Ингибирующие моноклональные антитела против фактора xii/xiia и их применения

Группа изобретений относится к медицине и касается моноклонального антитела против фактора XII/XIIa или его антигенсвязывающего фрагмента, аффинность связывания с фактором XIIa-бета человека которого в 2 раза больше аффинности связывания с фактором XII человека и которое способно полностью ингибировать амидолитическую активность фактора XIIa человека. Группа изобретений также касается моноклонального антитела против фактора XII/XIIa или его антигенсвязывающего фрагмента, которое ингибирует амидолитическую активность фактора XIIa-альфа на 50% больше в случае применения в молярном соотношении FXIIa-альфа к антителу 1:0,2. Группа изобретений также касается фармацевтической композиции для профилактики или лечения состояния, связанного с FXII/FXIIa, содержащей указанное антитело. Группа изобретений обеспечивает ингибирование активированного FXIIa, но не снижение уровня FXII в крови. 11 н. и 14 з.п. ф-лы, 16 ил., 14 табл., 10 пр.

 

Изобретение относится к ингибирующим антителам против фактора XII/FXIIa и способам их применения.

Фактор XII (фактор Хагемана) является сывороточным гликопротеидом с молекулярной массой примерно 80 кД. Кроме автоактивации при воздействии отрицательно заряженных поверхностей, фактор XII дополнительно активируется калликреином посредством протеолитического расщепления с образованием альфа-фактора XIIa, который в свою очередь затем преобразуется, например, под действием трипсина, в бета-фактор XIIa (FXIIa-β). Альфа-фактор XIIa состоит из N-концевой тяжелой цепи молекулярной массой около 50 кД, которая содержит контактный связывающий домен, и C-концевой легкой цепи с молекулярной массой около 28 кД, которая содержит каталитический центр. Тяжелая и легкая цепи связаны дисульфидной связью. FXIIa-β представляет собой активную форму FXII около 30 кД, состоящую из полной легкой цепи и фрагмента 2000 Д тяжелой цепи, связанных дисульфидной связью.

Повреждение стенок сосудов запускает мгновенную адгезию и агрегацию тромбоцитов с последующей активацией системы свертывания плазмы и образованием содержащих фибрин кровяных сгустков, которые закрывают место повреждения. Такие явления являются ключевыми для ограничения посттравматической потери крови, но также могут закупоривать пораженные заболеванием кровеносные сосуды, приводя к ишемии и инфаркту жизненно важных органов. В каскадной модели свертывание крови происходит благодаря серии реакций, в которые вовлечена активация зимогенов за счет ограниченного протеолиза, завершающаяся образованием тромбина, который превращает фибриноген плазмы в фибрин и активирует тромбоциты. В свою очередь, прилипшие к коллагену или фибрину тромбоциты усиливают образование тромбина на несколько порядков величин за счет экспонирования прокоагулянтных фосфолипидов (главным образом, фосфатидилсерина) на их наружной поверхности, что стимулирует сборку и активацию комплексов протеаз коагуляции, и благодаря прямому взаимодействию между рецепторами тромбоцитов и факторами свертывания.

Существует два сходящихся пути коагуляции, которые запускаются либо внешними (стенка сосуда), либо внутренними (переносимыми кровью) компонентами сосудистой системы. «Внешний» путь инициируется комплексом плазменного фактора VII (FVII) с интегральным мембранным белком тканевого фактора (ТФ), важным кофактором свертывания, который отсутствует на люминальной поверхности, но в высокой степени экспрессируется в субэндотелиальных слоях сосуда, и который становится доступным или высвобождается в результате повреждения ткани. ТФ, экспрессированный в циркулирующих микровезикулах, также может вносить вклад в распространение тромба за счет поддержания образования тромбина на поверхности активированных тромбоцитов. «Внутренний» или контактный путь активации инициируется, когда фактор XII (FXII, фактор Хагемана) контактирует с отрицательно заряженными поверхностями в реакции, в которую вовлечены высокомолекулярный кининоген и плазменный калликреин. FXII может быть активирован макромолекулярными компонентами субэндотелиального матрикса, такими как гликозаминогликаны и коллагены, сульфатиды, нуклеотиды, полифосфаты и другие растворимые полианионы, или нефизиологическим материалом, таким как стекло или полимеры. Одним из наиболее мощных контактных активаторов является коалин, и такая реакции служит в качестве механистической основы для главного клинического теста свертываемости, определения активированного частичного тромбопластинового времени (АЧТВ), благодаря которому измеряют способность к коагуляции по «внутреннему» пути. В реакциях, стимулируемых тромбоцитами, активированный FXII затем активирует FXI до FXIa и затем FXIa активирует фактор IX. Комплекс FVIIIa, где такой FVIIIa был ранее активирован следами FXa и/или тромбина, и FIXa (теназный комплекс) затем активирует FX.

Несмотря на высокий потенциал в отношении индукции свертывания крови in vitro, (пато-)физиологическое значение FXII-запускаемого внутреннего пути коагуляции подвергается сомнению в связи с тем фактом, что наследственные недостаточности FXII, а также высокомолекулярного кининогена и плазменного калликреина не связаны с геморрагическими осложнениями. Вместе с данными о том, что люди и мыши, у которых отсутствуют компоненты внешнего пути, такие как ТФ и FVII, страдают тяжелыми кровотечениями, такие факты привели к современной гипотезе о том, что прекращение кровотечения in vivo требует исключительно наличия внешнего каскада (Mackman, N. 2004. Role of tissue factor in hemostasis, thrombosis, and vascular development. Arterioscler. Thromb. Vase. Biol. 24, 1015-1022).

При патологических состояниях каскад коагуляции может быть активирован ненадлежащим образом, что затем приводит к образованию гемостатических пробок внутри кровеносных сосудов. При этом сосуды могут быть закупорены и кровоснабжение дистальных органов может быть ограничено. Такой процесс известен как тромбоз, и если тромб эмболизирует, то процесс называют тромбоэмболией, которая связана с высокой смертностью. Кроме того, применение протезных устройств, которые контактируют с кровью, сильно ограничено из-за активации внутреннего каскада коагуляции. В некоторых случаях подходящее покрытие поверхности протезного устройства позволяет избежать указанной проблемы, но может мешать его функционированию в другом. Примерами таких протезных устройств являются гемодиализаторы, аппараты искусственного кровообращения, сердечные клапаны, сосудистые стенты и постоянные катетеры. В случаях использования таких устройств вводят антикоагулянты, такие как гепарин, чтобы предотвратить образование фибрина на поверхности. Однако некоторые пациенты не переносят гепарин, который может вызывать индуцируемую гепарином тромбоцитопению (HIT), приводящую к агрегации тромбоцитов и опасному для жизни тромбозу. Кроме того, недостатком, присущим всем антикоагулянтам, применяемым в клинике, является повышенный риск серьезных случаев кровотечения. Таким образом, существует большая потребность в новых типах антикоагулянтов, которые не связаны с такими осложнениями и которые можно применять на больных пациентах или применять в схеме профилактики/терапии с целью предотвращения тромбоза без повышенного риска кровотечений.

В течение более пятидесяти лет известно, что недостаточность фактора свертывания XII не связана с повышенным спонтанными или связанными с повреждениями геморрагическими осложнениями (Ratnoff OD and Colopy JE 1955. A familial hemorrhagic trait associated with a deficiency of a clot-promoting fraction of plasma. J. Clin. Invest. 34: 602-613). Действительно, несмотря на простое выявление по патологическому значению, измеряемому в АЧТВ-тесте (клинический тест на свертываемость, который направлен на внутренний путь коагуляции), люди с недостаточностью FXII не страдают от отклоняющегося от нормы кровотечения, даже во время больших хирургических процедур (Colman RW. Hemostasis and Thrombosis. Basic principles & clinical practice (eds. Colman RW, Hirsch J, Mader VJ, Clowes AW, & George J) 103-122 (Lippincott Williams & Wilkins, Philadelphia, 2001)). Напротив, недостаточность FXII была связана с повышенным риском тромбоза вен (Kuhli C et al. 2004. Factor XII deficiency: a thrombophilic risk factor for retinal vein occlusion. Am. J. Ophthalmol. 137:459-464; Halbmayer WM et al. 1993. Factor XII (Hageman factor) deficiency: a risk factor for development of thromboembolism. Incidence of FXll deficiency in patients after recurrent venous or arterial thromboembolism and myocardial infarction. Wien. Med. Wochenschr. 143:43-50). Исследования и описания клинических случаев, подтверждающие такое предположение, относятся к показательному случаю недостаточности FXII у Джона Хагемана, который умер от эмболии легких. Гипотеза о том, что недостаточность FXII связана с повышенным риском протромботического состояния, была подвергнута сомнению при недавней повторной оценке нескольких описаний клинических случаев, в исходных сообщениях о которых связывали недостаточность FXII с тромбозом (Girolami A et al. 2004. The occasional venous thromboses seen in patients with severe (homozygous) FXll deficiency are probably due to associated risk factors: A study of prevalence in 21 patients and review of the literature. J. Thromb. Thrombolysis 17:139-143). В большинстве случаев авторы идентифицировали сопутствующие наследственные или приобретенные протромботические факторы риска в сочетании с недостаточностью фактора FXII, которые могут быть ответственны за тромботическое явление, независимо от FXII. Наиболее обширные эпидемиологические исследования с использованием хорошо охарактеризованных пациентов (Koster T. et al. 1994, John Hageman's factor and deep-vein thrombosis: Leiden thrombophilia Study. Br. J. Haematol. 87: 422-424) и семей с недостаточностью FXII (Zeerleder S et al. 1999. Reevaluation of the incidence of thromboembolic complications in congenital factor XII deficiency - a study on 73 subjects from 14 Swiss families. Thromb. Haemost. 82:1240-1246) показали, что не существует корреляции недостаточности FXII и какого-либо про- или антитромботического риска. Неожиданно и в отличие от распространенного мнения специалистов в данной области было обнаружено, что управляемый фактором XII внутренний путь коагуляции вовлечен в образование тромбов артерий in vivo, но не является необходимым для нормального тканеспецифичного гемостаза (Renne T et al. 2005. Defective thrombus formation in mice lacking factor XII. J. Exp. Med. 202:271-281; Kleinschnitz C et al. 2006. Targeting coagulation factor XII provides protection from pathological thrombosis in cerebral ischemia without interfering with hemostasis. J. Exp. Med. 203, 513-518; WO2006066878). Неожиданно такие результаты помещают фактор XII в центральное положение в процессе патологического тромбообразования. Следовательно, вещества, способные мешать и блокировать активацию FXII или активность FXII, могут быть подходящими для блокирования патологического тромбообразования артерий и его клинических последствий.

В WO2006066878 предлагается применение антител против FXII/FXIIa или применение ингибиторов FXII/FXIIa. В качестве возможных ингибиторов были предложены антитромбин III (AT III), ингибитор ангиотензинпревращающего фермента, ингибитор C1, апротинин, ингибитор альфа-I-протеазы, противоболевое средство ([(S)-l-карбокси-2-фенилэтил]карбамоил-L-Arg-L-Val-аргиналь), Z-Pro-Pro-альдегиддиметилацетат, DX88 (Dyax Inc., 300 Technology Square, Cambridge, MA 02139, USA; описанные в: Williams A. and Baird LG.2003. DX-88 и HAE: a developmental perspective. Transfus. Apheresis Sci. 29: 255-258), лейпептин, ингибиторы пролилолигопептидазы, такие как Fmoc-Ala-Pyr-CN, ингибитор трипсина кукурузы, мутанты ингибиторов трипсина поджелудочной железы быка, экотин, антикоагулянтный белок желтоперой камбалы, ингибитор-V трипсина Cucurbita maxima, включая изоингибиторы Curcurbita maxima и хамадарин (который раскрыт в lsawa H et al. 2002. A mosquito salivary protein inhibits activation of the plasma contact system by binding to factor XII and high molecular weight kininogen. J. Biol. Chem. 277:27651-27658).

Идеальный ингибитор FXII/FXIIa в качестве терапевтического средства - хотя и будет проявлять высокую ингибирующую активность по отношению к FXII/FXIIa - не будет увеличивать риск кровотечения, будет неиммуногенным и его нужно будет вводить так мало, насколько это возможно - в идеале только один раз. Низкомолекулярные ингибиторы, подобные Z-Pro-Pro-альдегиддиметилацетату, будут иметь только очень короткое время полужизни после введения, таким образом, будут требовать многократных инъекций, или их нужно будет разработать в перорально доступных формах медленного высвобождения и затем также назначать постоянно в течение длительного периода времени. Белки плазмы человека, подобные ингибитору C1, на первый взгляд удовлетворял бы всем требованиям, обладая относительно высокой ингибирующей активностью по отношению к FXII/FXIIa, при этом не повышая риск кровотечения, являясь неиммуногенным, так как представляет собой белок человека, а также имея достаточно продолжительное время полужизни в плазме. В настоящее время неожиданно было обнаружено, что в модели тромбоза in vivo ингибитор C1 в качестве основного кандидата на роль ингибитора FXII/FXIIa человека не может быть успешно использован для предотвращения окклюзии. Другой предлагаемый ингибитор FXII/FXIIa из плазмы человека, а именно ингибитор AT III, по меньшей мере, не может удовлетворять второму требованию, так как риск кровотечения может быть повышен (Warren BL et al. 2001. Caring for the critically ill patient. High-dose antithrombin Ill in severe sepsis: a randomized controlled trial. JAMA 286:1869-1878).

В WO2008098720A1 предлагается применение ингибитора сериновых протеаз типа Казаля, инфестина или его доменов, или модифицированных ингибиторов сериновых протеаз типа Казаля, основанных на гомологах инфестина, в качестве ингибиторов FXII/FXIIa. Разработан выбранный из такой подгруппы рекомбинантный инфестин-4, слитый с альбумином человека для увеличения времени полужизни (rHA-инфестин-4), проявляющий высокую ингибирующую активность по отношению к FXII/FXIIa. Кроме того, такое вещество проявляло антитромботическую эффективность, не нарушая (физиологический) гемостаз, при этом имея подходящее время полужизни после слияния с альбумином человека (Hagedorn et al. 2010. Factor XIIa Inhibitor Recombinant Human Albumin Infestin-4 Abolishes Occlusive Arterial Thrombus Formation Without Affecting Bleeding. Circulation. 121:1510-1517). Однако, хотя иммуногенность была снижена во время разработки, все еще остается риск иммунных ответов у человека. Кроме того, еще более длительное время полужизни может давать дополнительные полезные эффекты. Таким образом, очевидно, что еще существует необходимость в улучшенном лекарственном средстве для лечения и/или профилактики тромбоза и сходных расстройств. Таким образом, целью настоящего изобретения является удовлетворение такой потребности. Кандидатом для такого улучшенного лекарственного средства является улучшенное анти-FXII/FXIIa-антитело с ингибирующей активностью.

Были раскрыты антитела к фактору XII. Pixley et al. (J. Biol. Chem. (1987) 262, 10140-10145) описали моноклональное антитело B7C9 к фактору XII человека. Такое антитело блокировало опосредованную поверхностью коагулянтную активность, но не амидолитическую активность фактора XIIa. Small et al. (Blood (1985), 65, 202-210) раскрыли моноклональное антитело к фактору XII человека, которое предотвращало активацию фактора XII, но не коагулянтную или амидолитическую активность активированного FXII (FXIIa). Nuijens et al. (J. Biol. Chem. (1989) 264, 12941-12949) раскрыли моноклональные антитела F1 и F3, которые ингибировали коагулирующую активность, но не амидолитическую активность FXII. В WO8911865 предлагаются моноклональные антитела, полученные против легкой цепи FXII (B6F5, C6B7, D2E10). Такие антитела ингибируют коагулирующую активность, но дают только частичное ингибирование амидолитической активности FXIIa. В WO9008835 описано получение моноклонального антитела, которое избирательно связывает FXIIa-β по сравнению с FXII, и описана разработка иммуноанализа, который позволяет специфично выявлять FXIIa-β в крови. Из примера 7 в WO9008835 ясно, что антитело не ингибирует амидолитическую активность FXIIa. В WO9117258 описано лечение сепсиса анти-FXII-антителом OT-2, которое связывается с нативным FXII в плазме и ингибирует активацию контактной системы в плазме, а также амидолитическую активность FXIIa.

Целью настоящего изобретения была разработка улучшенного антитела, которое, проявляя высокую ингибирующую активность по отношению к FXIIa, не будет повышать риск кровотечения, не будет иммуногенным и будет иметь длительное время полужизни. Так как FXII имеет мультидоменную структуру, включающую домены типа фибронектина и EGF-подобные домены (обзор в публикации Stavrou and Schmaier (2010) Thromb. Res., 125: 210-215), полагали, что FXII должен обладать дополнительными важными физиологическими функциями в дополнение к его роли в качестве FXIIa, т.е., в качестве фермента после активации. Новые исследования показали, что FXII вносит вклад в пролиферацию и рост клеток, которые приводят к ангиогенезу (обзор в публикации Schmaier and LaRusch (2010) Thromb. Haemost., 104: 915-918). Таким образом, чтобы не мешать указанным (и может быть другим неизвестным до настоящего времени) функциям FXII, терапевтическое антитело против FXII/FXIIa, предпочтительно, должно обладать более высокой аффинностью по отношению к FXIIa, например, по отношению к FXIIa-β, по сравнению с FXII.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Таким образом, один из аспектов изобретения относится к моноклональному антителу против фактора XII/FXIIa или его антигенсвязывающему фрагменту, которые имеют больше чем в 2 раза более высокую аффинность связывания с фактором XIIa-бета, чем с фактором XII человека, и которые способны ингибировать амидолитическую активность фактора XIIa человека. Другой аспект изобретения относится к моноклональному антителу против фактора XII/XIIa или его антигенсвязывающему фрагменту, которые ингибируют фактор XIIa-альфа человека более чем на 50% в случае применения в молярном соотношении FXIIa-альфа к антителу 1:0,2.

Предпочтительно, антитело или его антигенсвязывающий фрагмент обладает одним или несколькими из следующих признаков:

- связывает FXII/FXIIa мыши;

- уровень связывания антитела с полипептидом, содержащим последовательность SEQ ID NO:2 или ее соответствующий фрагмент, где (a) остаток аспарагина в положении 398 последовательности SEQ ID NO:2 заменен лизином; или (b) остаток изолейцина в положении 438 последовательности SEQ ID NO:2 заменен аланином, ниже, чем уровень связывания белка с соответствующим полипептидом, содержащим последовательность SEQ ID NO:2 или ее соответствующий фрагмент без указанной замены;

- содержит вариабельную область тяжелой цепи (vH), которая более чем на 85% идентична последовательности SEQ ID NO:4;

- содержит вариабельную область легкой цепи (vL), которая более чем на 85% идентична последовательности SEQ ID NO:5;

- содержит CDR1 тяжелой цепи, которая по меньшей мере на 80% идентична последовательности SEQ ID NO:6, и/или CDR2 тяжелой цепи, которая по меньшей мере на 60% идентична последовательности SEQ ID NO:7, и/или CDR3 тяжелой цепи, которая по меньшей мере на 80% идентична последовательности SEQ ID NO:9;

- содержит CDR1 легкой цепи, которая по меньшей мере на 50% идентична последовательности SEQ ID NO:11, и/или CDR2 легкой цепи SEQ ID NO:12 и/или CDR3 легкой цепи с последовательностью A-X1-W-X2-X3-X4-X5-R-X6-X7, где X1 может быть A или S, X5 может быть L или V, другие Xn могут представлять собой любую аминокислоту (SEQ ID NO:14);

- связывает фактор XIIa-бета человека с KD лучше чем 10-8 М;

- конкурирует с инфестином, в частности, с инфестином-4, за связывание с фактором XIIa-бета человека;

- является IgG человека или его вариантом, предпочтительно, IgG4 человека или его вариантом.

Другим аспектом изобретения является нуклеиновая кислота, кодирующая антитело или его антигенсвязывающий фрагмент согласно изобретению.

Еще одним аспектом изобретения является вектор, содержащий нуклеиновую кислоту, кодирующую антитело или его антигенсвязывающий фрагмент согласно изобретению, функционально связанную с подходящей промоторной последовательностью.

Следующим аспектом изобретения является клеточная линия или дрожжевая клетка, содержащая вектор согласно изобретению.

Другим аспектом изобретения является способ получения антитела или его антигенсвязывающего фрагмента согласно изобретению, включающий культивирование клеточной линии или дрожжевой клетки согласно изобретению в подходящих условиях, чтобы экспрессировать антитело или его антигенсвязывающий фрагмент, и очистку антитела или его антигенсвязывающего фрагмента из надосадка культуры.

Еще одним аспектом изобретения является антитело или его антигенсвязывающий фрагмент для медицинского применения.

Следующим аспектом изобретения является антитело или его антигенсвязывающий фрагмент для применения с целью профилактики и/или лечения расстройства, выбранного из группы, состоящей из венозного, артериального или капиллярного тромбообразования, тромбообразования в сердце, тромбообразования во время и/или после контакта крови человека или животного с искусственными поверхностями, тромбоэмболии, за счет предотвращения образования и/или стабилизации тромбов и, следовательно, трехмерного внутрилюминального роста тромбов или за счет профилактики и/или лечения внутрилюминальных тромбов; интерстициального заболевания легких, воспаления, неврологического воспалительного заболевания, активации комплемента, фибринолиза, ангиогенеза и заболеваний, связанных с FXII/FXIIa-индуцированным образованием кинина или FXII/FXIIa-опосредованной активацией комплемента. Еще одним аспектом изобретения является антитело или его антигенсвязывающий фрагмент для применения при лечении внутрилюминальных тромбов у человека или животного, связанных с расстройством, выбранным из группы, состоящей из венозного, артериального или капиллярного тромбообразования, тромбообразования в сердце, тромбообразования во время и/или после контакта крови человека или животного с искусственными поверхностями, тромбоэмболии; интерстициального заболевания легких, воспаления, неврологического воспалительного заболевания, активации комплемента, фибринолиза, ангиогенеза и заболеваний, связанных с FXII/FXIIa-индуцированным образованием кинина или FXII/FXIIa-опосредованной активацией комплемента. Предпочтительно, венозным или артериальным тромбообразованием является инсульт, инфаркт миокарда, тромбоз глубоких вен, тромбоз воротной вены, тромбоз почечных вен, тромбоз яремных вен, тромбоз церебральных венозных синусов, синдром Бадда-Киари или болезнь Педжета-Шреттера. Предпочтительно, заболевания, связанные с FXII/FXIIa-индуцированным образованием кинина, выбраны из группы, состоящей из наследственного ангионевротического отека, бактериальных инфекций легких, трипаносомных инфекций, гипотонического шока, панкреатита, болезни Шагаса, суставной подагры, артрита, диссеминированного внутрисосудистого свертывания (DIC) и сепсиса.

Предпочтительно, интерстициальным заболеванием легких является фибропролиферативный и/или идиопатический фиброз легких.

Предпочтительно, тромбообразование происходит во время и/или после контакта крови человека или животного с искусственными поверхностями во время и/или после медицинской процедуры, осуществляемой на указанном человеке или животном, и указанное антитело или его антигенсвязывающий фрагмент вводят до и/или во время и/или после указанной медицинской процедуры и, кроме того,

(i) искусственную поверхность подвергают воздействию по меньшей мере 80% объема крови индивида, и искусственная поверхность имеет площадь по меньшей мере 0,2 м2, или

(ii) искусственная поверхность представляет собой емкость для сбора крови вне организма индивида, или

(iii) искусственная поверхность представляет собой стент, клапан, внутрилюминальный катетер или систему для внутреннего вспомогательного перекачивания крови.

Следующим аспектом изобретения является медицинское устройство, покрытое антителом или его антигенсвязывающим фрагментом согласно изобретению, при этом устройство представляет собой аппарат искусственного кровообращения, систему экстракорпоральной мембранной оксигенации для оксигенации крови, устройство для вспомогательного перекачивания крови, устройство для диализа крови, устройство для экстракорпоральной фильтрации крови, контейнер для применения при сборе крови, внутрилюминальный катетер, стент, искусственный клапан сердца и/или комплектующие любого из указанных устройств, включая трубку, канюлю, центробежный насос, клапан, порт и/или отводящее устройство.

Другой аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения с целью введения пациенту, подвергаемому медицинской процедуре, при этом медицинская процедура включает осуществление контакта по меньшей мере с одной из следующих частей организма:

(a) сердцем;

(b) по меньшей мере одним кровеносным сосудом, выбранным из: аорты, дуги аорты, сонной артерии, коронарной артерии, бранхиоцефальной артерии, вертебробазилярной системы кровообращения, внутричерепных артерий, почечной артерии, артерии печени, брыжеечной артерии и/или кровеносного сосуда артериальной системы, расположенной краниально по отношению к сердцу,

(c) венозным кровеносным сосудом, если пациент имеет известный дефект перегородки;

и при этом медицинская процедура включает высвобождение по меньшей мере одного эмбола, по меньшей мере, в один из указанных кровеносных сосудов в организме, что может приводить к ишемии по меньшей мере в одном органе-мишени, и введение антитела или его антигенсвязывающего фрагмента до, во время и/или после медицинской процедуры.

Другой аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения с целью профилактики или лечения состояния, связанного с повышенной проницаемостью сосудов, в частности, с повышенной проницаемостью сосудов сетчатки, включая прогрессирующую ретинопатию, угрожающее потерей зрения осложнение ретинопатии, макулярный отек, непролиферативную ретинопатию, пролиферативную ретинопатию, отек сетчатки, диабетическую ретинопатию, гипертоническую ретинопатию и травму сетчатки.

Другой аспект изобретения относится к фармацевтической композиции, содержащей антитело или его антигенсвязывающий фрагмент согласно изобретению.

КРАТКОЕ ОПИСАНИЕ ФИГУР

Фигура 1: Конкурентный ELISA анти-FXIIa-фагов с использованием ингибитора амидолитической активности FXIIa инфестина-4. Концентрации конкурирующего агента (rHA-Inf4) показаны на оси X. Фиксированные концентрации экспрессируемого фагом Fab-антитела или инфестина-4 (pTacInf4), используемых в анализе, определяли с помощью ELISA с титрованием фагов.

Фигура 2: Зависимое от концентрации ингибирование амидолитической активности FXIIa человека моноклональным антителом 3F7 в виде полностью человеческого IgG4. Моноклональное антитело против рецептора GCSF человека C1.2 (полностью человеческий IgG4) использовали в качестве негативного контроля и rHA-инфестин в качестве позитивного контроля для анализа.

Фигура 3: Стоп-матрицы тяжелой цепи 3F7, используемые для созревания аффинности. CDR-области заштрихованы серым, и положения аминокислот в каждой библиотеке, которые были рандомизированы, обозначены «x».

Фигура 4: Стоп-матрицы легкой цепи 3F7, используемые для созревания аффинности. CDR-области заштрихованы серым, и положения аминокислот в каждой библиотеке, которые были рандомизированы, обозначены «x».

Фигура 5: Зависимое от концентрации ингибирование амидолитической активности FXIIa человека моноклональными антителами 3F7 и OT-2.

Фигура 6: A: Выравнивание каталитических доменов FXII мыши, крысы и человека и идентификация остатков, которые образуют каталитическую триаду (*), и мутации, введенные (!) для идентификации потенциального эпитопа антитела 3F7. B: Вестерн-блот, показывающий связывание 3F7 с различными мутантами.

Фигура 7: Степень окклюзии при FeCl3-индуцированном тромбозе после обработки мАт 3F7 (n = 5-25/группу).

Фигура 8: Влияние мАт 3F7 на АЧТВ (n = 5-25/группу; среднее ± SD).

Фигура 9: Влияние мАт 3F7 на ПТВ (n = 5-25/группу; среднее ± SD).

Фигура 10: Влияние мАт 3F7 на FXIIa-активность (n = 5-25/группу; среднее + SD).

Фигура 11: Влияние мАт 3F7 на время до гемостаза. Данные представлены в виде средних значений (+SD). Статистика: p > 0,05 (критерий Краскела-Уоллиса). N = 10/группу.

Фигура 12: Влияние мАт 3F7 на общую потерю крови. Данные представлены в виде средних значений (+SD). Статистика: p > 0,05 (критерий Краскела-Уоллиса). N = 10/группу.

Фигура 13: Влияние мАт 3F7 на время до гемостаза. Горизонтальные линии представляют медианные значения. Статистика: p > 0,05 (критерий Краскела-Уоллиса). N = 10/группу.

Фигура 14: Влияние мАт 3F7 на общую потерю крови. Горизонтальные линии представляют медианные значения. Статистика: p > 0,05 (критерий Краскела-Уоллиса). N = 10/группу.

Фигура 15: Сравнение АЧТВ OT-2, мАт 3F7 и вариантов мАт 3F7 с созревшей аффинностью.

Фигура 16: Сравнение ингибирования фактора XIIa-альфа человека разными антителами.

Список последовательностей

SEQ ID NO:1: последовательность FXII человека

SEQ ID NO:2: последовательность FXII мыши

SEQ ID NO:3: последовательность FXII крысы

SEQ ID NO:4: последовательность vH 3F7

SEQ ID NO:5: последовательность vL 3F7

SEQ ID NO:6: CDR1 тяжелой цепи (HCDR1) 3F7

SEQ ID NO:7: CDR2 тяжелой цепи (HCDR2) 3F7

SEQ ID NO:8: CDR2 тяжелой цепи 3F7 с изменением

SEQ ID NO:9: CDR3 тяжелой цепи (HCDR3) 3F7

SEQ ID NO:10: CDR3 тяжелой цепи 3F7 с изменением

SEQ ID NO:11: CDR1 легкой цепи (LCDR1) 3F7

SEQ ID NO:12: CDR2 легкой цепи (LCDR2) 3F7

SEQ ID NO:13: CDR3 легкой цепи (LCDR3) 3F7

SEQ ID NO:14: CDR3 легкой цепи 3F7 с изменением

SEQ ID NO:15: стоп-матрица тяжелой цепи 3F7 H1

SEQ ID NO:16: смесь олигонуклеотидных мутагенных тримеров 3F7 H1

SEQ ID NO:17: стоп-матрица тяжелой цепи 3F7 H2

SEQ ID NO:18: смесь олигонуклеотидных мутагенных тримеров 3F7 H2

SEQ ID NO:19: стоп-матрица тяжелой цепи 3F7 H3.1

SEQ ID NO:20: смесь олигонуклеотидных мутагенных тримеров 3F7 H3.1

SEQ ID NO:21: стоп-матрица тяжелой цепи 3F7 H3.2

SEQ ID NO:22: смесь олигонуклеотидных мутагенных тримеров 3F7 H3.2

SEQ ID NO:23: стоп-матрица легкой цепи 3F7 L1

SEQ ID NO:24: смесь олигонуклеотидных мутагенных тримеров 3F7 L1

SEQ ID NO:25: стоп-матрица легкой цепи 3F7 L3.1

SEQ ID NO:26: смесь олигонуклеотидных мутагенных тримеров 3F7 L3.1

SEQ ID NO:27: стоп-матрица легкой цепи 3F7 L3.2

SEQ ID NO:28: смесь олигонуклеотидных мутагенных тримеров 3F7 L3.2

SEQ ID NO:29: CDR2 тяжелой цепи VR119

SEQ ID NO:30: CDR2 тяжелой цепи VR112

SEQ ID NO:31: CDR2 тяжелой цепи VR115

SEQ ID NO:32: CDR2 тяжелой цепи VR110

SEQ ID NO:33: CDR2 тяжелой цепи VR107

SEQ ID NO:34: CDR2 тяжелой цепи VR108

SEQ ID NO:35: CDR2 тяжелой цепи VR103

SEQ ID NO:36: CDR2 тяжелой цепи VR101

SEQ ID NO:37: CDR2 тяжелой цепи VR109

SEQ ID NO:38: CDR2 тяжелой цепи VR99

SEQ ID NO:39: CDR3 тяжелой цепи VR149

SEQ ID NO:40: CDR3 тяжелой цепи VR167

SEQ ID NO:41: CDR3 тяжелой цепи VR148

SEQ ID NO:42: CDR3 тяжелой цепи VR159

SEQ ID NO:43: CDR3 тяжелой цепи VR160

SEQ ID NO:44: CDR1 легкой цепи VR24

SEQ ID NO:45: CDR1 легкой цепи VR06

SEQ ID NO:46: CDR1 легкой цепи VR16

SEQ ID NO:47: CDR1 легкой цепи VR05

SEQ ID NO:48: CDR1 легкой цепи VR12

SEQ ID NO:49: CDR1 легкой цепи VR10

SEQ ID NO:50: CDR1 легкой цепи VR14

SEQ ID NO:51: CDR1 легкой цепи VR17

SEQ ID NO:52: CDR3 легкой цепи VR31

SEQ ID NO:53: CDR3 легкой цепи VR29

SEQ ID NO:54: CDR3 легкой цепи VR27

SEQ ID NO:55: CDR3 легкой цепи VR39

SEQ ID NO:56: CDR3 легкой цепи VR46

SEQ ID NO:57: CDR3 легкой цепи VR41

SEQ ID NO:58: CDR3 легкой цепи VR38

SEQ ID NO:59: CDR3 легкой цепи VR58

SEQ ID NO:60: CDR3 легкой цепи VR62

SEQ ID NO:61: CDR3 легкой цепи VR53

SEQ ID NO:62: CDR3 легкой цепи VR52

SEQ ID NO:63: CDR3 легкой цепи VR63

SEQ ID NO:64: Праймер для секвенирования CH1 Rev

SEQ ID NO:65: праймер для секвенирования pLacPCRfw

SEQ ID NO:66: праймер для секвенирования wt GIII stump rev

SEQ ID NO:67: праймер для секвенирования KpaCLfwd

SEQ ID NO:68: праймер для секвенирования LdaCLfwd

SEQ ID NO:69: праймер для секвенирования PUCrev

SEQ ID NO:70: праймер для секвенирования 3254

SEQ ID NO:71: праймер для секвенирования Seq CL lambda

SEQ ID NO:72: праймер для секвенирования Seq CH1

SEQ ID NO:73: последовательность vH VR115

SEQ ID NO:74: последовательность vH VR112

SEQ ID NO:75: последовательность vL VR24

SEQ ID NO:76: последовательность vH VR110

SEQ ID NO:77: последовательность vH VR119

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Целью настоящего изобретения была разработка улучшенного антитела, которое, проявляя высокую ингибирующую активность по отношению к FXIIa, не будет повышать риск кровотечения, будет неиммуногенным и будет иметь длительное время полужизни.

Таким образом, один из аспектов изобретения относится к моноклональному антителу против фактора XII/FXIIa или его антигенсвязывающему фрагменту, которое имеет больше чем в 2 раза более высокую аффинность связывания с фактором XIIa человека, предпочтительно, с фактором XIIa-бета человека, чем с фактором XII человека и которое способно полностью ингибировать амидолитическую активность фактора XIIa человека.

Другим аспектом изобретения является антитело или его антигенсвязывающий фрагмент, которое имеет больше чем в 2 раза более высокую аффинность связывания с фактором XIIa человека, предпочтительно, с фактором XIIa-бета человека, чем с фактором XII человека, и которое способно полностью ингибировать амидолитическую активность фактора XIIa человека и которое конкурирует с антителом, содержащим последовательности SEQ ID NO:4 и 75, экспрессированные в виде IgG4, за связывание с FXII/FXIIa.

Предпочтительно, антитело или его антигенсвязывающий фрагмент имеет больше чем в 3 раза, более предпочтительно, больше чем в 4 раза, еще более предпочтительно, больше чем в 5 раз, больше чем в 6 раз, больше чем в 8 раз, больше чем в 10 раз, больше чем в 12 раз, больше чем в 14 раз, больше чем в 16 раз, наиболее предпочтительно, больше чем в 18 раз более высокую аффинность связывания с фактором XIIa человека, предпочтительно, с фактором XIIa-бета человека, чем с фактором XII человека.

Предпочтительно, антитело или его антигенсвязывающий фрагмент полностью ингибирует амидолитическую активность FXIIa в концентрации меньше 100 нМ, более предпочтительно, меньше 50 нМ, еще более предпочтительно, меньше 40 нМ или даже меньше 30 нМ. Предпочтительно, антитело или его антигенсвязывающий фрагмент полностью ингибирует в концентрации от 1 пМ до 100 нМ, более предпочтительно, в концентрации от 5 пМ до 50 нМ. Предпочтительно, анализ амидолитической активности FXIIa осуществляют, как описано в примере 1(5).

Другой аспект изобретения относится к моноклональному антителу против фактора XII/FXIIa или его антигенсвязывающему фрагменту, которое ингибирует фактор XIIa-альфа, предпочтительно, фактор XIIa-альфа человека, более чем на 40%, предпочтительно, более чем на 50%, еще более предпочтительно, более чем на 60% при использовании в молярном соотношении FXIIa-альфа к антителу 1:0,2. Альтернативно, антитело или его антигенсвязывающий фрагмент ингибирует фактор XIIa-альфа, предпочтительно, фактор XIIa-альфа человека, более чем на 80%, предпочтительно, более чем на 85%, более предпочтительно, более чем на 90% в случае молярного соотношения FXIIa-альфа к антителу 1:0,5; наиболее предпочтительно, антитело или его антигенсвязывающий фрагмент осуществляет полное ингибирование FXIIa-альфа в случае молярного соотношения 1:0,5. Предпочтительно, антитело или его антигенсвязывающий фрагмент имеет аффинность по отношению к FXIIa человека, которая, по меньшей мере, сравнима с аффинностью антитела 3F7, раскрытого в настоящем описании.

Предпочтительно, антитело или его антигенсвязывающий фрагмент связывает FXII/FXIIa мыши; более предпочтительно, уровень связывания антитела с полипептидом, содержащим последовательность SEQ ID NO:2 или ее соответствующий фрагмент, где (a) остаток аспарагина в положении 398 последовательности SEQ ID NO:2 заменен лизином; или (b) остаток изолейцина в положении 438 последовательности SEQ ID NO:2 заменен аланином, ниже, чем уровень связывания белка с соответствующим полипептидом, содержащим последовательность SEQ ID NO:2 или ее соответствующий фрагмент без указанной замены. Соответствующий фрагмент полипептида SEQ ID NO:2 содержит каталитический центр; примерами являются легкая цепь, FXIIa-бета, FXIIa-альфа или полный FXII.

Предпочтительно, антитело или его антигенсвязывающий фрагмент содержит вариабельную область тяжелой цепи (vH), которая больше чем на 85% идентична последовательности SEQ ID NO:4, более предпочтительно, больше чем на 88%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, еще более предпочтительно, на 98% или даже на 99% идентична последовательности SEQ ID NO:4. Предпочтительными вариантами осуществления изобретения являются антитела или их антигенсвязывающие фрагменты, содержащие вариабельную область тяжелой цепи с последовательностью SEQ ID NO:4, 73, 74, 76 или 77.

Предпочтительно, антитело или его антигенсвязывающий фрагмент содержит вариабельную область легкой цепи (vL), которая больше чем на 85% идентична последовательности SEQ ID NO:5, более предпочтительно, больше чем на 88%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, еще более предпочтительно, на 98% или даже на 99% идентична последовательности SEQ ID NO:5. Предпочтительными вариантами осуществления изобретения являются антитела или их антигенсвязывающие фрагменты, содержащие вариабельную область легкой цепи с последовательностью SEQ ID NO:5 или 75.

Предпочтительными вариантами осуществления изобретения являются антитела или их антигенсвязывающие фрагменты с областью vH, описанной выше, в сочетании с областью vL, которая описана выше. Наиболее предпочтительными являются антитела со следующими сочетаниями vH/vL:

(a) область vH SEQ ID NO:4 в сочетании с областью vL SEQ ID NO:5 или SEQ ID NO:75;

(b) область vH с любой из последовательностей SEQ ID NO:4, 73, 74, 76 или 77 в сочетании с областью vL SEQ ID NO:5.

Предпочтительно, антитела или их антигенсвязывающие фрагменты содержат CDR1 тяжелой цепи, которая по меньшей мере на 80% идентична последовательности SEQ ID NO:6, предпочтительно, CDR1 тяжелой цепи SEQ ID NO:6 и/или CDR2 тяжелой цепи, которая по меньшей мере на 60% идентична последовательности SEQ ID NO:7 и/или CDR3 тяжелой цепи, которая по меньшей мере на 80% идентична последовательности SEQ ID NO:9. Более предпочтительно, CDR2 тяжелой цепи имеет последовательность GIX1X2X3X4X5X6TVYADSVKG (см. SEQ ID NO:8), где X1 означает R, N или D, X2 означает P, V, I или M, X3 означает S, P или A, X4 означает G, L, V или T, X5 может быть любой аминокислотой, предпочтительно, X5 означает G, Y, Q, K, R, N или M, и X6 означает T, G или S, и/или CDR3 тяжелой цепи имеет последовательность ALPRSGYLX1X2X3X4YYYYALDV (см. SEQ ID NO:10), где X1 означает I, M или V, X2 означает S или K, X3 означает P, K, T или H, и X4 означает H, N, G или Q. Предпочтительно, антитела или их антигенсвязывающие фрагменты содержат CDR1 легкой цепи, которая по меньшей мере на 50% идентична последовательности SEQ ID NO:11, и/или CDR2 легкой цепи SEQ ID NO:12, и/или CDR3 легкой цепи с последовательностью AX1WX2X3X4X5RX6X7 (показанной в SEQ ID NO:14), где X1 означает A или S, X5 означает L или V, X6 означает G, L или K, и X2, X3, X4 и X7 могут быть любой аминокислотой, предпочтительно, X2 означает D, Y, E, T, W, E или S, X3 означает A, N, I, L, V, P, Q или E, X4 означает S, D, P, E, Q или R, и X7 означает V, A, D, T, M или G.

Предпочтительными вариантами осуществления изобретения являются антитела или их антигенсвязывающие фрагменты с CDR тяжелой цепи, описанными выше, в сочетании с CDR легкой цепи, которые описаны выше.

Более предпочтительно, антитела или их антигенсвязывающие фрагменты содержат сочетания CDR тяжелой цепи (HCDR) и CDR легкой цепи (LCDR), показанные в таблице 1, где цифры в колонках под HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 и LCDR3 указывают соответствующие номера последовательностей SEQ ID NO:

мАт HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3
6 8 10 11 12 14
3F7 6 7 9 11 12 13
VR119 6 29 9 11 12 13
VR112 6 30 9 11 12 13
VR115 6 31 9 11 12 13
VR24 6 7 9 44 12 13
VR110 6 32 9 11 12 13
VR107 6 33 9 11 12 13
VR06 6 7 9 45 12 13
VR31 6 7 9 11 12 52
VR108 6 34 9 11 12 13
VR103 6 35 9 11 12 13
VR101 6 36 9 11 12 13
VR16 6 7 9 46 12 13
VR29 6 7 9 11 12 53
VR05 6 7 9 47 12 13
VR12 6 7 9 48 12 13
VR27 6 7 9 11 12 54
VR10 6 7 9 49 12 13
VR149 6 7 39 11 12 13
VR58 6 7 9 11 12 59
VR39 6 7 9 11 12 55
VR167 6 7 40 11 12 13
VR62 6 7 9 11 12 60
VR109 6 37 9 11 12 13
VR14 6 7 9 50 12 13
VR46 6 7 9 11 12 56
VR148 6 7 41 11 12 13
VR159 6 7 42 11 12 13
VR53 6 7 9 11 12 61
VR52 6 7 9 11 12 62
VR160 6 7 43 11 12 13
VR17 6 7 9 51 12 13
VR63 6 7 9 11 12 63
VR41 6 7 9 11 12 57
VR99 6 38 9 11 12 13
VR38 6 7 9 11 12 58

Предпочтительно, антитело или его антигенсвязывающие фрагменты согласно изобретению связывают фактор XIIa-бета человека с KD лучше чем 10-7 М, более предпочтительно, лучше чем 3×10-8 М, более предпочтительно, лучше чем 10-8 М, еще более предпочтительно, лучше чем 3×10-9 М, наиболее предпочтительно, 10-9 M или даже 5×10-10 М.

Предпочтительно, антитело или его антигенсвязывающий фрагмент согласно изобретению конкурирует с инфестином, предпочтительно, с инфестином-4, за связывание с фактором XIIa-бета человека.

Антитело или его антигенсвязывающий фрагмент может быть любого изотипа, включая IgG, IgM, IgE, IgD или IgA, и любого подтипа. Предпочтительно, антитело или его антигенсвязывающий фрагмент согласно изобретению представляет собой IgG человека или его вариант, предпочтительно, IgG4 человека или его вариант. Способы переключения типа антитела хорошо известны в данной области. Молекулу нуклеиновой кислоты, кодирующую область VH или VL, выделяют и функционально связывают с последовательностью нуклеиновой кислоты, кодирующей другие CH или CL, соответственно, из константной области другого класса молекулы иммуноглобулина.

Настоящее изобретение охватывает белки и/или антитела, раскрытые в настоящем описании, содержащие константную область антитела. Они содержат антигенсвязывающие фрагменты антитела, слитые с Fc.

Последовательности константных областей, используемые для получения белков согласно настоящему изобретению, могут быть получены из нескольких разных источников. В некоторых примерах константную область или часть константной области белка получают из антитела человека. Константная область или ее часть могут быть получены из любого класса антитела, включая IgM, IgG, IgD, IgA и IgE, и любого изотипа антитела, включая IgG1, IgG2, IgG3 и IgG4. В одном из примеров константная область представляет собой константную область изотипа IgG4 человека или стабилизированную константную область IgG4.

В одном из примеров Fc-область константной области имеет пониженную способность индуцировать эффекторную функцию, например, по сравнению с нативной Fc-областью или Fc-областью дикого типа IgG1 или IgG3 человека. В одном примере эффекторной функцией является зависимая от антител опосредованная клетками цитотоксичность (ADCC) и/или зависимый от антител опосредованный клетками фагоцитоз (ADCP) и/или зависимая от комплемента цитотоксичность (CDC). Способы оценки уровня эффекторной функции белка, содержащего Fc-область, хорошо известны в данной области.

В одном из примеров Fc-область является Fc-областью IgG4 (т.е., из константной области IgG4), например, Fc-областью IgG4 человека. Последовательности подходящих Fc-областей IgG4 будут очевидны для специалиста и/или их можно найти в общедоступных базах данных (например, доступны из National Center for Biotechnology Information).

В одном из примеров константная область является стабилизированной константной областью IgG4. Следует понимать, что термин «стабилизированная константная область IgG4» означает константную область IgG4, которая была модифицирована так, чтобы уменьшить обмен плеч Fab или склонность подвергаться обмену плеч Fab или образование половинных антител или склонность к образованию половинного антитела. «Обмен плеч Fab» относится к типу модификации белка IgG4 человека, при которой тяжелая цепь IgG4 и связанная легкая цепь (половинная молекула) заменяется парой легкая-тяжелая цепь из другой молекулы IgG4. Таким образом, молекулы IgG4 могут приобретать два отдельных плеча Fab, распознающие два разных антигена (что в результате приводит к образованию биспецифичных молекул). Обмен плеч Fab происходит в природе in vivo и может быть индуцирован in vitro очищенными клетками крови или восстановителями, такими как глутатион. «Половинное антитело» образуется, когда IgG4-антитело диссоциирует с образованием двух молекул, каждая из которых содержит одну тяжелую цепь и одну легкую цепь.

В одном из примеров стабилизированная константная область IgG4 содержит пролин в положении 241 шарнирной области согласно системе Kabat (Kabat et al., Sequences of Proteins of Immunological Interest Washington DC United States Department of Health and Human Services, 1987 and/or 1991). Такое положение соответствует положению 228 шарнирной области согласно системе нумерации EU (Kabat et al., Sequences of Proteins of Immunological Interest Washington DC United States Department of Health and Human Services, 2001 and Edelman et al., Proc. Natl. Acad. Sci USA, 63, 78-85, 1969). В IgG4 человека таким остатком обычно является серин. После замены серина пролином шарнирная область IgG4 содержит последовательность CPPC. В этой связи специалисту будет понятно, что «шарнирная область» является богатой пролином частью константной области тяжелой цепи антитела, которая связывает области Fc и Fab, которая придает подвижность двум Fab-плечам антитела. Шарнирная область содержит остатки цистеина, которые вовлечены в образование дисульфидных связей между тяжелыми цепями. Ее обычно определяют как участок от Glu226 до Pro243 IgG1 человека согласно системе нумерации Kabat. Шарнирные области других изотипов IgG можно выравнивать с последовательностью IgG1, помещая первый и последний остатки цистеинов, образующих дисульфидные (S-S) связи между тяжелыми цепями, в одних и тех же положениях (см., например, WO2010/080538).

Дополнительными примерами стабилизированных IgG4-антител являются антитела, в которых аргинин в положении 409 в константной области тяжелой цепи IgG4 человека (согласно системе нумерации EU) заменен лизином, треонином, метионином или лейцином (например, как описано в WO2006/033386). Fc-область константной области может дополнительно или альтернативно содержать остаток, выбранный из группы, состоящей из: аланина, валина, глицина, изолейцина и лейцина в положении, соответствующем 405 (согласно системе нумерации EU). Необязательно, шарнирная область содержит пролин в положении 241 (т.е., последовательность CPPC) (как описано выше).

В другом примере Fc-область представляет собой область, модифицированную так, чтобы она обладала пониженной эффекторной функцией, т.е. «не иммуностимулирующая Fc-область». Например, Fc-область представляет собой Fc-область IgG1, содержащую замену в одном или нескольких положениях, выбранных из группы, состоящей из положений 268, 309, 330 и 331. В другом примере Fc-область представляет собой Fc-область IgG1, содержащую одно или несколько из следующих изменений E233P, L234V, L235A и делецию G236 и/или одно или несколько из следующих изменений A327G, A330S и P331S {Armour et al., Eur. J. Immunol. 29: 2613-2624, 1999; Shields et al., J. Biol. Chem. 276(9): 6591-604, 2001). Дополнительные примеры не иммуностимулирующих Fc-областей описаны, например, в Dall'Acqua et al., J Immunol. 177: 1129-1138, 2006; и/или Hezareh J Virol ;75: 12161-12168, 2001).

В другом примере Fc-область представляет собой химерную Fc-область, например, содержащую по меньшей мере один домен CH2 из IgG4-антитела и по меньшей мере один домен CH3 из IgG1-антитела, при этом Fc-область содержит замену в одном или нескольких положениях аминокислот, выбранных из группы, состоящей из положений 240, 262, 264, 266, 297, 299, 307, 309, 323, 399, 409 и 427 (нумерация EU) (например, как описано в WO2010/085682). Примеры замен включают 240F, 262L, 264T, 266F, 297Q, 299A, 299K, 307P, 309K, 309M, 309P, 323F, 399S и 427F.

Настоящее изобретение также предполагает дополнительные модификации антитела.

Например, антитело содержит одну или несколько аминокислотных замен, которые увеличивают время полужизни белка. Например, антитело содержит Fc-область, содержащую одну или несколько аминокислотных замен, которые повышают аффинность Fc-области по отношению к неонатальному рецептору Fc-области (FcRn). Например, Fc-область имеет повышенную аффинность по отношению к FcRn при более низком pH, например, приблизительно pH 6,0, чтобы облегчить связывание Fc/FcRn в эндосоме. В одном примере, Fc-область имеет повышенную аффинность по отношению к FcRn при значении pH, примерно равном 6, по сравнению с ее аффинностью примерно при pH 7,4, что способствует повторному высвобождению Fc (и, следовательно, молекул, содержащих Fc-область) в кровь после клеточного рециклинга. Такие аминокислотные замены применимы для удлинения времени полужизни белка благодаря снижению клиренса из крови.

Примеры аминокислотных замен включают T250Q и/или M428L или T252A, T254S и T266F или M252Y, S254T и T256E или H433K и N434F согласно системе нумерации EU. Дополнительные или альтернативные аминокислотные замены описаны, например, в US20070135620 или US7083784.

Более предпочтительно, антитело согласно изобретению представляет собой IgG1 человека или IgG4 человека, сконструированный для получения усиленного связывания с неонатальным Fc-рецептором человека FcRn при более низком pH, например, pH 6, что приводит к повышению времени полужизни антитела в сыворотке человека. Способы скрининга оптимальных вариантов Fc для оптимизации связывания FcRn были описаны (например, Zalevsky et al. (2010), Nature Biotech. 28, 157-159).

Другие предпочтительные антитела или их антигенсвязывающие фрагменты согласно изобретению содержат константные области иммуноглобулинов млекопитающих, такие как константные области изотипов иммуноглобулинов млекопитающих, таких как IgG, IgM, IgE, IgD или IgA и любой их подтип. Предпочтительно, антитело представляет собой IgG млекопитающего, включая IgG мыши, IgG свиньи, IgG коровы, IgG лошади, IgG кошки, IgG собаки и IgG примата или их варианты. Такие антитела могут быть химерными антителами, при этом вариабельные области человека согласно изобретению объединяют с константной областью иммуноглобулина выбранного вида. Альтернативно антитело или его антигенсвязывающие фрагменты могут быть получены в результате прививания CDR-областей человека, описанных в настоящей публикации, в каркасные остатки из иммуноглобулина выбранного вида.

Предпочтительно, антитела или их антигенсвязывающие фрагменты согласно изобретению находятся в своей зрелой форме, т.е., без сигнального пептида; однако антитела или их антигенсвязывающие фрагменты, содержащие сигнальные пептиды, также включены в изобретение.

Антигенсвязывающим фрагментом может быть любой фрагмент антитела согласно изобретению, который сохраняет способность связывать FXIIa. Предпочтительными антигенсвязывающими фрагментами являются Fab-фрагмент, Fab’-фрагмент, F(ab’)2-фрагмент, Fv-фрагмент, одноцепочечное антитело, одноцепочечный Fv-фрагмент, стабилизированный дисульфидом белок Fv или димер одноцепочечного Fv-фрагмента. Антителами, также включенными в изобретение, являются химерное антитело, гуманизированное антитело, муринизированное антитело или биспецифичное антитело. Способы получения таких фрагментов и антител хорошо известны в данной области (см., например, Harlow and Lane: Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, 1988).

Также в изобретение включен слитый белок или фаговая частица, содержащая антигенсвязывающий фрагмент антитела согласно изобретению. Антигенсвязывающий фрагмент может быть, например, слит с сывороточным альбумином человека или его вариантом. Специалисту будут хорошо известны другие белки, которые могут быть использованы в качестве партнеров для слияния с антигенсвязывающими фрагментами. Антитело или его антигенсвязывающий фрагмент также могут быть слиты с меткой, такой как гекса-гистидиновая метка. Метка может быть вместе с расщепляемым линкерным пептидом, так чтобы при необходимости ее можно было удалить от антитела или его антигенсвязывающего фрагмента.

Другой аспект изобретения относится к нуклеиновой кислоте, кодирующей антитело или его антигенсвязывающий фрагмент согласно изобретению. Предпочтительно, нуклеиновая кислота также содержит область, кодирующую сигнальный пептид, предпочтительно, нуклеиновая кислота содержит область, кодирующую сигнальный пептид для тяжелой цепи, и область, кодирующую сигнальный пептид для легкой цепи.

Молекулы нуклеиновых кислот, кодирующие полипептиды, предлагаемые в изобретении, легко могут быть получены специалистом с использованием предложенных аминокислотных последовательностей, генетического кода и последовательностей, доступных в открытых базах данных. Кроме того, легко можно получить множество функционально эквивалентных нуклеиновых кислот, и поэтому такие нуклеиновые кислоты также включены в настоящее изобретение. Молекулы нуклеиновых кислот могут быть получены любым подходящим способом, например, прямым химическим синтезом. Способы получения ДНК хорошо известны в данной области.

Еще один аспект изобретения относится к вектору, содержащему нуклеиновую кислоту, кодирующую антитело или его антигенсвязывающий фрагмент согласно изобретению, функционально связанную с подходящей промоторной последовательностью или включенную в подходящую кассету экспрессии, которая может содержать дополнительные регуляторные элементы, такие как энхансерные элементы, чтобы повысить уровни экспрессии. Предпочтительно, используют сильный промотор. Для экспрессии в E. coli можно использовать такой промотор, как промоторы T7, lac, trp или лямбда, предпочтительно, вместе с участком связывания с рибосомой и сигналом терминации транскрипции. В случае клеток млекопитающих можно использовать промоторы SV40, CMV или иммуноглобулина, чтобы получить высокие уровни экспрессии. Предпочтительно, вектор представляет собой вектор экспрессии клеток млекопитающих, более предпочтительно, вектор, выбранный из систем Lonza GS SystemTM или Selexis Genetic ElementsTM. Предпочтительно, вектор также содержит последовательность селектируемого маркера, такого как гены gpt, neo, amp или hyg, и систему амплификации генов, таких как глутаминсинтетаза или DHFR. Другой предпочтительный вектор представляет дрожжевой вектор экспрессии, например, вектор экспрессии, оптимизированный для Pichia pastoris. Вектор также может быть вирусным вектором, например, вектором, основанным на вирусе осповакцины, аденовирусе или ретровирусе. Вектором также может быть бакуловирус для экспрессии в клетках насекомых.

Следующий аспект изобретения относится к клеточной линии или дрожжевой клетке, содержащей вектор согласно изобретению. Предпочтительно, клеточная линия является линией клеток млекопитающих, такой как линии клеток CHO, HEK293, MDCK, COS, HeLa или линии клеток миеломы, такие как NSO. Другим вариантом является линия клеток насекомых для применения с бакуловирусом, такая как клетки SF9, клетки SF21 или клетки HighFiveTM. Еще одной клеткой является дрожжевая клетка, такая как Saccharomyces, например, S. cerevisiae, или Pichia pistoris. Также возможны бактериальные клетки-хозяева, такие как E. coli. Способы введения ДНК в соответствующие клетки-хозяева хорошо известны в данной области. Например, когда клеткой-хозяином является линия клеток млекопитающих, можно использовать такие способы, как липофекция или электропорация.

Другим аспектом изобретения является способ получения антитела или его антигенсвязывающего фрагмента согласно изобретению, включающий культивирование клеток-хозяев, таких как линия клеток или дрожжевая клетка, согласно изобретению в подходящих условиях для экспрессии антитела или его антигенсвязывающего фрагмента. Затем антитело или его антигенсвязывающий фрагмент могут быть очищены. Предпочтительно, антитело или его антигенсвязывающий фрагмент секретируются клеткой-хозяином и затем может быть легко очищен из надосадка культуры. Способы очистки антител хорошо известны в данной области и включают такие способы, как преципитация сульфатом аммония, эксклюзионная хроматография по размеру, аффинная хроматография, ионообменная хроматография и другие.

При экспрессии в E. coli антитела или их антигенсвязывающие фрагменты могут быть получены в тельцах включения. Способы выделения телец включения и рефолдинга экспрессированного белка хорошо известны в данной области.

Еще один аспект изобретения относится к антителу или его антигенсвязывающему фрагменту согласно изобретению для медицинского применения.

Следующий аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения с целью профилактики образования и/или стабилизации тромбов у человека или животного. Трехмерный внутрилюминальный рост тромбов снижается или даже предотвращается. Таким образом, данный аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения при лечении или профилактике расстройства, выбранного из группы, состоящей из венозного, артериального или капиллярного тромбообразования, тромбообразования в сердце, тромбообразования во время и/или после контакта крови человека или животного с искусственными поверхностями и тромбоэмболии за счет предотвращения и/или лечения образования и/или стабилизации тромбов и, тем самым, трехмерного внутрилюминального роста тромбов. Еще один аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения при лечении внутрилюминальных тромбов у человека или животного, связанных с расстройством, выбранным из группы, состоящей из венозного, артериального или капиллярного тромбообразования, тромбообразования в сердце, тромбообразования во время и/или после контакта крови человека или животного с искусственными поверхностями, или тромбоэмболией. Предпочтительно, венозным или артериальным тромбообразованием является инсульт, инфаркт миокарда, тромбоз глубоких вен, тромбоз воротной вены, тромоэмболия, тромбоз почечных вен, тромбоз яремных вен, тромбоз церебральных венозных синусов, синдром Бадда-Киари или болезнь Педжета-Шреттера.

Следующий аспект согласно изобретению относится к антителу или его антигенсвязывающему фрагменту для применения с целью профилактики и/или лечения воспаления, неврологического воспалительного заболевания, интерстициального заболевания легких, активации комплемента, фибринолиза, ангиогенеза и заболеваний, связанных с FXII/FXIIa-индуцированным образованием кинина или FXII/FXIIa-опосредованной активацией комплемента. Предпочтительно, заболевания, связанные с FXII/FXIIa-индуцированным образованием кинина, выбраны из группы, состоящей из наследственного ангионевротического отека, бактериальных инфекций легких, трипаносомных инфекций, гипотонического шока, панкреатита, болезни Шагаса, суставной подагры, артрита, диссеминированного внутрисосудистого свертывания (DIC) и сепсиса.

Предпочтительно, интерстициальным заболеванием легких является фибропролиферативный и/или идиопатический фиброз легких.

Аспект изобретения также относится к способу лечения любого из состояний или заболеваний, указанных выше, у индивида путем введения индивиду, нуждающемуся в таком введении, терапевтически эффективного количества антитела или его антигенсвязывающего фрагмента.

Полезное действие антитела или его антигенсвязывающего фрагмента в разных условиях можно подтвердить, например, используя подходящую животную модель, например, мышиную модель. Сравнивая животных, которых лечили антителом или его антигенсвязывающим фрагментом, и контрольную группу, можно продемонстрировать полезный эффект лечения соответствующего заболевания антителом. Альтернативно, можно тестировать образцы плазмы пациента в отношении соответствующих параметров. Например, полезный эффект при лечении или профилактике связанных с заболеванием симптомов у пациентов с наследственной ангионевротическим отеком можно тестировать, используя мышиную модель, например, как описано в публикации Han et al. (2002) J. Clin. Invest. 109: 1057-1063. Также может быть предусмотрен тест in vitro с использованием образцов плазмы пациентов; образцы плазмы подвергаемых лечению и не подвергаемых лечению пациентов можно сравнивать в отношении уровней брадикинина и/или высокомолекулярного кининогена. Антитело должно снижать генерацию брадикинина и/или предотвращать снижение уровня высокомолекулярного кининогена.

Предпочтительно, образование тромба происходит во время и/или после контакта крови человека или животного с искусственными поверхностями во время и/или после медицинской процедуры, осуществляемой на указанном человеке или животном, и указанное антитело или его антигенсвязывающий фрагмент вводят до и/или во время и/или после указанной медицинской процедуры и, кроме того, при этом

(i) искусственную поверхность подвергают воздействию по меньшей мере 80% объема крови индивида и искусственная поверхность имеет площадь по меньшей мере 0,2 м2, или

(ii) искусственная поверхность представляет собой емкость для сбора крови вне организма индивида, или

(iii) искусственная поверхность представляет собой стент, клапан, внутрилюминальный катетер или систему для внутреннего вспомогательного перекачивания крови.

Предпочтительно, риск кровотечения у указанного человека или животного

(i) не повышается; и/или

(ii) его определяют

a) по времени кровотечения из кончика уха или пальца по Дьюку, и при этом указанное время кровотечения из кончика уха или пальца составляет не более чем 10 минут, или

b) согласно способу Айви, и при этом время кровотечения составляет не более чем 10 минут, или

c) согласно способу Маркса, и время кровотечение составляет не более 4 минут.

Медицинской процедурой может быть

i) любая процедура, требующая искусственного кровообращения, или

ii) оксигенация крови посредством экстракорпоральной мембранной оксигенации, или

iii) внутреннее вспомогательное перекачивание крови, или

iv) диализ крови, или

v) экстракорпоральная фильтрация крови, или

vi) сбор крови в любую емкость для последующего использования на животных или человеке, или

vii) использование внутрилюминального катетера(ов), или

viii) использование стента(ов), или

ix) применение искусственного клапана(ов) сердца.

Антитело или его антигенсвязывающий фрагмент согласно изобретению можно вводить до, после и/или во время медицинской процедуры, требующей искусственного кровообращения, или медицинской процедуры, включающей сбор крови в любую емкость для последующего применения на животном или человеке. Его также можно вводить в виде покрытия на искусственной поверхности. Когда медицинская процедура включает донорство крови, антитело или его антигенсвязывающий фрагмент можно:

i) вводить донору крови до и/или во время сдачи крови, или

ii) смешивать с кровью в емкости для сбора, или

iii) вводить реципиенту крови до, во время и/или после введения крови реципиенту, человеку или животному.

Предпочтительно, количество гепарина или его производных и/или гирудина или его производных, которое добавляют дополнительно к антителу или его антигенсвязывающему фрагменту до и/или во время и/или после медицинской процедуры, снижают или даже полностью исключают, по сравнению с количеством гепарина или его производных и/или гирудина или его производных, которое обычно вводят до и/или во время указанной медицинской процедуры, когда не вводят указанное анти-FXII/FXIIa-антитело или его антигенсвязывающий фрагмент.

Предпочтительно, риск развития протромботического состояния вследствие послеоперационного антагонизма гепарина или его производных и/или послеоперационного антагонизма гирудина или его производных предотвращается или снижается; риск протромботического состояния также может быть вызван введением протамина.

Следующий аспект изобретения относится к антителу или его антигенсвязывающему фрагменту согласно изобретению для профилактики или лечения синдрома «pump head» (когнитивного нарушения после искусственного кровообращения).

Следующий аспект изобретения относится к медицинскому устройству, покрытому антителом или его антигенсвязывающим фрагментом согласно изобретению, при этом устройство представляет собой аппарат искусственного кровообращения, систему экстракорпоральной мембранной оксигенации для оксигенации крови, устройство для вспомогательного перекачивания крови, устройство для диализа крови, устройство для экстракорпоральной фильтрации крови, контейнер для применения при сборе крови, внутрилюминальный катетер, стент, искусственный клапан сердца и/или комплектующие любого из указанных устройств, включая трубку, канюлю, центробежный насос, клапан, порт и/или отводящее устройство.

Другой аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения с целью введения пациенту, подвергаемому медицинской процедуре, при этом медицинская процедура включает контакт, по меньшей мере, с одной из следующих частей организма:

(a) сердцем,

(b) по меньшей мере одним кровеносным сосудом, выбранным из: аорты, дуги аорты, сонной артерии, коронарной артерии, бранхиоцефальной артерии, вертебробазилярной системы кровообращения, внутричерепных артерий, почечной артерии, артерии печени, брыжеечной артерии и/или кровеносного сосуда артериальной системы, расположенной краниально по отношению к сердцу,

(c) венозным кровеносным сосудом, если пациент имеет известный дефект перегородки;

и при этом медицинская процедура включает высвобождение по меньшей мере одного эмбола, по меньшей мере в один из указанных кровеносных сосудов в организме, что может приводить к ишемии, по меньшей мере, в одном органе-мишени, и введение антитела или его антигенсвязывающего фрагмента до, во время и/или после медицинской процедуры.

Эмбол может состоять из пузырьков, масла, жира, холестерина, коагулированной крови и/или продуктов распада.

Органом-мишенью может быть:

(a) головной мозг, и при этом пациент имеет, имел или для него существует риск:

(i) молчащей ишемии головного мозга или

(ii) инсульта, вызванного веществом, которое не подвергается тромболизу; и/или

(b) сердце, почка, печень и/или орган желудочно-кишечного тракта.

Предпочтительно, медицинская процедура включает контакт с внутренней стороной или зажим, по меньшей мере, одного или нескольких из указанных кровеносных сосудов.

Предпочтительно, медицинская процедура является процедурой, проводимой на сосудах, которая включает использование любого одного или нескольких из следующих устройств: катетера, стента, баллона, трансплантата, и/или введение контрастного средства. Предпочтительно, медицинская процедура представляет собой операцию на сосудах и/или является процедурой на сосудах, которая является диагностической. Более предпочтительно, медицинская процедура представляет собой коронароангиографию, стентирование сонных артерий, чрезкожное вмешательство в коронарные сосуды, каротидную эндартерэктомию, операцию на сердце и сосудах или расширение стенозированной почечной артерии.

Другой аспект изобретения относится к антителу или его антигенсвязывающему фрагменту для применения при профилактике или лечении состояния, связанного с повышенной проницаемостью сосудов, в частности, с повышенной проницаемостью сосудов сетчатки, включая прогрессирующую ретинопатию, угрожающее потере зрения осложнение ретинопатии, макулярный отек, непролиферативную ретинопатию, пролиферативную ретинопатию, отек сетчатки, диабетическую ретинопатию, гипертоническую ретинопатию и травму сетчатки.

Другой аспект изобретения относится к фармацевтической композиции, содержащей антитело или его антигенсвязывающий фрагмент согласно изобретению. Антитело или его антигенсвязывающий фрагмент могут быть получены согласно известным способам для получения фармацевтической композиции. Например, антитело или его антигенсвязывающий фрагмент можно смешивать с одним или несколькими фармацевтически приемлемыми носителями, разбавителями или эксципиентами. Например, можно использовать стерильную воду или физиологический раствор соли. Также могут быть включены другие веществ, такие как растворы для за забуферивания pH, средства для снижения вязкости или стабилизаторы.

В данной области известно широкое множество фармацевтически приемлемых эксципиентов и носителей. Такие фармацевтические носители и эксципиенты, а также подходящие фармацевтические препараты в достаточной мере описаны в различных публикациях (см., например, “Pharmaceutical Formulation Development of Peptides and Proteins”, Frokjaer et al., Taylor & Francis (2000) or “Handbook of Pharmaceutical Excipients”, 3rd edition, Kibbe et al., Pharmaceutical Press (2000) A. Gennaro (2000) "Remington: The Science and Practice of Pharmacy", 20th edition, Lippincott, Williams, & Wilkins; Pharmaceutical Dosage Forms and Drug Delivery Systems (1999) H. C. Ansel et al., eds 7th ed., Lippincott, Williams, & Wilkins; and Handbook of Pharmaceutical Excipients (2000) A. H. Kibbe et al., eds., 3rd ed. Amer. Pharmaceutical Assoc). В частности, фармацевтическая композиция, содержащая антитело согласно изобретению, может быть получена в лиофилизированной или стабильной растворимой форме. Полипептид можно лиофилизировать различными способами, известными в данной области. Лиофилизированные препараты перерастворяют перед применением, добавляя один или несколько фармацевтически приемлемых разбавителей, таких как стерильная вода для инъекции или стерильный физиологический раствор соли.

Фармацевтическую композицию согласно изобретению можно вводить в дозах и способами, хорошо известными в данной области. Количество и время введения будет определять лечащий врач или ветеринар так, чтобы достичь требуемых целей. Путь введения может представлять собой любой путь, который позволяет доставлять безопасную и терапевтически эффективную дозу в кровь индивида, который получает лечение. Возможные пути введения включают системные, местные, энтеральные и парентеральные пути, такие как внутривенное, внутриартериальное, подкожное, внутрикожное, внутрибрюшинное, пероральное, трансмукозальное, эпидуральное или интратекальное введение. Предпочтительными путями являются внутривенное или подкожное введение.

Эффективную дозу и путь введения определяют на основании таких факторов, как возраст и масса индивида, и в зависимости от природы и терапевтического диапазона антитела или его антигенсвязывающего фрагмента. Определение дозы осуществляют известными способами, при этом не требуется чрезмерного экспериментирования.

Терапевтически эффективной дозой является доза антитела или его антигенсвязывающего фрагмента согласно изобретению, которая вызывает положительный терапевтический эффект у пациента или индивида, требующего лечения. Терапевтически эффективная доза находится в диапазоне примерно от 0,01 до 50 мг/кг, примерно от 0,01 до 30 мг/кг, примерно от 0,1 до 30 мг/кг, примерно от 0,1 до 10 мг/кг, примерно от 0,1 до 5 мг/кг, примерно от 1 до 5 мг/кг, примерно от 0,1 до 2 мг/кг или примерно от 0,1 до 1 мг/кг. Лечение может включать прием одной дозы или множества доз. Если требуются многократные дозы, то их можно вводить ежедневно, через день, еженедельно, раз в две недели, ежемесячно или раз в два месяца или в случае необходимости. Также можно использовать депонирующий препарат, который медленно и непрерывно высвобождает антитело или его антигенсвязывающий фрагмент. Терапевтически эффективной дозой может быть доза, которая ингибирует FXIIa у индивида по меньшей мере на 50%, предпочтительно, по меньшей мере на 60%, 70%, 80%, 90%, более предпочтительно, по меньшей мере на 95%, 99% или даже 100%.

Следующий аспект изобретения относится к аффинно зрелому антителу или его антигенсвязывающему фрагменту (или его антигенсвязывающим фрагментам), которые описаны выше.

ОПРЕДЕЛЕНИЯ

Если не указано иное, все термины использованы в соответствии с общепринятым использованием.

«Антитело» в его широком смысле означает полипептид, содержащий вариабельную область иммуноглобулина, которая специфично распознает эпитоп на антигене. Антитела обычно состоят из двух идентичных тяжелых цепей и двух идентичных легких цепей, каждая из которых имеет вариабельную область на своем N-конце (области VH и VL). Обычно область VH и VL могут объединяться с образованием антигенсвязывающего участка. Однако также были описаны однодоменные антитела, в которых присутствует и связывается с антигеном только одна вариабельная область.

Обычно антитело содержит две тяжелых и две легких цепи, связанные дисульфидными связями. Существует 5 основных изотипов антител (IgG, IgM, IgE, IgA, IgD), некоторые из которых встречаются в виде мультимеров основной структуры антитела. Изотип определяется по константной области тяжелых цепей. Существует два типа легких цепей, лямбда и каппа.

Термин «антитело» в используемом в настоящем описании смысле включает интактные антитела, а также их варианты и части, которые сохраняют способность к связыванию антигена. Такие части включают фрагменты антител, такие как Fab-фрагменты, F(ab’)2-фрагменты, Fab’-фрагменты, одноцепочечные Fv-фрагменты или стабилизированные дисульфидными связями Fv-фрагменты. Таким образом, термин «антитело или его антигенсвязывающий фрагмент» в настоящем документе является только предупредительным, подразумевается, что термин «антитело» уже охватывает антитело и его антигенсвязывающие фрагменты.

Каждая тяжелая и легкая цепь состоит из вариабельной области и константной области. Вариабельные области содержат каркасные остатки и гипервариабельные области, которые также называют определяющим комплементарность областями или CDR. Протяженность каркасных остатков и CDR определяют согласно системе Kabat; база данных по Kabat доступна в режиме онлайн (Kabat EA, Wu TT, Perry HM, Gottesman KS, Foeller C (1991) Sequences of proteins of immunological interest, 5th edn. U.S. Department of Health and Human services, NIH, Bethesda, MD). CDR-области важны для связывания с эпитопом и поэтому определяют специфичность антитела.

«Моноклональное антитело» представляет собой антитело, продуцируемое одним клоном B-лимфоцитов или клеточной линией, сконструированной для экспрессии одного антитела.

Термин «химерное антитело» означает антитело с вариабельными областями из одного вида, привитыми в константные области из другого вида. «Гуманизированным» антителом является антитело, в котором CDR-области другого вида, например, из моноклонального антитела мыши, привиты в каркас антитела человека. Аналогично «муринизированным» антителом является антитело, в котором CDR-области из другого вида, например, из моноклонального антитела человека, привиты в каркас антитела мыши. Человеческим антителом является антитело, которое полностью получено от человека, т.е. CDR человека в каркасе человека и любая константная область, подходящая для введения человеку.

Антитело, «приведенное к зародышевой линии», представляет собой антитело, в котором соматические мутации, которые вводили изменения в каркасные остатки, обратно изменены к исходной последовательности, присутствующей в геноме.

«Антигенсвязывающий фрагмент» относится к любому фрагменту антитела, который сохраняет способность специфично связывать эпитоп антигена, с которым связывается антитело. Такие фрагменты включают без ограничения фрагмент Fab, F(ab’)2 или одноцепочечный Fv.

«Аффинность связывания» относится к аффинности антитела по отношению к его антигену. Аффинность можно измерять различными способами, например, используя методику, основанную на резонансе поверхностного плазмона (BiaCore).

Термин «эпитоп» означает антигенную детерминанту, которую определяют по остаткам или конкретным химическим структурам на антигене, с которым контактирует антитело.

«Идентичность последовательностей» относится к сходству аминокислотных последовательностей. Получают наилучшее из возможных выравниваний двух последовательностей, и идентичность последовательностей определяют на основании процентного содержания идентичных остатков. Для выравнивания последовательностей имеются стандартные способы, например, алгоритмы Нидлмана-Вунша (J. Mol. Biol. (1970) 48, 443), Смита и Ватермана (Adv. Appl. Math. (1981) 2, 482), Пирсона и Липмана (Proc. Natl. Acad. Sci. USA (1988) 85, 2444) и другие. Подходящая компьютерная программа коммерчески доступна, например, пакет компьютерных программ GCG (Devereux et al. (1984), Nucl. Acids Res. 12, 387), с помощью которых алгоритмы могут быть получены с использованием, например, GAP или BESTFIT с параметрами по умолчанию или их последующих вариантов. Алгоритм Blast, исходно описанный Altschul et al. (J. Mol. Biol. (1990) 215, 403), но дополнительно усовершенствованный так, чтобы он включал выравнивания с пробелами (Blast 2), доступный из разных источников, таких как EBI, NCBI, также дает выравнивания и позволяет вычислять % идентичности между двумя последовательностями.

«Специфичное связывание» относится к связыванию по существу только одного антигена.

«FXII/FXIIa» относится к любому или обоим факторам, фактору XII и активированному фактору XII (FXIIa). Таким образом «ингибитор FXII/FXIIa» включает ингибиторы любого одного или обоих факторов, FXII и FXIIa. Кроме того, анти-FXII/FXIIa-антитела включают антитела, которые связываются и ингибируют любой один или оба фактора, FXII и FXIIa.

«Инфестины» представляют собой класс ингибиторов сериновых протеаз, полученных из средней кишки питающегося кровью насекомого, Triatoma infestans, основного переносчика паразита Trypanosoma cruzi, который, как известно, вызывает болезнь Шагаса (Campos ITN et al., 32 Insect Biochem. Mol. Bio. 991-997, 2002; Campos ITN et al. 577 FEBS Lett. 512-516, 2004). Указанное насекомое использует такие ингибиторы для предотвращения свертывания крови, которую оно поглощает. Ген инфестина кодирует 4 домена, которые дают белок, который может ингибировать разные факторы пути коагуляции. В частности, домен 4 кодирует белок (инфестин-4), который является сильным ингибитором FXIIa. Инфестин-4 был введен мышам без осложнений в виде кровотечений (WO 2008/098720). Инфестин-4 был связан с сывороточным альбумином человека (rHA-инфестин-4).

«Полное ингибирование амидолитической активности FXIIa» означает ингибирование на 80% или больше, предпочтительно, на 90% или больше, более предпочтительно, на 95% или больше активности, наблюдаемой в контрольном эксперименте в отсутствие какого-либо ингибитора. «Активность фактора XIIa» включает активность всех форм фактора XIIa, таких как FXIIa-альфа и FXIIa-бета.

Термины «лечение» или «способ лечения» или «терапия» следует интерпретировать в широком смысле; термины могут включать улучшение любого из связанных с заболеванием симптомов у индивида или пациента или уровня соответствующего биомаркера.

ПРИМЕРЫ

Следующие примеры иллюстрируют некоторые варианты осуществления изобретения, но не предназначены для ограничения изобретения вариантами осуществления, которые приведены в качестве примеров. Применяемые способы основаны на стандартных лабораторных способах, хорошо известных специалисту, и описаны в стандартных лабораторных руководствах.

Цель

Выделение полностью человеческих антител из основанной на Fab библиотеке в фаговом дисплее DYAX, которые способны эффективно ингибировать амидолитическую активность FXIIa человека.

Материалы

rHA-инфестин-4 (ингибитор амидолитической активности FXIIa) получен от доктора Thomas Weimer, Holger Lind, и доктора Stefan Schmidbauer (CSL Behring). FXII, FXIIa и FXIIa-бета человека приобретали из Enzyme Research Laboratories (поставляется Banksia Scientific, Qld, Australia). Хромогенный субстрат S-2303 получен из Chromogenix (поставляется Abacus ALS). Сульфо-NHS-SS-биотин и раствор для субстрата TMB приобретали из Pierce. Ферменты и хелперный фаг M13-KO7 получали из New England Biolabs. Иммунологические планшеты Maxisorp приобретали из Nunc. Стрептавидин на шариках Dynabeads M-280 приобретали из Invitrogen Corp. 96-луночные планшеты Twin tec с ободком приобретали из Eppendorf. ДНК-полимеразу Taq приобретали из Scientifix. ExoSAP-lt поставляется GE Healthcare. Набор для секвенирования с терминаторами BigDye приобретали из Applied Biosystems. Антитело против FXII человека (OT-2) приобретали из Sanquin (Amsterdam, Netherlands).

Пример 1. Селекция на фаговом дисплее

1) Способ пэннинга фагов

Основанную на Fab человека библиотеку в фаговом дисплее (Dyax Corp. Cambridge, MA) использовали для скрининга против биотинилированного FXIIa-бета. Перед инициацией каждого раунда отбора библиотеку антител предварительно инкубировали с 500 мкл 4% молока в PBS в течение 1 часа при комнатной температуре (КТ). Аликвоты объемом 100 мкл шариков со стрептавидином M280 покрывали 3 мкг биотинилированного FXIIa-бета в течение ночи при 4°C, затем 3 раза промывали в PBS/0,05% твин-20 (PBST) и один раз в PBS, используя устройство для обработки магнитных частиц KingFisher (Thermo Fisher Scientific). Шарики собирали, используя сепаратор магнитных частиц (MPS) Dynal (Invitrogen Corp.), ресуспендировали в 1 мл 2% молока в PBS и перемешивали при комнатной температуре в течение 1 часа. Блокированные шарики собирали, используя MPS, и раунд 1 осуществляли, инкубируя 5,5×1012 колониеобразующих единиц (КОЕ) фага с иммобилизованным FXIIa-бета в общем объеме 1 мл при комнатной температуре в течение 20 минут. После инкубации шарики собирали и промывали 10 раз PBST, используя Kingfisher, с последующими 2 промывками PBS вручную. Наконец, шарики ресуспендировали в 500 мкл PBS и были названы продуктов раунда 1 (всего примерно 0,5×108 КОЕ). Затем фаг из продукта раунда 1 амплифицировали, инфицируя 6 мл культуры TG1 половиной (250 мкл) шариков при 37°C в течение 30 минут, при этом встряхивая при 250 об./мин. Один мл инфицированной культуры извлекали и хранили при 4°C, а к остальным 5 мл культуры добавляли 2,5×1010 КОЕ хелперного фага M13KO7 с последующей дополнительной инкубацией при 37°C без встряхивания. Амплификацию завершали добавлением 30 мл среды 2xYT (содержащей 100 г/мл ампициллина и 50 г/мл канамицина) и инкубацией в течение ночи при 30°C. После амплификации бактериальные осадки собирали центрифугированием в течение 30 минут при 4000 об./мин и фаг преципитировали из полученной в результате среды после добавления 1:5 объема раствора NaCl-ПЭГ (20% ПЭГ 8000, 2,5 М NaCl) и инкубации на льду в течение 60 минут. Преципитат ресуспендировали в 1 мл PBS, обломки бактерий удаляли центрифугированием при 8000 об./мин, используя настольную центрифугу, в течение 10 минут и фаг снова преципитировали, как описано выше. Конечный осадок фагов ресуспендировали в общем объеме 1 мл в PBS и титровали с целью использования в качестве исходного материала для следующего раунда селекции. Раунды 2 и 3 осуществляли, как описано для раунда 1. После раунда 3 осуществляли отбор клонов в пилотном масштабе и предварительный анализ связывания FXIIa-бета, используя ELISA.

2) Сбор в пилотном масштабе и ELISA-анализ клонов, полученных в раунде 3 селекции на фаговом дисплее

Предварительный скрининг клонов, полученных на выходе раунда 3, осуществляли, используя ELISA Fab-фагов. Колонии собирали и инокулировали в 120 мкл среды 2xYT, содержащей 2% глюкозы и 100 мкг/мл ампициллина. Колонии встряхивали в течение ночи при 37°C, 250 об./мин (Infors Supershaker), и планшет назвали «базовым планшетом». Такие культуры использовали для инокуляции 100 мкл 2xYT/100 мкг/мкл ампициллина в планшеты с глубокими лунками, и планшеты инкубировали при 37°C, 700 об./мин до OD600 примерно 0,5. Затем добавляли 100 мкл хелперного фага до конечной концентрации 0,5×1010 КОЕ, и планшеты инкубировали без встряхивания в течение 30 минут при 37°C. К спасенным культурам добавляли среду 2xYT (содержащую 100 мкг/мл ампициллина и 100 мкг/мл канамицина), получая конечную концентрацию 25 мкг/мл канамицина, затем осуществляли инкубацию в течение ночи при 30°C со встряхиванием (650 об./мин). Полученные культуры центрифугировали при 600 g в течение 30 минут и надосадки использовали для ELISA фагов.

Для ELISA Fab-фагов, иммунологические планшеты Nunc покрывали в течение ночи при 4°C, используя 100 мкл/лунку раствора FXIIa в концентрации 1 мкг/мл в PBS. Также включали лунки с негативным контролем, покрытые только PBS. Затем лунки блокировали в течение 2 часов при 37°C, используя 200 мкл 5% обезжиренного молока/PBS и 3 раза промывали в PBST. Пятьдесят мкл 1% обезжиренного молока/PBST и 50 мкл надосадка фаговой культуры добавляли в каждую лунку и планшеты инкубировали со встряхиванием при комнатной температуре в течение 2 часов. Затем планшеты 5 раз промывали PBST вручную и в каждую лунку добавляли 100 мкл анти-M13-мАт, разбавленного 1/5000 в 1% молоке/PBST, затем инкубировали в течение 30 минут при комнатной температуре со встряхиванием. Затем планшеты промывали, как описано выше, и в каждую лунку добавляли 100 мкл субстрата TMB и затем планшеты инкубировали в течение 10 минут при комнатной температуре со встряхиванием. Реакцию останавливали добавлением 50 мкл 2 М фосфорной кислоты и регистрировали оптическую плотность при 450 нм на устройстве для считывания микропланшетов (Wallac Victor). Двенадцать клонов выглядели положительными в ELISA на отдельных лунках, и затем были подвергнуты тестированию в конкурентном ELISA.

3) Анализ клонов из 3-его раунда селекции: конкурентный ELISA фагов

Двенадцать клонов, которые, как было обнаружено, взаимодействуют с FXIIa в ELISA Fab-фагов на отдельных лунках, дополнительно тестировали в отношении реактивности по отношению к FXIIa в конкурентном ELISA. Коротко, сначала определяли титры фагов из надосадков культур (смотри предыдущий раздел), используя ELISA с титрованием. Для ELISA с титрованием иммунологические планшеты Nunc покрывали в течение ночи при 4°C с использованием 100 мкл/лунку раствора FXIIa в концентрации 1 мкг/мл в PBS. Также включали лунки с негативным контролем, покрытые только PBS. Затем лунки блокировали в течение 2 часов при 37°C, используя 200 мкл 5% обезжиренного молока/PBS и 3 раза промывали в PBS/0,05% твин 20 (PBST). Пятьдесят мкл надосадков фагов 4-кратно серийно разбавляли в 1% обезжиренном молоке/PBST и добавляли 100 мкл каждого разведения в блокированный планшет. После инкубации в течение 1,5 часов при комнатной температуре со встряхиванием планшеты вручную 5 раз промывали в PBST, и в остальной части протокола ELISA по существу следовали описанию, приведенному в предыдущем разделе. Данные представляли графически, используя компьютерную программу KaleidaGraph с подгонкой к сигмоидальной кривой, и регистрировали значение EC50.

Для конкурентного ELISA 96-луночные иммунологические планшеты Nunc покрывали и блокировали, как описано выше. Концентрации фага фиксировали на уровне, определяемом в ELISA с титрованием, и конкурирующий белок (rHA-инфестин-4) серийно разбавляли. Коротко, готовили 4-кратные серийные разведения конкурирующего белка, имея 100 мкл конкурента в 2-кратной концентрации в исходной лунке (т.е., 200 нМ в случае требуемой концентрации 100 нМ) и по 75 мкл буфера для разбавления (1% обезжиренное молоко/PBST) в остальных лунках и проводя серийное разбавление в результате переноса по 25 мкл конкурента дальше в планшете. В каждую лунку добавляли 75 мкл 2-кратного исходного раствора фага (разбавление, определяемое на основании ELISA с титрованием) и 100 мкл из каждой лунки переносили в покрытый и блокированный планшет, и остальную часть протокола ELISA осуществляли, как описано выше. Фаг, экспрессирующий домен инфестина домен 4 (Inf4) в виде слияния с геном-III, использовали в качестве позитивного контроля в конкурентном ELISA. В случае фаговых клонов, названных 3F7 и 3H4, наблюдали конкуренцию со значениями EC50, эквивалентными значению для контрольного Inf4-фага, и такие клоны были отобраны для дальнейшего анализа (фигура 1). Результаты конкурентного ELISA показывают, что rHA-инфестин-4 способен конкурировать с Fab-фагом 3F7 и 3H4, и наиболее вероятно связывается со сходными областями FXIIa. Все другие фаговые клоны, хотя и способны связываться с FXIIa, не конкурировали с rHA-инфестином-4 (как показано для клона 3G5 на фигуре 1) и, следовательно, вероятно не связываются со сходными областями в каталитическом домене FXIIa.

4) Анализ клона 3F7: Анализ последовательности

Чтобы определить аминокислотные последовательности для Fab-клонов 3F7 и 3H4, получали 5 мл ночных культур, используя для начала 5 мкл культур с «базового планшета», и плазмиды выделяли, используя набор Qiagen miniprep. ДНК Fab-кассеты секвенировали, используя праймеры CH1Rev и pLacPCRfw (таблица 2). Реакции секвенирования и электрофорез осуществляли в центре секвенирования ДНК отделения патологии Мельбурнского университета. Последовательности анализировали, используя SeqMan (Lasergene), и обнаружили, что они на 100% идентичны, следовательно, в результате пэннинга было получено одно антитело (3F7) со способностью конкурировать с инфестином-4 за связывание с FXIIa.

Таблица 2
Праймеры для секвенирования, используемого для характеристики фаговых клонов
Название праймера Последовательность SEQ ID NO
CH1 Rev 5’ GTCCTTGACCAGGCAGCCCAG 3’ 64
pLacPCRfw 5` GTGAGTTAGCTCACTCATTAG 3` 65
wt GIII stump rev 5` TTTTCATCGGCATTTTCGGTC 3` 66
KpaCLfwd 5` CCATCTGATGAGCAGTTGAAATCT 3` 67
LdaCLfwd 5` GTTCCCGCCCTCCTCTGAGGAGCT 3` 68
PUCrev 5’ AGCGGATAACAATTTCACACAGG 3’ 69
3254 5’ GGTTCTGGCAAATATTCTG 3’ 70
Seq CL лямбда 5’ GTTGCACCGACCGAATGTA 3’ 71
Seq CH1 5’ ACCGTGAGCTGGAACAGCGGTGCGC 3’ 72

Таблица 3
Последовательности вариабельных областей и CDR 3F7
CDR, определенные согласно системе нумерации Kabat (Kabat EA, Wu TT, Perry HM, Gottesman KS, Foeller C (1991) Sequences of proteins of immunological interest, 5th edn. U.S. Department of Health and Human services, NIH, Bethesda, MD)
Область Аминокислотная последовательность
vH EVQLLESGGGLVQPGGSLRLSCAASGFTFSKYIMQWVRQAPGKGLEWVSGIRPSGGTTVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARALPRSGYLISPHYYYYALDVWGQGTTVTVSS
vL QSELTQPPSASGTPGQRVTISCSGSSSNIGRNYVYWYQQVPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLVISGLRSEDEADYYCAAWDASLRGVFGGGTKLTVLG
HCDR 1
(Kabat 31-35)
KYIMQ
HCDR 2
(Kabat 50-65)
GIRPSGGTTVYADSVKG
HCDR 3
(Kabat 95-102)
ALPRSGYLISPHYYYYALDV
LCDR 1
(Kabat 24-34)
SGSSSNIGRNYVY
LCDR 2
(Kabat 50-56)
SNNQRPS
LCDR 3
(Kabat 89-97)
AAWDASLRGV

5) Анализ клона 3F7: Ингибирование FXIIa моноклональным антителом 3F7

Чтобы оценить, ингибирует ли мАт 3F7 амидолитическую активность FXIIa в анализе in vitro, 3F7 Fab-фаг преобразовывали в полноразмерное антитело IgG4/лямбда человека и очищали, используя протоколы, описанные в примере 3. Кратко, 1 мкг FXIIa инкубировали в иммунологических планшетах Nunc в присутствии или в отсутствие rHA-инфестина-4, мАт 3F7 или контрольного мАт (антитело против GCSFR человека C1.2) в объеме 160 мкл в течение 5 минут при 37°C. Добавляли сорок микролитров субстрата (4 мМ S-2302) и планшет дополнительно инкубировали при 37°C в течение 15 минут. Реакцию останавливали добавлением 40 мкл 20% уксусной кислоты и изменение окраски регистрировали при 405 нм в устройстве для считывания планшетов. Данные представляли графически, используя компьютерную программу KaleidaGraph с подгонкой к сигмоидальной кривой, и регистрировали значение EC50. Как показано на фигуре 2, было обнаружено, что антитело 3F7 эффективно ингибирует амидолитическую активность FXIIa.

Пример 2. Созревание аффинности антитела 3F7

Целью созревания аффинности 3F7 была идентификация и характеристика вариантов мАт 3F7, способных связываться с FXIIa человека с более высокой аффинностью, чем исходное антитело. Варианты с более высокой аффинностью потенциально способны проявлять усиленное ингибирование амидолитической активности FXIIa. Способ создания библиотек Fab-фагов на основе созревания аффинности (смотри конструирование библиотек ниже) зависит от вырожденных олигонуклеотидов, отжигаемых с онДНК-матрицей, которую затем удлиняют, получая двунитевую форму для трансформации. Размер библиотеки зависит от эффективности трансформации и вырожденности используемых праймеров. Используемые праймеры (см. ниже) охватывали сочетание 19 аминокислот (без цистеина). Конструировали библиотеки, мишенью которых было 6 аминокислотных остатков одновременно. Теоретическое разнообразие при использовании тримерных олигонуклеотидов в случае 6 остатков составляет 196 = 4,7×107.

1) Конструирование библиотек созревания аффинности

Для каждой фагмиды создавали стоп-матрицу зародышевой линии, заменяя 18 кодонов (6 аминокислотных остатков) во всех CDR, за исключением CDR-L2, стоп-кодонами TAA. Конструкции имели следующий линейный дизайн: NcoI-VL-CL-линкер-VH-SalI. Фланкирующие сайты NcoI и SalI включали для клонирования в векторе фагового дисплея pTac, содержащем остальные элементы для фагового дисплея. Варианты стоп-матрицы, названные 3F7 H1, 3F7 H2, 3F7 H3.1 и 3F7 H3.2 (вариабельная область тяжелой цепи) и 3F7 L1, 3F7 L3.1, 3F7 L3.2 (вариабельная область легкой цепи) получали в GeneArt, и они показаны на фигурах 3 и 4, соответственно.

2) Конструирование библиотеки

Библиотеки конструировали, используя способы, описанные Sidhu et al. (Phage display for selection of novel binding peptides. Methods in Enzymology, 2000, vol. 238, p.333-336) с вариантами «стоп-матрицы» pTac-3F7 Fab. Каждую стоп-матрицу использовали в качестве матрицы для способа мутагенеза по Кункелю (Kunkel et al., Rapid and efficient site-specific mutagenesis without phenotypic selection. Methods in Enzymology, 1987, vol. 154, p. 367-382), используя мутагенные олигонуклеотиды (таблица 4), сконструированные для одновременной репарации стоп-кодонов и введения мутаций в требуемые сайты. Продукты реакции мутагенеза вводили в E. coli SS320 путем электропорации и продуцирование фагов инициировали добавлением хелперного фага M13-KO7. После выращивания в течение ночи при 30°C фаг собирали преципитацией ПЭГ/NaCl. Эффективности мутагенеза оценивали секвенированием 12 клонов, случайным образом собранных из каждой библиотеки, и эффективность была в диапазоне от 50 до 100%. Каждая библиотека содержала 0,75 - 3,75×109 отдельных клонов. Праймер 3254 (таблица 2) использовали для секвенирования клонов из библиотек L1, L3.1 и L3.2, и праймер Seq CL лямбда (таблица 2) использовали для секвенирования клонов из библиотек H1, H2, H3.1 и H3.2.

Таблица 4
Мутагенные тримерные олигонуклеотиды 3F7, используемые для созревания аффинности, где каждый «Nnn» означает триплет, кодирующий одну из 19 аминокислот без цистеина (полученные и поставляемые Ella Biotech, Germany).
3F7 L1 5’GCTGTAGCGGTAGCAGCNnnNnnNnnNnnNnnNnnTATGTGTATTGGTATCAGCA 3’ (SEQ ID NO:24)
3F7 L3.1 5’GATGAAGCCGATTATTATTGTNnnNnnNnnNnnNnnNnnCTGCGTGGTGTTTTTGGT 3’ (SEQ ID NO:26)
3F7 L3.2 5’TTATTGTGCAGCATGGGATNnnNnnNnnNnnNnnNnnTTTGGTGGTGGCACCAAA 3’ (SEQ ID NO:28)
3F7 H1 5’AGCAAGCGGTTTTACCTTTNnnNnnNnnNnnNnnNnnTGGGTTCGCCAGGCAC 3’ (SEQ ID NO:16)
3F7 H2 5’GGAATGGGTTAGCGGTATTNnnNnnNnnNnnNnnNnnACCGTTTATGCAGATAGCG 3’ (SEQ ID NO:18)
3F7 H3.1 5’TTATTATTGCGCACGTGCANnnNnnNnnNnnNnnNnnCTGATTTCTCCGCATTATTA 3’ (SEQ ID NO:20)
3F7 H3.2 5’CACTGCCTCGTAGCGGTNnnNnnNnnNnnNnnNnnTATTATTATTATGCCCTGGAT 3’ (SEQ ID NO:22)

3) Пэннинг библиотек

Библиотеки подвергали циклу из пяти раундов селекции с использованием снижения концентрации биотинилированного FXIIa-бета. Концентрацию мишени снижали в 10 раз в каждом раунде от 40 нМ в раунде 1 до 4 пМ в раунде 5. Пэннинг осуществляли в растворе с использованием биотинилированного FXIIa-бета. Образцы фагов инкубировали с антигеном, разбавленным в 4% молоке в PBST (или только в 4% молоке/PBST, чтобы получить контрольные образцы без мишени), с вращением при комнатной температуре в течение 1 часа. Магнитные шарики со стрептавидином Dynal M-280 блокировали в 5% обезжиренном молоке/PBS в течение 30 минут при 37°C в условиях горизонтального встряхивания. Шарики собирали, используя MPS, добавляли смесь фаг/антиген на 30 минут. Затем шарики 10 раз промывали в (KingFisher Long Wash), затем промывали вручную в PBS. Наконец шарики ресуспендировали в 500 мкл 50 мМ DTT и инкубировали при 37°C в течение 30 минут с горизонтальным встряхиванием. Элюированный фаг собирали и добавляли к 170 мкл буфера для нейтрализации (0,351 г L-цистеина + 5 мг БСА, доведенные до 5 мл 1 М трис, pH 8). 330 мкл элюированного фага использовали в качестве вводимого материала для следующего раунда. Обогащение в случае каждого раунда селекции вычисляли в виде отношения элюированного фага, отобранного на мишени, к контрольным образцам.

4) Анализ клонов полученных в результате созревания аффинности 3F7

После завершения пэннинга отбирали несколько фаговых клонов из каждой обогащенной библиотеки и секвенировали, используя праймеры, подробно описанные выше («конструирование библиотеки»). Затем из каждой библиотеки отбирали уникальные клоны на основе последовательности и преобразовывали в полные IgG4/лямбда-антитела человека для анализа связывания. Варианты с созревшей аффинностью сначала подвергали скринингу, используя Biacore, в виде неочищенного надосадка культур клеток, чтобы оценить аффинности связывания по сравнению с исходным 3F7 (как описано в примере 4(1)). В таблице 5 перечислены антитела, которые, как было обнаружено, обладают более высокой аффинностью связывания с FXIIa-бета, чем 3F7. Имела место тенденция происхождения клонов с наибольшей аффинностью из областей CDR2 тяжелой цепи и CDR1 легкой цепи.

Таблица 5
Оцениваемые аффинности связывания 3F7 и вариантов с созревшей аффинностью на основе кинетики связывания при одной концентрации FXIIa-бета. Все антитела тестировали в виде неочищенных молекул IgG4 в надосадках культур клеток на устройстве Biacore A100. Показаны только варианты с лучшей аффинностью по отношению к FXIIa, чем 3F7. В отношении положений в библиотеке следует обратиться к фигурам 3 и 4.
мАт Библиотека Последовательность SEQ ID NO KD (M)
VR119 H2 NVPLYG 29 (остатки 3-8) 1,31E-09
VR112 H2 NVPVQG 30 (остатки 3-8) 1,52E-09
VR115 H2 DIPTKG 31 (остатки 3-8) 1,56E-09
VR24 L1 EMTVHH 44 (остатки 5-10) 1,63E-09
VR110 H2 DMPTKG 32 (остатки 3-8) 2,04E-09
VR107 H2 NPATRT 33 (остатки 3-8) 2,45E-09
VR06 L1 FSHPHH 45 (остатки 5-10) 2,56E-09
VR31 L3.1 ASWYND 52 (остатки 1-6) 2,71E-09
VR108 H2 NPATKT 34 (остатки 3-8) 2,81E-09
VR103 H2 DVPVRG 35 (остатки 3-8) 2,87E-09
VR101 H2 NPATRS 36 (остатки 3-8) 3,33E-09
VR16 L1 EFVEYN 46 (остатки 5-10) 3,63E-09
VR29 L3.1 ASWEIP 53 (остатки 1-6) 3,89E-09
VR05 L1 DTNSHH 47 (остатки 5-10) 4,36E-09
VR12 L1 WTEQHN 48 (остатки 5-10) 4,45E-09
VR27 L3.1 ASWTNE 54 (остатки 1-6) 4,64E-09
VR10 L1 VMVTNH 49 остатки 5-10) 4,97E-09
VR149 H3.2 YLMKKN 39 (остатки 7-12) 5,12E-09
VR58 L3.2 PQVRLA 59 (остатки 5-10) 5,33E-09
VR39 L3.1 ASWWND 55 (остатки 1-6) 5,63E-09
VR167 H3.2 YLMKTG 40 (остатки 7-12) 5,80E-09
VR62 L3.2 QQVRLD 60 (остатки 5-10) 5,81E-09
VR109 H2 NPATNT 37 (остатки 3-8) 5,98E-09
VR14 L1 GMVEQN 50 (остатки 5-10) 6,22E-09
VR46 L3.1 ASWELP 56 (остатки 1-6) 6,67E-09
VR148 H3.2 YLVKKQ 41 (остатки 7-12) 6,93E-09
VR159 H3.2 YLVKHG 42 (остатки 7-12) 6,93E-09
VR53 L3.2 QQVRKT 61 (остатки 5-10) 7,05E-09
VR52 L3.2 ERVRLM 62 (остатки 5-10) 7,10E-09
VR160 H3.2 YLMKPG 43 (остатки 7-12) 7,13E-09
VR17 L1 FKVEET 51 (остатки 5-10) 7,15E-09
VR63 L3.2 NQVRLG 63 (остатки 5-10) 8,30E-09
VR41 L3.1 ASWSIP 57 (остатки 1-6) 9,14E-09
VR99 H2 NPATMT 38 (остатки 3-8) 9,19E-09
VR38 L3.1 ASWEVP 58 (остатки 1-6) 9,23E-09
3F7 3,30E-08

Затем на основании результатов, полученных при скрининге оцениваемой аффинности связывания, 5 наилучших 5 мАт очищали и подвергали подробному анализу аффинности связывания (как описано в примере 4(2)). Как показано в таблице 6, в случае таких клонов наблюдали 24-57-кратное улучшение аффинности связывания по сравнению с исходным 3F7.

Таблица 6
Подробный анализ Biacore аффинности связывания очищенных 3F7 и 5 наилучших вариантов с созревшей аффинностью с FXIIa-бета из таблицы 5. Все антитела тестировали в виде полностью человеческих молекул IgG4.
Вариант 3F7 ka
(1/M сек)
kd (1/с) KD (M) Кратное улучшение аффинности
3F7 1,2×105 1,1×10-3 8,6×10-9 1
VR115 1,7×105 2,5×10-5 1,5×10-10 57
VR112 2,5×105 4,3×10-5 1,7×10-10 51
VR24 2,4×105 6,4×10-5 2,6×10-10 33
VR110 1,1×105 3,9×10-5 3,5×10-10 25
VR119 1,6×105 5,9×10-5 3,6×10-10 24

Пример 3. Получение и очистка IgG полученных из фагов антител согласно изобретению

1) Конструирование вектора экспрессии млекопитающих

Векторы экспрессии млекопитающих конструировали, используя стандартную методику молекулярной биологии, путем клонирования полной легкой цепи (вариабельный и константный домены) и вариабельного домена тяжелой цепи из отобранных полученных из фагов Fab-конструкций в векторе pRhG4, как описано ранее (Jostock et al 2004. Rapid generation of functional human IgG antibodies derived from Fab-on-phage display libraries. J Immunol Methods, 289; 65-80).

2) Культура клеток

Бессывороточную суспензию адаптированных клеток 293-T получали из Genechoice Inc. Клетки культивировали в среде для экспрессии FreeStyleTM (Invitrogen) с добавлением пенициллина/стрептомицина/реагента фунгизона (Invitrogen). Перед трансфекцией клетки поддерживали при 37°C в инкубаторах с увлажнением в атмосфере 8% CO2.

3) Временная трансфекция

Временную трансфекцию векторов экспрессии млекопитающих с использованием клеток 293-T осуществляли, используя реагент для трансфекции 293-фектин (Invitrogen) согласно инструкциям производителя. Векторы, экспрессирующие легкую и тяжелую цепи, объединяли и котрансфицировали в клетки 293-T. Клетки (1000 мл) подвергали трансфекции в конечной концентрации 1×106 живых клеток/мл и инкубировали в Cellbag 2L (Wave Biotech/GE Healthcare) в течение 5 суток при 37°C в атмосфере 8% CO2 в системе биореактора волнового типа 2/10 или 20/50 (Wave Biotech/GE Healthcare). Использовали следующие условия культивирования: 35 качаний в минуту с углом 8°. Через 4 часа после трансфекции добавляли плюроник F-68 (Invitrogen) до конечной концентрации 0,1% об./об. Через 24 часа после трансфекции в культуры клеток добавляли триптон N1 (Organotechnie, France) до конечной концентрации 0,5% об./об. Надосадки клеточных культур собирали центрифугированием при 2500 об./мин и затем пропускали через фильтр 0,45 мкМ (Nalgene) перед очисткой.

4) Анализ экспрессии белка

Через 5 дней 20 мкл надосадка культуры подвергали электрофорезу в 4-20% SDS-полиакриламидном геле в трис-глицине и антитело визуализировали, окрашивая реагентом Кумасси синим.

5) Очистка антитела

Моноклональные антитела очищали, используя тандемную аффинную хроматографию на белке A и хроматографию на колонках для обессоливания. Хроматографию с использованием Hitrap MabSelect sure (1 мл, GE Healthcare, UK) и смол для обессоливания (HiPrep 26/10, GE Healthcare, UK) осуществляли, используя AKTA express (GE Healthcare, UK) согласно способу, рекомендованному производителем. Коротко, уравновешивание аффинной колонки с белком A осуществляли в 1X-буфере MT-PBS. Профильтрованную кондиционированную среду из культуры клеток (500 мл) наносили на колонку со скоростью 1 мл/мин и промывали последовательно 1X MT-PBS (10 мл) и раствором, содержащим 10 мМ трис, 0,5 М аргинин, 150 мМ NaCl, pH 7,2 (80 мл). Затем связанное антитело элюировали, используя 0,1 М Na-ацетат, pH 3,0 (8 мл) и сразу наносили на колонку для обессоливания. Концентрацию антитела определяли хроматографически, сравнивая со стандартами контрольных антител. Белковые фракции объединяли и концентрировали, используя центрифужное устройство Amicon UltraCel 50K (Millipore), затем стерильно фильтровали, используя фильтры 0,22 мкм.

Чистоту антитела анализировали в SDS-PAGE, при этом 2 мкг белка в восстанавливающем буфере для образцов (Invitrogen, CA) нагружали на 4-12% бис-трис-гель Novex NuPAGE (Invitrogen, CA) и прикладывали постоянное напряжение 200 В в течение 40 минут в миниячейке XCell SureLock (Invitrogen, CA), используя рабочий буфер NuPAGE MES SDS, затем визуализировали, используя краситель Кумасси, согласно инструкциям производителя.

Пример 4. Определение аффинности антитела - анализ Biacore

1) Оцениваемые аффинности связывания для неочищенных надосадков с антителами

Антитело против Ig человека (антитела козы против IgG (гамма) человека, адсорбированные на сыворотке мышей, Invitrogen, № в каталоге H10500) химически иммобилизовали на поверхности сенсора CM-5, используя химию связывания аминов. Надосадки культуры разбавляли 1/60 рабочим буфером перед улавливанием. Антитела улавливали в течение 180 секунд, получая среднее улавливание 800 единиц ответного сигнала (RU). Затем FXIIa-бета инъецировали в концентрации ноль и 100 нМ в течение 180 секунд и диссоциировали в течение 180 секунд. Все анализы проводили на устройстве Biacore A100 при 37 градусах по Цельсию, и данные подгоняли к кинетической модели 1:1.

2) Подробный анализ аффинности связывания

Антитело против Ig человека (антитела козы против IgG (gamma), адсорбированное на сыворотке мышей, Invitrogen, № в каталоге H10500) или специфичное антитело против Fc мыши (Jackson Immuno Research Labs inc. № в каталоге 515-005-071) химически иммобилизовали на поверхности сенсора CM-5, используя химию связывания аминов. Затем иммобилизованные антитела использовали для улавливания анти-FXII/FXIIa-мАт из раствора.

Затем FXII или FXIIa-бета человека инъецировали на захваченное антитело в разных концентрациях для подробного анализа кинетики связывания. Сигналы от эталонной проточной ячейки (в которой мАт не улавливали, но во всем остальном обрабатывали идентично) вычитали. Сигналы от инъекции пустого контроля затем вычитали из полученных сенсограмм.

Конечные скорректированные сигналы подгоняли, используя нелинейную регрессию к модели, описывающей кинетику 1:1, показатель ограничения массопереноса. Значение Rmax подгоняли локально, чтобы учесть небольшие отклонения в уровне улавливаемого мАт. Определяли скорость ассоциации (ka), скорость диссоциации (kd) и равновесную константу диссоциации (KD).

Для подробного анализа кинетики связывания FXII инъецировали в концентрации 0, 15,1, 31,25, 62,5, 125, 250 и 500 нМ в двух повторах, и FXIIa-бета инъецировали в концентрации 0, 1,25, 2,5, 5, 10, 20 и 40 нМ, при этом 10 нМ в двух повторах.

В случае антитела 3F7 регенерацию осуществляли после каждого цикла, используя инъекцию 100 мМ H3PO4 в течение 90 секунд. В случае мАт OT-2 регенерацию осуществляли после каждого цикла, используя 60-секундную инъекцию 25 мМ глицина, pH 1,7, с последующей 30-секундной инъекцией 25 мМ глицина, pH 8,6. Все анализы проводили при 25°C.

Пример 5. Сравнение 3F7 с другими антителами-ингибиторами амидолитической активности FXIIa.

Просмотр соответствующей научной литературы показал, что хотя было описано несколько антител, которые могут модулировать активность FXII, большинство из них либо направлены к тяжелой цепи и предотвращают начальную контактную активацию FXII, либо направлены к легкой цепи, и, по-видимому, только частично ингибируют амидолитическую активность FXII. Целью настоящей работы было сравнение 3F7 с антителом OT-2, которое, как было заявлено, полностью блокирует амидолитическую активность FXIIa (Dors et al., A novel sensitive assay for functional FXII based on the generation of kallikrein-C1-inhibitor complexes in FXII deficient plasma by glass-bound Factor XII. Thrombosis and Haemostasis, 1992, vol. 67, p. 644-648; Citarella et al., Structure/function analysis of human factor XII using recombinant deletion mutants. European Journal of Biochemistry, 1996, vol. 238, p. 240-249).

1) Ингибирование амидолитической активности FXIIa антителами 3F7 и OT-2

Активность антител 3F7 и OT-2 сравнивали в анализе амидолитической активности FXIIa in vitro, по существу как описано в примере 1(5). Оба антитела способны полностью блокировать амидолитическую активность FXIIa (фигура 5).

2) Анализ Biacore связывания мАт 3F7 и OT-2 с FXII и активированным FXIIa-бета

Хотя было показано, что оба антитела 3F7 и OT-2 полностью блокируют амидолитическую активность FXIIa, 3F7 проявлял небольшую, но воспроизводимую примерно в 2 раза более высокую эффективность в таком анализе. Чтобы определить, имеют ли 3F7 и OT-2 сходный эпитоп на FXIIa, авторы сначала осуществляли конкурентный ELISA, используя такие антитела, и показали, что они были способны эффективно конкурировать друг с другом за связывание с FXIIa (данные не показаны).

Чтобы дополнительно охарактеризовать сравнительное связывание таких антител с FXII, авторы осуществляли эксперименты Biacore, используя оба антитела, против не подвергнутого активации FXII и каталитически активного FXIIa-бета. Результаты такого эксперимента показаны в таблице 7 и демонстрируют, что в то время как OT-2 проявляет эквивалентную аффинность связывания с FXII или активированным FXIIa-бета, 3F7 проявляет явное предпочтение к связыванию с активированной формой FXII (FXIIa). Полученные результаты показывают, что в то время как оба антитела, по-видимому, связывают сходные области на легкой цепи FXII, они, по-видимому, не имеют идентичного эпитопа. Способность 3F7, предпочтительно, связываться с активированным XII может давать фармакокинетические и/или фармакодинамические преимущества.

Таблица 7
Подробный анализ Biacore аффинности связывания очищенных моноклональных IgG-антител 3F7 и OT-2 с FXIIa-бета.
мАт FXII KD (нМ) FXIIaβ KD (нМ)
3F7 121±19 (N=3) 6,2±0,2 (N=3)
OT-2 0,69±0,25 (N=3) 0,76±0,077 (N=3)

Пример 6: Идентификация ключевых остатков FXIIa, вовлеченных в связывание 3F7

Проведя скрининг 3F7 в отношении его способности ингибировать активность FXIIa из нескольких видов (данные не показаны), авторы определили, что 3F7 является высокоэффективным против FXIIa мыши и человека, но не против FXIIa крысы. Используя полученную информацию, авторы исследовали, какие ключевые остатки в легкой цепи FXIIa могут быть вовлечены в эпитоп 3F7, посредством создания рекомбинантного FXII мыши (который распознается антителом 3F7 при использовании Вестерн-анализа) и мутагенеза различных остатков, которые отличаются от аминокислот крысы (смотри фигуру 6). Как показывают результаты, мутации либо в положении 398, либо в положении 438, исключают связывание 3F7.

1. Конструирование и экспрессия мышиного фактора XII дикого типа и мутантного мышиного фактора XII (Mu-FXII)

кДНК, кодирующее полный белок Mu-FXII (GenBank, № доступа NM_021489), получали из GeneART AG (Regensberg, Germany). Такую кДНК использовали в качестве матрицы для получения следующих изменений отдельных остатков стандартными способами ПЦР: a) N376D, b) A385D, c) N398K, d) W420R, e)R427H, f) I438A, g) Q450R, h) delE451, i) S452G, j) K453R, T454K, k) G472S, l)N516S, m) T538A и n) A589D. За исключением f) I438A, такие изменения остатков соответствовали переключению с мышиного остатка на его крысиный ортолог (GenBank, № доступа NM_001014006) (смотри фиг. 6A). В случае h), изменение представляло собой делецию Glu451. Был создан один дополнительный мутант (o), множественный мутант, включающий изменения мышиных аминокислот на крысиные E552D, T555V и A556T. Все конструкции модифицировали на 3’-конце так, чтобы они кодировали C-концевую 8xHis-метку, клонировали в векторе экспрессии млекопитающих pcDNA3.1 (Invitrogen, Carlsbad, USA) и последовательность подтверждали в анализе последовательностей ДНК.

Суспензионные клетки 293 FreestyleTM (Invitrogen] выращивали до концентрации 1,1×106 клеток/мл в 5 мл среды для экспрессии Freestyle (Invitrogen). 7 мкл реагенты для трансфекции 293фектина (Invitrogen) предварительно инкубировали в течение 5 минут с 167 мкл среды Opti-MEM I (Invitrogen), затем добавляли к 5 мкг плазмидной ДНК, кодирующей Mu-FXII дикого типа или мутантный Mu-FXII, и смесь инкубировали еще в течение 20 минут. Комплекс ДНК-293фектин добавляли к клеткам, которые культивировали в течение 6 суток при 37°C, 8% CO2 в инкубаторе со встряхиваем при 250 об./мин. Надосадки культур собирали центрифугированием при 2000 об./мин в течение 5 минут и хранили при 4°C для анализа.

2. Вестерн-блоттинг

Надосадки, содержащие рекомбинантный mu-FXII дикого типа или мутантный mu-FXII, добавляли к равным объемам 2x невосстанавливающего буфера для образцов, инкубировали при 80°C в течение 10 минут и затем наносили на готовые 4-12% бис-трис-гели (Invitrogen) и подвергали электрофорезу в течение 1 часа при 200 В. Затем белки переносили электрофоретически на нитроцеллюлозные фильтры и блокировали в течение 1 часа в 5% сухом молоке в трис-забуференном растворе соли с 0,05% твина-20 (TTBS). Затем фильтры инкубировали в течение 1 часа либо с мАт 3F7, либо с анти-His-мАт 3H3 (оба антитела в концентрации 1 мг/мл в TTBS с 5% сухим молоком), тщательно промывали TTBS, затем инкубировали еще в течение часа с антителом против IgG человека, конъюгированным с ФИТЦ или с антителом против IgG мыши, конъюгированным с ФИТЦ, соответственно (Millipore, USA; оба антитела в концентрации 0,25 мг/мл в TTBS с 5% сухого молока). После дополнительной промывки мембран в TTBS белки, связанные Ат-ФИТЦ, визуализировали, используя анализатор с переменным режимом Typhoon (GE Healthcare, USA). Результаты показаны на фиг. 6B. Связывание 3F7 прекращается, когда остатки 398 и 438 последовательности мыши подвергаются мутации, что свидетельствует о том, что указанные два остатка могут быть частью эпитопа мАт 3F7.

Пример 7: Предотвращение FeCl3-индуцированного артериального тромбоза у мышей при внутривенном лечении моноклональным антителом 3F7

Предыдущие исследования (например, раскрытые в WO2006066878) показали, что ингибирование FXIIa предотвращало FeCl3-индуцированный артериальных тромбоз у мышей. Цель настоящего исследования заключалась в выяснении того, имеет ли место защиты мышей от артериального тромбоза также и в случае лечения специфичным моноклональным антителом, направленным против фактора свертывания XIIa (мАт 3F7).

Способы

Группы лечения показаны в таблице 8:

Таблица 8
Группы лечения
No. Лечение Доза/Объем/схема/путь N (f)
1 Изотонический раствор н.п.1 / 0,1 мл/20 г массы тела / t=-15 мин / в/в 25
2 мАт 3F7 30 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 10
3 мАт 3F7 20 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 5
4 мАт 3F7 10 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 10
5 мАт 3F7 5 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 10
6 мАт 3F7 2,5 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 10
7 мАт 3F7 1 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин / в/в 10
8 мАт 3F7 0,5 мг/кг / 0,1 мл/20 г массы тела / t=-15 мин/ в/в 10
9 Контрольное мАт 30 мг/кг / 0,2 мл/20 г массы тела / t=-15 мин / в/в 10
1н.п. = не применимо.

Мыши линии NMRI, полученные из Charles River Laboratories, самки в возрасте 6-8 недель массой от 25 до 39 г, получали одну внутривенную инъекцию растворов для лечения, которые перечислены в таблице 8 в момент времени t=-15 минут в глубокой анестезии. Затем количественно оценивали влияние лечения на степень тромботической окклюзии. Исходный кровоток определяли, помещая ультразвуковой зонд кровотока вокруг обнаженной сонной артерии. Чтобы инициировать тромбоз, кусочек фильтровальной бумаги размером 0,5 мм2 (0,5×1,0 мм), насыщенный 10% раствором хлорида железа, помещали на сонную артерию ниже зонда кровотока в момент времени t=0 минут. Через 3 минуты фильтровальную бумагу удаляли и наблюдали за кровотоком в течение 60 минут, чтобы определить появление тромботических окклюзий.

После 60-минутного периода наблюдения брали образцы крови от исследуемых животных (антикоагулянт: 10% цитрат). Затем готовили плазму согласно стандартным способам и подвергали глубокой заморозке (-80°C±10°C) вплоть до определения АЧТВ (активированного частичного тромбопластиного времени), ПТВ (протромбиновое время) и активность FXIIa.

Определение АЧТВ:

АЧТВ определяли добавлением 50 мкл исследуемых образцов плазмы (смотри выше) к 50 мкл патромтина SL (Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany) с последующей фазой инкубации в течение 120 секунд при 37°C. Затем добавляли 50 мкл раствора хлорида кальция (25 мМ, Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany), чтобы начать реакцию.

Определение ПТВ:

ПТВ определяли добавлением 50 мкл исследуемых образцов плазмы (смотри выше) к 100 мкл реагента для активации тромбореля S (Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany) после 15-секундного периода инкубации при 37°C.

Определение активности FXIIa:

Активность FXIIa определяли, используя основанный на АЧТВ анализ и сравнивали с эталонной кривой, полученной с использованием разбавлений стандартной плазмы человека и FXII-дефицитной плазмы (Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany). 50 мкл исследуемых образцов плазмы (см. выше), которые предварительно разбавляли 1:5 буферным раствором на основе имидазола (Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany), добавляли к 50 мкл FXII-дефицитной плазмы. После 30-секундного периода инкубации при 37°C к раствору добавляли 50 мкл патромтина SL (Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany) и затем раствор инкубировали в течение 120 секунд при 37°C. Затем добавляли 50 мкл раствора хлорида кальция (25 мМ, Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany), чтобы начать реакцию.

Все три анализа осуществляли в анализаторе BCT (Behring Coagulation Timer; Siemens HealthCare Diagnostics Products GmbH, Marburg, Germany) в соответствии с условиями, предлагаемыми поставщиком соответствующих реагентов для анализа (Siemens Healthcare Diagnostics Products GmbH, Marburg, Germany).

Результаты:

Внутривенная инъекция 30 мг/кг, 20 мг/кг, 10 мг/кг и 5 мг/кг мАт 3F7 приводила к полной защите от FeCl3-индуцированной окклюзии сонной артерии у мышей (таблица 9, фигура 7). При снижении доз (т.е. 2,5-0,5 мг/кг) степень окклюзии возрастала, в то время как время до окклюзии снижалось зависимым от дозы образом (таблица 9, фигура 7). По сравнению с контролями ПТВ оставалось неизменным (таблица 10, фигура 9), тогда как АЧТВ увеличивалось примерно в четыре раза при высоких дозах (таблица 10, фигура 8). FXIIa-активность была почти полностью ингибирована в случае дозы 10 мг/кг и выше и составляла почти половину в случае дозы 0,5 мг/кг (таблица 10, фигура 10). Кроме того, АЧТВ снижалось, в то время как FXIIa-активность увеличивалась зависимым от дозы образом при снижении доз мАт 3F7 (таблица 10, фигуры 8 и 10). Контрольное мАт не обеспечивало защиту от FeCl3-индуцированной окклюзии сонной артерии, и значения АЧТВ, ПТВ и FXIIa-активности оставались без изменения (таблицы 9, 10, фигуры 7-10).

Таблица 9
Степени окклюзии
No Лечение Степень окклюзии
1 Изотонический раствор соли 21/25 (84%)
2 мАт 3F7
30 мг/кг
0/10 (0%)
3 мАт 3F7
20 мг/кг
0/5 (0%)
4 мАт 3F7
10 мг/кг
0/10 (0%)
5 мАт 3F7
5 мг/кг
0/10 (0%)
6 мАт 3F7
2,5 мг/кг
3/10 (30%)
7 мАт 3F7
1 мг/кг
4/10 (40%)
8 мАт 3F7
0,5 мг/кг
6/10 (60%)
9 Контрольное мАт
30 мг/кг
8/10 (80%)

Таблица 10
ПТВ, АЧТВ и FXIIa-активность (среднее ± SD)
No Лечение ПТВ АЧТВ XIIa-активность
1 Изотонический раствор соли 8,99±1,13 31,19±3,97 71,13±14,64
2 мАт 3F7
30 мг/кг
10,58±1,12 116,70±29,96 0,63±1,16
3 мАт 3F7
20 мг/кг
11,68±0,98 137,90±7,74 0,00±0,00
4 мАт 3F7
10 мг/кг
9,74±0,57 124,70±24,41 0,94±1,29
5 мАт 3F7
5 мг/кг
10,43±0,92 91,72±16,89 3,17±0,92
6 мАт 3F7
2,5 мг/кг
9,14±0,33 69,02±11,05 7,68±1,59
7 мАт 3F7
1 мг/кг
9,51±0,61 39,84±5,83 30,02±10,00
8 мАт 3F7
0,5 мг/кг
9,61±0,60 35,89±3,73 37,22±7,92
9 Контрольное мАт
30 мг/кг
7,56±0,28 29,33±2,52 59,70±12,54

Обсуждение:

Настоящее исследование показало, что мыши были полностью защищены от артериального тромбоза после внутривенного введения мАт 3F7 в дозе 5 мг/кг или выше. При снижении доз степень окклюзии возрастала, тогда как время до окклюзии уменьшалось зависимым от дозы образом. По сравнению с контролями ПТВ оставалось неизменным, тогда как АЧТВ и активность FXIIa зависимым от дозы образом, соответственно, увеличивалось и снижалась. Таким образом, мАт 3F7 имело отличающийся профиль эффективности и требуемую зависимость доза-ответ.

Пример 8: Влияние моноклонального анти-FXIIa антитела 3F7 на гемостаз в подводной модели кровотечения у мышей

В примере 7 показано, что мАт 3F7 полностью предотвращает FeCl3-индуцированный артериальный тромбоз у мышей в дозах 30 - 5 мг/кг. В дополнение к указанному эффекту FXIIa-активность была почти полностью ингибирована, и АЧТВ увеличено до четырехкратного значения при таких защитных дозах. Чтобы выяснить вопрос о том, могут ли такие эффекты влиять на физиологический гемостаз, в данном исследовании была поставлена цель исследовать мАт 3F7 в отношении его влияния на гемостаз в модели кровотечения из кончика мышиного хвоста в наименьшей полностью защищающей дозе (т.е., 5 мг/кг), а также в дозе в 5 раз превышающей такую дозу (т.е., 25 мг/кг).

Способы

Таблица 11
Группы лечения
No Лечение Доза/Объем/схема/путь N(m/f)
1 Изотонический раствор соли н.п1./ 0,1 мл/20 г массы тела / t=-5 мин. / в/в 10 (0/10)
2 мАт 3F7 5 мг/кг / 0,1 мл/20 г массы тела / t=-5 мин. / в/в 10 (0/10)
3 мАт 3F7 25 мг/кг / 0,1 мл/20 г массы тела / t=-5 мин. / в/в 10 (0/10)
1н.п. = не применимо.
Самок мышей NMRI получали из Charles River Laboratories (Kisslegg). Они были в возрасте 6-8 недель и весили 25-32 г.

Гемостаз определяли в подводной модели. Вкратце, параметры кровотечения из кончика хвоста определяли количественно оценивая время до гемостаза и потерю крови. Объем общей потери крови вычисляли, измеряя гемоглобин, присутствующий в физиологическом растворе, используемом для погружения кончика хвоста. Соответственно учитывали гемоглобин животных. Отрезание кончика хвоста осуществляли скальпелем при глубокой анестезии (наркорен), удаляя примерно 3 мм кончика хвоста. Сразу после повреждения кончик хвоста погружали в физиологический раствор, который поддерживали при физиологической температуре тела мышей, используя водяную баню. Период наблюдения за кровотечением составлял 30 минут. Все тестируемые изделия вводили внутривенно за 5 минут до начала периода наблюдения (отрезания хвоста).

Результаты:

Независимо от группы, у всех животных наблюдали гемостаз в течение периода исследования (таблица 12). Время до гемостаза и общая потеря крови не отличались в разных группах (таблицы 12 и 13, фигуры 11-14; критерий Краскела-Уоллиса: p > 0,05).

Таблица 12
Частота и
время до гемостаза в пределах 30 минут после лечения мАт 3F7 (n=10/группу)
Лечение Частота гемостаза Время до гемостаза
среднее ±SD (сек) Мин. (сек) Медианное (сек) Макс. (сек)
Изотонический раствор соли 10/10 (100%) 157±94 70 125 360
мАт 3F7
5 мг/кг
10/10 (100%) 178±185 60 98 660
мАт 3F7
25 мг/кг
10/10 (100%) 196±144 30 163 450

Таблица 13
Общая потеря крови после лечения мАт 3F7 (n = 10/группу)
Лечение среднее ±SD (мкл) Мин. (мкл) Медианное (мкл) Макс. (мкл)
Изотонический раствор соли 12,3±9,5 2,1 10,5 27,0
мАт 3F7 5 мг/кг 7,0±7,1 0,6 4,2 23,3
мАт 3F7 25 мг/кг 9,9±10,3 2,1 5,1 30,8

Обсуждение:

На основании результатов, полученных в настоящем исследовании, можно сделать вывод, что две применяемых дозы мАт 3F7 (5 и 25 мг/кг), потенциально предотвращающих FeCl3-индуцированный тромбоз у мышей, не оказывали влияния на физиологический гемостаз в случае использования модели кровотечения из кончика хвоста у мышей.

Пример 9: Сравнение АЧТВ 3F7 и вариантов с созревшей аффинностью

Активированное частичное тромбопластиновое время (АЧТВ) определяли в стандартной плазме человека (SHP, Dade Behring), в которую добавляли разные количества соответствующего ингибитора в физиологическом растворе соли до общего объема 200 мкл. 50 мкл полученного раствора добавляли к 50 мкл патромтина SL (Dade Behring) и инкубировали в течение 120 секунд при 37°C. Затем добавляли 50 мкл раствора хлорида кальция (25 мМ), чтобы начать реакцию.

Способ осуществляли в анализаторе BCS XP (Behring Coagulation System) в соответствии с условиями, предлагаемыми производителем.

Сравнивали АЧТВ OT-2, мАт 3F7 и имеющих созревшую аффинность вариантов мАт 3F7. Результаты показаны на фигуре 15. Варианты мАт 3F7 с созревшей аффинностью были значимо более активными, чем OT-2 и исходное мАт 3F7.

Пример 10: Сравнение ингибирования фактора XIIa-альфа разными антителами

Анализ ингибирования осуществляли по существу, как описано в примере 1(5) выше. В данном случае 3F7, производные 3F7 с созревшей аффинностью и OT-2 сравнивали в разных молярных соотношениях с фактором XIIa-альфа человека, в диапазоне от 1:0,1 до 1:10. Данные показаны в таблице 14 ниже и на фигуре 16. 3F7 и производные с созревшей аффинностью лучше ингибировали, чем ОТ-2, и требовалось большее количество ОТ-2, чтобы достичь максимального ингибирования, чем 3F7 и его производных.

1. Моноклональное антитело против фактора XII/XIIa или его антигенсвязывающий фрагмент, аффинность связывания с фактором XIIa-бета человека которого в 2 раза больше аффинности связывания с фактором XII человека и которое способно полностью ингибировать амидолитическую активность фактора XIIa человека, где аффинность связывания измерена с использованием методики поверхностного плазмонного резонанса и где полное ингибирование амидолитической активности фактора XIIa человека означает ингибирование по меньшей мере на 80% активности, наблюдаемой в контрольном эксперименте в отсутствие какого-либо ингибитора, где антитело содержит CDR1 тяжелой цепи, по меньшей мере на 80% идентичный последовательности SEQ ID NO: 6, CDR2 тяжелой цепи, по меньшей мере на 60% идентичный последовательности SEQ ID NO: 7, и CDR3 тяжелой цепи, по меньшей мере на 80% идентичный последовательности SEQ ID NO: 9.

2. Моноклональное антитело против фактора XII/XIIa или его антигенсвязывающий фрагмент по п.1, где антитело содержит CDR1 легкой цепи, по меньшей мере на 50% идентичный последовательности SEQ ID NO: 11, CDR2 легкой цепи с последовательностью SEQ ID NO: 12 и CDR3 легкой цепи с последовательностью SEQ ID NO: 14.

3. Моноклональное антитело против фактора XII/XIIa или его антигенсвязывающий фрагмент, которое ингибирует амидолитическую активность фактора XIIa-альфа на 50% больше в случае применения в молярном соотношении FXIIa-альфа к антителу 1:0,2, где антитело содержит CDR1 тяжелой цепи, по меньшей мере на 80% идентичный последовательности SEQ ID NO: 6, CDR2 тяжелой цепи, по меньшей мере на 60% идентичный последовательности SEQ ID NO: 7, и CDR3 тяжелой цепи, по меньшей мере на 80% идентичный последовательности SEQ ID NO: 9.

4. Моноклональное антитело против фактора XII/XIIa или его антигенсвязывающий фрагмент по п.3, где антитело содержит CDR1 легкой цепи, по меньшей мере на 50% идентичный последовательности SEQ ID NO: 11, CDR2 легкой цепи с последовательностью SEQ ID NO: 12 и CDR3 легкой цепи с последовательностью SEQ ID NO: 14.

5. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-4, в котором антитело связывает FXII/FXIIa мыши; и в котором уровень связывания антитела с полипептидом, содержащим последовательность SEQ ID NO:2, в которой (a) остаток аспарагина в положении 398 последовательности SEQ ID NO:2 заменен лизином; или (b) остаток изолейцина в положении 438 последовательности SEQ ID NO:2 заменен аланином, ниже, чем уровень связывания белка с соответствующим полипептидом, содержащим последовательность SEQ ID NO:2 без указанной замены.

6. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-4, в котором антитело содержит вариабельную область тяжелой цепи (vH), которая более чем на 85% идентична последовательности SEQ ID NO:4.

7. Антитело или его фрагмент по любому из пп.1-4, в котором антитело содержит вариабельную область легкой цепи (vL), которая более чем на 85% идентична последовательности SEQ ID NO:5.

8. Антитело или его фрагмент по любому из пп.1-4, в котором антитело или его фрагмент связывает фактор XIIa-бета человека с KD лучше чем 10-7 М.

9. Антитело или его фрагмент по любому из пп.1-4, в котором антитело или его фрагмент конкурирует с инфестином за связывание с фактором XIIa-бета человека.

10. Антитело или его фрагмент по любому из пп.1-4, в котором антитело представляет собой IgG человека или его вариант.

11. Антитело или его фрагмент по п.10, в котором IgG представляет собой IgG4.

12. Нуклеиновая кислота, кодирующая антитело или его фрагмент по любому из предшествующих пунктов.

13. Вектор экспрессии, содержащий нуклеиновую кислоту по п.12, функционально связанную с подходящей последовательностью промотора.

14. Клетка-хозяин для получения антитела или его антигенсвязывающего фрагмента по любому из пп. 1-11, содержащая вектор по п.13.

15. Способ получения антитела или его фрагмента по любому из пп.1-11, включающий культивирование клетки-хозяина по п.14 в подходящих условиях, чтобы экспрессировать антитело, и очистку антитела из надосадка культуры.

16. Применение антитела или его антигенсвязывающего фрагмента по любому из пп.1-11 для лечения или профилактики расстройства, связанного с FXII/FXIIa.

17. Применение по п.16 для лечения или профилактики расстройства, выбранного из группы, состоящей из венозного, артериального или капиллярного тромбообразования, тромбообразования в сердце, тромбоэмболии, тромбообразования во время и/или после контакта крови человека или животного с искусственными поверхностями, за счет предотвращения образования и/или стабилизации тромбов и, следовательно, трехмерного внутрилюминального роста тромбов или за счет профилактики и/или лечения внутрилюминальных тромбов; интерстициального заболевания легких, воспаления, неврологического воспалительного заболевания, активации комплемента, фибринолиза, ангиогенеза и заболеваний, связанных с FXII/FXIIa-индуцированным образованием кинина или FXII/FXIIa-опосредованной активацией комплемента.

18. Применение по по п.16 или 17, в котором венозным или артериальным тромбообразованием является инсульт, инфаркт миокарда, тромбоз глубоких вен, тромбоз воротной вены, тромбоэмболия, тромбоз почечных вен, тромбоз яремных вен, тромбоз церебральных венозных синусов, синдром Бадда-Киари или болезнь Педжета-Шреттера.

19. Применение по п.17, в котором заболевания, связанные с FXII/FXIIa-индуцированным образованием кинина, выбраны из группы, состоящей из наследственного ангионевротического отека, бактериальных инфекций легких, трипаносомных инфекций, гипотонического шока, панкреатита, болезни Шагаса, суставной подагры, артрита, диссеминированного внутрисосудистого свертывания (DIC) и сепсиса.

20. Применение по п.17, в котором интерстициальным заболеванием легких является фибропролиферативный и/или идиопатический фиброз легких.

21. Применение по п.17, в котором тромбообразование во время и/или после контакта крови с искусственными поверхностями происходит во время и/или после медицинской процедуры, осуществляемой на указанном человеке или животном, и в котором указанное антитело вводят до, и/или во время, и/или после указанной медицинской процедуры и, кроме того, в котором

(i) искусственную поверхность подвергают воздействию по меньшей мере 80% объема крови индивида, и искусственная поверхность имеет площадь по меньшей мере 0,2 м2, или

(ii) искусственная поверхность представляет собой емкость для сбора крови вне организма индивида, или

(iii) искусственная поверхность представляет собой стент, клапан, внутрилюминальный катетер или систему для внутреннего вспомогательного перекачивания крови.

22. Медицинское устройство, покрытое антителом или его антигенсвязывающим фрагментом по любому из пп.1-11, при этом устройство представляет собой аппарат искусственного кровообращения, систему экстракорпоральной мембранной оксигенации для оксигенации крови, устройство для вспомогательного перекачивания крови, устройство для диализа крови, устройство для экстракорпоральной фильтрации крови, контейнер для применения при сборе крови, внутрилюминальный катетер, стент, искусственный клапан сердца и/или комплектующие любого из указанных устройств, включая трубку, канюлю, центробежный насос, клапан, порт и/или отводящее устройство.

23. Применение антитела или его антигенсвязывающего фрагмента по любому из пп.1-11 для введения пациенту, подвергаемому медицинской процедуре, при этом медицинская процедура включает осуществление контакта по меньшей мере с одной из следующих частей организма:

(a) сердцем;

(b) по меньшей мере одним кровеносным сосудом, выбранным из: аорты, дуги аорты, сонной артерии, коронарной артерии, бранхиоцефальной артерии, вертебробазилярной системы кровообращения, внутричерепных артерий, почечной артерии, артерии печени, брыжеечной артерии и/или кровеносного сосуда артериальной системы, расположенной краниально по отношению к сердцу,

(c) венозным кровеносным сосудом, если пациент имеет известный дефект перегородки;

и при этом медицинская процедура включает высвобождение по меньшей мере одного эмбола по меньшей мере в один из указанных кровеносных сосудов в организме, что может приводить к ишемии по меньшей мере в одном органе-мишени, и введение антитела или его антигенсвязывающего фрагмента до, во время и/или после медицинской процедуры.

24. Применение антитела или его антигенсвязывающего фрагмента по любому из пп.1-11 для профилактики или лечения состояния, связанного с FXII/FXIIa, такого как состояние с повышенной проницаемостью сосудов сетчатки, включая прогрессирующую ретинопатию, угрожающую потерей зрения, осложнение ретинопатии, макулярный отек, непролиферативную ретинопатию, пролиферативную ретинопатию, отек сетчатки, диабетическую ретинопатию, гипертоническую ретинопатию и травму сетчатки.

25. Фармацевтическая композиция для профилактики или лечения состояния, связанного с FXII/FXIIa, содержащая антитело или его антигенсвязывающий фрагмент по любому из пп.1-11.



 

Похожие патенты:

Изобретение относится к эфирам янтарной кислоты 5-гидроксиадамантан-2-она и к их изучению на локальный кровоток в коре большого мозга в условиях глобальной преходящей ишемии.

Изобретение относится к фармацевтической промышленности и представляет собой новое производное 4-гидроксибензамида, а именно 4-(4-ацетоксибензоиламино)бутаноилглицина: обладающее выраженным церебропротекторным действием, при ишемии головного мозга.

Настоящее изобретение относится к новому дейтерированному соединению хиназолинона формулы (I) или его фармацевтически приемлемой соли, обладающим свойствами ингибитора PI3К.

Изобретение относится к фармацевтической промышленности и представляет собой фармацевтическую композицию для профилактики и лечения атеросклероза, содержащую экстракт красного дрожжевого риса с содержанием монаколина К не менее 4,5 мас.

Изобретение относится к фармацевтической промышленности, а именно к кардиотоническому средству при хронической сердечной недостаточности. Предложено применение густого экстракта из травы первоцвета весеннего (Primula veris L.) в качестве кардиотонического средства при хронической сердечной недостаточности.

Изобретение относится к новым производным хиназолин-4(3H)-она общей формулы где R1=Н или СН3; R2=Н, СН3, Сl или Br; R3=Н или Вr; R4=Н или СН3, которые обладают ингибиторной активностью в отношении натрий-водородного обменника первой изоформы.

Изобретение относится к медицине и касается способа лечения геморрагического шока или массивной кровопотери у млекопитающих, который включает введение млекопитающему транексамовой кислоты в количестве от 0,005 до 0,5 г/кг массы тела в комбинации с рекомбинантным полноразмерным SERPING1 или его серпиновым доменом в количестве от 10 до 900 ME/кг массы тела.

Изобретение относится к водорастворимому комплексу каррагинан-гистохром при весовом соотношении указанных компонентов 5:1, обладающему пролонгированным гастропротекторным, кардиопротекторным и антиоксидантным действием.

Изобретение относится к новому способу получения азетидинонового соединения, представленного формулой (I). Кетоэфир карбоновой кислоты, представленный формулой (II), служит в качестве исходного вещества, и его подвергают присоединению Гриньяра, стереоселективной дегидратации, восстановлению сложноэфирной группы, защите гидроксильной группы, присоединению имина после конденсации с хиральным вспомогательным веществом, циклизации и удалению защитной группы с получением соединения, представленного формулой (I).

Настоящая группа изобретений относится к медицине, а именно к терапии и эндокринологии. И касается лечения сердечной недостаточности у пациентов с диабетом.

Изобретение относится к области биотехнологии, конкретно к молекуле искусственной нуклеиновой кислоты. Изобретение дополнительно относится к применению такой молекулы искусственной нуклеиновой кислоты, кодирующей терапевтические пептиды или белки в медицине при генной терапии и/или генетической вакцинации.

Изобретение относится к области биохимии, в частности к химерному антигенному рецептору (CAR), вызывающему антигенспецифический ответ против CD22 при связывании CAR с CD22, нуклеиновой кислоте, его кодирующей, а также к вектору и клетке-хозяину, содержащим вышеуказанную нуклеиновую кислоту.

Группа изобретений относится к области биотехнологии, в частности к вариантам антитела, которое специфически связывается с человеческим интерлейкином-6 (IL6), а также к композиции и комбинации для лечения заболевания, ассоциированного с IL6, и фармацевтической композиции для применения при лечении заболевания, ассоциированного с IL6, его содержащим.

Изобретение относится к области биотехнологии, конкретно к получению анти-HER2 антитела и конъюгата анти-HER2 антитела и низкомолекулярного медицинского средства, и может быть использовано в медицине.

Настоящее изобретение относится к области иммунологии. Предложено антитело против альфа-энолазы (ENO1), а также его scFv- и Fab-фрагмент.

Настоящее изобретение относится к области иммунологии. Предложены антитело и фрагмент антитела, способные к связыванию с фосфорилхолином и/или конъюгатом фосфорилхолина.

Изобретение относится к биотехнологии и представляет собой устойчивую, содержащую антитело фармацевтическую композицию для подкожного введения, включающую аргининаспартат или аргининглутамат и/или буфер, выбранный из группы, включающей гистидинаспартатный, гистидинглутаматный буфер, трис(гидроксиметил)аминометанаспартатный буфер и трис(гидроксиметил)аминометанглутаматный буфер, причем концентрация антитела в ней равна 50 мг/мл или более, а антитело является антителом, которое было модифицировано для обеспечения изоэлектрической точки (pI) от 5 до 8.

Изобретение относится к биотехнологии. Описана иммуносвязывающая молекула, содержащая: CDR1, CDR2 и CDR3 легкой цепи из донорной иммуносвязывающей молекулы зайцеобразного и CDR1, CDR2 и CDR3 тяжелой цепи из донорной иммуносвязывающей молекулы зайцеобразного, каркас вариабельной области легкой цепи человека и каркас вариабельной области тяжелой цепи человека, содержащий по меньшей мере четыре следующих аминокислоты: треонин (T) в положении 24, аланин (A) или глицин (G) в положении 56, треонин (T) в положении 84, валин (V) в положении 89 и аргинин (R) в положении 108 (нумерация AHo).

Настоящее изобретение относится к иммунологии. Предложено антитело и его фрагмент, способные связываться с рецептором эпидермального фактора роста (EGFR) и содержащие гипервариабельные участки из антитела панитумумаб и константную область IgG1 человека.

Данное изобретение относится к иммунологии. Предложена выделенная молекула антитела, которая является селективной в отношении связывания человеческого бета-амилоидного 1-42 пептида (Aβ1-42), а не человеческого бета-амилоидного 1-40 пептида (Aβ1-40).

Группа изобретений относится к области медицины, а именно к фармакологии и иммунологии, и предназначена для лечения субъекта, имеющего аутоиммунное заболевание. Для лечения субъекта, имеющего аутоиммунное заболевание, указанному субъекту вводят терапевтически эффективное количество водного фармацевтического состава, включающего адалимумаб в концентрации, равной по меньшей мере 50 мг/мл, и воду.

Группа изобретений относится к медицине и касается моноклонального антитела против фактора XIIXIIa или его антигенсвязывающего фрагмента, аффинность связывания с фактором XIIa-бета человека которого в 2 раза больше аффинности связывания с фактором XII человека и которое способно полностью ингибировать амидолитическую активность фактора XIIa человека. Группа изобретений также касается моноклонального антитела против фактора XIIXIIa или его антигенсвязывающего фрагмента, которое ингибирует амидолитическую активность фактора XIIa-альфа на 50 больше в случае применения в молярном соотношении FXIIa-альфа к антителу 1:0,2. Группа изобретений также касается фармацевтической композиции для профилактики или лечения состояния, связанного с FXIIFXIIa, содержащей указанное антитело. Группа изобретений обеспечивает ингибирование активированного FXIIa, но не снижение уровня FXII в крови. 11 н. и 14 з.п. ф-лы, 16 ил., 14 табл., 10 пр.

Наверх