Пептид



Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид

Владельцы патента RU 2667428:

Эпитоп Текнолоджи (Бристоль) Лимитед (GB)

Изобретение относится к области биотехнологии, конкретно к эпитопным пептидам, и может быть использовано в медицине для терапии демиелинизирующего заболевания, такого как рассеянный склероз. Получены пептидные фрагменты из протеолипидного белка (PLP): PLP 39-53: LTGTEKLIETYFSKN; PLP 42-56: TEKLIETYFSKNYQD; PLP 43-57: EKLIETYFSKNYQDY; PLP 180-194: WTTCQSIAFPSKTSA; PLP 181-195: TTCQSIAFPSKTSAS; PLP 182-196: TCQSIAFPSKTSASI; PLP 183-197: CQSIAFPSKTSASIG; PLP 184-198: QSIAFPSKTSASIGS; PLP 208-222: VLPWNAFPGKVCGSN; PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI; PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY и PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM. Изобретение обеспечивает получение пептидного эпитопа PLP, способного связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена. 5 н. и 3 з.п. ф-лы, 15 ил., 5 пр.

 

Настоящее изобретение относится к пептидам из протеолипидного белка (PLP). В частности, изобретение относится к пептидам из одной из гидрофильных областей PLP, которые способны связываться с молекулой MHC и быть представленными T-клетке in vitro без процессинга антигена. Изобретение также относится к применению таких пептидов в лечении и/или профилактике заболевания.

УРОВЕНЬ ТЕХНИКИ

Рассеянный склероз (РС) это хроническое дегенеративное заболевание, поражающее центральную нервную систему, которое характеризуется демиелинизацией аксонов. РС может вызывать многочисленные физические и психические симптомы и часто прогрессирует до состояния физической и когнитивной инвалидности. Заболевание, как правило, возникает у молодых людей (20-40 лет), чаще встречается у женщин и поражает более 1 миллиона человек по всему миру.

Заболевание РС протекает по-разному и может быть латентным или неуклонно прогрессировать с течением времени. Описано несколько подтипов РС в зависимости от характера прогрессирования. У больного РС может развиваться практически любой неврологический симптом или признак, в том числе изменения ощущений, такие как потеря чувствительности или покалывание, ощущение колющей боли или онемение (гипестезия и парестезия), мышечная слабость, подергивание мышц, мышечные спазмы или затруднения при движении; нарушение координации и равновесия (атаксия); проблемы с речью (дизартрия) или глотанием (дисфагия), проблемы со зрением (нистагм, неврит зрительного нерва, включая фосфены или двоение в глазах), утомляемость, острая или хроническая боль, а также проблемы с мочевым пузырем и кишечником.

В настоящее время РС считают иммуноопосредованным заболеванием, при котором собственная иммунная система организма атакует и повреждает миелин.

Для РС не существует известного лечения. Несколько современных методов лечения оказались полезными для восстановления функции после приступа (рецидива), предотвращения или снижения степени тяжести или частоты новых приступов (рецидивов), либо предотвращения или снижения степени инвалидности. Однако многие современные методы лечения РС связаны с неблагоприятными эффектами или плохо переносятся. Таким образом, существует потребность в альтернативных методах лечения РС, эффективных для лечения РС и для облегчения или уменьшения симптомов РС.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Авторы настоящего изобретения идентифицировали ряд пептидов, полученных из протеолипидного белка (PLP), которые могут быть представлены фиксированными антигенпредставляющими клетками T-клеткам. Эти пептиды могут быть полезны для профилактики и/или лечения демиелинизирующих заболеваний, таких как рассеянный склероз.

Таким образом, в первом аспекте настоящее изобретение относится к пептиду, способному связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена, который содержит все или часть следующих областей протеолипидного белка (PLP):

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID NO. 1);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2);

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID NO. 3).

Пептид может содержать часть следующих областей:

PLP 39-57: LTGTEKLIETYFSKNYQDY (SEQ ID NO. 4);

PLP 180-198: WTTCQSIAFPSKTSASIGS (SEQ ID NO. 5);

PLP 208-222: VLPWNAFPGKVCGSN (SEQ ID NO. 6).

Пептид можно выбирать из следующих пептидов PLP:

PLP 39-53: LTGTEKLIETYFSKN (SEQ ID NO. 7);

PLP 42-56: TEKLIETYFSKNYQD (SEQ ID NO. 8);

PLP 43-57: EKLIETYFSKNYQDY (SEQ ID NO. 9);

PLP 180-194: WTTCQSIAFPSKTSA (SEQ ID NO. 10);

PLP 181-195: TTCQSIAFPSKTSAS (SEQ ID NO. 11);

PLP 182-196: TCQSIAFPSKTSASI (SEQ ID NO. 12);

PLP 183-197: CQSIAFPSKTSASIG (SEQ ID NO. 13);

PLP 184-198: QSIAFPSKTSASIGS (SEQ ID NO. 14);

PLP 208-222: VLPWNAFPGKVCGSN (SEQ ID NO. 15);

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID NO. 1);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2) и

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID NO. 3).

Во втором аспекте изобретение относится к пептиду по первому аспекту изобретения, предназначенному для использования в лечении и/или профилактике демиелинизирующего заболевания.

В третьем аспекте настоящее изобретение относится к фармацевтической композиции, содержащей один или более пептидов по первому аспекту изобретения.

В четвертом аспекте настоящее изобретение относится к способу лечения и/или профилактики демиелинизирующего заболевания у субъекта, который нуждается в этом, включающему этап введения пептида по первому аспекту изобретения субъекту.

В пятом аспекте настоящее изобретение относится к применению пептида по первому аспекту изобретения в производстве лекарственного средства, предназначенного для использования в профилактике и/или лечении демиелинизирующего заболевания.

В случае второго, четвертого и пятого аспектов изобретения заболевание может представлять собой рассеянный склероз.

КРАТКОЕ ОПИСАНИЕ ФИГУР

Фигура 1. Три пептидные области PLP демонстрируют ответ in vitro и in vivo, и ответ коррелирует с прогнозируемым связыванием DR2. A представляет в общих чертах прогноз связывания пептидов PLP с HLA-DRB1*1501 in silico (методы IEDB и NetMHCII) и способность этих пептидов индуцировать пролиферативный ответ у таких мышей. B и C, представлена способность 4 из этих длинных пептидов индуцировать ЭАЭ (2 отдельных эксперимента).

Фигура 2. Идентификация эпитопов в HEAL-26.

Фигура 3. Идентификация эпитопов в TWTT-28.

Фигура 4. Идентификация эпитопов в GVLP-28.

Фигура 5. Протокол толеризации.

Фигура 6. Пролиферация и продуцирование цитокинов в LNC от мышей, предварительно получавших HEAL-26 или POP-4. A, представлены средние значения +/- среднеквадратическая ошибка среднего (SEM) для включения тимидина в LNC от мышей, предварительно получавших эпитоп HEAL-26 или POP-4.

Фигура 7. Пролиферация и продуцирование цитокинов в спленоцитах (SPL) от мышей, предварительно получавших HEAL-26 или POP-4. A представляет средние значения +/- SEM для включения тимидина в SPL от мышей, предварительно получавших эпитоп HEAL-26 или POP-4.

Фигура 8. Пролиферация и продуцирование цитокинов в LNC от мышей, предварительно получавших TWTT-28. A представляет средние значения +/- SEM для включения тимидина в LNC от мышей, предварительно получавших эпитоп TWTT-28.

Фигура 9. Пролиферация и продуцирование цитокинов в SPL от мышей, предварительно получавших TWTT-28. A представляет средние значения +/- SEM для включения тимидина в SPL от мышей, предварительно получавших эпитоп TWTT-28.

Фигура 10. Пролиферация и продуцирование цитокинов в LNC от мышей, предварительно получавших POP-15. A представляет средние значения +/- SEM для включения тимидина в LNC от мышей, предварительно получавших эпитоп POP-15.

Фигура 11. Пролиферация и продуцирование цитокинов в SPL от мышей, предварительно получавших POP-15. A представляет средние значения +/- SEM для включения тимидина в SPL от мышей, предварительно получавших эпитоп POP-15.

Фигура 12. Пролиферация и продуцирование цитокинов в LNC от мышей, предварительно получавших POP-22. A представляет средние значения +/- SEM для включения тимидина в LNC от мышей, предварительно получавших эпитоп POP-22.

Фигура 13. Пролиферация SPL от мышей, предварительно получавших POP-22. A представляет средние значения +/- SEM для включения тимидина в SPL от мышей, предварительно получавших эпитоп POP-22.

Фигура 14. Пролиферация и продуцирование цитокинов в LNC от мышей, предварительно получавших POP-22 или GVLP-28. A представляет средние значения +/- SEM для включения тимидина в LNC от мышей, предварительно получавших эпитоп POP-22 (левая панель) или GVLP-28 (правая панель).

Фигура 15. Пролиферация и продуцирование цитокинов в SPL от мышей, предварительно получавших POP-22 и GVLP-28. A представляет средние значения +/- SEM для включения тимидина в SPL от мышей, предварительно получавших эпитоп POP-22 или GVLP-28.

На каждой из фигур 6-15, B, представлен индекс стимуляции для включения тимидина. C представляет количество цитокинов, секретированных в культуральный супернатант. На B и C каждая точка на дозу соответствует отдельной мыши, и столбик представляет среднее значение, p рассчитывали с использованием критерия Манна-Уитни. Показаны только низкие значения p. Величину p <0,05 считали значимой.

ПОДРОБНОЕ ОПИСАНИЕ

В первом аспекте настоящее изобретение относится к пептиду.

Пептиды

Термин «пептид» используют в обычном смысле для обозначения последовательности остатков, как правило, L-аминокислот, связанных друг с другом, как правило, пептидными связями между α-амино и карбоксильными группами расположенных рядом аминокислот. Термин включает модифицированные пептиды и синтетические пептидные аналоги.

Пептид по настоящему изобретению имеет такую длину, что он способен связываться с молекулой главного комплекса гистосовместимости (MHC) класса I или II in vitro и быть представленным T-клетке без процессинга антигена. Иными словами, пептиды способны связываться непосредственно с пептидсвязывающей бороздкой молекулы MHC без необходимости какого-либо укорочения с одного или обоих концов.

Пептиды, которые связываются с молекулами MHC класса I, как правило, имеют длину 7-13, чаще 8-10 аминокислот. Связывание пептида стабилизируется на обоих его концах за счет контактов между атомами в основной цепи пептида и инвариантными сайтами в пептидсвязывающей бороздке всех молекул MHC класса I. На обоих концах бороздки существуют инвариантные сайты, которые связывают амино- и карбоксильные концы пептида. Вариации длины пептидов приходятся на сгибы пептидного каркаса, часто на остатки пролина или глицина, что придает необходимую гибкость.

Пептиды, которые связываются с молекулами MHC класса II, имеют длину, как правило, 8-20 аминокислот, чаще длину 10-17 аминокислот и могут быть намного длиннее. Эти пептиды располагаются в вытянутой конформации вдоль пептидсвязывающей бороздки MHC II, которая (в отличие от пептидсвязывающей бороздки MHC класса I) открыта на обоих концах. Пептид удерживается на месте в основном за счет контактов атомов основной цепи с консервативными остатками, которые выстилают пептидсвязывающую бороздку.

Пептид по настоящему изобретению можно получать химическими методами (Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin). Например, пептиды можно синтезировать твердофазным методом (Roberge J.Y. et al. (1995) Science 269: 202-204), отщеплять от смолы и очищать препаративной высокоэффективной жидкостной хроматографией (например, Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York NY). Автоматический синтез можно осуществлять, например, с использованием пептидного синтезатора ABI 431A (Perkin Elmer) в соответствии с инструкциями производителя.

Альтернативно, пептид можно получать рекомбинантными методами или путем отщепления от более длинного полипептида. Например, пептид можно получать путем отщепления от протеолипидного белка миелина. Состав пептида можно подтверждать аминокислотным анализом или секвенированием (например, методом деградации по Эдману).

Протеолипидный белок миелина (PLP)

Миелин представляет собой диэлектрический (изолирующий электрические импульсы) материал, который образует слой, миелиновую оболочку, как правило, только вокруг аксона нейрона. Это важно для правильного функционирования нервной системы. Некоторые из белков, составляющих миелин, представляют собой основной белок миелина (MBP), миелиновый олигодендроцитарный гликопротеин (MOG) и протеолипидный белок (PLP).

Протеолипидный белок миелина (PLP), наиболее распространенный белок центральной нервной системы (ЦНС), представляет собой гидрофобный интегрированный мембранный белок.

Последовательность PLP человека представлена в SEQ ID No. 16.

SEQ ID No. 16

1 glleccarc lvgapfaslv atglcffgva lfcgcgheal tgtekliety fsknyqdyey

60 linvihafqy viygtasfff lygalllaeg fyttgavrqi fgdyktticg kglsatvtgg

120 qkgrgsrgqh qahslervch clgkwlghpd kfvgityalt vvwllvfacs avpvyiyfnt

180 wttcqsiafp sktsasigsl cadarmygvl pwnafpgkvc gsnllsickt aefqmtfhlf

240 iaafvgaaat lvslltfmia atynfavlkl mgrgtkf

Пептид по изобретению получают из гидрофильной области последовательности PLP. Пептид можно получать из фрагмента антигена, возникающего в результате естественного процессинга антигена антигенпредставляющей клеткой.

Гидрофильные области PLP являются следующими:

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID No. 17);

PLP 88-119: EGFYTTGAVRQIFGDYKTTICGKGLSATVTGG (SEQ ID No. 18);

PLP 104-135: KTTICGKGLSATVTGGQKGRGSRGQHQAHSLE (SEQ ID No. 19);

PLP 119-150: GQKGRGSRGQHQAHSLERVCHCLGKWLGHPDK (SEQ ID No. 20);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID No. 21);

PLP 192-219: TSASIGSLCADARMYGVLPWNAFPGKVC (SEQ ID No. 22);

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID No. 23);

PLP 260-276: ATYNFAVLKLMGRGTKF (SEQ ID No. 24).

Пептид может содержать все или часть из следующих областей протеолипидного белка (PLP):

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID NO. 1);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2);

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID NO. 3).

Пептид может содержать минимальный эпитоп из одной из этих областей.

Пептид может содержать часть из следующих областей:

PLP 39-57: LTGTEKLIETYFSKNYQDY (SEQ ID NO. 4);

PLP 180-198: WTTCQSIAFPSKTSASIGS (SEQ ID NO. 5);

PLP 208-222: VLPWNAFPGKVCGSN (SEQ ID NO. 6).

Пептид можно выбирать из следующих пептидов PLP:

PLP 39-53: LTGTEKLIETYFSKN (SEQ ID NO. 7);

PLP 42-56: TEKLIETYFSKNYQD (SEQ ID NO. 8);

PLP 43-57: EKLIETYFSKNYQDY (SEQ ID NO. 9);

PLP 180-194: WTTCQSIAFPSKTSA (SEQ ID NO. 10);

PLP 181-195: TTCQSIAFPSKTSAS (SEQ ID NO. 11);

PLP 182-196: TCQSIAFPSKTSASI (SEQ ID NO. 12);

PLP 183-197: CQSIAFPSKTSASIG (SEQ ID NO. 13);

PLP 184-198: QSIAFPSKTSASIGS (SEQ ID NO. 14);

PLP 208-222: VLPWNAFPGKVCGSN (SEQ ID NO. 15);

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID NO. 1);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2) и

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID NO. 3).

Пептид может содержать минимальный эпитоп из одного из этих пептидов.

В частности, пептид может содержать, состоять из или содержать минимальный эпитоп из одного из следующих пептидов:

PLP 39-53: LTGTEKLIETYFSKN (SEQ ID NO. 7);

PLP 181-195: TTCQSIAFPSKTSAS (SEQ ID NO. 11);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2).

Эпитопы

При адаптивном иммунном ответе T-лимфоциты способны узнавать внутренние эпитопы белкового антигена. Антигенпредставляющие клетки (АПК) поглощают белковые антигены и расщепляют их на короткие пептидные фрагменты. Пептид может связываться с молекулой главного комплекса гистосовместимости (MHC) класса I или II внутри клетки и переноситься на поверхность клетки. Будучи представленным на поверхности клетки в сочетании с молекулой MHC, пептид может узнаваться T-клеткой (с помощью T-клеточного рецептора (TCR)), в этом случае пептид представляет собой T-клеточный эпитоп.

T-клеточные эпитопы играют центральную роль в адаптивном иммунном ответе на любой антиген, как собственный, так и чужеродный. Центральная роль T-клеточных эпитопов в заболеваниях гиперчувствительности (включающих аллергию, аутоиммунные заболевания и отторжение трансплантата) была продемонстрирована на экспериментальных моделях. Можно индуцировать воспалительные или аллергические заболевания путем инъекции синтетических пептидов (на основе структуры T-клеточных эпитопов) в сочетании с адъювантом.

Напротив, показано, что можно индуцировать иммунологическую толерантность в отношении конкретных пептидных эпитопов путем введения пептидных эпитопов в растворимой форме. Показано, что введение растворимых пептидных антигенов является эффективным способом ингибирования заболевания при экспериментальном аутоиммунном энцефаломиелите (ЭАЭ - модель для рассеянного склероза (РС) (Metzler and Wraith (1993) Int. Immunol. 5: 1159-1165; Liu and Wraith (1995) Int. Immunol. 7: 1255-1263; Anderton and Wraith (1998) Eur. J. Immunol. 28: 1251-1261) и в экспериментальных моделях артрита, диабета и увеоретинита (обзор в Anderton and Wraith (1998), выше). Также была продемонстрирована эффективность этого метода для лечения текущего заболевания при ЭАЭ (Anderton and Wraith (1998), выше).

Использование толерогенных пептидов для лечения или профилактики заболевания привлекло значительное внимание. Одной из причин этого является то, что было показано, что некоторые толерогенные эпитопы способны подавлять ответы T-клеток на другие антигены в той же ткани. Это явление, известное как «подавление иммунного ответа неродственным антигеном», означает, что должна быть возможность индуцировать толерантность к более чем одному эпитопу (предпочтительно, ко всем эпитопам) в конкретном антигене и к более чем одному антигену для конкретного заболевания с использованием конкретного толерогенного пептида (Anderton and Wraith (1998), выше). Это избавило бы от необходимости определения всех патогенных антигенов при конкретном заболевании.

Пептиды также являются подходящим вариантом для терапии вследствие их относительно низкой стоимости и того факта, что можно получать пептидные аналоги с измененными иммунологическими свойствами. Пептиды, таким образом, можно модифицировать для изменения их взаимодействий либо с MHC, либо с TCR.

Одна из возможных проблем этого подхода заключается в том, что было показано, что не все пептиды, которые действуют в качестве T-клеточных эпитопов, способны вызывать толерантность. Пептид 89-101 основного белка миелина (MBP) является иммунодоминантным антигеном после иммунизации и также является очень эффективным иммуногеном как с точки зрения примирования для реакционной способности T-клеток, так и индукции ЭАЭ. Однако показано, что данный пептид неэффективен для индукции толерантности при введении в растворе (Anderton and Wraith (1998), выше).

Был предложен целый ряд объяснений для наблюдаемой иерархии в способности T-клеточных эпитопов индуцировать толерантность (обзор в Anderton and Wraith (1998), выше). В частности, было высказано предположение, что существует корреляция между аффинностью пептида в отношении MHC и толерогенностью (Liu and Wraith (1998), выше), но это не согласуется с некоторыми из наблюдений. Например, MBP [89-101], который не является толерогенным, связывается с I-AS с относительно высокой аффинностью. Таким образом, не просто предсказать, какие пептиды будут индуцировать толерантность.

Авторы настоящего изобретения показали, что если пептидный эпитоп имеет соответствующий размер, чтобы быть представленным незрелой АПК без процессинга антигена, он может индуцировать иммунологическую толерантность (международная патентная заявка номер PCT/GB01/03702). То наблюдение, что некоторые T-клеточные эпитопы являются толерогенными, а другие неспособны индуцировать толерантность, таким образом, может быть объяснено тем фактом, что некоторые эпитопы нуждаются в процессинге антигена прежде, чем они смогут быть представлены молекулой MHC. Эти эпитопы, которым необходим дополнительный процессинг, не индуцируют толерантность при введении в растворимой форме, несмотря на их способность индуцировать заболевание при введении в сочетании с адъювантом.

Эпитопы, которые не нуждаются в дополнительном процессинге, способны индуцировать толерантность, и они были названы авторами изобретения «эпитопами» (независящими от процессинга антигена эпитопами).

Независящие от процессинга антигена системы представления (APIPS)

Пептиды по настоящему изобретению способны связываться с молекулой MHC in vitro и быть представленными T-клетке без процессинга антигена.

Можно тестировать способность пептида связываться с молекулой MHC без процессинга антигена, используя «беспроцессинговую» систему. Такая система должна быть способна представлять антиген с помощью молекул MHC T-клеткам, но не способна процессировать антиген. Таким образом, пептиды можно тестировать на их способность связываться с молекулой MHC in vitro и быть представленными T-клетке без процессинга антигена с использованием независящей от процессинга антигена системы представления (APIPS).

Примеры APIPS включают:

a) фиксированные АПК (с антителами к CD28 или без них);

b) липидные мембраны, содержащие молекулы MHC класса I или II (с антителами к CD28 или без них); и

c) очищенные природные или рекомбинантные молекулы MHC, связанные с планшетом (с антителами к CD28 или без них).

Известно, что фиксированные АПК используют для изучения T-клеточных ответов, например, в исследованиях с целью определения минимального эпитопа в полипептиде путем измерения ответа на укороченные пептиды (Fairchild et al. (1996) Int. Immunol. 8: 1035-1043). АПК можно фиксировать при помощи, например, формальдегида (как правило, параформальдегида) или глутаральдегида.

Липидные мембраны (которые могут быть плоскими мембранами или липосомами) могут быть получены с использованием искусственных липидов или могут представлять собой плазматические мембранные/микросомальные фракции из АПК.

На практике, APIPS можно наносить в лунки планшета для культивирования тканей. Затем добавляют пептидные антигены и связывание пептида с MHC частью APIPS определяют, добавляя выбранные T-клеточные линии или клоны. Активацию T-клеточной линии или клона можно измерять любыми методами, известными в данной области, например, по включению 3H-тимидина или секреции цитокинов.

Если пептид может быть представлен T-клетке при помощи APIPS, тогда он способен связываться с молекулой MHC без процессинга антигена и является эпитопом.

Толерантность

Пептиды по настоящему изобретению способны индуцировать толерантность к протеолипидному белку.

Используемый в настоящем документе термин «толерогенный» означает способный индуцировать толерантность.

Толерантность это неспособность реагировать на антиген. Толерантность к собственным антигенам является важной особенностью иммунной системы, если она теряется, может развиться аутоиммунное заболевание. Адаптивная иммунная система должна поддерживать способность реагировать на огромное разнообразие инфекционных агентов, при этом избегая аутоиммунной атаки на собственные антигены, содержащиеся в собственных тканях организма. В значительной степени это контролируется за счет подверженности незрелых T-лимфоцитов клеточному апоптозу в тимусе (центральная толерантность). Однако не все собственные антигены обнаруживаются в тимусе, так что гибели аутореактивных тимоцитов недостаточно. Вследствие этого, существуют дополнительные механизмы, за счет которых толерантность могут приобретать зрелые аутореактивные T-лимфоциты в периферических тканях (периферическая толерантность). Обзор механизмов центральной и периферической толерантности приведен в Anderton et al. (1999) (Immunological Reviews 169: 123-137).

Толерантность может возникать вследствие, или характеризоваться индукцией, анергии по меньшей мере в части CD4+ T-клеток. Для активации T-клетки пептид должен связываться с «профессиональной» АПК, способной доставлять два сигнала к T-клеткам. Первый сигнал (сигнал 1) доставляется MHC-пептидным комплексом на клеточную поверхность АПК и воспринимается T-клеткой через рецептор TCR. Второй сигнал (сигнал 2) доставляется на поверхность АПК костимулирующими молекулами, такими как CD80 и CD86, и воспринимается CD28 на поверхности T-клетки. Считается, что когда T-клетка получает сигнал 1 в отсутствие сигнала 2, она не активируется и, фактически, становится анергической. Анергические T-клетки невосприимчивы к последующему воздействию антигена и могут быть способны подавлять другие иммунные ответы. Считается, что анергические T-клетки вовлечены в опосредование T-клеточной толерантности.

Пептиды, которым необходим процессинг прежде, чем они смогут быть представлены в сочетании с молекулами MHC, не индуцируют толерантность, поскольку они должны подвергаться процессингу зрелыми антигенпредставляющими клетками. Зрелые антигенпредставляющие клетки (такие как макрофаги, B-клетки и дендритные клетки) способны к процессингу антигена, но также и к доставке обоих сигналов 1 и 2 к T-клетке, что приводит к активации T-клетки. Эпитопы, с другой стороны, способны связывать MHC класса II на незрелых АПК. Таким образом, они будут представлены T-клеткам без костимулирования, что приводит к анергии T-клеток и толерантности.

Безусловно, эпитопы также способны связываться с молекулами MHC на клеточной поверхности зрелых АПК. Однако в иммунной системе имеется намного больше незрелых, чем зрелых АПК (было высказано предположение, что менее 10% дендритных клеток являются активированными, Summers et al. (2001) Am. J. Pathol. 159: 285-295). Таким образом, по умолчанию, основное действие эпитопа будет заключаться в индукции анергии/толерантности, а не активации.

Показано, что при индукции толерантности способность антигенспецифических CD4+ T-клеток к пролиферации снижена. Кроме того, продуцирование IL-2, IFN-γ и IL-4 этими клетками снижено, однако продуцирование IL-10 повышено. Показано, что нейтрализация IL-10 у мышей в состоянии индуцированной пептидом толерантности полностью восстанавливает восприимчивость к заболеванию. Было высказано предположение, что популяция регуляторных клеток сохраняется в толерантном состоянии, при котором продуцируется IL-10 и опосредуется иммунная регуляция (Burkhart et al. (1999) Int. Immunol. 11: 1625-1634).

Таким образом, индукцию толерантности можно отслеживать различными способами, включая:

(a) уменьшение восприимчивости к заболеванию, для которого пептид является эпитопом-мишенью in vivo;

(b) индукцию анергии в CD4+ T-клетках (которая может быть обнаружена при последующей стимуляции антигеном in vitro);

(c) изменения в популяции CD4+ T-клеток, включая

(i) снижение пролиферации;

(ii) уменьшение продуцирования, например, IL-2, IFN-γ и IL-4; и

(iii) увеличение продуцирования IL-10.

Целевые заболевания

Пептид по изобретению можно использовать в лечении и/или профилактике заболевания.

Заболевание может представлять собой демиелинизирующие заболевания, такие как адренолейкодистрофия, болезнь исчезновения белого вещества или рассеянный склероз (РС).

Пептиды по настоящему изобретению особенно полезны в лечении и/или профилактике рассеянного склероза (РС). Рассеянный склероз (РС) представляет собой хроническое воспалительное заболевание, характеризующееся наличием множественных очагов демиелинизации, диссеминированных по всему белому веществу ЦНС и возникающих в различных участках в разное время (McFarlin and McFarland, 1982 New England J. Medicine 307: 1183-1188 и 1246-1251). Считается, что РС опосредуется аутореактивными Т-клетками.

Фармацевтическая композиция

Во втором аспекте настоящее изобретение относится к фармацевтической композиции, содержащей один или более пептидов по первому аспекту изобретения.

Авторы настоящего изобретения прогнозируют, что, несмотря на «подавление иммунного ответа неродственным антигеном», может быть необходимым воздействие на ряд различных T-клеточных клонов, чтобы эффективно индуцировать толерантность. Таким образом, индивидууму можно вводить несколько пептидов для лечения или профилактики заболевания.

Фармацевтическая композиция может, например, содержать от 1 до 20 эпитопов, например, 1-15, 2-8 или 4-6 эпитопов.

В случае двух или более эпитопов фармацевтическая композиция может быть в виде набора, в котором некоторые или все эпитопы предоставлены отдельно для одновременного, раздельного или последовательного введения.

Альтернативно (или дополнительно), если фармацевтическую композицию (или любую ее часть) предстоит вводить в нескольких дозах, каждая доза может быть упакована отдельно.

Фармацевтическая композиция может содержать терапевтически или профилактически эффективное количество каждого эпитопа и, необязательно, фармацевтически приемлемый носитель, разбавитель или эксципиент.

Кроме того, в фармацевтической композиции по настоящему изобретению каждый эпитоп можно смешивать с любым подходящим связующим веществом(ами), смазывающим веществом(ами), суспендирующим веществом(ами), покрывающим средством(ами) или солюбилизирующим средством(ами).

Введение

Пептид можно вводить в растворимой форме без адъюванта.

Пептид можно вводить интраназальным, трансмукозальным, подкожным или внутрикожным путями введения.

Исследования показали, что пептид при введении в растворимой форме внутрибрюшинно (в/б), внутривенно (в/в), интраназально (и/н) или перорально может индуцировать толерантность T-клеток (Anderton and Wraith (1998), выше; Liu and Wraith (1995), выше; Metzler and Wraith (1999) Immunology 97: 257-263).

Исследования на мышах показали, что продолжительность введения пептида, необходимая для индукции толерантности, зависит от частоты предшественников T-клеток у реципиента (Burkhart et al. (1999), выше). Во многих экспериментальных исследованиях было показано, что для индукции толерантности необходимы повторные дозы пептида (Burkhart et al. (1999), выше). Таким образом, точная доза и число доз пептида будет зависеть от индивидуума, однако в предпочтительном варианте осуществления вводят несколько доз.

Если несколько пептидов вводят одновременно, они могут находиться в виде «коктейля», подходящего для введения в одной или нескольких дозах. Альтернативно, может быть предпочтительным введение нескольких доз, но с варьирующими от дозы к дозе относительными концентрациями пептидов.

В предпочтительном варианте осуществления можно следовать протоколу «эскалации дозы», согласно которому несколько доз вводят пациенту в возрастающих концентрациях. Такой подход был использован, например, для пептидов фосфолипазы A2 в иммунотерапии против аллергии на пчелиный яд (Müller et al. (1998) J. Allergy Clin Immunol. 101: 747-754 и Akdis et al. (1998) J. Clin. Invest. 102: 98-106).

ПРИМЕРЫ

Следующие далее примеры служат для иллюстрации настоящего изобретения, но их не следует рассматривать в качестве его ограничения. Изобретение, в частности, относится к конкретным вариантам осуществления, описанным в этих примерах.

Пример 1 - Изучение гидрофильных участков последовательности протеолипидного белка (PLP)

Материалы и методы

Антигены

Поскольку PLP является в значительной степени гидрофобным белком, нужно было использовать гидрофильные участки последовательности. Для этого проводили гидропатические исследования и синтезировали восемь пептидов из гидрофильных доменов молекулы PLP, а именно:

36-61 (26-членный): HEALTGTEKLIETYFSKNYQDYEYLI-NH2;

88-119 (32-членный): EGFYTTGAVRQIFGDYKTTICGKGLSATVTGG-NH2;

104-135 (32-членный): KTTICGKGLSATVTGGQKGRGSRGQHQAHSLE-NH2;

119-150 (32-членный): GQKGRGSRGQHQAHSLERVCHCLGKWLGHPDK-NH2;

179-206 (28-членный): TWTTCQSIAFPSKTSASIGSLCADARMY-NH2;

192-219 (28-членный): TSASIGSLCADARMYGVLPWNAFPGKVC-NH2;

207-234 (28-членный): GVLPWNAFPGKVCGSNLLSICKTAEFQM-NH2;

260-276 (17-членный): ATYNFAVLKLMGRGTKF-NH2.

Для каждого пептида проводили исследования in silico для прогнозирования способности к связыванию DR2 (HLA-DRB1*1501) и проводили исследования in vitro (анализ пролиферации) и in vivo (индукция ЭАЭ) для изучения иммунного ответа. Результаты представлены на фигуре 1.

Показано, что три пептида демонстрировали реакцию в исследованиях как in vitro, так и in vivo, и это коррелировало с прогнозом связывания DR2. Этими пептидами были HEAL-26, TWTT-28 и GVLP-28 (для идентификации пептида использованы первые четыре аминокислоты, выделенные жирным шрифтом в последовательностях, приведенных выше).

Пример 2 - Идентификация эпитопов в HEAL-26

Синтезировали панель 15-членных перекрывающихся пептидов, охватывающих HEAL-26, с использованием стандартной Fmoc-технологии. Каждый пептид имел сдвиг на 1 аминокислоту, как показано ниже:

Пептид HEAL-26 Последовательность
POP-1 HEALTGTEKLIETYF
POP-2 EALTGTEKLIETYFS
POP-3 ALTGTEKLIETYFSK
POP-4 LTGTEKLIETYFSKN
POP-5 TGTEKLIETYFSKNY
POP-6 GTEKLIETYFSKNYQ
POP-7 TEKLIETYFSKNYQD
POP-8 EKLIETYFSKNYQDY
POP-9 KLIETYFSKNYQDYE
POP-10 LIETYFSKNYQDYEY
POP-11 IETYFSKNYQDYEYL
POP-12 ETYFSKNYQDYEYLI

Пептиды анализировали с использованием HEAL-26-специфичных гибридом, полученных от мышей DR2.

Из этих пептидов, POP-4, POP-7 и POP-8 были идентифицированы как эпитопы.

Пример 3 - Идентификация эпитопов в TWTT-28

Синтезировали панель 15-членных перекрывающихся пептидов, охватывающих TWTT-28, с использованием стандартной Fmoc-технологии. Каждый пептид имел сдвиг на 1 аминокислоту. Пептиды анализировали с использованием TWTT-28-специфичных гибридом, полученных от мышей DR2.

Как эпитопы были идентифицированы пептиды от POP-14 до POP-18, имеющие следующие последовательности:

Пептиды TWTT-28 Последовательность
POP-14 WTTCQSIAFPSKTSA
POP-15 TTCQSIAFPSKTSAS
POP-16 TCQSIAFPSKTSASI
POP-17 CQSIAFPSKTSASIG
POP-18 QSIAFPSKTSASIGS

Пример 4 - Идентификация эпитопов в GVLP-28

Синтезировали панель 15-членных перекрывающихся пептидов, охватывающих GVLP-28, с использованием стандартной Fmoc-технологии. Каждый пептид имел сдвиг на 1 аминокислоту. Пептиды анализировали с использованием GVLP-28-специфичных гибридом, полученных от мышей DR2.

Как эпитоп был идентифицирован пептид POP-22, имеющий следующую последовательность: VLPWNAFPGKVCGSN.

ПРИМЕР 5 - Ex vivo анализ толерантности

Для оценки способности эпитопов индуцировать толерантность авторы изобретения сначала определяли способность этих эпитопов ингибировать иммунный ответ ex vivo. Для этой цели мыши HLA-DRB1*1501 предварительно получали отдельный эпитоп в режиме эскалации дозы, а затем были примированы соответствующим длинным пептидом. Через 10 дней после примирования спленоциты (SPL) и клетки лимфатических узлов (LNC) переводили в культуру и стимулировали соответствующим длинным пептидом в течение 3 дней для оценки их пролиферации по включению 3H-тимидина и оценки продуцирования цитокинов с помощью мультиплексных систем профилирования цитокинов (фигура 5).

Изучение толеризации показало, что предварительное введение POP-4 приводило к ингибированию пролиферации T-клеток и подавлению продуцирования цитокинов Th1/Thl7 (значительному снижению уровней IFN-γ, TNF-α и IL-17) в лимфатических узлах (фигура 6) и селезенке (фигура 7). HEAL-26 (фигура 6 и 7) приводил к снижению пролиферации и уменьшению продуцирования IL-17 как в SPL, так и в LNC. Однако также наблюдалось увеличение уровня IL-5, что свидетельствовало о переключении продуцирования с Th1/Thl7 цитокинов на Th2 цитокины, когда мыши предварительно получали HEAL-26.

POP-15 и TWTT-28 очень хорошо ингибировали пролиферацию и продуцирование цитокинов в SPL и LNC. В случае POP-15 отсутствовала разница в пролиферации для спленоцитов, однако имели место небольшие различия в продуцировании цитокинов. Действительно, мыши, предварительно получавшие POP-15, продуцировали меньше IFN-γ (статически достоверно), меньше GM-CSF и меньше IL-17. Кроме того, имело место значительное ингибирование пролиферации и продуцирования цитокинов (IFN-γ, GM-CSF и IL-17) в LNC, когда мыши предварительно получали POP-15.

В случае POP-22 результаты были менее очевидными из-за очень слабого ответа PBS мышей. Однако можно было наблюдать эффект предварительного воздействия POP-22 и GVLP-28. Действительно, индекс стимуляции показывает снижение пролиферации LNC при использовании POP-22 (фигура 12 и 14) и GVLP-28 (фигура 14). Также наблюдали значительное ингибирование продуцирования IL-17 этими клетками, когда мыши предварительно получали POP-22 или GVLP-28.

Материалы и методы

Мыши

Мышей HLA-DRB1*1501 (мышей DR2) получали от Lars Fugger (L.S. Madsen et al. A humanized model for multiple sclerosis using HLA-DR2 and a human T-cell receptor. Nature genet 1999, 23, 343-347) и проводили обратное скрещивание с мышами Ab0. Полученные мыши DR2 экспрессировали молекулу HLA-DRB1*1501, но не молекулу MHC мыши.

Пептиды

Длинные пептиды и 15-членные пептиды синтезировали при помощи GL Biochem Ltd (Shangai, China) и хранили в диметилсульфоксиде (ДМСО, Sigma-Aldrich, Saint Louis, MA) при -80°C.

Изучение пептидов, связывающихся с HLA-DRB1*1501

Сервер NetMHCII 2.2

Сервер NetMHCII 2.2 позволяет прогнозировать связывание пептидов с HLA-DRB1*1501 с использованием искусственных нейронных сетей. Прогнозируемые значения выражаются в величинах нМ IC50. В выходных данных указаны сильно и слабо связывающиеся пептиды. Связывающиеся с высокой аффинностью пептиды имеют величину IC50 ниже 50 нМ, а слабо связывающиеся пептиды имеют величины IC50 ниже 500 нМ. Результат представлен в виде прогностических баллов, рассчитанных следующим образом: 1-log50000(афф). Адрес веб-сайта:

http://wvvw.cbs.dtu.dk/services/NetMHCII.

База данных иммунных эпитопов (IEDB): консенсусный метод

Для каждого пептида создавали процентильный ранг для каждого из четырех методов (ARB, комбинаторная библиотека, SMM_align и Sturniolo) путем сравнения баллов пептида с баллами пяти миллионов случайных 15-членных пептидов, выбранных из базы данных SWISSPROT. Малочисленный процентильный ранг свидетельствовал о высокой аффинности. Усредненный процентильный ранг для четырех методов затем использовали для создания ранга для консенсусного метода. Адрес веб-сайта:

http://tools.immuneepitope.org/analyze/html/mhc_II_binding.html.

Определение иммуногенности длинных пептидов

Примирование и ЭАЭ (экспериментальный аутоиммунный энцефаломиелит)

Трансгенные мыши HLA-DRB1*1501 получали инъекцию 100 мкл смеси, содержащей 100 мкг длинного пептида в PBS (Lonza, Verviers, Belgium) или только PBS с полным адъювантом Фрейнда (CFA; BD Difco, Oxford, UK), содержащим 4 мг/мл Mycobacterium tuberculosis (MTb, BD Difco, Oxford, UK), подкожно в основание хвоста. Для изучения ЭАЭ мыши получали инъекцию 200 нг коклюшного токсина одновременно с примированием и через 2 дня. Затем мышей ежедневно осматривали, взвешивали и определяли степень тяжести заболевания в баллах.

Культура клеток

В день 10 дренирующие лимфатические узлы и селезенку удаляли и спленоциты и клетки лимфатических узлов выделяли и культивировали в среде X-vivo 15 (с добавлением глютамина, пенициллина и стрептомицина; Lonza, Verviers, Belgium) в 96-луночных плоскодонных планшетах. Для анализа пролиферации 0,5×106 клеток/лунку в объеме 200 мкл/лунку культивировали с пептидом в различных концентрациях.

Тест на пролиферацию и анализ цитокинов

Через 3 дня культивирования отбирали 60 мкл супернатанта (не затрагивая клетки) и замораживали. 25 мкл/лунку меченого тритием тимидина, предварительно разведенного до 20 мкКи/мл (сток 5 мКи; PerkinElmer, Waltham, MA), добавляли к клеткам до конечной концентрации 0,5 мкКи/лунку. Клетки инкубировали при температуре 37°C. Через 18 часов планшеты замораживали. Затем оттаявший материал собирали из планшетов и просчитывали на β-счетчике (жидкостной сцинтилляционный счетчик Wallac 1450 MicroBeta TriLux). Затем супернатант анализировали с помощью системы Th1/Th2 10plex FlowCytomix Multiplex (Bender) для мышей.

Получение клонов T-клеток

Примирование и создание линии T-клеток:

В день 0 пять трансгенных мышей HLA-DRB1*1501 получали инъекцию 100 мкг длинного пептида в CFA с 4 мг/мл Mycobacterium tuberculosis в основание хвоста. Примированную PBS контрольную группу использовали в качестве контроля для примирования. В день 10 дренирующие лимфатические узлы и селезенки удаляли и выделяли спленоциты и клетки лимфатических узлов. Спленоциты и клетки лимфатических узлов смешивали и CD4 T-клетки очищали с использованием набора для очистки по отрицательному принципу (нетронутые CD4 T-клетки; Miltneyi, Bergisch Gladbach, Germany). Затем CD4 T-клетки повторно стимулировали с облученными спленоцитами (3000 рад) в качестве APC (антигенпредставляющих клеток) от мышей HLA-DRB1*1501 в соотношении 1:1 при концентрации примерно 5×106 клеток/мл и с длинным пептидом в концентрации 10 мкг/мл в 6-луночном планшете. Стимуляцию проводили в среде X-vivo 15, чтобы избежать активации клеток, специфичных для эмбриональной телячьей сыворотки (ЭТС). В день 4 к клеткам добавляли рекомбинантный человеческий IL-2 в концентрации 20 Ед/мл (R&D, Mineapolis, MN). В день 7 все клетки собирали и от мертвых клеток освобождались путем разделения в градиенте плотности фиколла (Histopaque 1083, Sigma-Aldrich, St Louis, MA). Затем клетки повторно стимулировали с облученными спленоцитами от мышей DR2 в соотношении APC:CD4 T-клетки, равном 2:1. Вновь в культуру добавляли длинный пептид в концентрации 10 мкг/мл. На этот раз использовали RPMI-5% ЭТС (Biosera, Ringmer, UK; с добавлением HEPES, пенициллина, стрептомицина, глютамина: Lonza; и β-меркаптоэтанола: Gibco). В день 7 клетки собирали, разделяли в фиколле и проводили слияние.

Слияние:

1×107 клеток BW5147 (коллекция клеточных культур Агентства защиты здоровья (Health Protection Agency), Salisbury, UK) и 1×106 линейных CD4 T-клеток смешивали вместе и промывали в бессывороточной среде при температуре 37°C в 50-мл пробирке с использованием максимальных параметров торможения на центрифуге для получения плотного осадка. Супернатант сливали и оставшийся супернатант удаляли пипеткой. Клетки оставляли на водяной бане на 5 минут, чтобы оставшиеся капли среды могли стечь, после чего капли удаляли пипеткой. Клеточный осадок осторожно, но тщательно ресуспендировали. Затем добавляли 1 мл ПЭГ (полиэтиленгликоль, 40-50% раствор, Sigma-Aldrich, St Louis, MA) с температурой 37°C в течение 45 секунд, держа клетки в мини-водяной бане в вытяжном шкафу. Клетки инкубировали при температуре 37°C в течение 45 секунд. 1 мл бессывороточной среды с температурой 37°C добавляли в течение 30 секунд, при этом поворачивая пробирку, затем таким же образом добавляли 2 мл и после этого также добавляли 3, 4, 10 и 30 мл, как указано выше. Пробирку очень медленно переворачивали и инкубировали при температуре 37°C в течение 5 минут. Затем клетки центрифугировали в течение 5 минут со скоростью 1300 об/мин при комнатной температуре (RT) без использования тормоза. Супернатант осторожно удаляли с помощью пипетки (примерно 1 мл оставляли над осадком). Добавляли 50 мл бессывороточной среды с температурой RT, не разрыхляя осадок клеток. Клетки вновь осаждали центрифугированием, как указано, и промывание повторяли, используя полную среду. Затем клетки ресуспендировали в 50 мл полной среды 10%-ЭТС с температурой RT и высаживали в четыре 96-луночных плоскодонных планшета (100 мкл/лунку). Вслед за этим в пробирку добавляли 38 мл полной среды RPMI-10% ЭТС и предыдущий этап повторяли дважды, заканчивая 3 серийными разбавлениями (всего 12 планшетов) и инкубировали при температуре 37°C. Через 48 часов 100 мкл 2x среды HAT (гипоксантин-аминоптерин-тимидин, Sigma-Aldrich, Saint Louis, MA) добавляли в каждую лунку. К 6 дню начинали появляться гибридомы. Клоны поддерживали в 1X среде HAT до достижения ими стабильности, затем переводили их в среду HT (гипоксантин-тимидин Sigma-Aldrich, Saint Louis, MA) на 2-3 недели, а затем в полную среду RPMI. Клоны регулярно замораживали, поскольку они могли стать нестабильными (90% ЭТС + 10% ДМСО).

Оценка антигенной специфичности клонов

100 мкл клеток гибридом культивировали с 5×104 клеток MGAR (линия человеческих клеток, экспрессирующих HLA-DRB1*1501, коллекция клеточных культур Агентства защиты здоровья, Salisbury, UK) в лунках плоскодонного 96-луночного планшета. В лунки добавляли 50 мкл полной среды RPMI-10% ЭТС, содержащей длинный пептид в концентрации 10 мкг/мл, или такой же объем ДМСО (разбавитель пептида). Через 48 ч 120 мкл супернатанта удаляли и проводили анализ ELISA (твердофазный иммуноферментный анализ) на IL-2 мыши. Клоны, продуцирующие IL-2, узнавали используемый антиген. Оставшиеся супернатанты замораживали при -20°C.

IL-2 ELISA

96-луночные планшеты (Immunosorb 96 well, Nunc, Roskilde, Denmark) покрывали по 50 мкл/лунку очищенными антителами крысы против IL-2 мыши в качестве захватывающих Ат (BD Biosciences, Oxford, UK), разведенными 1:250 в карбонатном буфере (3,56 г Na2CO3 (Sigma-Aldrich, Saint Louis, MA), 8,4 г NaHCO3 (Fisher Scientific, Loughborough, UK), 1 л воды Elgastat; pH 9,5) и инкубировали в течение ночи при температуре 4°C. После 2 промываний в PBS-Tween (1 л 10x PBS, 9 л дистиллированной воды, 0,5 мл Tween (Sigma-Aldrich, Saint Louis, MA)) добавляли 200 мкл/лунку PBS-10% ЭТС и инкубировали при RT в течение 1 часа. После 3 промываний в PBS-Tween, 50 мкл супернатанта или серийно разведенного стандарта IL-2 (BD Biosciences, Oxford, UK) (в PBS-10% ЭТС) добавляли в лунки и инкубировали 2 часа при RT. После 4 промываний в PBS-Tween (Sigma-Aldrich, Saint Louis, MA) добавляли 50 мкл/лунку биотинилированных антител крысы против IL-2 мыши (BD Biosciences, Oxford, UK), разведенных 1:1000 в 10% ЭТС/PBS, и инкубировали в течение 1 часа при RT. После 4 промываний добавляли 50 мкл/лунку конъюгата экстравидин-пероксидаза (Sigma-Aldrich, Saint Louis, MA), разведенного 1:1000 в PBS, и инкубировали 30 минут при RT. После 4 промываний добавляли 50 мкл/лунку раствора субстрата* и инкубировали при RT до отчетливого изменения цвета раствора. Реакцию останавливали, добавляя 50 мкл/лунку 2M H2SO4 (BDH, Poole, UK) и планшеты просчитывали при 450 нм (550 нм реф.) на ELISA-ридере (SpectraMax Pro, Molecular Device, Sunnyvale, CA). *Раствор субстрата: 10 мл фосфат-цитратного буфера 0,1 M (5,14 мл 0,2 M Na2HPO4 (BDH, Poole, UK), 4,86 мл 0,1 M цитрата (Sigma), 10 мл воды Elgastat), 0,1 мл TMB (размороженный 3,3',5,5'-тетраметилбензидин в концентрации 10 мг/мл в ДМСО, Sigma-Aldrich, Saint Louis, MA), 6 мкл пероксида водорода (Sigma-Aldrich, Saint Louis, MA).

Независящая от процессинга антигена система представления

Специфические клоны впоследствии тестировали в отношении их ответов на 15-членные пептиды (POP-1 до POP-12) с фиксированными или нефиксированными клетками MGAR. С этой целью, 1×105 клеток из отдельных клонов культивировали с 5×104 фиксированных или свежих клеток MGAR в 96-луночном плоскодонном планшете. Для фиксирования клеток MGAR 20×106 клеток MGAR инкубировали в течение 5 минут с 6 мл 0,5% параформальдегида (PFA, BDH, Poole, UK) (pH 7) при RT и затем добавляли 6 мл глицина (Wisher Scientific, Loughborough, UK) в концентрации 0,4 M для остановки реакции. Затем клетки промывали и ресуспендировали в RPMI-10% ЭТС. В отдельные лунки добавляли каждый из 15-членных пептидов в концентрации 10 мкг/мл, разведенный в RPMI-10% ЭТС. Лунку, содержащую ДМСО вместо пептида, использовали для каждого клона в качестве отрицательного контроля и лунку, содержащую длинный пептид, использовали в качестве положительного контроля. Через 48 часов культивирования собирали 120 мкл супернатанта и анализировали методом ELISA для оценки продуцирования IL-2.

Индукция толерантности путем введения эпитопа

Трансгенным мышам HLA-DRB*1501 предварительно вводили эпитоп в режиме эскалации дозы (0,1, 1, 10 и 3 раза 100 мкг) или 100 мкл PBS в день -15, -13, -11, -8, -6, -4. В день 0 проводили примирование мышей путем введения 100 мкг длинного пептида в CFA с 4 мг/мл Mycobacterium tuberculosis инъекцией в основание хвоста. Через 10 дней собирали паховые лимфатические узлы и селезенки. Пролиферацию и продуцирование цитокинов LNC и спленоцитами анализировали, как описано выше.

Для специалистов в данной области будут очевидны различные модификации и вариации описанных способов и системы по изобретению без отклонения от объема и сущности изобретения. Хотя изобретение описано применительно к конкретным вариантам осуществления, следует понимать, что заявленное изобретение не должно быть ограничено такими конкретными вариантами осуществления. Действительно, различные модификации описанных способов осуществления изобретения, которые очевидны для специалистов в области химии или молекулярной биологии, или родственных областях, должны входить в объем настоящего изобретения. Все публикации, упомянутые в приведенном выше описании, включены в настоящий документ посредством ссылки.

1. Пептид, способный связываться с молекулой MHC класса I или II in vitro и быть представленным T-клетке без процессинга антигена и который выбран из следующих пептидов PLP:

PLP 39-53: LTGTEKLIETYFSKN (SEQ ID NO. 7);

PLP 42-56: TEKLIETYFSKNYQD (SEQ ID NO. 8);

PLP 43-57: EKLIETYFSKNYQDY (SEQ ID NO. 9);

PLP 180-194: WTTCQSIAFPSKTSA (SEQ ID NO. 10);

PLP 181-195: TTCQSIAFPSKTSAS (SEQ ID NO. 11);

PLP 182-196: TCQSIAFPSKTSASI (SEQ ID NO. 12);

PLP 183-197: CQSIAFPSKTSASIG (SEQ ID NO. 13);

PLP 184-198: QSIAFPSKTSASIGS (SEQ ID NO. 14);

PLP 208-222: VLPWNAFPGKVCGSN (SEQ ID NO. 15);

PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI (SEQ ID NO. 1);

PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY (SEQ ID NO. 2) и

PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM (SEQ ID NO. 3).

2. Применение пептида по п.1 в лечении или профилактике демиелинизирующего заболевания у субъекта.

3. Применение пептида по п.2, где заболевание представляет собой рассеянный склероз.

4. Фармацевтическая композиция, содержащая эффективное количество одного или более пептидов по п.1 и фармацевтически приемлемый носитель, разбавитель или эксципиент, для применения в лечении или профилактике демиелинизирующего заболевания.

5. Способ лечения или профилактики демиелинизирующего заболевания у субъекта, который нуждается в этом, включающий этап введения пептида по п.1 субъекту.

6. Способ по п.5, где заболевание представляет собой рассеянный склероз.

7. Применение пептида по п.1 в производстве лекарственного средства, предназначенного для профилактики или лечения демиелинизирующего заболевания.

8. Применение по п.7, где заболевание представляет собой рассеянный склероз.



 

Похожие патенты:

Изобретение относится к области биотехнологии, а именно к способу идентификации модулятора вкуса. Указанное изобретение представляет собой метод анализа для измерения интернализации вкусовых рецепторов, который позволяет идентифицировать соединения, являющиеся модуляторами вкуса.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его функциональный фрагмент, способные к связыванию с PD-1.

Изобретение относится к области биотехнологии, конкретно к получению химерных антигенных рецепторов (CAR), называемых многоцепочечными CAR, и может быть применено в медицине для противоопухолевой терапии.

Изобретение относится к области биохимии, в частности к способу получения терапевтически активного слитого белка, содержащего группировку направленного взаимодействия с опухолью и по меньшей мере одну иммуномодулирующую группировку, противодействующую иммунной толерантности раковой клетки, а также к препарату для лечения эпителиальных форм рака, содержащему эффективное количество гомогенных терапевтически активных слитых белков, полученных указанным способом.

Изобретение относится к области биохимии, в частности к генетически модифицированному грызуну, экспрессирующему гуманизированный Т-клеточный рецептор (TCR) и содержащему в геноме своей зародышевой линии: нереаранжированную последовательность вариабельной области TCRα, и/или нереаранжированную последовательность вариабельной области TCRβ, к способу его получения, а также к его выделенной эмбриональной клетке и ткани.

Изобретение относится к области биохимии, в частности к генетически модифицированному грызуну, экспрессирующему гуманизированный Т-клеточный рецептор (TCR) и содержащему в геноме своей зародышевой линии: нереаранжированную последовательность вариабельной области TCRα, и/или нереаранжированную последовательность вариабельной области TCRβ, к способу его получения, а также к его выделенной эмбриональной клетке и ткани.

Изобретение относится к области биохимии, в частности к грызуну, который экспрессирует химерный человеческий/относящийся к грызуну белковый комплекс МНС II, а также к его клетке и ткане.

Изобретение относится к области биохимии, в частности к грызуну, который экспрессирует химерный человеческий/относящийся к грызуну белковый комплекс МНС II, а также к его клетке и ткане.

Изобретение относится к биотехнологии, конкретно к получению рекомбинантных белков человека, и может быть использовано для получения и очистки рекомбинантного белка GAGE1 человека.

Настоящее изобретение относится к области биотехнологии, в частности к способу выделения антител, обладающих различными степенями фукозилирования. Способ основан на аффинности связывания антител с Fc-рецептором, иммобилизованными на подложке.

Изобретение относится к биотехнологии. Описана интерферирующая рибонуклеиновая кислота (РНК), которая функционирует при поглощении видом насекомого-вредителя с подавлением экспрессии гена-мишени у указанного насекомого-вредителя, при этом РНК содержит по меньшей мере один сайленсирующий элемент, который является областью двухцепочечной РНК, содержащей соединенные комплементарные цепи, одна цепь из которых содержит или состоит из последовательности нуклеотидов, которая комплементарна целевой нуклеотидной последовательности в пределах гена-мишени, и при этом ген-мишень (i) выбран из группы генов, имеющих нуклеотидную последовательность, содержащую SEQ ID NO 122, 131, 144, 145, 178, 179 или комплементарную ей последовательность, или имеющих такую нуклеотидную последовательность, которая при оптимальном выравнивании и сравнении двух последовательностей по меньшей мере на 85% идентична SEQ ID NO 122, 131, 144, 145, 178, 179 или комплементарной ей последовательности, или (ii) у насекомого-вредителя является ортологом гена, имеющего нуклеотидную последовательность, содержащую SEQ ID NО 122, 131, 144, 145, 178, 179 или комплементарную ей последовательность, при этом два ортологических гена сходны по последовательности до такой степени, что при оптимальном выравнивании и сравнении двух генов ортолог имеет последовательность, которая по меньшей мере на 85% идентична последовательности, представленной в SEQ ID NО 122, 131, 144, 145, 178, 179, или (iii) выбран из группы генов, имеющих нуклеотидную последовательность, кодирующую аминокислотную последовательность, которая при оптимальном выравнивании и сравнении двух аминокислотных последовательностей является по меньшей мере на 85% идентичной аминокислотной последовательности, кодируемой SEQ ID NО 122, 131, 144, 145, 178, 179.

Изобретение относится к связывающему антитело полипептиду, представленному в любой из SEQ ID NO: с 1 по 18, и адсорбционному материалу для антитела или производного антитела, где связывающий антитело полипептид иммобилизован на водонерастворимом носителе.

Изобретение относится к области биотехнологии, конкретно к получению химерных антигенных рецепторов (CAR), называемых многоцепочечными CAR, и может быть применено в медицине для противоопухолевой терапии.

Изобретение относится к биотехнологии. Предложено применение раствора цитрата для удаления С-реактивного белка (CRP) с помощью аффинной хроматографии из биологических жидкостей.

Изобретение относится к области биохимии, в частности к генетически модифицированному грызуну, экспрессирующему гуманизированный Т-клеточный рецептор (TCR) и содержащему в геноме своей зародышевой линии: нереаранжированную последовательность вариабельной области TCRα, и/или нереаранжированную последовательность вариабельной области TCRβ, к способу его получения, а также к его выделенной эмбриональной клетке и ткани.

Изобретение относится к области биохимии, в частности к грызуну, который экспрессирует химерный человеческий/относящийся к грызуну белковый комплекс МНС II, а также к его клетке и ткане.

Изобретение относится к области биотехнологии, конкретно к биологически активным пептидам, и может быть использовано в медицине. На основе антимикробного пептида тахиплезина из гемоцитов мечехвоста, представителя семейства бета-шпилечных АМП, получен пептид Tach1[Ile11Asp].

Изобретение относится к области биотехнологии, конкретно к С5-связывающим полипептидам, содержащим С5-связывающий мотив ВМ, что может быть использовано в медицине. Получают С5-связывающий полипептид, содержащий С5-связывающий мотив ВМ, причем этот мотив состоит из аминокислотной последовательности, соответствующей EX2X3X4AX6X7EIDX11LPNLX16X17X18QWX21AFIX25X26LX28D, и применяют полученный полипептид для лечения связанного с С5 состояния, например для ингибирования гемолитического эффекта.

Изобретение относится к области биохимии, в частности к генетически модифицированному грызуну, который продуцирует человеческий или гуманизированный белок IL-7. Также раскрыта нуклеиновая кислота, кодирующая человеческий или гуманизированный белок IL-7, ES-клетка, указанного грызуна, клетка, которая содержит гуманизированный ген IL-7, ткань, которая содержит гуманизированный ген IL-7.

Настоящее изобретение относится к области биотехнологии, конкретно к иммунодепрессивным полипептидам, являющимся производными трансактиватора транскрипции (Tat), и может быть использовано в медицине для лечения аутоиммунного заболевания, ассоциированного с воспалением заболевания и/или нейродегенеративного заболевания.

Изобретение относится к области биохимии, в частности к рекомбинантному связывающему HER2 белку, содержащему по меньшей мере первую и вторую области анкириновых повторов, каждая из которых связывает внеклеточную область HER2.

Изобретение относится к области биотехнологии, конкретно к эпитопным пептидам, и может быть использовано в медицине для терапии демиелинизирующего заболевания, такого как рассеянный склероз. Получены пептидные фрагменты из протеолипидного белка : PLP 39-53: LTGTEKLIETYFSKN; PLP 42-56: TEKLIETYFSKNYQD; PLP 43-57: EKLIETYFSKNYQDY; PLP 180-194: WTTCQSIAFPSKTSA; PLP 181-195: TTCQSIAFPSKTSAS; PLP 182-196: TCQSIAFPSKTSASI; PLP 183-197: CQSIAFPSKTSASIG; PLP 184-198: QSIAFPSKTSASIGS; PLP 208-222: VLPWNAFPGKVCGSN; PLP 36-61: HEALTGTEKLIETYFSKNYQDYEYLI; PLP 179-206: TWTTCQSIAFPSKTSASIGSLCADARMY и PLP 207-234: GVLPWNAFPGKVCGSNLLSICKTAEFQM. Изобретение обеспечивает получение пептидного эпитопа PLP, способного связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена. 5 н. и 3 з.п. ф-лы, 15 ил., 5 пр.

Наверх