения количества жизнеспособных бактерий в легких ниже предела детекции (фиг. 1D), этих режимов лечения было недостаточно для достижения устранения Mtb у мышей SWR/J.

Пример 2

Оценка терапевтической эффективности ТБ вакцины ID93+химиотерапии в мышиной модели SWR/J рецидива ТБ и реактивации активной инфекции ТБ.

Ранее было продемонстрировано, что ТБ вакцинные слитые белки ID83 и ID93 или их компонентные антигены, составленные с антагонистом TLR4 GLA-SE, обеспечивают профилактическую защиту против ТБ в моделях мыши и морской свинки при введении в трех дозах (Baldwin, et al., 2009, Bertholet, et al., 2010). Вакцину ID93/GLA-SE тестировали в модели SWR/J активной инфекции для определения того, если этот состав будет обеспечивать иммунотерапевтическое преимущество, как измерено снижением КОЕ или улучшенной выживаемостью. Мышей SWR/J (6 или 7 мышей на группу) инфицировали с LDA Mtb, как описано в примере 1. Через пятнадцать дней (день 15) мышей подвергали лечению имитационно или с антибиотиками в течение 90 дней (Rx 90 д). Подгруппу подвергаемых антибиотическому лечению мышей в каждой группе также иммунизировали. Мышей иммунизировали 3 раза в 3 отдельные недели с 8 мкг белка ID93, составленного с 20 мкг GLA-SE или во время (ВТЛ; дней 15, 36, 57) или после антибиотического терапевтического лечения (ПТЛ; дней 107, 128, 149). Терапевтическую эффективность определяли посредством слежения за выживаемостью с течением времени и посевом легочных гомогенатов, как описано ранее (Bertholet et. al., 2008). Вакцина ID93/GLA-SE, вводимая терапевтически (- -) в мышинной модели SWR/J активной ТБ инфекции, увеличивала частоту выживаемости после инфекции (P<0,01).

По сравнению с химиотерапией (Rx) отдельно (-●-) иммунизация с вакциной ID93/GLA-SE в качестве вспомогательного средства к химиотерапии (-■-) дополнительно снижала КОЕ на 0,643 log10 (P<0,05) (фиг. 2B). Не наблюдали никаких различий в легочных КОЕ между группами с вводимым отдельно адъювантом GLA-SE плюс химиотерапия (Rx+GLA-SE , по сравнению с химиотерапией отдельно Rx (-●-) (P>0,05) (фиг. 2B). Кроме того, имело место значимое различие между эффективностью после воздействия, индуцированного посредством групп Rx+ID93/GLA-SE и Rx+GLA-SE (4,419±0,17 против 4,938±0,16 log10, Ρ<0,05), что указывает на то, что вспомогательный бактерицидный эффект, наблюдаемый в этих исследованиях, является антиген-зависимым.

Введение вакцины в качестве иммунотерапевтического вспомогательного средства к химиотерапии после (ПТЛ) или во время (ВТЛ) 90 дней химиотерапевтического лечения предотвращало смерть у 52% и 67% Mtb-инфицированных мышей, соответственно, (P<0,0001) (фиг. 2C).

Пример 3

Введение терапевтической вакцины ID93/GLA-SE в качестве вспомогательного средства к химиотерапии снижает продолжительность лекарственной терапии, требуемой для пролонгирования выживаемости при активной ТБ инфекции.

Дополнительные эксперименты выполняли в мышиной модели SWR/J рецидива ТБ и реактивации активной ТБ инфекции для оценки того, если введение терапевтической вакцины ID93/GLASE могло снижать продолжительность лекарственной терапии, требуемой для пролонгирования выживаемости при активной ТБ инфекции. Мышей SWR/J инфицировали c LDA Mtb H37Rv. Через пятнадцать дней мышей подвергали лечению в течение 60 или 90 дней с антибиотиками, как описано ранее (Rx 60 д и Rx 90, соответственно). После завершения 60-дневного антибиотического режима мышей иммунизировали 3 раза в отдельные 3 недели с 8 мкг белка ID93, составленного с 20 мкг GLASE (Rx 60 д+ID93/GLA-SE; дни 77, 98, 119). Защиту оценивали наблюдением за смертями животных (7 мышей/группу), вызванных Mtb с течением времени (P<0,05 (логарифмический ранговый критерий) считали значимым). (B-M) Гистопатологическая оценка легочных тканей после стимуляции с Mtb H37Rv. Образование воспалительных ответов и гранулема (г) продемонстрированы в срезах H&E (B-I), и оценивали наличие AFB (стрелки) (J-M). (B, F, J). Подвергаемые имитационному лечению мыши, день 106; (C, J и K) с 90-дневной антибиотической терапией, день 106; (D, H, L) 90-дневной антибиотической терапией+ID93/GLA-SE, день 241; (Ε, I и M) 60-дневной антибиотической терапией+ID93/GLA-SE, день 295. Продемонстрированные данные являются репрезентативными для 5 мышей/группу.

40% животных, получающих 90 дней химиотерапии отдельно (Rx90 д; -▲-), выживали при Mtb инфекции (СВВ 214 дней), тогда как 100% животных, получавших вакцинную иммунотерапию после 60 дней химиотерапии (-●-) выживали в течение по меньшей мере 250 дней (P<0,05) (фиг. 3A). Эти исследования демонстрируют, что вакцинная иммунотерапия может снижать продолжительность лекарственной терапии на по меньшей мере 1/3, при этом предотвращая смерть в течение более длительного периода после того, как химиотерапия была прекращена.

Для того, чтобы определить, если антибиотики, комбинированные с ID93/GLA-SE, снижали легочную ТБ патологию, срезы подвергаемых лечению имитационно, Rx- и Rx+ID93/GLA-SE- мышей брали на гистологический анализ (гистологические результаты представлены в таблице 1 (ниже) и фиг. 3B-M.

Таблица 1
Эффекты иммунотерапии ID93/GLA-SE на легочную патологию Μtb-инфицированных SWR/J
Группaa Степень поражения Легочная (%)b Легочные AFBc Гранулема Диагноз
Имитация (день 106) 3-4
Умеренная-выраженная
40-100 6-30 - Коалесцирующие макрофагальные узелки, с гигантскими клетками синцития - Гистиоцитарная альвеолярная и интерстициальная пневмония, от умеренной до выраженной; гранулематозная лобарная бронхопневмония.
- Множественные AFB в поражениях
Rxd (день 106) 0-2
Слабая-умереная
0-40% <1 - Нет узелковых гранулем
- Мало макрофагов
- Регрессия крупных поражений
- Гистиоцитарная альвеолярная и интерстициальная пневмония, от слабой до умеренной.
- Минимальные AFB в поражениях
Rxd (день 241, 295) 4
Выраженная
41-100 ≤30 -Нет значимых гистиоцитарных гранулем, нет синцитиальных макрофагов - Гистиоцитарная альвеолярная и интерстициальная пневмония, выраженная.
- Много AFB в поражениях

Rxd + ID93/ GLA-SEf (день 241) 2
Слабая-Умеренная
11-40 ≤6 - Гистиоцитарные гранулемы с синцитиальными макрофагами
- Несколько лимфоидных скоплений с малой плотностью
- Гистиоцитарная альвеолярная и интерстициальная пневмония, слабая-умеренная.
- Мало или нет AFB в поражениях
Rxe+ ID93/- GLA-SEf
(день 295)
1-3 Минимальная-Умеренная 0-40 ≤1-6 - Гистиоцитарные гранулемы с синцитиальными макрофагами
- Минимальная мультифокальная инфильтрация лимфоцитов
- Гистиоцитарная альвеолярная и интерстициальная пневмония, минимальная-умеренна
- Мало AFB в поражениях
aДанные являются репрезентативными для 3-5 животных в расчете на группу
bПроцент задействованной легочной ткани: Минимальная (степень 1 или <10%); Слабая (степень 2 или 11-20%); Умеренная (степень 3 или 21-40%); Выраженная (степень 4 или 41-100%)
cКоличество кислотоустойчивых бактерий (AFB) / в поле зрения при большом увеличении (High Power Field, HPF), 600x
d90 дневную химиотерапию INH/RIF начинали через 15 дней после инфекции с Mtb
e60 дневную химиотерапию INH/RIF начинали через 15 после инфекции с Mtb
fМышей иммунизировали 3 раза в 3 отдельные недели после введения химиотерапевтического лечения.

Легкие подвергаемых имитационному лечению мышей имели диффузный альвеолярный отек (фиг. 3B,F) со степенью 3-4 (40-100%) легочной паренхимы, оказавшейся значительно воспаленной и некротической, как сообщали ранее [29, 38], со множественными кислотоустойчивыми бациллами (>30/600x в поле зрения при большом увеличении (HPF) (фиг. 3J). Легочные срезы группы с химиотерапией отдельно (Rx90 д) продемонстрировали заметную регрессию восполительных поражений (фиг. 3 C,G) с лишь редкими бациллами (<1/HPF) (фиг. 3 K; Таблица 1). На день 241 легкие мышей Rx 90 д+ID93/GLA-SE имели множественные гранулемы (фиг. D,H) и мало бацилл (<6 организмов /HPF, 600x) (фиг. 3 L; Таблица 1). На день 295 легкие мышей, подвергаемых лечению с 60 д антибиотиков и иммунизированных с ID93/GLA-SE, продемонстрировали отсутствие значимых поражений (фиг. 3 E,I; Таблица 1) и мало бацилл (фиг. 3 M).

Данные демонстрируют, что вакцина ID93/GLA-SE, вводимая в сочетании с антибиотиками может быть применена для укорачивания стандартных химиотерапевтических режимов при активной ТБ инфекции (фиг. 3A).

Пример 4

Иммунные ответы у мышей SWR/J, получающих химиотерапию отдельно или химиотерапию плюс вакцинацию ID93/GLA-SE.

Цитокиновый профиль ID93-стимулированных спленоцитов

Мышей SWR/J инфицировали с LDA Mtb H37Rv и подвергали лечению 90 дней антибиотиками отдельно или антибиотиками с последующими тремя иммунизациями с ID93/GLA-SE в 3 отдельных недели, как описано в примере 2. Цитокиновые профили супернатантов ID93-стимулированных спленоцитов (день 177 или 241 после инфекции) анализировали после инкубирования в течение 24 часов в присутствии антигена или среды отдельно мультиплексным гранулярным анализом на IFN-γ, IL-2, TNF, IL-5, IL-10, IL-13 и IL-17. Коробчатые диаграммы демонстрируют серединный и интерквартильный диапазон после вычитания фона. P-величины из критерия суммы рангов Уилкоксона.

Внутриклеточное цитокиновое окрашивание на ID93-специфичные T-клеточные ответы в дни 149 и 177 после инфекции.

Клетки стимулировали с ID93 или контрольными средами в присутствии брефелдина A в течение 8-12 часов, окрашивали флуорохром-коньюгированными антителами против CD3, CD4, CD8, CD44, IFN-γ, IL-2 и TNF и анализировали посредством FACS. (B и C) Панели демонстрируют схему пропускания для анализа FACS. (D) Коробчатые диаграммы в нижней панели демонстрируют серединный и интерквартильный диапазон после вычитания фона. P-величины из критерия суммы рангов Уилкоксона. В ответ на in vitro рестимуляцию с ID93 подмножество цитокинов, представляющих провоспалительные, а также TH1 и TH2 функциональные группы, было в значительной мере повышено (фиг. 4A). TNF, растворимый медиатор Mtb-специфичного иммунитета у инфицированных индивидуумов, был значительно повышен на день 241 в группе, иммунизированной с ID93/GLA-SE (P<0,05). В добавление, детектировали ID93-специфичные IFN-γ, IL-2 и IL-17 ответы, которые были значительно выше у вакцинированных животных по сравнению с невакцинированными животными. Не было детектировано значимого различия в концентрации IL-5 цитокина TH2-типа, но значимые ID93-специфичные IL-10 и IL-13 ответы измеряли на день 241.

Полифункциональные CD4+ TH1 клетки недавно были описаны как коррелирующие с защитой против Leishmania major и как задействованные в ограничении прогрессирования заболевания при человеческом ТБ [39, 40]. Частоты встречаемости Τ клеток CD4+ и CD8+, продуцирующих IFN-γ, IL-2 и TNF, таким образом, исследовали для определения фенотипа ID93-специфичных T-клеточных ответов (фиг. 4B-D; S2B). Более высокие частоты встречаемости ID93-специфичных полифункциональных тройных положительных и IFN-γ+TNF+ двойных положительных Τ-клеток CD4+ наблюдали у мышей, получающих вспомогательную иммунотерапию по сравнению с мышами, получающими только химиотерапию (P<0,05), (фиг. 4B-D). Наблюдали высокие фоновые ответы ID93-специфичных TNF как в Т-клетках CD4+, так и в CD8+ подмножествах, что вероятно обосновано увеличением иммунной активации действующией Mtb инфекции у этих животных. Хотя ID93- специфичные ответы в Τ-клетках CD8+ были ниже по величине, чем наблюдаемые в CD4+ компартменте, они были значительно выше частоты двойных (IFN-γ +TNF+) и тройных положительных (ΙFΝ-γ+IL-2+TNF+) Τ-клеток CD8+ у мышей, получающих вспомогательную вакцинацию ID93/GLA-SE. Все вместе, эти данные демонстрируют, что хотя многие антигены представлены после Mtb инфекции, которая могла бы потенциально постоянно вызывать и усиливать воздействие, ID93/GLA-SE, вводимый в качестве вспомогательного средства с антибиотиками, являлся успешным в стимулировании значительно более сильного, высококачественного (полифункционального) и долговременного CD4+ T-клеточного анти-ID93 ответа Th1-типа.

Пример 5

ID93/GLA-SE в качестве вспомогательного средства к антибиотическому лечению яванских макак.

Для того, чтобы продемонстрировать безопасность ID93/GLA-SE при введении в качестве вспомогательного средства с антибиотиками в NHP, макакам вводили три дозы вакцины после одного месяца антибиотиков RIF/INH (фиг. 5A). Реакции в месте инъекции были минимальными с не более чем с трудом заметной эритемой и отеком (диапазон шкалы Дрейза 0-1), и не имело место значимых изменений в массе и температуре тела (данные не приведены). Все 7 (100%) из иммунизированных Rx+ID93/GLA-SE NHP выживали до последней оцениваемой временной точки, тогда как 6 NHP (85,7%) в группе с антибиотиками отдельно и 3 NHP (42,8%, P=0,44) в подвергаемой имитационному лечению группе доживали до этой точки (фиг. 5B). Четырех обезьян подвергали лечению с Rx+1D93/GLA-SE, и они не имели радиологических изменений или Mtb инфекция была устранена перед концом эксперимента (как свидетельствовали легочные инфильтраты на ранее положительной рентгенографии органов грудной клетки), тогда как ни у одной из макак, получавших Rx отдельно или имитационные лечения, не была устранена Mtb инфекция, и они оставались с положительной рентгенографией органов грудной клетки (фиг. 5C). Сорок процентов макак, подвергаемых лечению с Rx+ID93/GLA-SE, сильно отвечали на вспомогательную иммунотерапию, демонстрируя количественные различия в количестве бактерий Mtb по сравнению с группой с Rx отдельно; (P<0,05), (фиг. 5D). Что интересно, макаки Rx+ID93/GLA-SE, которые имели более низкое количество КОЕ, также имели отрицательную рентгенографию органов грудной клетки в конце эксперимента. Также имела место корреляция по гистопатологии между группой определения и наличием ткани с заболеванием, с животными, получающими 1D93/GLA-SE, содержащими наиболее здоровые органы, и группой с солевым раствором, имеющей наиболее больные органы (p=0,003) (фиг. 5E). В общем, эти результаты продемонстрировали, что вакцина ID93/GLA-SE хорошо переносилась в качестве поствоздействующего иммунотерапевтического агента яванскими макаками.

Пример 6

Иммунные ответы у мышей BALB/c, получающих химиотерапию отдельно или химиотерапию плюс вакцинацию ID83/GLA-SE.

Шестинедельных самок BALB/c (Charles River, Wilmington, MA) инфицировали M. tuberculosis H37Rv, с применением системы ингаляционного воздействия (Glas-Col, Terre Haute, IN) и бульонную культуру в log фазе (оптическая плотность 1,0 при 600 нм) разбавляли 10 в бульоне 7H9 с целью прививания 2,5-3,0 log10 КОЕ в легкие. M. tuberculosis H37Rv получали из мыши замораживали в аликвотах и субкультивировали в бульоне Middlebrook 7H9 с 10% олеиновая кислота-альбумин-декстроза-каталаза (OADC) (Fisher, Pittsburgh, PA) и 0,05% Tween 80 перед инфекцией. Пять мышей умерщвляли через 1 день после инфекции для подтверждения количества привитых бактерий. Оставшихся мышей рандомизировали в группы лечения, указанные в таблице 2. Лечение рифампицином (R), изониазидом (H) и пиразинамидом (Z), совместно RHZ, начинали через 26 дней после инфекции в день 0. Рифампицин и изониазид (Sigma, St. Louis, MO) растворяли отдельно в дистиллированной воде с 1 мг/мл для получения дозирующего раствора. Пиразинамид (Fisher Scientific, Suwanee, GA) растворяли в дистиллированной воде с 15 мг/мл для получения дозирующего раствора. Растворы готовили и разделяли на аликвоты еженедельно и держали при 4°C перед применением. Четыре контрольные группы получали лекарственный наполнитель (вода)+GLA-SE адъювант, лекарственный наполнитель+ID83 вакцина, RHZ+вакцина наполнитель (солевой раствор) и RHZ+GLA-SE адъювант. Группа тестирования получала вакцину RHZ+ID83. RHZ и лекарственный наполнитель вводили 5 дней в неделю посредством гаважа в течение 12 недель. R или наполнитель вводили по меньшей мере за 1 час перед HZ или наполнителем для избежания ранее описанных фармакокинетических взаимодействий лекарственное средство-лекарственное средство, что ограничивает абсорбцию R.

ID83 составляли в виде устойчивой эмульсии масло-в-воде с GLA в качестве адъюванта (GLA-SE) смешиванием 4 мл вакцины смесь готовили с 2 мл GLA-SE (0,040 мг/мл, 4% масла), 0,1 мл ID83 (0,2 мг/мл) и 1,9 мл солевого раствора (NaCl). Вакцинные препараты быстро перемешивали вихревым способом перед применением. 100 мкл вакцины вводили подкожно. Инъецированными дозами являлись: 2 мкг GLA-SE +/- 0,5 мкг ID83.

Вакцинацию инфицированных мышей начинали через 6 недель после инфекции (2 недели после инициации лечения RHZ). Три дозы вакцины или контроли (солевой раствор или только адъювант) вводили подкожно в 100 микролитрах с 3-недельными интервалами (т.е., после 2, 5 и 8 недель лечения). Вакцина содержала 2 микрограмма адъюванта GLA-SE и 0,5 микрограмма ID83. Контроли включали в себя только солевой раствор и только адъювант. Место инъекции меняли.

Таблица 2
Экспериментальная схема
Количество мышей для умерщвления к временной точке
Режим* Нед-4 День
0
Нед 6 Нед
12
Нед
12+5**
Нед
12+10**
Всего
Наполнитель+ Адъювант 5 5 5 5 20
Наполнитель+ Вакцина 5 5 10

RHZ+Солевой раствор 5 5 5 5 20
RHZ+Адъювант 5 5 5 5 20
RHZ+Вакцина 5 5 5 5 20
Всего 5 5 25 25 15 15 90
Наполнитель является водой; Адъювант представляет собой GLA-SE; Вакцина представляет собой ID83+GLA-SE
**Недели 12+5 и 12+10 указывают временную точку после 12 недель лечения плюс 5 и 10 недель последующего наблюдения без какого-любо лечения.

Патологическая оценка. Репрезентативные фотографии легких выполняли после 72 часов инкубирования в стерильном PBS и перед гомогенизацией для количественных культур, для регистрирования макроскопического проявления легочных поражений. Другое легкое промывали и помещали в 10% нейтральный буферизованный формалиновый раствор. Эти легкие погружали в парафин, разрезали, фиксировали на предметных стеклах и окрашивали с H&E и кислотоустойчивым красителем для обзора гистопатологии.

Оценка гистопатологии. Количество КОЕ (x) логарифмически преобразовывали в виде (x+1) перед анализом. Групповые средства сравнивали однофакторным дисперсионным анализом c послеэкспериментальным тестом Бонферрони.

Результаты

Легочное количество КОЕ во время лечения. Среднее (±SD) легочное log10 количество КОЕ в Д-26 составляло 2,78±0,21. Среднее количество КОЕ в начале лечения (DO) составляло 7,60±0,23. После 6 недель лечения легочные количества КОЕ снижались примерно на 0,9 log10 в группах наполнитель+адъювант и наполнитель+вакцина, тогда как количества КОЕ в группах RHZ+солевой раствор, RHZ+адъювант и RHZ+вакцина падали на 4,27, 4,19 и 4,44 log10, соответственно (Фигура 6A). После 12 недель лечения, количества КОЕ в подвергаемых лечению с лекарственным наполнителем группах были в значительной степени устойчивыми, тогда как 3 из 5, 2 из 4 и 4 из 5 мышей подвергаемых лечению с антибиотиками отдельно (RHZ+солевой раствор), антибиотиком плюс TLR4 адъювант (RHZ+адъювант) и антибиотиками + вакцина ID 83 (RHZ+Вакцина), соответственно, были негативными на культуру (Фигура 6).

Легочные количества КОЕ после завершения лечения. После 5 недель последующего наблюдения после прекращения любого лечения 4 из 5 мышей в каждой группе имели положительные легочные культуры (Таблица 3 ниже). Средние легочные log10 количеств КОЕ в группах RHZ+солевой раствор, RHZ+адъювант и RHZ+вакцина составляли 1,14±1,14, 0,72±0,49 и 0,63±0,42, соответственно. Исключая негативных на культуру мышей, количества КОЕ составляли 1,42±1,09, 0,90±0,32 и 0,78±0,27, соответственно. После 10 недель последующего наблюдения только 1 из 5 мышей в группе RHZ+вакцина имела положительную культуру, по сравнению с 3 из 5 мышей в группах RHZ+адъювант и RHZ+ солевой раствор. Исключая негативных по культуре мышей, средние легочные log10 количества КОЕ в группах RHZ+солевой раствор, RHZ+адъювант и RHZ+вакцина составляли 1,82±1,85, 1,37±1,56 и 0,75±1,68, соответственно. На десятой неделе после прекращения лечения (Фигура 7) количества КОЕ у трех животных с положительными легочными культурами в обеих группах, подвергаемых лечению с RHZ+солевой раствор или RHZ+адъювант отдельно, проявляли логарифмическое бактериальное возобновление роста, тогда как только животные с положительными легочными культурами в группе RHZ+вакцина проявляли бактериальное возобновление роста, которое было сниженным по сравнению с другими двумя группами.

Несмотря на то, что исследование было обеспечено статистической значимостью в отношении количества КОЕ, эти данные продемонстрировали, что лечение активного туберкулеза в соответствии со способами по изобретению приводит в результате к долговременному улучшению признаков или симптомов туберкулеза и предоставляет сокращение продолжительности химиотерапии по сравнению с антибиотической лекарственной терапией отдельно.

Таблица 3
Процент (пропорция) мышей с положительными культурами после 12 недель лечения с последующими 5 или 10 неделями последующего наблюдения
Временная точка последующего наблюдения
Режим Нед 12+5 Нед 12+10
RHZ+Солевой раствор 80% (4/5) 60% (3/5)
RHZ+Адъювант 80% (4/5) 60% (3/5)
RHZ+Вакцина 80% (4/5) 20% (1/5)

Все из вышеприведенных патентов США, публикаций патентных заявок США, патентных заявок США, иностранных патентов, иностранных патентных заявок и непатентных публикаций, на которые имеют место ссылки в данном описании и/или которые приведены в листе данных заявки, полностью включены в данный документ посредством ссылки.

В вышеприведенном следует принимать во внимание, что хотя в данном документе в целях иллюстрации были описаны конкретные варианты осуществления изобретения, различные модификации могут быть осуществлены без выхода за рамки основной идеи и объема изобретения. Соответственно, изобретение не является ограниченным за исключением прилагаемой формулы изобретения.

Иллюстративные аминокислотные последовательности

Слитый полипептид ID93 с необязательным His tag (SEP ID NO:1)

Слитый полипептид ID93 (SEO ID NO:2)

Слитый полипептид ID83 с необязательным His tag (SEP ID NO:3)

Слитый полипептид ID83 (SEP ID NO:4)

Rv1813 (SEP ID NO:5)

Rv3620 (SEP ID NO:6)

MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS

Rv2608 (SEP ID NO:7)

Rv3619 (SEP ID NO:8)

MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA

1. Способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадию введения млекопитающему, имеющему активную инфекцию туберкулезом, иммунологически эффективного количества терапевтической вакцины в сочетании с одним или более химиотерапевтическими агентами, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, где слитый полипептид содержит комбинацию антигена Rv1813, Rv3620, Rv3619 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или последовательность, имеющую по меньшей мере 90% идентичности с комбинацией антигенов.

2. Способ по п.1, где антиген Rv1813 включает аминокислоты 33-143 последовательности SEQ ID No: 5.

3. Способ по п.1, где N-концевая лидерная последовательность или трансмембранный домен Rv1813 необязательно удалены.

4. Способ по п.2, где антиген микобактерии Rv2608, Rv3619, Rv3620 и Rv1813 представляет собой антиген Rv2608, Rv3619, Rv3620 и Rv1813 M. tuberculosis.

5. Способ по п.3, где слитый полипептид содержит аминокислотную последовательность, приведенную в SEQ ID NO:1, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

6. Способ лечения активной туберкулезной инфекции у млекопитающего, включающий стадию введения млекопитающему, имеющему активную инфекцию туберкулезом, иммунологически эффективного количества терапевтической вакцины в сочетании с одним или более химиотерапевтическими агентами, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, где слитый полипептид содержит аминокислотную последовательность, приведенную в SEQ ID NO:2, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

7. Способ по п.3, где млекопитающее является человеком.

8. Способ по п.6, где млекопитающее является человеком.

9. Способ по любому из пп.1-8, где активная туберкулезная инфекция представляет собой активную первичную инфекцию M. tuberculosis.

10. Способ по любому из пп.1-8, где активная туберкулезная инфекция представляет собой реактивированную туберкулезную инфекцию.

11. Способ по любому из пп.1-8, где активная туберкулезная инфекция ассоциирована с клиническим симптомом слабости, утомлением, жаром, простудами, потерей веса, потерей аппетита, анорексией, ночной потливостью или любой их комбинацией.

12. Способ по любому из пп.1-8, где активная туберкулезная инфекция представляет собой легочную активную ТБ инфекцию.

13. Способ по п.12, где легочная активная туберкулезная инфекция ассоциирована с клиническим симптомом непрекращающегося кашля, густой слизью, болью в груди, кровохарканьем или любой их комбинацией.

14. Способ по любому из пп.1-8, где активная туберкулезная инфекция характеризуется бактериями Mtb, которые пролиферируют, репродуцируются, распространяются или активно размножаются с экспоненциальной, логарифмической или полулогарифмической скоростью в органе млекопитающего.

15. Способ по любому из пп.1-8, где активную туберкулезную инфекцию идентифицируют с применением анализа, выбранного из группы, состоящей из анализа кислотоустойчивого окрашивания (AFS); анализа бактериальной культуры; теста IGR; кожного теста; и внутриклеточного цитокинового окрашивания цельной крови или выделенных МКПК после антигенной стимуляции.

16. Способ по любому из пп.1-8, где млекопитающее инфицировано M. tuberculosis с множественной лекарственной устойчивостью (МЛУ).

17. Способ по любому из пп.1-8, где млекопитающее было ранее иммунизировано с бациллой Кальмета-Герена (БКГ).

18. Способ по любому из пп.1-8, где один или более химиотерапевтических агентов представляет собой изониазид, рифампицин или их комбинацию.

19. Способ по любому из пп.1-8, где млекопитающему сначала вводят один или более химиотерапевтических агентов в течение промежутка времени и затем вводят терапевтическую вакцину.

20. Способ по любому из пп.1-8, где млекопитающему сначала вводят терапевтическую вакцину и затем вводят один или более химиотерапевтических агентов в течение промежутка времени.

21. Способ по любому из пп.1-8, где введение одного или более химиотерапевтических агентов и терапевтической вакцины осуществляется одновременно.

22. Способ по любому из пп.1-8, дополнительно включающий введение терапевтической вакцины млекопитающему один или более раз последовательно, где туберкулезная инфекция, остающаяся у млекопитающего при одном или более последовательных введений, может являться или не являться активной туберкулезной инфекцией.

23. Способ по любому из пп.1-8, где вакцина дополнительно содержит адъювант.

24. Способ по п.23, где адъювант представляет собой GLA, имеющий следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил.

25. Способ по п.24, где R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил.

26. Способ по п.24, где R1, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C13 алкил.

27. Способ по п.24, где R1, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C9 алкил.

28. Способ уменьшения времени курса химиотерапии против активной туберкулезной инфекции, включающий: введение млекопитающему, имеющему активную туберкулезную инфекцию, иммунологически эффективного количества терапевтической вакцины, где вакцина содержит фармацевтическую композицию, содержащую выделенный слитый полипептид, где слитый полипептид содержит комбинацию антигена Rv1813, Rv3620, Rv3619 и Rv2608 видов микобактерий туберкулезного комплекса, и антигены являются ковалентно связанными, или последовательность, имеющую по меньшей мере 90% идентичности с комбинацией антигенов, где N-концевая лидерная последовательность или трансмембранный домен Rv1813 необязательно удалены, и где вакцина индуцирует иммунный ответ против туберкулеза и введение млекопитающему химиотерапии укороченным курсом, по сравнению со временем курса химиотерапии без введения терапевтической вакцины.

29. Способ по п.28, где антиген Rv1813 включает аминокислоты 33-143 последовательности SEQ ID No: 5.

30. Способ по п.28, где N-концевая лидерная последовательность или трансмембранный домен Rv1813 необязательно удалены.

31. Способ по п.30, где антиген микобактерии Rv2608, Rv3619, Rv3620 и Rv1813 представляет собой антиген Rv2608, Rv3619, Rv3620 и Rv1813 M. tuberculosis.

32. Способ по п.30, где слитый полипептид содержит последовательность, приведенную в SEQ ID NO:1, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

33. Способ по п.30, где слитый полипептид содержит последовательность, приведенную в SEQ ID NO:2, или последовательность, имеющую по меньшей мере 90% идентичности с ней.

34. Способ по п.30, где млекопитающее является человеком.

35. Способ по п.33, где млекопитающее является человеком.

36. Способ по любому из пп.28-35, где время курса химиотерапии укорочено до не более чем приблизительно 3 месяцев, приблизительно 5 месяцев или приблизительно 7 месяцев.

37. Способ по любому из пп.28-35, где вакцина дополнительно содержит адъювант.

38. Способ по п.37, где адъювант представляет собой GLA, имеющий следующую структуру:

,

где R1, R3, R5 и R6 представляют собой C11-C20 алкил; и R2 и R4 представляют собой C9-C20 алкил.

39. Способ по п.38, где R1, R3, R5 и R6 представляют собой C11-14 алкил; и R2 и R4 представляют собой C12-15 алкил.

40. Способ по п.38, где R1, R3, R5 и R6 представляют собой C11 алкил; и R2 и R4 представляют собой C13 алкил.

41. Способ по п.38, где R1, R3, R5 и R6 представляют собой С11 алкил; и R2 и R4 представляют собой C9 алкил.



 

Похожие патенты:

Изобретение относится к медицине. Предложен способ предотвращения туберкулеза оральным периодическим введением инактивированных микобактерий, причём интервал между дозами не превышает 5 дней, количество доз не менее 5.

Изобретение относится к фармакологической промышленности, в частности к средству, обладающему противотуберкулезным действием. Средство, обладающее противотуберкулезным действием, представляет собой сухой экстракт, полученный путем измельчения кроющих листьев початков антоциановой диплоидной формы кукурузы, экстракции спиртом 96% на водяной бане до кипения и кипячения в течение 14-15 минут, выпаривания при температуре 55-60°С, разведения выпаренного остатка сначала дистиллированной водой при температуре 40-50°С, затем добавления хлороформа в пропорции 4/5 части воды и 1/5 части хлороформа, охлаждения до комнатной температуры и центрифугирования со скоростью 1500 оборотов в минуту в течение 15 минут с последующим отделением водной фракции и высушиванием ее.

Изобретение относится к энантиомерам 6-этоксикарбонил-7-(тиен-2-ил)-5-метил-4,7-дигидро-1,2,4-триазоло[1,5-а]пиримидина и 6-этоксикарбонил-7-фенил-5-метил-4,7-дигидро-1,2,4-триазоло[1,5-а]пиримидина, обладающим туберкулостатической активностью.

Изобретение относится к медицине, а именно к фтизиатрии, и может быть использовано для лечения инфильтративного туберкулеза легких с множественной лекарственной устойчивостью.

Настоящее изобретение относится к липосомному препарату для применения в способе лечения или предупреждения туберкулеза, а также к суспензии, содержащей растворенный липосомный препарат.

Изобретение относится к фармацевтической промышленности и медицине и представляет собой препарат для лечения туберкулеза, включающий изониазид, воду для инъекций, метионин, янтарную кислоту и натрия сукцинат, причем компоненты в препарате находятся в определенном соотношении, в г.

Изобретение относится к медицине, а именно к иммунологии, и может быть использовано для получения вакцины против туберкулеза. Вакцина содержит активное начало на основе микобактерий туберкулеза и вспомогательных веществ, при этом в качестве активного начала она содержит белок Tb10.4 M.

Изобретение относится к производному фторхинолонкарбоновой кислоты, а именно 1-этил-6-фтор-4-оксо-7-(8-этокси-2-оксо-2Н-хромен-3-ил)-1,4-дигидрохинолин-3-карбоновой кислоте формулы (4), обладающей высокой противотуберкулезной активностью, в том числе по отношению к штаммам микобактерий с множественной лекарственной устойчивостью.

Изобретение относится к соединениям общей формулы (I) или (II): n=0-2;A выбирается независимо и представляет собой 5-7-членный ароматический гетероцикл, содержащий 1-2 атома N и 0-1 атом S; А содержит 0-2 заместителя R; R выбирается независимо и представляет собой метил или этил; B выбирается независимо и представляет собой фенил, 5-6-членный гетероарильный цикл, содержащий 0-2 атома N и 0-1 атом S, или 5-6-членный циклоалкил, содержащий 0-2 атома N и 0-1 атом S; B содержит 0-3 заместителя R1; C выбирается независимо и представляет собой фенил, -NH2, -NH-C1-3-алкил, -NH(С1-3-алкил)С1-3-алкил, 5-6-членный гетероарильный цикл, содержащий 0-2 атома N и 0-1 атом S, или 5-6-членный циклоалкил, содержащий 0-2 атома N и 0-1 атом S; C содержит 0-3 заместителя R1; R1 выбирается независимо и представляет собой -C1-6-алкил, галоген, фенил, -C5-7-гетероарил, содержащий 1-2 атома N и 0-1 атом S, -COOH, -CONH2, -NH2 или -NHR2; R2 выбирается независимо и представляет собой -C1-6-алкил, -C(O)-C1-8-алкил; линкер X выбирается независимо и представляет собой -CH2-, -С(=O)-СН2- или -CH2-O-группу; линкер Q выбирается независимо и представляет собой -NH- или -NH-C(O)-группу; линкер Y выбирается независимо и представляет собой -O-(СН2)m или -С(O)-NH-(СН2)m, где m=1-3; Z выбирается независимо и представляет собой -СН2- группу или атом кислорода.

Изобретение относится к новым четвертичным аммонийным солям производных 2-аминотиофен-3-карбоновых кислот, обладающих противотуберкулезной активностью, общей формулы I и формулы II: где X отсутствует или представляет собой -СН2-, -(СН2)2-, СН3СН-, -N(R4)-; R1 представляет собой CN, C(O)OR5, C(O)NHR6; R4 представляет собой алифатические насыщенные, неразветвленные или разветвленные С1-С5 углеводороды, бензил; R5 представляет собой алифатические насыщенные, неразветвленные или разветвленные C1-С5 углеводороды; R6 представляет собой Н, алифатические насыщенные, неразветвленные или разветвленные C1-С5 углеводороды, циклические углеводороды С3-С7.

Изобретение относится к области ветеринарии и представляет собой способ выявления анергичного, больного туберкулезом крупного рогатого скота. Изобретение обеспечивает возможность выявления недовыявленных больных туберкулезом, анергичных животных в неблагополучных по туберкулезу хозяйствах.

Изобретение относится к медицине. Предложен способ предотвращения туберкулеза оральным периодическим введением инактивированных микобактерий, причём интервал между дозами не превышает 5 дней, количество доз не менее 5.

Настоящее изобретение относится к липосомному препарату для применения в способе лечения или предупреждения туберкулеза, а также к суспензии, содержащей растворенный липосомный препарат.

Изобретение относится к медицине, а именно к иммунологии, и может быть использовано для получения вакцины против туберкулеза. Вакцина содержит активное начало на основе микобактерий туберкулеза и вспомогательных веществ, при этом в качестве активного начала она содержит белок Tb10.4 M.

Изобретение относится к ветеринарной медицине, а именно к средству для профилактики лейкоза крупного рогатого скота. Средство для профилактики лейкоза крупного рогатого скота, которое содержит водорастворимую белковую фракцию с молекулярной массой 18-20 кДа, выделенную из продуктов разрушения микобактерий туберкулеза, и характеризующуюся наличием пиков при длине волны 214 нм в ультрафиолетовой области спектра, фосфатно-солевой буферный раствор, водный раствор муравьиного альдегида и изотонический раствор натрия хлорида, взятые в определенном соотношении компонентов.

Изобретение относится к области биотехнологии, конкретно к иммуногенным системам презентации множественных антигенов, и может быть использовано в медицине. Иммуногенная композиция против одного или более из антигенного полисахарида, пептидного антигена или полипептидного антигена содержит по меньшей мере один антигенный полисахарид, по меньшей мере один пептидный или полипептидный антиген и по меньшей мере одну комплементарную пару аффинных молекул.

Группа изобретений относится к молекулярной биологии, биотехнологии, медицине и может быть использована для осуществления профилактики и лечения туберкулеза. Предложены гибридные белки для индукции специфичного иммунного ответа против Mycobacterium tuberculosis, включающие белки Ag85B, Tb10.4 M.tuberculosis, фрагменты флагеллина FliC S.Typhimurium, соединенные гибкими мостиками, кодирующие полинуклеотиды, генетические конструкции для экспрессии полинуклеотидов, рекомбинантные клетки и варианты вакцины для профилактики или лечения туберкулеза на основе описанного гибридного белка, потребитель разработанной вакцины - человек либо животное.

Изобретение относится к ветеринарной микробиологии. Предложен способ получения аллергена для дифференциации неспецифических реакций на ППД туберкулин для млекопитающих.

Группа изобретений относится к медицине и раскрывает средство для лечения или профилактики аллергического состояния. При этом средство представляет собой липосомную форму, включающую: (а) фрагменты штамма Mycobacterium tuberculosis комплекса (МБТК), (б) образующее липосомы средство, (в) от 1 до 20% сахарозы.

Настоящее изобретение относится к применению Mycobacterium w для лечения экспрессирующего десмоколлин-3 рака. Mycobacterium w вводят млекопитающим, страдающим экспрессирующими десмоколлин-3 типами рака.

Группа изобретений относится к медицине, а именно к фтизиатрии, и может быть использована для лечения активной туберкулезной инфекции. Способы по изобретению включают введение млекопитающему иммунологически эффективного количества терапевтической вакцины, содержащей выделенный слитый полипептид, содержащий комбинацию антигенов Rv1813, Rv3620, Rv3619 и Rv2608 в сочетании с химиотерапевтическими агентами. Использование изобретений позволяет пролонгировать выживание при лечении активной туберкулезной инфекции и сократить продолжительность химиотерапии. 3 н. и 38 з.п. ф-лы, 4 табл., 32 ил., 6 пр.

Наверх