Способы и композиции для доставки в цнс арилсульфатазы а

Группа изобретений относится к медицине и касается стабильного состава для интратекального введения, содержащего белок арилсульфатазу A (ASA), полисорбат и фосфат. При этом указанный фосфат содержится в количестве не более 10 мМ. Группа изобретений также касается способа лечения болезни метахроматической лейкодистрофии, включающего этап интратекального введения нуждающемуся в этом субъекту указанного состава. Группа изобретений обеспечивает успешное интратекальное введение состава без возникновения значительной токсичности и иммунного ответа. 2 н. и 28 з.п. ф-лы, 9 пр., 46 табл., 56 ил.

 

[0001] Настоящая заявка испрашивает приоритет по предварительным заявкам на патент США под номерами 61/358,857 с датой подачи 25 июня, 2010; 61/360,786 с датой подачи 1 июля, 2010; 61/387,862 с датой подачи 29 сентября, 2010; 61/435,710 с датой подачи 24 января, 2011; 61/442,115 с датой подачи 11 февраля, 2011; 61/476,210 с датой подачи 15 апреля, 2011; и 61/495,268 с датой подачи 9 июня, 2011; каждая из которых включена в настоящую заявку посредством ссылки.

[0002] Родственными для данной заявки являются заявки на патент США, озаглавленным «Доставка терапевтических агентов в ЦНС», с такой же датой подачи; «Способы и композиции для доставки в ЦНС гепаран-N-сульфатазы», та же дата подачи; «Способы и композиции для доставки в ЦНС идуронат-2-сульфатазы», та же дата подачи; «Способы и композиции для доставки в ЦНС β-галактоцереброзидазы», та же дата подачи; «Лечение синдрома Санфилиппо типа B», та же дата подачи; каждая из которых включена в настоящую заявку посредством ссылки.

Предпосылки создания изобретения

[0003] Заместительная ферментная терапия (ЗФТ) включает системное введение субъектам природных или рекомбинантных белков и/или ферментов. Одобренные терапевтические средства обычно вводят субъектам внутривенно и обычно они эффективны в лечении соматических симптомов первичной ферментной недостаточности. В результате ограниченного распределения введенного внутривенно белка и/или фермента по клеткам и тканям центральной нервной системы (ЦНС) лечение заболеваний, имеющих этиологию, связанную с ЦНС, является особенно сложной задачей, поскольку введенные внутривенно белки и/или ферменты не проникают в достаточной мере через гематоэнцефалический барьер (ГЭБ).

[0004] Гематоэнцефалический барьер (ГЭБ) - это структурная система, состоящая из эндотелиальных клеток, функцией которых является защита центральной нервной системы (ЦНС) от вредных веществ в крови, таких как бактерии, макромолекулы (например, белки) и друге гидрофильне молекулы, путем ограничения проникновения подобных веществ через ГЭБ в спинномозговую жидкость (СМЖ) и ЦНС.

[0005] Существует несколько способов обойти ГЭБ для улучшения доставки терапевтического агента в мозг, в том числе прямая внутричерепная инъекция, кратковременная пермеабилизация ГЭБ и модификация активного агента, изменяющая распределение в тканях. Прямая инъекция терапевтического агента в ткани мозга полностью обходит сосудистую систему, но связана в первую очередь с риском осложнений (инфекция, повреждение тканей, иммунный ответ), которые возникают в результате внутричерепных инъекций и слабой диффузии активного агента из места введения. На настоящий момент прямое введение белков в мозговое вещество не обеспечило значительного терапевтического эффекта вследствие существования барьера для диффузии и ограниченного объема состава, который может быть введен. Была изучена диффузия с конвекцией через катетеры, размещенные в паренхиме мозга с использованием медленной долгосрочной инфузии (Bobo, et al., Proc. Natl. Acad. Sci. U.S.A 91, 2076-2080 (1994); Nguyen, et al. J. Neurosurg. 98, 584-590 (2003)), однако ни один способов одном из одобренных способов терапии не этот подход не используется для длительного лечения. Кроме того, размещение внутримозговых катетеров является крайне инвазивным и является менее желательной клинической альтернативой.

[0006] Также были предприняты попытки осуществить интратекальную (ИТ) инъекцию или введения белков в спинномозговую жидкость (СМЖ), но они также не привели к терапевтическому успеху. Одной из основных проблем в таком лечении является склонность активного вещества к очень плотному связыванию с эпендимной выстилкой желудочка, которое мешает последующей диффузии. В настоящее время отсутствуют разрешенные продукты для лечения генетического заболевания мозга путем прямой доставки агентов в СМЖ.

[0007] На самом деле, многие полагают, что барьер для диффузии на поверхности мозга, а также отсутствие эффективных и удобных способов доставки, являются слишком существенными препятствием для достижения соответствующего терапевтического эффекта в головном мозге при лечении любого заболевания.

[0008] Многие лизосомные болезни накопления затрагивают нервную систему, что особенно усложняет лечение этих болезней при помощи традиционных методов терапии. Часто встречаются значительные накопления глюкозоаминогликанов (ГАГ) в нейронах и в мозговых оболочках больных индивидов, что приводит к различным формам симптомов со стороны ЦНС. На сегодняшний день не известно случаев успешного лечения симптомов со стороны ЦНС, вызванных лизосомными болезнями, использованием доступных средств.

[0009] Таким образом, остается большая потребность в эффективной доставке терапевтических веществ в мозг. В частности, существует большая потребность в более эффективной доставке активных веществ в центральную нервную систему для лечения лизосомных болезней накопления.

Краткое описание изобретения

[0010] Настоящее изобретение обеспечивает эффективный и менее инвазивный подход для прямой доставки терапевтических агентов в центральную нервную систему (ЦНС). В частности, настоящее изобретение основано на неожиданно обнаруженном факте, заключающемся в том, что замещающий фермент (например, арилсульфатаза A (ASA)) для лизосомных болезней накопления (например, МЛД) может быть напрямую введен в спинномозговую жидкость (СМЖ) субъекта, нуждающегося в лечении, в высокой концентрации (например, более 3 мг/мл, 4 мг/мл, 5 мг/мл, 10 мг/мл или больше), благодаря чему фермент эффективно и активно проникает через различные поверхности и распространяется по различным областям мозга, включая глубокие области мозга.

Совершенно неожиданно, авторы настоящего изобретения продемонстрировали, что доставка такой высокой концентрации белка может быть достигнута с использованием простых физиологических или буферных растворов, не вызывая существенных побочных эффектов, таких как резко выраженный иммунный ответ, у субъекта. Таким образом, настоящее изобретение обеспечивает высокоэффективный, клинически желательный и удобный для пациента подход для прямой доставки в ЦНС для лечения различных заболеваний и нарушений, связанных с компонентами ЦНС, в частности, лизосомных болезней накопления. Настоящее изобретение представляет собой значительное достижение в области направленной доставки веществ в ЦНС и фермент-заместительной терапии.,

[0011] Как подробно описано ниже, настоящее авторы настоящего изобретения разработали стабильные составы для эффективного интратекального (ИТ) введения белка арилсульфатазы A (ASA). Предполагается, однако, что различные стабильные составы, описанные в настоящей заявке, являются в целом подходящими для доставки в ЦНС терапевтических агентов, включая различные другие лизосомальные ферменты. Действительно, стабильные составы согласно настоящему изобретению могут быть использованы для доставки в ЦНС с помощью различных способов и путей, включая, но не ограничиваясь перечисленными: интрапаренхимальное, интрацеребральнов; интраветрикулярное церебральное (ИСВ), интратекальное (т.е. ИТ-люмбальное, ИТ-мостомозжечковое) введение или любой другой метод и путь прямого или непрямого введения в ЦНС и/или в СМЖ.

[0002] Предполагается также, что различные стабильные составы, представленные в настоящей заявке, являются в целом подходящими для доставки в ЦНС терапевтических агентов, таких как терапевтические белки, включая различные замещающие ферменты для лечения болезней лизосомного накопления. В некоторых вариантах реализации замещающий фермент может являться синтетическим, рекомбинантным, генактивированным или природным ферментом.

[0003] В различных вариантах реализации настоящее изобретение включает стабильный состав для прямого интратекального введения в ЦНС, включающий белок арилсульфатазу A (ASA), соль и поверхностно-активное вещество полисорбат. В некоторых вариантах реализации белок ASA присутствует в диапазоне концентраций примерно 1-300 мг/мл (т.е. 1-250 мг/мл, 1-200 мг/мл, 1-150 мг/мл, 1-100 мг/мл, 1-50 мг/мл). В некоторых вариантах реализации белок ASA присутствует в концентрации, выбранной из: 2 мг/мл, 3 мг/мл, 4 мг/мл, 5 мг/мл, 10 мг/мл, 15 мг/мл, 20 мг/мл, 25 мг/мл, 30 мг/мл, 35 мг/мл, 40 мг/мл, 45 мг/мл, 50 мг/мл, 60 мг/мл, 70 мг/мл, 80 мг/мл, 90 мг/мл, 100 мг/мл, 150 мг/мл, 200 мг/мл, 250 мг/мл, или 300 мг/мл или выше.

[0004] В различных вариантах реализации настоящее изобретение включает стабильный состав для любого применения, приведенного в настоящей заявке, в которых белок ASA включает аминокислотную последовательность SEQ ID NO:1. В некоторых вариантах реализации белок ASA включает аминокислотную последовательность, по меньшей мере на 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% или 98% идентичную последовательности SEQ ID NO:1. В некоторых вариантах реализации стабильный состав для любого применения, описанного в настоящей заявке, включает соль. В некоторых вариантах реализации солью является NaCl. В некоторых вариантах реализации NaCl присутствует в диапазоне концентраций примерно 0-300 мМ (т.е. 0-250 мМ, 0-200 мМ, 0-150 мМ, 0-100 мМ, 0-75 мМ, 0-50 мМ или 0-30 мМ). В некоторых вариантах реализации NaCl присутствует в диапазоне концентраций примерно 137-154 мМ. В некоторых вариантах реализации NaCl присутствует в концентрации примерно 154 мМ.

[0005] В различных вариантах реализации настоящее изобретение включает стабильный состав согласно любому из вариантов реализации, представленных в настоящей заявке, в котором поверхностно-активное вещество полисорбат выбрано из группы, включающей полисорбат 20, полисорбат 40, полисорбат 60, полисорбат 80 и их комбинации. В некоторых вариантах реализации поверхностно-активное вещество полисорбат является полисорбатом 20. В некоторых вариантах реализации полисорбат 20 присутствует в диапазоне концентраций примерно 0-0,02%. В некоторых вариантах реализации полисорбат 20 присутствует в диапазоне концентраций примерно 0-0,005%.

[0006] В различных вариантах реализации настоящее изобретение включает стабильный состав согласно любому из вариантов реализации, представленных в настоящей заявке, причем указанный состав дополнительно включает буферный агент. В некоторых вариантах реализации, буферный агент выбран из группы, состоящей из фосфата, гистидина и сукцината, трис (гидроксиметил) аминометана («Трис») и их комбинаций. В некоторых вариантах реализации агентом для буферизации является фосфат. В некоторых вариантах реализации фосфат присутствует в концентрации не выше 50 мМ (т.е. не выше, чем 45 мМ, 40 мМ, 35 мМ, 30 мМ, 25 мМ, 20 мМ, 15 мМ, 10 мМ или 5 мМ). В некоторых вариантах реализации фосфат присутствует в концентрации не выше 20 мМ. В различных вариантах реализации настоящее изобретение включает стабильный состав согласно любому из вариантов реализации, представленных в настоящей заявке, в которых состав имеет pH примерно 3,0-8,0 (т.е. примерно 4-7,5, 5-8, 5-7,5, 5-6,5, 5-7,0, 5,5-8,0, 5,5-7,7, 5.5-6,5, 6-7,5 или 6-7,0). В некоторых вариантах реализации состав имеет pH примерно 5,5-6,5 (т.е. 5,5, 6,0, 6,1, 6,2, 6,3, 6,4 или 6,5). В некоторых вариантах реализации состав имеет pH примерно 6,0.

[0007] В различных вариантах реализации настоящее изобретение включает стабильный состав согласно любому из вариантов реализации, представленных в настоящей заявке, в которых состав является жидким составом. В различных вариантах реализации настоящее изобретение включает стабильный состав согласно любому из вариантов реализации, представленных в настоящей заявке, в которых состав имеет лекарственную форму лиофилизированного сухого порошка.

[0008] В некоторых вариантах реализации настоящее изобретение включает стабильный состав для интратекального введения, включающий белок арилсульфатазу A в концентрации примерно 1-300 мг/мл, NaCl в концентрации примерно 154 мМ, полисорбат 20 в концентрации примерно 0,005% и pH примерно 6,0. В некоторых вариантах реализации белок ASA присутствует в концентрации примерно 10 мг/мл. В некоторых вариантах реализации белок ASA присутствует в концентрации примерно 30 мг/мл, 40 мг/мл, 50 мг/мл, 100 мг/мл, 150 мг/мл, 200 мг/мл, 250 мг/мл или 300 мг/мл.

[0009] В различных аспектах настоящее изобретение включает контейнер, содержащий дозированную лекарственную форму стабильного состава в различных вариантах реализации, представленных в настоящей заявке. В некоторых вариантах реализации контейнер может быть выбран из группы, включающей ампулы, виалы, бутылки, картриджи, резервуары, шприцы «lyo-jects» или предварительно заполненные шприцы. В некоторых вариантах реализации контейнер является предварительно заполненным шприцем. В некоторых вариантах реализации предварительно заполненный шприц выбран из группы, включающей шприцы из боросиликатного стекла с термически обработанным силиконовым покрытием, шприцы из боросиликатного стекла с нанесенным слоем силикона и пластиковые шприцы без силикона. В некоторых вариантах реализации стабильный состав присутствует в объеме менее чем 50 мл (т.е. менее чем 45 мл, 40 мл, 35 мл, 30 мл, 25 мл, 20 мл, 15 мл, 10 мл, 5 мл, 4 мл, 3 мл, 2,5 мл, 2,0 мл, 1,5 мл, 1,0 мл или 0,5 мл). В некоторых вариантах реализации стабильный состав присутствует в объеме менее чем 3,0 мл.

[0010] В различных аспектах реализации настоящее изобретение включает способы лечения метахроматической лейкодистрофии, включающий интратекальное введение нуждающемуся в этом субъекту состава согласно любому из вариантов реализации, представленных в настоящей заявке.

[0011] В некоторых вариантах реализации настоящее изобретение включает способ лечения метахроматической лейкодистрофии, включающий интратекальное введение нуждающемуся в этом субъекту состава, включающего белок арилсульфатазу A (ASA) в концентрации примерно 1-300 мг/мл, NaCl в концентрации примерно 154 мМ, полисорбат 20 в концентрации примерно 0,005%, и pH примерно 6,0.

[0012] В некоторых вариантах реализации интратекальное введение не вызывает у субъекта существенных побочных эффектов, таких как тяжелая иммунная реакция. В некоторых вариантах реализации интратекальное введение не вызывает у субъекта существенного адаптивного T-клеточного иммунного ответа.

[0013] В некоторых вариантах реализации интратекальное введение состава обеспечивает доставку белка арилсульфатазы A в различные ткани-мишени в головном мозге, спинном мозге и/или периферических органах. В некоторых вариантах реализации интратекальное введение состава обеспечивает доставку белка арилсульфатазы A к тканям-мишеням головного мозга. В некоторых вариантах реализации ткани-мишени головного мозга включают белое вещество и/или нейроны в сером веществе. В некоторых аспектах белок арилсульфатаза A доставляется к нейронам, клеткам глии, периваскулярным клеткам и/или менингеальным клеткам. В некоторых вариантах реализации белок арилсульфатаза A доставляется к нейронам в спинном мозге.

[0014] В некоторых вариантах реализации интратекальное введение состава дополнительно обеспечивает системную доставку белка ASA в периферические клетки-мишени. В некоторых вариантах реализации периферические клетки-мишени выбраны из группы, включающей печень, почки, селезенку и/или сердце.

[0015] В некоторых вариантах реализации интратекальное введение состава приводит к его лизосомальной локализации в тканях-мишенях головного мозга, нейронах спинного мозга и/или периферических тканях-мишенях. В некоторых вариантах реализации интратекальное введение состава приводит к снижению накопления сульфатидов в тканях-мишенях головного мозга, нейронах спинного мозга и/или периферических тканях-мишенях. В некоторых вариантах реализации накопление сульфатидов снижается по меньшей мере на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, в 1 раз, в 1,5 раза или в 2 раза по сравнению с контролем (т.е. накоплением у субъекта ГАГ до терапии). В некоторых вариантах реализации интратекальное введение состава приводит к снижению вакуолизации в нейронах (по меньшей мере, на 20%, 40%, 50%, 60%, 80%, 90%, в 1 раз, в 1,5 раза или в 2 раза по сравнению с контролем). В некоторых вариантах реализации нейроны содержат клетки Пуркинье.;

[0016] В некоторых вариантах реализации интратекальное введение состава приводит к повышению ферментативной активности ASA в тканях-мишенях головного мозга, нейронах спинного мозга и/или периферических тканях-мишенях. В некоторых вариантах реализации ферментативная активность ASA повышается, по меньшей мере в 1 раз, в 2 раза, в 3 раза, в 4 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз или в 10 раз по сравнению с контролем (т.е. эндогенной ферментативной активностью у субъекта до лечения). В некоторых вариантах реализации повышенная ферментативная активность ASA составляет, по меньшей мере, примерно 10 нмоль/ч/мг, 20 нмоль/ч/мг, 40 нмоль/ч/мг, 50 нмоль/ч/мг, 60 нмоль/ч/мг, 70 нмоль/ч/мг, 80 нмоль/ч/мг, 90 нмоль/ч/мг, 100 нмоль/ч/мг, 150 нмоль/ч/мг, 200 нмоль/ч/мг, 250 нмоль/ч/мг, 300 нмоль/ч/мг, 350 нмоль/ч/мг, 400 нмоль/ч/мг, 450 нмоль/ч/мг, 500 нмоль/ч/мг, 550 нмоль/ч/мг или 600 нмоль/ч/мг.

[0017] В некоторых вариантах реализации ферментативная активность ASA повышается в поясничном отделе. В некоторых вариантах реализации повышенная ферментативная активность ASA в поясничном отделе составляет, по меньшей мере, примерно 500 нмоль/ч/мг, 600 нмоль/ч/мг, 700 нмоль/ч/мг, 800 нмоль/ч/мг, 900 нмоль/ч/мг, 1000 нмоль/ч/мг, 1500 нмоль/ч/мг, 2000 нмоль/ч/мг, 3000 нмоль/ч/мг, 4000 нмоль/ч/мг, 5000 нмоль/ч/мг, 6000 нмоль/ч/мг, 7000 нмоль/ч/мг, 8000 нмоль/ч/мг, 9000 нмоль/ч/мг или 10000 нмоль/ч/мг.

[0018] В некоторых вариантах реализации интратекальное введение состава снижению интенсивности, тяжести или частоты, или замедление проявления по меньшей одного симптома или признака болезни МЛД. В некоторых вариантах реализации по меньшей мере один симптом или признак болезни МЛД представляет собой повышенное внутричерепное давление, заместительную гидроцефалию, накопление сульфатированных гликолипидов в миелиновых оболочках в центральной и периферической нервной системе и во внутренних органах, прогрессирующую демиелинизацию и потерю аксонов в ЦНС и ПНС и/или двигательную и когнитивную дисфункцию.

[0019] В некоторых вариантах реализации интратекальное введение осуществляют один раз каждые 2 недели. В некоторых вариантах реализации интратекальное введение осуществляют один раз каждый месяц. В некоторых вариантах реализации интратекальное введение осуществляют один раз каждые 2 месяца. В некоторых вариантах реализации интратекальное введение применяют в сочетании с внутривенным введением. В некоторых вариантах реализации внутривенное введение осуществляют не чаще, чем один раз каждую неделю. В некоторых вариантах реализации интратекальное введение осуществляют не чаще, чем один раз каждые две недели. В некоторых вариантах реализации интратекальное введение осуществляют не чаще, чем один раз каждый месяц. В некоторых вариантах реализации интратекальное введение осуществляют не чаще, чем один раз каждые два месяца. В определенных вариантах реализации интратекальное введение осуществляют чаще, чем один раз в месяц, например, введение дважды в неделю, один раз в неделю, один раз через неделю или два раза в месяц.

[0020] В некоторых вариантах реализации внутривенное и интратекальное введение осуществляют в один и тот же день. В некоторых вариантах реализации внутривенное и интратекальное введение не осуществляют в течение некоторого периода времени между введениями, например, в пределах по меньшей мере 2 дней, в пределах по меньшей мере 3 дней, в пределах по меньшей мере 4 дней, в пределах по меньшей мере 5 дней, в пределах по меньшей мере 6 дней, в пределах по меньшей мере 7 дней или, по меньшей мере в пределах по меньшей мере одной недели. В некоторых вариантах реализации внутривенное и интратекальное введение осуществляют по переменному графику, например, переменное введение еженедельно, раз в две недели, два раза в месяц или ежемесячно. В некоторых вариантах реализации внутривенное введение заменяют интратекальным введением в графике введений, например, при графике внутривенного введения один раз в неделю, один раз в две недели, два раза в месяц или один раз в месяц, каждое третье или четвертое или пятое внутривенное введение в этом графике может быть заменено на интратекальное введение вместо внутривенного введения.

[0021] В некоторых вариантах реализации внутривенное и интратекальное введения осуществляют последовательно, например, сначала осуществляют внутривенное введение (например, еженедельно, раз в две недели, два раза в месяц или ежемесячное, дозирование в течение двух недель, месяца, двух месяцев, трех месяцев, четырех месяцев, пяти месяцев, шести месяцев или года и более) с последующим ИТ введением (например, еженедельно, раз в две недели, два раза в месяц, или ежемесячно, дозирование в течение более двух недель, месяца, двух месяцев, трех месяцев, четырех месяцев, пяти месяцев, шести месяцев или года или более). В некоторых вариантах реализации интратекальное введение осуществляют первым (например, еженедельно, раз в две недели, два раза в месяц, ежемесячно, раз в два месяца, раз в три месяца, дозирование в течение двух недель, месяца, двух месяцев, трех месяцев, четырех месяцев, пяти месяцев, шести месяцев или года, или более) с последующим внутривенным введением (например, еженедельно, раз в две недели, два раза в месяц или ежемесячно, дозирование в течение более двух недель, месяца, двух месяцев, трех месяцев, четырех месяцев, пяти месяцев, шести месяцев или года, или более).

[0022] В некоторых вариантах реализации интратекальное введение применяют в отсутствие внутривенного введения.

[0023] В некоторых вариантах реализации интратекальное введение применяют в отсутствие сопутствующей иммуносупрессорной терапии.

Краткое описание графических материалов

[0024] Фигура 1 иллюстрирует показательные данные по концентрации арислульфатазы A (rhASA) в сыворотке после BB введения.

[0025] Фигура 2 иллюстрирует показательные данные по концентрации rhASA в сыворотке после ИТ люмбального введения.

[0026] Фигура 3 иллюстрирует показательные данные по концентрации rhASA в СМЖ после BB введения.

[0027] Фигура 4 иллюстрирует показательные данные по концентрации rhASA в СМЖ после ИТ люмбального введения.

[0028] Фигура 5 иллюстрирует показательное исследование влияния буфера и pH на температурную стабильность rhASA.

[0029] Фигура 6 иллюстрирует показательный анализ rhASA методом электрофореза в полиакриламидном геле (ПААГ) с додецилсульфатом натрия (ДСН) (окрашивание Кумасси) после хранения в течение 2 недель при температуре 40±2°C.

[0030] Фигура 7 иллюстрирует показательный анализ rhASA в составе для ИТ введения методом электрофореза в ПААГ с ДСН (окрашивание Кумасси) после хранения в течение 3 месяцев при температуре 5 и 25°C.

[0031] На Фигуре 8 показан показательный внешний вид лекарственной субстанции и лекарственного препарата rhASA после 48 часов перемешивания (A) и встряхивания (B).

[0032] На Фигуре 9 показан показательный внешний вид лекарственного препарата rhASA (без P20) с (n=2) и без свободного пространства (n=1) над продуктом после перемешивания в течение 48 часов.

[0033] Фигура 10 иллюстрирует показательные данные по буферной емкости лекарственной субстанции rhASA в сравнении с контрольным буфером при титровании хлористоводородной кислотой.

[0034] На Фигуре 11 приведены показательные данные по буферной емкости лекарственной субстанции rhASA в сравнении с контрольным буфером при титровании 1 М гидроксидом натрия.

[0035] На Фигуре 12 изображены показательные образцы rhASA в солевом растворе, pH 6,0, с различной концентрацией.

[0036] Фигура 13 иллюстрирует показательный анализ rhASA методом эксклюзионной ВЭЖХ (pH подвижной фазы 5,5) в 154 мМ NaCl, pH 5,9.

[0037] Фигура 14 иллюстрирует показательный анализ rhASA в 154 мМ NaCl, pH 5,9 методом эксклюзионной ВЭЖХ (pH подвижной фазы 7,0).

[0038] Фигура 15 иллюстрирует показательны профили эксклюзионнной хроматографии образцов rhASA в начальной точке отсчета времени и образцов, хранившихся в течение 11 месяцев изучения стабильности в 154 мМ NaCl, pH 5.

[0039] На Фигуре 16 приведена типичная микрофотография тканей мозга, мозговых оболочек, инфильтратов (группы со средними и высокими дозами, оба пола) после лечения.

[0040] На Фигуре 17 приведена другая показательная микрофотография тканей мозга, мозговых оболочек, инфильтратов (группы со средними и высокими дозами, оба пола) после лечения.

[0041] На Фигуре 18 приведена показательная микрофотография тканей мозга, периваскулярных, инфильтратов (группы со средними дозами - мужчины; группы с высокими дозами - женщины) после лечения.

[0042] На Фигуре 19 приведено показательное окрашивание с использованием альцианового синего спинного мозга иммунотолерантных мышей МЛД, которые получали rhASA, и результаты, демонстрирующие уменьшение сульфатидов, которое было определено путем окрашивания с использованием альцианового синего шейного отдела спинного мозга у животных, которые получали интратекальные инъекции рекомбинантного hASA в 1, 8, 15 и 22 день в дозе 520 мг/кг массы мозга, или контрольных мышей, которым вводили наполнитель. Как показано, обработка путем интратекального введения рекомбинантного hASA приводила к снижению накопления сульфатидов в спинном мозге, в том числе в шейном отделе спинного мозга.

[0043] Фигура 20 иллюстрирует показательный морфометрический анализ окрашивания с использованием альцианового синего отделов позвоночника у иммунотолерантных мышей МЛД, получавших rhASA, включая типичные результаты, иллюстрирующие оптическую плотность альцианового синего всего спинного мозга (О-СМ), всего серого вещества (О-СВ), серого вещества люмбального отдела (Л-СВ), серого вещества шейного отдела (Ц-СВ), всего белого вещества (О-БВ), белого вещества люмбального отдела (Л-БВ) и белого вещества шейного отдела (Ц-БВ), как определено с; использованием морфометрического анализа. Статистически значимое уменьшение окрашивания, показанное окрашиванием альцианового синего, было обнаружено у животных, получавших rhASA, по сравнению с контрольными мышами, которым вводили наполнитель.

[0044] На Фигуре 21 показано показательное уменьшение окрашивания на LAMP в белом веществе (фимбрия) иммунотолерантных мышей с МЛД, получавших rhASA, приведены показательные результаты, иллюстрирующие уровень LAMP-1 в бахромке, определенный с использованием иммуногистохимии. Увеличение 20X. Показано, что обработка путем интратекального введения rhASA приводила к уменьшению LAMP-1 в белом веществе головного мозга.

[0045] На Фигуре 22 приведены результаты показательного морфометрического анализа окрашивания на LAMP тканей мозга иммунотолерантных мышей МЛД, получавших rhASA, и изображены показательные результаты, иллюстрирующие интенсивность окрашивания на LAMP-1 в мозолистом теле (МТ), бахромке (Б), белом веществе мозжечка (Мозж-БВ) и стволе мозга (СтМ) животных, получавших 20 мг/кг внутривенно rhASA, 300 мг/кг массы мозга интратекально rhASA, 520 мг/кг массы мозга внутривенно rhASA или контрольных мышей, которым вводили наполнитель.

[0046] Фигура 23 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения наполнителя раз в две недели в течение 6 месяцев - общая некропсия.

[0047] Фигура 24 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 1,8 мг раз в две недели в течение 6 месяцев - общая некропсия.

[0048] Фигура 25 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 6,0 мг раз в две недели в течение 6 месяцев - общая некропсия.

[0049] Фигура 26 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 18,6 мг раз в две недели в течение 6 месяцев - общая некропсия.

[0050] Фигура 27 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения раз в две недели (ФСБ как контроль) в течение 6 месяцев - прижизненное вскрытие.

[0051] Фигура 28 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения РДН наполнителя в течение 6 месяцев - прижизненное вскрытие.

[0052] Фигура 29 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 1,8 мг раз в две недели в течение 6 месяцев - прижизненное вскрытие.

[0053] Фигура 30 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 6,0 мг раз в две недели в течение 6 месяцев - прижизненное вскрытие.

[0054] Фигура 31 иллюстрирует в качестве примера концентрацию rhASA во фрагментах тканей головного мозга молодых длиннохвостых макак после ИТ введения rhASA в дозе 18,6 мг раз в две недели в течение 6 месяцев - прижизненное вскрытие.

[0055] Фигура 32 иллюстрирует в качестве примера концентрацию rhASA в выбранных фрагментах ткани головного мозга, взятых с поверхности мозга животных с контрольным устройством, животных, которым вводили наполнитель, 1,8 мг, 6,0 мг и 18,6 мг (самцы и самки разделены, контрольные данные для эксперимента с устройством представляют собой данные, полученные при прижизненном вскрытии, все остальные данные получены при общей некропсии).

[0056] Фигура 33 иллюстрирует в качестве примера концентрацию rhASA в выбранных фрагментах ткани из глубокого белого вещества головного мозга животных с контрольным устройством, животных, которым вводили наполнитель, 1,8 мг, 6,0 мг и 18,6 мг (самцы и самки разделены, контрольные данных для эксперимента с устройством представляют собой данные, полученные при прижизненном вскрытии, все остальные данные получены при общей некропсии.

[0057] Фигура 34 иллюстрирует в качестве примера концентрацию rhASA в выбранных фрагментах ткани из глубокого серого вещества головного мозга животных с контрольным устройством, животных, которым вводили наполнитель, 1,8 мг, 6,0 мг и 18,6 мг (самцы и самки разделены, контрольные данных для эксперимента с устройством представляют собой данные, полученные при прижизненном вскрытии, все остальные данные получены при общей некропсии.

[0058] Фигура 35 иллюстрирует в качестве примера концентрацию rhASA в выбранных фрагментах ткани из различных областей головного мозга животных с контрольным устройством, животных, которым вводили наполнитель, 1,8 мг, 6,0 мг и 18,6 мг (самцы и самки разделены, контрольные данных для эксперимента с устройством представляют собой данные, полученные при прижизненном вскрытии, все остальные данные получены при общей некропсии).

[0059] Фигура 36 иллюстрирует в качестве примера концентрацию rhASA в отделах позвоночника молодых длиннохвостых макак после ИТ введения раз в две недели в течение 6 месяцев - прижизненное вскрытие.

[0060] Фигура 37 иллюстрирует в качестве примера концентрацию rhASA в отделах позвоночника молодых длиннохвостых макак после ИТ введения раз в две недели в течение 6 месяцев - прижизненное вскрытие.

[0061] Фигура 38 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0062] Фигура 39 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0063] Фигура 40 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0064] Фигура 41 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0065] Фигура 42 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0066] Фигура 43 иллюстрирует в качестве примера анатомическое положение некоторых фрагментов тканей головного мозга.

[0067] Фигура 44A-G иллюстрирует концентрацию рекомбинантной человеческой арилсульфатазы (rhASA) в выделенных фрагментах тканей головного мозга взрослых и молодых длиннохвостых макак, которым инъецировали либо наполнитель, либо 1,8 мг rhASA или 18,6 мг rhASA. Каждая из Фигур 44A-G соответствует области ткани головного мозга, показанной на Фигуре 39.

[0068] Фигура 45A и B иллюстрирует показательное сравнение концентрации рекомбинантной человеческой арилсульфатазы A (rhASA), определенной в глубоком белом веществе (Фигура 45A) или в глубоком сером веществе (Фигура 45B) тканей мозга взрослых или молодых длиннохвостых макак, которые получали интратекальные или интрацеребровентрикулярные инъекции rhASA.

[0069] Фигура 46А иллюстрирует в качестве примера концентрации rhASA, определенные в нескольких фрагментах тканей, полученных у молодых (12 месяцев от роду) длиннохвостых макак, которые получали интратекальные инъекции 18,6 мг рекомбинантной человеческой арилсульфатазы A (rhASA). Как показано на обоих Фигурах 46A и B, концентрация rhASA, доставленного в ткани, была в пределах или превышала необходимую терапевтическую концентрацию 2,5 нг/мг белка. Анатомическими областями тканей мозга, которые соответствуют образцам ткани, показанным на Фигуре 46A и Фигуре 46B, являются: подкорковое белое вещество (1); перивентрикулярное белое вещество и глубокое белое вещество (2); подкорковое белое вещество (3); подкорковое белое вещество (4); внутренняя капсула (5); хвостатое ядро внутренней капсулы (6); глубокое белое вещество (7); подкорковое белое вещество и кора (8); скорлупа (9); подкорковое белое вещество и кора височной доли (10); глубокое серое вещество (11); глубокое серое вещество (12); перивентрикулярное и подкорковое лобной доли (13); подкорковое белое вещество, корковое поверхностное вещество (14); мозолистое тело и околомозолистое подкорковое белое вещество (15); глубокое подкорковое белое вещество (16); глубокое серое вещество (17); глубокое серое вещество (18); перивентрикулярное белое вещество (19); глубокое подкорковое белое вещество (20); гиппокамп (21); мозолистое тело (22); глубокое белое вещество (23); подкорковое белое вещество, затылочная доля (24); и белое вещество мозжечка (25).

[0070] На Фигуре 47A показаны участки тканей глубокого белого вещества, полученного от длиннохвостых макак, которые получали интратекальные инъекции 1,8 мг rhASA. Фигура 47B иллюстрирует иммуноокрашивание тканей глубокого белого вещества и обнаруженное распределение rhASA в соответствующих клетках. На фигуре 142B белок (ASA) показан в правом нижнем окне. Фигура 47C иллюстрирует, что ИТ введенная rhASA демонстрирует органельную колокализацию в тканях глубокого белого вещества у длиннохвостых макак и, в частности, в лизосомах. На Фигуре 47C в верхнем левом окне показано иммуноокрашивание на ASA.

[0071] На Фигуре 48 приведено сравнение распределения 124I-меченой арилсульфатазы (rhASA) с использованием ПЭТ-сканирования через 24 часа после ИТ или ИЦВ введения длиннохвостым макакам rhASA, меченной указанным способом.

[0072] Фигура 49 иллюстрирует распределение 124I-меченой ASA сразу после ИЦВ введения длиннохвостым макакам и сравнение распределения ИТ введенной 124I-меченой ASA в течение 2-5 часов. Как показано, ИТ введение доставляет 124I-меченую ASA в те} же самые исходные отделы (цистерна и проксимальный отдел позвоночника), как это показано для ИЦВ введения.

[0073] На Фигуре 50 приведены результаты показательного ИЦВ и ИТ введения на модели мыши.

[0074] На Фигуре 51 показан пример устройства интратекальной доставки лекарственных препаратов (УИДЛС).

[0075] На Фигуре 52 показан пример низкопрофильной интратекально имплантируемой системы доступа PORT-A-CATH.

[0076] На Фигуре 53 показан пример устройства интратекальной доставки лекарственных препаратов (УИДЛС).

[0077] На Фигуре 54 показан пример устройства интратекальной доставки лекарственных препаратов (УИДЛС), которое позволяет вводить в домашних условиях ферменты в ЦНС при заместительной ферментной терапии (ЗФТ).

[0078] Фигура 55 иллюстрирует типичную схему устройства интратекальной доставки лекарственных препаратов (УИДЛС) с защитным механизмом.

[0079] На Фигуре 56A показан пример расположения УИДЛС на теле пациента. На Фигуре 56B показаны различные компоненты устройства интратекальной доставки лекарственных препаратов (УИДЛС); на Фигуре 56C показан пример расположения внедренного в тело пациента устройства для ИТ люмбальной инъекции.

Определения

[0090] Для облегчения понимания настоящего изобретения ниже даны определения некоторых терминов. Дополнительные определения следующих терминов и другие термины приведены в тексте описания.

[0091] Примерно или около: В настоящей заявке термин "примерно" или "около" применительно к одному или более рассматриваемым значениям, относится к значению, которое близко к указанному эталонному значению. В некоторых вариантах реализации термин "примерно" или "около" относится к диапазону значений, которые входят в диапазон 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% или менее в любом направлении (больше или меньше) от; установленного эталонного значения, если не оговорено иное или другое не очевидно из контекста (кроме случаев, когда такое значение превышает 100% от возможного значения).

[0092] Улучшение: В настоящей заявке "улучшение" означает предотвращение, сокращение или временное облегчение состояния, или улучшение состояния субъекта. Улучшение включает, но не обязательно, полное выздоровление или полное предотвращение болезненного состояния. В некоторых вариантах реализации улучшение включает повышение уровней соответствующего белка или его активности, которые являются недостаточными в соответствующих больных тканях.

[0093] Биологическая активность: В настоящей заявке выражение "биологическая активность" относится к характеристике любого агента, который обладает активностью в биологической системе и, в частности, в организме. Например, агент, который при введении в организм демонстрирует биологическое влияние на организм, считается биологически активным. В конкретных вариантах реализации, в случаях, когда белок или полипептид является биологически активными, ту часть белка или полипептида, которая обладает по меньшей мере одним видом биологической активности белка или полипептида, как правило, называют "биологически активной" частью.

[0094] Наполнитель: В настоящей заявке термин "наполнитель" относится к соединению, которое добавляет массу лиофилизированной смеси и вносит вклад в физическую структуру лиофилизированной таблетки (например, облегчает производство по существу однородной лиофилизированной таблетки, поддерживающей структуру с открытыми порами). Примеры таких наполнителей включают маннитол, глицин, хлорид натрия, гидроксиэтилкрахмал, лактозу, сахарозу, трегалозу, полиэтиленгликоль и декстран.

[0095] Катион-независимый манноза-6-фосфатный рецептор (CI-MRP): В настоящей заявке термин "катион-независимый манноза-6-фосфатный рецептор (CI-MRP)" относится к клеточным рецепторам, которые связывают фрагменты манноза-6-фосфата на предшественниках кислых гидролаз в аппарате Гольджи, предназначенных для транспорта в лизосомы. В дополнение к манноза-6-фосфатам, CI-MRP также связывает другие белки, в том числе IGF-II. CI-MRP также известен как рецептор "M6PAGF-II", рецептор "CI-MRP/IGF-H", "рецептор IGF-H" или "рецептор IGF2". Эти термины и их сокращения используются в настоящей заявке взаимозаменяемо.

[0096] Сопутствующая иммуноподавляющая терапия: В настоящей заявке термин "сопутствующая иммуноподавляющая терапия" включает любые способы иммуносупрессорной терапии, используемые в качестве предварительного лечения, прекондиционирования или параллельно со способом лечения.

[0097] Растворитель: В настоящей заявке термин "растворитель" относится к фармацевтически приемлемому (например, безопасному и нетоксичному для инъекции человеку) растворяющему веществу, применимому для приготовления восстанавливаемого состава. Примеры растворителей включают стерильную воду, бактериостатическую воду для инъекций (БВИ), буферный раствор (например, фосфатно-солевой буфер), стерильный физиологический раствор, раствор Рингера или раствор декстрозы.

[0098] Лекарственная форма: В настоящей заявке термин "лекарственная форма" и "дозированная лекарственная форма" относится к физически дискретной единице терапевтического белка для лечения пациента. Каждая единица содержит некоторое количество активного вещества, рассчитанное для получения желаемого терапевтического эффекта. Следует понимать, однако, что общая доза в композиции будет определена лечащим врачом в рамках обоснованного медицинского заключения.

[0099] Заместительная ферментная терапия (ЗФТ): В настоящей заявке термин "Заместительная ферментная терапия (ЗФТ)" относится к любой терапевтической стратегии, которая корректирует дефицит фермента с использованием доставки недостающего фермента. В некоторых вариантах реализации отсутствующий фермент доставляют путем интратекального введения. В некоторых вариантах реализации отсутствующий фермент доставляют путем инфузии в кровяной поток. После введения фермент поглощается клетками и транспортируется в лизосомы, где фермент действует, удаляя вещества, которые накапливаются в лизосомах в результате ферментной недостаточности. Обычно Заместительная ферментная терапия лизосомальными ферментами является эффективной, терапевтические ферменты доставляются в лизосомы в клетках соответствующих тканей-мишеней, где проявляется дефект накопления.

[0100] Улучшение, увеличение или уменьшение: В настоящей заявке термины "улучшение"; "увеличение" или "уменьшение" или грамматические эквиваленты, указывают значения, полученные относительно базовых измерений, например, у того же самого индивида, до начала обработки/лечения, описанного в настоящей заявке, или измеренные контрольных индивидов (или нескольких контрольных индивидов) в отсутствие обработки/лечения, описанного в настоящей заявке. "Контрольные индивиды" представляют собой индивиды, страдающие теми же самыми формами лизосомной болезни накопления, что и индивиды, проходящих лечение, примерно того же возраста как и индивиды, проходящие лечение (для того, чтобы стадии заболевания индивида, проходящего лечение, и контрольного индивида (индивидов) были сопоставимыми).

[0101] Индивид, субъект, пациент: В настоящей заявке термины "индивид", "субъект" или "пациент" относятся к человеку или животному, отличному от человека. Индивид (также упоминаемый как "пациент" или "субъект"), проходящий лечение, представляет собой индивид (плод, младенец, ребенок, подросток или взрослый человек), страдающим рассматриваемым заболеванием.

[0102] Интратекальное введение: В настоящей заявке термин "интратекальное введение" или "интратекальная инъекция" относится к инъекции в спинномозговой канал (интратекальное пространство, окружающее спинной мозг). Могут быть использованы различные методики, включая, но не ограничиваясь перечисленными: латеральную церебровентрикулярную инъекцию через трепанационное отверстие или цистерновую или поясничную пунктуру, или т.п. В некоторых вариантах реализации "интратекальное введение" или "интретекальная доставка" в соответствии с настоящим изобретением относится к ИТ введению или доставке через поясничную область или отдел, например, поясничное ИТ введение или доставка. В настоящей заявке термин "поясничный отдел" или "поясничная область" относится к области между третьим и четвертым поясничными (нижняя часть спины) позвонками и, более строго, отделу позвоночника L2-S1.

[0103] Линкер: В настоящей заявке термин "линкер" относится к аминокислотной последовательности в гибридном белке, помимо той, которая встречается в конкретном положении в природных белках и, как правило, линкер сконструирован таким образом, что он является гибким или представляет собой промежуточную структуру, такую как а-спираль, между двумя частями белка. Линкер также относится к спейсеру.

[0104] Лиопротектор: В настоящей заявке термин "лиопротектор" относится к молекуле, которая предотвращает или уменьшает химическую и/или физическую нестабильность белка или другого вещества при лиофилизации и последующем хранении. Примеры лиопротекторов включают сахара, такие как сахароза или трегалоза; аминокислоты, такие как глутамат натрия или гистидин; метиламины, такие как бетаин; лиотропные соли, такие как сульфат магния; многоатомные спирты, такие как трехатомные или высшие спирты, например, глицерин, эритрит, глицерин, арабитол, ксилит, сорбит и маннитол, пропиленгликоль, полиэтиленгликоль; плюроники; и их комбинации. В некоторых вариантах реализации лиопротектор представляет собой невосстановленный сахар, такой как трегалоза или сахроза.

[0105] Лизосомалъный фермент: В настоящей заявке термин "лизосомальный фермент" относится к любому ферменту, который является способным уменьшить накопленные, соединения в лизосомах животных или который может предотвратить или улучшить один или более симптом лизосомной болезни накопления. Лизосомальные ферменты, пригодные для настоящего изобретения, включают в себя как фермент дикого типа, так и модифицированный лизосомальный фермент, и они могут быть получены с использованием рекомбинантных и синтетических методик или могут быть выделены из природных источников. Примеры лизосомальных ферментов перечислены в Таблице 1.

[0106] Лизосомная ферментная недостаточность: В настоящей заявке термин "лизосомная ферментная недостаточность" относится к группе генетических заболеваний, которые являются результатом недостаточности по меньшей мере одного фермента, который является необходимым для разрушения макромолекул (например, ферментных субстратов) до пептидов, аминокислот, моносахаров, нуклеиновых кислот и жирных кислот в лизосомах. В результате, у индивидов, страдающие лизосомной ферментной недостаточностью, накапливаются соединения в различных тканях (например, ЦНС, печени, селезенке, кишечнике, стенках кровеносных сосудов и в других органах).

[0107] Лизосомная болезнь накопления: В настоящей заявке термин "лизосомная болезнь накопления" относится к любой болезни в результате недостаточности одного или нескольких лизосомальных ферментов, необходимых для метаболизма природных макромолекул. Эти заболевания, как правило, приводят к накоплению не разрушенных молекул в лизосомах, что приводит к увеличению числа запасных гранул (также называемых запасными пузырьками). Эти заболевания и различные примеры описаны более подробно ниже.

[0108] Полипептид: В настоящей заявке "полипептид", в целом, представляет собой цепочку из по меньшей мере 2 аминокислот, соединенных друг с другом при помощи пептидной связи. В некоторых вариантах реализации полипептид может включать по меньшей мере 3-5 аминокислот, каждая из которых соединена с другими с использованием по меньшей мере одной пептидной связи. Специалистам в данной области известно, что полипептиды могут включать "неприродные" аминокислоты или другие молекулы, которые, тем не менее, способны к интеграции в полипептидную цепь.

[0109] Замещающий фермент: В настоящей заявке термин "замещающий фермент" относится к любому ферменту, который может действовать как замещающий по меньшей мере частично, при недостатке или отсутствии фермента при лечении болезни. В некоторых вариантах реализации термин "замещающий фермент" относится к любому ферменту, действие которого может замещать, по меньшей мере частично, недостаток или отсутствие лизосомальных ферментов при лизосомных болезнях накопления, подлежащих лечению. В некоторых вариантах реализации замещающий фермент позволяет снизить накопление веществ в лизосомах млекопитающих или может предотвратить или улучшить один или несколько симптомов лизосомной болезни накопления. Замещающие ферменты, пригодные для настоящего изобретения, включают в себя оба фермент дикого типа или модифицированный лизосомальный фермент и могут быть получены с использованием рекомбинантных и синтетических способов или выделены из природных источников. Замещающий фермент может быть рекомбинантным, синтетическим, ген-активированным или природным ферментом.

[0110] Растворимый: В настоящей заявке термин "растворимый" относится к способности терапевтического агента образовывать гомогенный раствор. В некоторых вариантах реализации растворимость терапевтического агента в растворе, в который он введен и с использованием которого он транспортируется к участку-мишени (например, к клеткам и тканям головного мозга), является достаточной для доставки терапевтически эффективного количества терапевтического агента к сайту-мишени. Несколько факторов могут влиять на растворимость терапевтических агентов. Например, факторы, которые могут влиять на растворимость белка, включают ионную силу, аминокислотную последовательность и наличие других сопутствующих косолюбилизирующих агентов или солей (например, солей кальция). В некоторых вариантах реализации фармацевтические композиции составлены так, что соли кальция, исключаются из таких композиций. В некоторых вариантах реализации терапевтические агенты в соответствии с настоящим изобретением являются растворимыми в соответствующей фармацевтической композиции. Следует иметь в виду, что, хотя изотонические растворы, как правило, предпочтительны для парентерального введения составов, применение изотонических растворов может ограничивать адекватную растворимость для некоторых терапевтических агентов и, в частности, некоторых белков и/или ферментов. Было продемонстрировано, что слегка гипертонические растворы (например, до 175 мм хлорида натрия в 5 мМ фосфата натрия при pH 7,0) и сахаросодержащих растворов (например, до 2% сахарозы в 5 мМ фосфата натрия при pH 7,0) хорошо переносятся обезьянами. Например, наиболее распространенной принятой композицией болюсного состава для ЦНС является физиологический раствор (150 мМ NaCl в воде).

[0111] Стабильность: В настоящей заявке термин "стабильность" относится к способности терапевтического агента (например, рекомбинантного фермента) поддерживать его терапевтическую эффективность (например, всю или преимущественно всю его предполагаемую биологическую активность и/или физико-химическую, целостность) при длительном периоде времени. Стабильность терапевтического агента и способность фармацевтической композиции поддерживать стабильность такого терапевтического агента, могут быть оценены в течение длительного периода времени (например по меньшей мере в течении 1, 3, 6, 12, 18, 24, 30, 36 месяцев и более). В общем, фармацевтические композиции согласно настоящему изобретению были составлены таким образом, чтобы они были бы способны стабилизировать, или же замедлять или предотвращать деградацию одного или более терапевтических агентов, составленных с ними (например, рекомбинантных белков). В контексте настоящего, изобретения стабильным составом является тот, в котором терапевтический агент по существу сохраняет свои физическую и/или химическую целостность и биологическую активность при хранении и во время обработки (например, замораживания/оттаивания, механического перемешивания и лиофилизации). Стабильность белка может быть оценена по образованию высокомолекулярных агрегатов, потере ферментативной активности, формированию пептидных фрагментов и сдвигу профилей заряда.

[0112] Субъект: В настоящей заявке термин "субъект" обозначает любое млекопитающее, включая человека. В некоторых вариантах реализации настоящего изобретения, субъект, представляет собой взрослого, подростка и младенца. Кроме того, настоящее изобретение предусматривает введение фармацевтической композиции и/или осуществление способов лечения внутриутробно.

[0113] Существенная гомология: В настоящей заявке словосочетание "существенная гомология" относится к сравнению между последовательностями аминокислот или нуклеиновых кислот. Как будет понятно специалистам в данной области, две последовательности обычно считаются "по существу гомологичными", если они содержат гомологичные остатки в соответствующих положениях. Гомологичные остатки могут быть одинаковыми остатками. Кроме того, гомологичные остатки могут быть не идентичными остатками, обладающие адекватно близкими структурными и/или функциональными характеристиками. Например, как хорошо известно специалистам в данной области, некоторые аминокислоты обычно классифицируют как "гидрофобные" или "гидрофильные" аминокислоты, и/или имеющие "полярные" или "неполярные" боковые цепи. Замена одной аминокислоты на другую того же типа, часто может считаться "гомологичной" заменой.

[0114] Как хорошо известно в данной области, аминокислотные или последовательности нуклеиновых кислот могут быть сравнены с использованием любой из множества алгоритмов, в том числе теми, которые доступны среди коммерческих компьютерных программ, таких как BLASTN для нуклеотидных последовательностей и BLASTP, gapped BLAST, и PSI-BLAST для аминокислотных последовательностей. Примерами таких программ, описанных в Altschul, et al., Basic local alignment search дооl, J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et al., Methods in Enzymology; Altschul, et al., "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis, et al., Bioinformatics: A Practical Guide do the Analysis of Genes and Proteins, Wiley, 1998; and Misener, et al., (eds.), Bioinformatics Methods and Prodocols (Methods in Molecular Biology, Vol.132), Humana Press, 1999. В дополнение к идентификации гомологичных последовательностей, программы, упомянутые выше, как правило, обеспечивают индикацию степени гомологии. В некоторых вариантах реализации две последовательности считаются действительно гомологичными, если по меньшей мере 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более их соответствующих остатков гомологичны соответствующему участку остатков. В некоторых вариантах реализации соответствующий участок остатков является полной последовательности. В некоторых вариантах реализации соответствующий участок составляет по меньшей мере 10, 15, 20; 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 или более остатков.

[0115] Существенная идентичность: В настоящей заявке сочетание "Существенная идентичность" относится к сравнению последовательностей аминокислот или нуклеиновых кислот. Как будет понятно специалистам в данной области, две последовательности, как правило, считаются "по существу идентичными", если они содержат одинаковые остатки в соответствующих позициях. Как хорошо известно в данной области, аминокислотные или последовательности нуклеиновых кислот могут быть сравнены с использованием любой из множества алгоритмов, в том числе теми, которые доступны среди коммерческих компьютерных программ, таких как BLASTN для нуклеотидных последовательностей и BLASTP, gapped BLAST, и PSI-BLAST для аминокислотных последовательностей. Примерами таких программ, описанных в Altschul, et al., Basic local alignment search доо1, J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et al, Methods in Enzymology; Altschul et al., Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis et al., Bioinformatics: A Practical Guide do the Analysis of Genes and Proteins, Wiley, 1998; and Misener, et al., (eds.), Bioinformatics Methods and Prodocols (Methods in Molecular Biology, Vol.132), Humana Press, 1999. В дополнение к определению одинаковых последовательностей, программы, упомянутые выше, как правило, обеспечивают индикацию степени идентичности. В некоторых вариантах реализации две последовательности считаются действительно идентичными, если не менее 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более их соответствующих остатков идентичны соответствующему участку остатков. В некоторых вариантах реализации соответствующий участок является полной последовательностью. В некоторых вариантах реализации соответствующий участок составляет по меньшей мере 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 или более остатков.

[0116] Синтетическая СМЖ: В настоящей заявке термин "синтетическая СМЖ" относится к раствору, который имеет pH, электролитный состав, содержание глюкозы и осмос в соответствии с таковыми в спинномозговой жидкости. Синтетическую СМЖ также называют искусственной СМЖ. В некоторых вариантах реализации синтетическая СМЖ представляет собой раствор Эллиотта В.

[0117] Подходящий для доставки в ЦНС: В настоящей заявке фраза "подходящий для доставки в ЦНС" или "подходящий для интратекальной доставки" в отношении фармацевтической композиции согласно настоящему изобретению, как правило, относится к стабильности, переносимости и свойствам растворимости таких композиций, а также к способности таких композиций доставлять эффективное количество терапевтического агента, содержащегося в нем, к целевым местам доставки (например, в СМЖ или мозг).

[0118] Ткани-мишени: В настоящей заявке термин «ткани-мишени» относится к любой ткани, на которую влияет лизосомная болезнь накопления, рассматриваемая для лечения, или любая ткань, в которой недостаточно лизосомальных ферментов, выраженных в норме. В некоторых вариантах реализации ткани-мишени включают те ткани, в которых существует заметное или аномально высокое количество фермента, субстрата, например, накопленных в клеточных лизосомах ткани, у пациентов, страдающих или восприимчивых к болезни лизосомных накопления. В некоторых вариантах реализации ткани-мишени включают те ткани, которые отражают патологии, сопутствующие болезни, симптомы или функции. В некоторых вариантах реализации ткани-мишени включают ткани, в которых недостаточно лизосомальных ферментов, как правило, в норме экспрессируемых на высоком уровне. В настоящей заявке «ткани-мишени» могут представлять собой ткани-мишени головного мозга, ткани-мишени спинного мозга и/или периферическими ткани-мишени. Примеры тканей-мишеней подробно описаны ниже.

[0119] Терапевтическая группа/фрагмент: В настоящей заявке термин "терапевтическая группа/фрагмент" относится к группе/фрагменту молекулы, которая обуславливает терапевтический эффект молекулы. В некоторых вариантах реализации терапевтическая группа/фрагмент представляет собой полипептид, обладающий терапевтической активностью.

[0120] Терапевтически эффективное количество: В настоящей заявке термин "терапевтически эффективное количество" относится к количеству терапевтического белка (например, замещающего фермента), который дает терапевтический эффект у прошедшего лечение субъекта, в соответствии с разумным соотношением польза/риск, применимым для любого медицинского лечения. Терапевтический эффект может быть объективным (то есть измеримым с использованием некоторых испытаний или маркеров) или субъективным (то есть субъект проявляет признаки или чувствует эффект). В частности, "терапевтически эффективное количество" относится к количеству терапевтического белка или композиции, которые обеспечивают лечение, улучшение или предотвращение желаемого заболевания или состояния, или демонстрирует заметный терапевтический или профилактический эффект, такой как улучшение симптомов, связанных с болезнью, предотвращение или задержка проявления заболевания и/или уменьшение тяжести или частоты симптомов заболевания. Терапевтически эффективное количество обычно вводят в режиме введения, который может включать многократное введение доз. Для любого конкретного терапевтического белка, терапевтически эффективное количество (и/или соответствующая доза с эффективным режимом введения) может варьировать, например, в зависимости от способа введения, в сочетании с другими фармацевтическими средствами. Кроме того, конкретное терапевтически эффективное количество (и/или доза) для каждого конкретного пациента может зависеть от различных факторов, включая заболевание, которое лечат, тяжесть заболевания; активность применяемого конкретного фармацевтического агента, конкретного применяемого состава, возраста, массы тела, общего состояния здоровья, пола и диеты пациента, времени введения, пути введения и/или скорости выведения или метаболизма применяемого конкретного гибридного белка, продолжительности лечения и подобных факторов, которые хорошо известны в медицине.

[0121] Допустимый/переносимый: В настоящей заявке термины "допустимый/переносимый" и "переносимость" относятся к способности фармацевтических композиции согласно настоящему изобретению не вызывать побочных реакций у субъекта, которому вводят такую композицию, или, как вариант, не вызывать серьезной побочной реакции у субъекта, которому вводят такую композицию. В некоторых вариантах реализации фармацевтическая композиция согласно настоящему изобретению хорошо переносится субъектом, которому вводят такую композицию.

[0122] Лечение: В настоящей заявке термин "лечение " (а также "лечить/") относится к любому введению терапевтического белка (например, лизосомального фермента), которое полностью или частично смягчает, улучшает состояние, снимает, тормозит, задерживает наступление, уменьшает тяжесть и/или уменьшает частоту одного или нескольких симптомов или особенностей конкретного заболевания, расстройства и/или условия (например, синдрома Хантера, синдрома Санфилиппо В). Такое лечение/обработка может проводиться для субъекта, который не проявляет признаков соответствующего заболевания, расстройства и/или состояния и/или субъекта, который демонстрирует только первые признаки заболевания, расстройства и/или патологического состояния. В качестве альтернативы или дополнения такое лечение может проводиться для субъекта, который обладает одним или более выраженным признаком соответствующего заболевания, расстройства и/или патологического состояния.

Подробное описание изобретения

[0123] Настоящее изобретение предусматривает, среди прочего, улучшенные способы и композиции для эффективной прямой доставки терапевтических агентов в центральную нервную систему (ЦНС). Как уже говорилось выше, настоящее изобретение основано на неожиданно обнаруженном факте, что замещающий фермент (например, белок ASA) для лизосомной болезни накопления (например, метахроматической лейкодистрофии) может быть непосредственно введен в спинномозговую жидкость (ликвор) субъекта, нуждающегося в лечении, в высоких концентрациях, не вызывая существенных неблагоприятных эффектов у субъекта. Наиболее удивительно, авторы настоящего изобретения обнаружили, что замещающий фермент может быть доставлен в простом физиологическом растворе или буферной композиции, без применения синтетической СМЖ. Еще более неожиданно то, что интратекальная доставка в соответствии с настоящим изобретением не приводит к существенным побочным эффектам, таким как тяжелая иммунная реакция, у субъекта. Таким образом, в некоторых вариантах реализации интратекальную доставку в соответствии с настоящим изобретением можно применять в отсутствие сопутствующей терапии иммунодепрессантами (например, без индукции иммунной толерантности с использованием предварительной обработки или предварительной подготовки).

[0124] В некоторых вариантах реализации интратекальная доставка в соответствии с настоящим изобретением обеспечивает эффективную диффузию в различные ткани головного мозга, что приводит к эффективному замещению фермента в различных тканях-мишенях на поверхности головного мозга, в неглубоких и/или глубоких областях головного мозга. В некоторых вариантах реализации интратекальная доставка в соответствии с настоящим изобретением обеспечивает достаточное количество замещающего фермента, циркулирующего в периферической системе кровообращения. В результате, в некоторых случаях, интратекальная доставка в соответствии с настоящим; изобретением приводит к доставке замещающего фермента в периферические ткани, такие как печень, сердце, селезенка и почки. Этот результат является неожиданным и может быть особенно полезен для лечения лизосомных болезней накопления, затрагивающих как ЦНС, так и периферические компоненты, которые, как правило, требуют как регулярного интратекального введения, так и внутривенного введения. Предполагается, что интратекальная доставка в соответствии с настоящим изобретением может позволить уменьшить дозы и/или частоту внутривенной инъекции без ущерба для терапевтического эффекта при лечении периферических симптомов.

[0125] Настоящее изобретение обеспечивает различные неожиданные и полезные признаки, которые обеспечивают эффективную и удобную доставку замещающего фермента к различным тканям мозга, что приводит к эффективному лечению лизосомных болезней накопления, проявление которых связано с ЦНС.

[0126] Различные аспекты настоящего изобретения подробно описаны в следующих разделах. Использование разделов не предназначено для ограничения настоящего изобретения. Каждый раздел можно применить к любому аспекту настоящего изобретения. В настоящей заявке использование «или» означает «и/или», если не указано иное.

Терапевтические белки

[0080] В некоторых вариантах реализации способы согласно изобретению и композиции, представленные в настоящем изобретении, применяют для доставки белка арилсульфатазы A (ASA) в ЦНС для лечения метахроматической лейкодистрофии. Подходящим белком ASA может быть любая молекула или совокупность молекул, которые способны заменить активность белка арилсульфатазы A (ASA) природного происхождения или избавить от одного или более фенотипов или симптомов, ассоциированных с дефицитом ASA. В некоторых вариантах реализации замещающим ферментом, подходящим для настоящего изобретения, является полипептид, имеющий N-и C-концы и аминокислотную последовательность, существенно подобную или идентичную зрелому белку ASA человека.

[0081] Обычно ASA человека синтезируется в виде молекулы-предшественника, которая затем процессируется в зрелую форму. Этот процесс обычно происходит путем удаления сигнального пептида, состоящего из 18 аминокислот. Обычно форму предшественника также называют полноразмерным предшественником или полноразмерным белком ASA, который содержит 507 аминокислот.18 N-концевых аминокислот отрезаются, в результате чего образуется зрелая форма длиной 489 аминокислот. Таким образом, предполагают, что 18 N-концевых аминокислот обычно не являются необходимыми для активности белка ASA. Аминокислотные последовательности зрелой формы (SEQ ID NO:1) и полноразмерного предшественника (SEQ ID NO:2) показательного белка ASA человека дикого типа, т.е. природного происхождения, представлены в Таблице 1.

ТАБЛИЦА 1
Арилсульфатаза A человека
Зрелая форма RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVRMГMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPHA (SEQ ID NO:1)
Полноразмерный предшественник MГAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVRMrMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQ ICCHPGCTPRPACCHCPDPHA (SEQ ID NO:2)

[0082] Таким образом, в некоторых вариантах реализации терапевтическим фрагментом, подходящим для настоящего изобретения, является белок ASA человека (SEQ ID NO:1). В некоторых вариантах реализации подходящим терапевтическим фрагментом может выступать гомолог либо аналог зрелого белка ASA человека. Например, гомологом либо аналогом зрелого белка ASA человека может выступать модифицированная зрелая форма белка ASA человека, содержащая одну или более аминокислотную замену, делецию и/или инсерцию в сравнении с белком ASA дикого типа, или природного происхождения (например, SEQ ID NO:1), и сохраняющая существенную активность белка ASA. Таким образом, в некоторых вариантах реализации терапевтическим фрагментом, подходящим для настоящего изобретения, является белок, существенно гомологичный зрелой форме белка ASA человека (SEQ ID NO:1). В некоторых вариантах реализации терапевтический фрагмент, пригодный для применения согласно настоящему изобретению, имеет аминокислотную последовательность, по меньшей мере, на 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более гомологичную SEQ ID NO:1. В некоторых вариантах реализации терапевтический фрагмент, пригодный для применения согласно настоящему изобретению, существенно идентичен зрелой форме белка ASA человека (SEQ ID NO:1). В некоторых вариантах реализации терапевтический фрагмент, пригодный для применения согласно настоящему изобретению, имеет аминокислотную последовательность, по меньшей мере, на 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более идентичную SEQ ID NO:1. В некоторых вариантах реализации терапевтический фрагмент, пригодный для применения согласно настоящему изобретению, содержит фрагмент либо часть зрелой формы белка ASA человека.

[0083] Кроме того, замещающим ферментом, подходящим для настоящего изобретения, является полноразмерный белок ASA. В некоторых вариантах реализации подходящий замещающий фермент может быть гомологом либо аналогом полноразмерного белка ASA человека. Например, гомолог либо аналог полноразмерного белка ASA человека может быть модифицированным полноразмерным белком ASA человека, содержащим одну или более аминокислотную замену, делецию и/или вставку в сравнении с полноразмерным белком ASA дикого типа либо природного происхождения (например, SEQ ID NO:2), и по существу сохраняющим активность белка ASA. Таким образом, в некоторых вариантах реализации замещающим ферментом, подходящим для настоящего изобретения, является белок, существенно гомологичный полноразмерному белку ASA человека (SEQ ID NO:2). В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, имеет аминокислотную последовательность, по меньшей мере, на 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более гомологичную SEQ ID NO:2. В некоторых вариантах реализации замещающим ферментом, подходящим для настоящего изобретения, является белок, по существу идентичный полноразмерному белку ASA человека (SEQ ID NO:2). В некоторых; вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, имеет аминокислотную последовательность, по меньшей мере, на 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более идентичную SEQ ID NO:2. В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, содержит фрагмент либо часть полноразмерного белка ASA человека. В контексте данной заявки полноразмерный белок ASA обычно содержит сигнальную пептидную последовательность.

[0084] В некоторых вариантах реализации терапевтический белок включает терапевтический фрагмент (например, последовательность, нацеливающую на лизосомы) и/или пептид, проникающий через мембраны. В некоторых вариантах реализации последовательность, нацеливающая на лизосомы, и пептид, проникающий через мембраны, являются внутренней частью терапевтического фрагмента (например, связанной посредством химической связи или образующей с терапевтическим фрагментом химерный белок). В некоторых вариантах реализации нацеливающая последовательность содержит фрагмент маннозо-6-фосфата. В некоторых вариантах реализации нацеливающая последовательность содержит фрагмент IGF-I. В некоторых вариантах реализации нацеливающая последовательность содержит фрагмент IGF-II.

Другие лизосомные болезни накопления и замещающие ферменты

[0132] Предполагается, что способы и композиции согласно настоящему изобретению можно применять для лечения других лизосомных болезней накопления, в частности, лизосомных болезней накопления, имеющих этиологию и/или симптомы ЦНС, включая, но не ограничиваясь перечисленными: аспартилглюкозаминурию, болезнь накопления холестериновых эфиров, болезнь Вольмана, цистиноз, болезнь Данона, болезнь Фабри, липогрунуломатоз Фарбера, болезнь Фарбера, фукозидоз, галактазидоз I/II типов, болезнь Гоше I/II/III типа, лейкодистрофию глобоидных клеток, болезнь Краббе, болезнь накопления гликогена II, болезнь Помпе, GM1-ганглиозидоз I/II/III типа, GM2-ганглиозидоз I типа, болезнь Тея-Сакса, GM2-ганглиозидоз II типа, болезнь Сандхоффа, GM2-ганглиозидоз, α-маннозидоз I/II типа, β-маннозидоз, метахроматическую лейкодистрофию, мулипидоз типа I, сиалидоз типа I/II, муколипидоз II/III типа, болезнь клеточных включений, муколипидоз типа IIIC, муколипидоз III типа, мукополисахаридоз I типа, мукополисахаридоз II типа, мукополисахаридоз IIIA типа, синдром Санфилиппо, мукополисахаридоз IIIB типа, мукополисахаридоз IIIC типа, мукополисахаридоз IIID-типа, мукополисахаридоз IVA типа, синдром Моркио, мукополисахаридоз IVB типа, мукополисахаридоз VI типа, мукополисахаридоз VII типа, синдром Слая, мукополисахаридоз IX типа, множественный дефицит сульфатазы, нейронный цероидный липофусциноз, болезнь Баттена CLN1, болезнь Баттена CLN2, болезнь Ниман-Пика типа A/B, болезнь Ниман-Пика типа C1, болезнь Ниман-Пика типа C2, пикнодизостоз, болезнь Шиндлера I/II типа, болезнь Гоше и болезнь накопления сиаловых кислот.

[0133] Подробный обзор генетической этиологии, клинических проявлений и молекулярно-биологические механизмы лизосомных болезней накопления, подробно; изложен в работе Scriver et ai., eds., The Metaboiic and Moiecuiar Basis of Inherited Disease, 7.sup.th Ed., Vol.II, McGraw Hill, (1995). Таким образом, ферментная недостаточность при вышеупомянутых заболеваниях известна специалистам в данной области, некоторые из таких заболеваний них приведены в качестве примеров в Таблице 2 ниже:

Таблица 2
Название болезни Недостаток фермента Накапливаемые вещества
Болезнь Помпа Кислая α1,4-глюкорозилаза Гликоген α1-4-связанные олигосахариды
GM1 ганглиозид β-галактозидаза GM1 ганглиозиды
Болезнь Тея-Сакса β-гексозаминидаза A GM2 ганглиозид
GM2 ганглиозидоз: АВ вариант GM2 активаторный белок GM2 ганглиозид
Болезнь Сандхоффа β-гексозаминидаза A и B GM2 ганглиозид
Болезнь Фабри α-галактозидаза A глобозиды
Болезнь Гоше глюкоцереброзидаза глюкосилцерамид
Метахромотическая лейкодистрофия Арилсульфатаза A Сульфатиды
Болезнь Краббе Галактозилцерамидаза Галактоцереброзид
Болезнь Нимана-Пика, типы A и B Кислая сфингомиелиназа Сфингомиелин
Болезнь Нимана-Пика, тип C Повреждение эстерификации холестерина Сфингомиелин
Болезнь Нимана-Пика, тип D Неизвестно Сфингомиелин
Болезнь Фарбера Кислая керамидаза Церамид
Болезнь Вольмана Кислая липаза Холестериновые эфиры
Синдром Херлера (MPS IH) α-L-идуронидаза Гепаран и дерматан, сульфаты
Синдром Шая (MPS IS) α-L-идуронидаза Гепаран и дерматан, сульфаты
Херлер-Шай(MPS IH/S) α-L-идуронидаза Гепаран и дерматан, сульфаты
Синдром Хантера (MPS II) Идуронат сульфатаза Гепаран и дерматан, сульфаты
Санфилиппо A (MPS ША) Гепаран N-сульфатаза Гепаран сульфатаза

Санфилиппо B (MPS IIIB) α-N-ацетилглюкозаминидаза Гепаран сульфатаза
Санфилиппо C (MPS IIIC) Ацетил-CoA-глюкозамиминид ацетилтрансфераза Гепаран сульфатаза
Санфилиппо D (MPS IIID) N-ацетилглюкозамин-6-сульфатаза Гепаран сульфатаза
Моркио B (MPS IVB) β-галактозидаза Кератан сульфат
Марото-Лами (MPS VI) Арилсульфатаза B Дерматан сульфат
Синдром Слая (MPS VII) β-глюкоронидаза
α-маннозидоз α-маннозидаза Манноза/олигосахариды
β-маннозидоз β-маннозидаза Манноза/олигосахариды
Фукозидоз α-L-фукозидаза Фукозил олигосахариды
Аспартилглюкозами нурия N-Аспартил-β-глюкозоаминидаза Аспартилглюкозамин аспарагины
Сиалидоз (Муколипидоз I) α-нейроминидаза Сиалилолигосахариды
Галактосиалидоз (Синдром Голдберга) Недостаточность лизосомного защитного белка Сиалилолигосахариды
Болезни Шиндлера α-N-Ацетил-Галактозаминидаза
Муколипидоз II (I-клеточная болезнь) N-ацетилглюкозоамин-1-фосфотрансфераза Гепаран сульфат
Муколипидоз III (Псевдо-Хантер полидистрофия) То же, что и при МЛ II
Цистиноз Цистин транспортный белок Свободный цистин
Болезнь Салла Сиаловый кислый Свободная сиаловая

транспортный белок кислота и глюкуроновая кислота
Инфантильная болезнь накопления сиаловых кислот Сиаловый кислый транспортный белок Свободная сиаловая кислота и глюкуроновая кислота
Инфантильный нейро-цероидный липофусциноз Пальмитоил-белковая тиоэстераза Липофусцины
Муколипидоз IV Неизвестно Ганглиозиды (хиалуроновые кислоты
Прозапосин Сапозины A, B, C и D

[0134] Способы согласно настоящему изобретению можно применять для доставки других различных замещающих ферментов. В настоящей заявке замещающие ферменты, пригодные для применения для настоящего изобретения, могут включать любой фермент, который может действовать как замещающий по меньшей мере частично, активность недостаточного или отсутствующего лизосомального фермента при лизосомной болезни накопления, подлежащей лечению. В некоторых вариантах реализации замещающий фермент способен снизить накопленные вещества в лизосомах, или способен облегчить или улучшить один или несколько симптомов лизосомной болезни накопления.

[0135] В некоторых вариантах реализации подходящие замещающие ферменты могут представлять собой любые лизосомальные ферменты, о которых известно, что они связаны с лизосомной болезнью накопления, лечение которой проводится. В некоторых вариантах реализации подходящие замещающие ферменты выбраны из ферментов, перечисленных выше в Таблице 2.

[0136] В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, может иметь последовательность дикого типа, или природную последовательность. В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, может иметь измененную последовательность, по существу идентичную или гомологичную последовательности дикого типа, или природной последовательности (например, имеющую по меньшей мере 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% идентичности последовательности с последовательностью дикого типа, или природной последовательностью).

[0137] Замещающий фермент, пригодный для применения согласно настоящему изобретению, может быть получен любым доступным способом. Например, замещающие ферменты могут быть получены рекомбинантным путем с использованием системы клетки-хозяина, в которой экспрессируются нуклеиновые кислоты, кодирующие замещающий фермент. В качестве альтернативы или дополнения замещающие ферменты могут быть получены путем активации эндогенных генов. В качестве альтернативы или дополнения замещающие ферменты могут быть частично или полностью получены путем химического синтеза. В качестве альтернативы или дополнения замещающие ферменты также могут быть выделены из природных источников.

[0138] При получении ферментов рекомбинантным путем можно использовать любую систему экспрессии. Известные системы экспрессии включают, например, яйцеклетки, бакуловирусы, растения, дрожжи или клетки млекопитающих.

[0139] В некоторых вариантах реализации ферменты, пригодные для применения для настоящего изобретения, получают в клетках млекопитающих. Неограничивающие примеры клеток млекопитающих, которые можно применять в соответствии с настоящим изобретением, включают линию мышиной миеломы BALB/c (NSO/I, ЕСАСС No: 85110503); ретинобласты человека (PER.C6, Crucell, Лейден, Нидерланды); линию CV1 почек обезьяны, трансформированную SV40 (COS-7, АТСС CRL 1651); линию клеток почки эмбриона человека (293 или 293 клетки, субклонированные для роста в суспензионной культуре, Graham et al., J. Gen Virol, 36:59,1977.); клеточную линию фибросаркомы человека (например, НТ1080); клетки почек детенышей хомяка (BHK, ATCC CCL 10); клетки яичника китайского хомячка+/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216, 1980); клетки Сертоли мыши (TM4, Mather, Biol. Reprod., 23:243-251, 1980); клетки почки обезьяны (CV1 АТСС CCL 70); клетки почки африканской зеленой обезьяны (VERO-76, АТСС CRL-1 587); клетки цервикальной карциномы человека (HeLa, АТСС CCL 2); клетки почки собаки (MDCK, АТСС CCL 34); клетки печени крыс buffalo (BRL 3A, АТСС CRL 1442); клетки легкого человека (W138, АТСС CCL 75); клетки печени человека (Hep G2, HB 8065); клетки опухоли молочной железы мыши (ММТ 060562, АТСС CCL51); клетки TRI (Mather et al., Annals N.Y. Acad. Sci., 383:44-68, 1982); MRC 5 клетки; клетки FS4 ыи линию гепатомы человека (Hep G2).

[0140] В некоторых вариантах реализации предложенные способы в соответствии с настоящим изобретением применяют для доставки замещающих ферментов, вырабатываемых клетками человека. В некоторых вариантах реализации предлагаемые способы в соответствии с настоящим изобретением применяют для доставки замещающих ферментов, вырабатываемых клетками CHO.

[0141] В некоторых вариантах реализации замещающие ферменты, доставляемые с использованием способа согласно настоящему изобретению, содержат молекулу, которая связывается с рецепторами на поверхности клеток головного мозга, что способствует поглощению клетками и/или нацеливанию на лизосомы. Например, такой рецептор может представлять собой катион-независимый манноза-6-фосфат рецептор (CI-MPR), который связывается с остатком манноза-6-фосфата (М6Р). Кроме того, CI-MPR также связывается с другими белками, в том числе IGF-II. В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, содержит остатки M6P на поверхности белка. В некоторых вариантах реализации замещающий фермент, пригодный для применения согласно настоящему изобретению, может содержать бис-фосфорилированные олигосахариды, которые имеют более высокую аффинность связывания с CI-MPR. В некоторых вариантах реализации подходящий фермент содержит по меньшей мере примерно 20%-бис-фосфорилированных олигосахаридов в ферменте. В других вариантах реализации подходящие ферменты могут содержать примерно 10%, 15%, 18%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60% бис-; фосфорилированных олигосахаридов в ферменте. Хотя такие бис-фосфорилированные олигосахариды могут естественным образом присутствовать в ферменте, следует отметить, что ферменты могут быть модифицированы с получением ферментов, содержащих такие олигосахариды. Например, подходящие замещающие ферменты могут быть модифицированы с использованием некоторых ферментов, которые способны катализировать перенос N-ацетилглюкозамина-L-фосфата из UDP-GlcNAc в положении 6 α-1,2-связанных манноз на лизосомальные ферменты. Способы и композиции для получения и применения таких ферментов описаны, например, Canfield et аl. в патенте, США №6537785 и патенте США №6534300, каждый из которых включен в настоящую заявку посредством ссылки.

[0142] В некоторых вариантах реализации замещающие ферменты для применения в настоящем изобретении могут быть конъюгированы или гибридизованы с молекулами, обуславливающими направленную доставку (таргетинг) в лизосомы, которые способны связываться с рецептором на поверхности клеток головного мозга. Подходящими молекулами для лизосомного таргетинга являются IGF-I, IGF-II, RAP, p97,и их варианты, гомологи или фрагменты (например, включая их пептиды, имеющие последовательность, по меньшей мере на 70%, 75%, 80%, 85%, 90% или 95% идентичную последовательности зрелого пептида человека IGF-I, IGF-II, RAP, p97 дикого типа).

[0143] В некоторых вариантах реализации замещающие ферменты, пригодные для настоящего изобретения, не модифицированы для улучшения доставки или транспорта таких агентов через ГЭБ и в ЦНС.

[0085] В некоторых вариантах реализации терапевтический белок включает нацеливающий фрагмент (например, нацеливающую на лизосомы последовательность) и/или пептид, проникающий через мембраны. В некоторых вариантах реализации последовательность, нацеливающая на лизосомы, и пептид, проникающий через мембраны, являются внутренней частью терапевтического фрагмента (например, связанной посредством химической связи или образующей с терапевтическим фрагментом химерный белок). В некоторых вариантах реализации нацеливающая последовательность содержит маннозо-6-фосфат фрагмент. В некоторых вариантах реализации нацеливающая последовательность содержит фрагмент IGF-I. В некоторых вариантах реализации нацеливающая последовательность содержит фрагмент IGF-II.

Составы

[0145] Водные фармацевтические растворы и композиции (т.е. составы), обычно используемые для доставки в ЦНС субъекта, обычно включают традиционный небуферный изотонический солевой раствор и раствор Эллиотта В, представляющий собой искусственную СМЖ. Сравнение состава СМЖ и раствора Эллиотта В приведено в Таблице 3. Как показано в Таблице 3, концентрации веществ в растворе Эллиотта В близки к таковым в СМЖ. Раствор Эллиотта В, однако, содержит очень низкие концентрации буфера и, соответственно, не может обеспечить адекватную буферную емкость, необходимую для стабилизации терапевтических агентов (например, белков), особенно в течение длительного периода времени (например, в ходе хранения). Кроме того, раствор Эллиотта В содержит некоторые соли, которые могут быть несовместимы с составами, предназначенными для доставки некоторых терапевтических агентов, и, в частности белков или ферментов. Например, соли кальция, присутствующие в растворе Эллиотта В, способствуют осаждению белков и тем самым снижают стабильность состава.

Таблица 3
Раствор Na+ K+ Ca++ Mr++ HCO3- Cl- pH Фосфор Глюкоза
мЭкв/л мЭкв/л мЭкв/л мЭкв/л мЭкв/л мЭкв/л мг/л мг/л
СМЖ 117-137 2,3 2,2 2,2 22,9 113-127 7,31 1,2-2,1 45-80
Раствор Элиотта В 149 2,6 2,7 2,4 22,6 132 6,0-7,5 2,3 80

[0086] Настоящее изобретение обеспечивает составы, находящиеся либо в жидкой, либо в пре-лиофилизированной, либо в лиофилизированной, либо в восстановленной форме, для терапевтических агентов, которые были составлены таким образом, что они являются стабильными, или же замедляют либо предотвращают деградацию одного или более терапевтического агента, входящего в их состав (например, рекомбинантных белков). В некоторых вариантах реализации настоящие составы обеспечивают лиофилизированный состав для терапевтических агентов. В некоторых вариантах реализации настоящие составы обеспечивают жидкий состав для терапевтических агентов. В некоторых вариантах реализации составы являются стабильными составами.

[0087] В настоящей заявке термин "стабильный" относится к возможности терапевтического агента (например, рекомбинантного фермента) поддерживать его терапевтическую эффективность (например, все или большинство видов предполагаемой биологической активности и/или физико-химическую целостность) в течение длительного периода времени. Стабильность терапевтического агента и способность фармацевтической композиции поддерживать стабильность такого терапевтического агента может быть оценена в течение длительного периода времени (например, предпочтительнее в течение по меньшей мере 1, 3, 6, 12, 18, 24, 30, 36 месяцев и более). В данном контексте стабильный состав является таким составом, в котором терапевтический агент по существу сохраняет свою физическую и/или химическую целостность и биологическую активность при хранении и при проведении с ним различных операций (например, в ходе замораживания/оттаивания, механического перемешивания и лиофилизации). Стабильность белка может быть оценена на основании образования высокомолекулярных агрегатов, на основании потери ферментативной активности, формирования пептидных фрагментов и по сдвигу профилей заряда.

[0148] Стабильность терапевтического агента имеет особенно важное для поддержания определенного уровня концентрации терапевтического агента, необходимого для возможности осуществления агентом его желаемой терапевтической функции. Стабильность терапевтического агента может быть также оценена по биологической активности и физико-химической целостности терапевтического агента в течение длительного периода времени. Например, стабильность в данный момент времени может быть сопоставлена со стабильностью в более ранний момент времени (например, при составлении в день 0) или может быть сопоставлена со стабильностью терапевтического агента без вспомогательных веществ, и результаты этого сравнения выражены в процентах. Предпочтительно, фармацевтические композиции согласно настоящему изобретению сохраняют, по меньшей мере 100%, по меньшей мере 99%, по меньшей мере 98%, по меньшей мере 97%, по меньшей мере 95%, по меньшей мере 90%, по меньшей мере 85%, по меньшей мере 80%, по меньшей мере 75%, по меньшей мере 70%, по меньшей мере 65%, по меньшей мере 60%, по меньшей мере 55% или по меньшей мере 50% биологической активности терапевтического агента или физико-химической целостности в течение длительного периода времени (например, при измерении по меньшей мере 6-12 месяцев, при комнатной температуре или при специальных условиях хранения).

[0149] Терапевтические агенты являются преимущественно растворимыми в фармацевтических композициях согласно настоящему изобретению. Термин "растворимый" в отношении терапевтических агентов согласно настоящему изобретению относится к способности таких терапевтических агентов образовывать гомогенный раствор. В предпочтительном варианте растворимость терапевтического агента в растворе, в котором его вводят и с которым он транспортируется к сайту-мишени действия (например, клеткам и тканям головного мозга), является достаточной для доставки терапевтически эффективного количества терапевтического агента к целевым участкам-мишеням. Несколько факторов могут повлиять на растворимость терапевтических агентов. Например, соответствующие факторы, которые могут повлиять на растворимость белка, включают ионную силу, аминокислотную последовательность и наличие других сопутствующих солюбилизирующих агентов или солей (например, солей кальция). В некоторых вариантах реализации фармацевтические композиции составлены таким образом, что из их состава исключены соли кальция.

[0088] Подходящие составы, находящиеся либо в жидкой, либо в прелиофилизированной, либо в лиофилизированной, либо в восстановленной форме, могут содержать целевой терапевтический агент в различных концентрациях. В некоторых вариантах реализации подходящие составы могут содержать белок или терапевтический агент в концентрации в пределах от примерно 0,1 мг/мл до 100 мг/мл (т.е. от примерно 0,1 мг/мл до 80 мг/мл, от примерно 0,1 мг/мл до 60 мг/мл, от примерно 0,1 мг/мл до 50 мг/мл, от примерно 0,1 мг/мл до 40 мг/мл, от примерно 0,1 мг/мл до 30 мг/мл, от примерно 0,1 мг/мл до 25 мг/мл, от примерно 0,1 мг/мл до 20 мг/мл, от примерно 0,1 мг/мл до 60 мг/мл, от примерно 0,1 мг/мл до 50 мг/мл, от примерно 0,1 мг/мл до 40 мг/мл, от примерно 0,1 мг/мл до 30 мг/мл, от примерно 0,1 мг/мл до 25 мг/мл, от примерно 0,1 мг/мл до 20 мг/мл, от примерно 0,1 мг/мл до 15 мг/мл, от примерно 0,1 мг/мл до 10 мг/мл, от примерно 0,1 мг/мл до 5 мг/мл, от примерно 1 мг/мл до 10 мг/мл, от примерно 1 мг/мл до 20 мг/мл, от примерно 1 мг/мл до 40 мг/мл, от примерно 5 мг/мл до 100 мг/мл, от примерно 5 мг/мл до 50 мг/мл, или от примерно 5 мг/мл до 25 мг/мл). В некоторых вариантах реализации составы, в соответствии с изобретением, могут содержать терапевтический агент в концентрации примерно 1 мг/мл, 5 мг/мл, 10 мг/мл, 15 мг/мл, 20 мг/мл, 25 мг/мл, 30 мг/мл, 40 мг/мл, 50 мг/мл, 60 мг/мл, 70 мг/мл, 80 мг/мл, 90 мг/мл или 100 мг/мл.

[0089] Составы согласно настоящему изобретению характеризуются переносимостью либо в форме водных растворов, либо в виде восстановленных растворов лиофилизата. В настоящей заявке термин «переносимый» и «переносимость» относится к способности фармацевтической композиции согласно настоящему изобретению не вызывать побочной реакции у субъекта, которому вводится данная композиция, или не вызывать серьезной побочной реакции у субъекта, которому вводится данная композиция. В некоторых вариантах реализации фармацевтические композиции согласно настоящему изобретению являются хорошо переносимыми субъектом, которому вводятся данные композиции.

[0152] Многие терапевтические агенты, в частности, белки и ферменты согласно настоящему изобретению, требуют контролируемого рН и определенных вспомогательных веществ для поддержания их растворимости и стабильности в фармацевтической композиции согласно настоящему изобретению. В Таблице 4 ниже приведены типичные аспекты примеров белковых составов, которые поддерживают растворимость и стабильность белковых терапевтических агентов согласно настоящему изобретению.

Таблица 4
Параметр Типичный диапазон/Тип Назначение
pH 5 до 7,5 Для стабилизации
Иногда также для стабилизации
Тип буфера ацетат, сукцинат, цитрат, Для поддержания оптимального pH
гистидин, фосфат или Трис Может также влиять на стабилизацию
Концентрация буфера 5-50 мМ Для поддержания pH
Может также стабилизировать и добавлять ионную силу
Регулятор тоничности NaCl, сахара, маннитол Для создания изоосматического или изотонического растворов
Поверхностно-активное вещество Полисорбит 20, полисорбит 80 Для придания устойчивости к поверхности раздела и при сдвиге
Другое Аминокислоты (например, аргинин) примерно сотни мМ Для увеличения растворимости и стабильности

Буферы [0090] pH состава является дополнительным фактором, который способен изменить растворимость терапевтического агента (например, фермента или белка) в водном составе или пре-лиофилизированном составе. Соответственно, составы согласно настоящему изобретению предпочтительно содержат один или несколько буферов. В некоторых вариантах реализации водные составы содержат количество буферов, достаточное для поддержания оптимального pH указанной композиции приблизительно между 4,0 и 8,0 (т.е. примерно 4,0, 4,5, 5,0, 5,5, 6,0, 6,2, 6,4, 6,5, 6,6, 6,8, 7,0, 7,5 или 8,0). В некоторых вариантах реализации pH состава составляет приблизительно между 5,0 и 7,5, приблизительно между 5,5 и 7,0, приблизительно между 6,0 и 7,0, приблизительно между 5,5 и 6,0, приблизительно между 5,5 и 6,5, приблизительно между 5,0 и 6,0, приблизительно между 5,0 и 6,5 и приблизительно между 6,0 и 7,5. Подходящие концентрации буфера включают, например, ацетат, цитрат, гистидин, фосфат, сукцинат, трис (гидроксиметил) аминометан ("Трис") и другие органические кислоты. Концентрации буфера и диапазон pH фармацевтической композиции согласно настоящему изобретению являются факторами, контролирующими и регулирующими переносимость состава. В некоторых вариантах реализации буферный агент присутствует в концентрации, находящейся в диапазоне между от примерно 1 мМ до примерно 150 мМ, или между примерно 10 мМ до примерно 50 мМ, или между примерно 15 мМ до примерно 50 мМ, или между примерно 20 мМ до примерно 50 мМ, или между примерно 25 мМ до примерно 50 мМ. В некоторых вариантах реализации подходящий буферный агент присутствует в концентрации примерно 1 мМ, 5 мМ, 10 мМ, 15 мМ, 20 мМ, 25 мМ, 30 мМ, 35 мМ, 40 мМ, 45 мМ, 50 мМ, 75 мМ, 100 мМ, 125 мМ или 150 мМ.

Тоничность[0091] В некоторых вариантах реализации составы, находящиеся либо в жидкой, либо в пре-лиофилизированной, либо в лиофилизированной, либо в восстановленной форме, содержат изотонический агент для поддержания изотоничности состава. Обычно термин "изотонический" означает, что рассматриваемый состав по существу имеет такое же осмотическое давление, что и кровь человека. Изотонические составы обычно имеют осмотическое давление от 240 мОсм/кг до 350 мОсм/кг. Изотоничность можно измерить с использованием, например, давления паров или осмотической точки замораживания. Примеры изотоничных агентов, включают, но не ограничиваются перечисленными: глицин, сорбит, маннит, хлорид натрия и аргинин. В некоторых вариантах реализации подходящие изотонические агенты могут присутствовать в водных и/или пре-лиофилизированных составах в концентрации от 0,01-5% (например, 0,05, 0,1, 0,15, 0,2, 0,3, 0,4, 0.5, 0,75, 1,0, 1,25, 1,5, 2,0, 2,5, 3,0, 4,0 или 5,0%) по весу. В некоторых вариантах реализации составы для лиофилизации содержат изотонический агент, поддерживающий пре-лиофилизационные составы или восстановленные составы изотоничными..

[0092] Хотя изотоничные растворы обычно предпочтительны для парентерального введения лекарственных препаратов, применение изотоничных растворов может изменить растворимость некоторых терапевтических агентов и, в частности, некоторых белков и/или ферментов. Было показано, что слабо гипертонические растворы (т.е. содержащие более 175 мМ хлорида натрия в 5 мМ фосфате натрия, pH 7,0) и сахар-содержащие растворы (т.е. более 2% сахарозы в 5 мМ фосфате натрия, pH 7,0) являются хорошо переносимыми. Наиболее часто применяемым составом для болюсного введения в ЦНС является композиция в солевом растворе (около 150 мМ NaCl в воде).

Стабилизирующие агенты

[0156] В некоторых вариантах реализации составы могут содержать стабилизирующий агент, или лиопротектор, для защиты белка. Обычно подходящим агентом является сахар, невосстанавливающий сахар или аминокислота. Примеры Сахаров могут включать, но не ограничиваться ими: декстран, лактозу, маннитол, маннозу, сорбитол, рафиинозу, сахарозу и трегалозу. Примеры аминокислот могут включать, но не ограничиваются перечисленными: аргинин, глицин и метионин. Дополнительные стабилизирующие агенты могут включать хлорид натрия, гидроксиэтиловый крахмал и поливинилпиролидон. Количество стабилизирующего агента в лиофилизированном составе подбирается, главным образом, так, чтобы состав был изотоничным. Тем не менее, гипертонические восстановленные составы могут также подходить. Кроме того, количество стабилизирующего агента не должно быть слишком низким, при котором имеет место неприемлемые разрушение/ агрегация терапевтического агента. Примерные концентрации стабилизирующего агента в композиции могут варьировать от 1 мМ до 400 мМ (например, от 30 мМ до 300 мМ, от 50 мМ до 100 мМ), или, наоборот, от 0,1% до 15% (например, от 1% до 10%, от 5% до 15%, от 5% до 10%) по весу. В некоторых вариантах реализации отношение массового количества стабилизирующего агента и терапевтического агента составляет примерно 1:1. В других вариантах реализации соотношение массы стабилизирующего агента и терапевтического агента может составлять примерно 0,1:1, 0,2:1, 0,25:1, 0,4:1, 0,5:1, 1:1, 2:1, 2,6:1, 3:1, 4:1, 5:1, 10, 1, или 20:1. В некоторых вариантах реализации подходящий для лиофилизации стабилизирующий агент является лиопротектором.

[0093] В некоторых вариантах реализации жидкие составы, пригодные для применения согласно настоящему изобретению, содержат аморфные материалы. В некоторых вариантах реализации жидкие составы, пригодные для применения согласие настоящему изобретению, содержат существенное количество аморфных материалов (например, составы на основе сахарозы). В некоторых вариантах реализации жидкие составы, пригодные для применения согласно настоящему изобретению, содержат частично кристаллические/частично аморфные материалы.

Наполнители

[0094] В некоторых вариантах реализации подходящие составы для лиофилизации могут также включать один наполнитель или более. «Наполнитель» - это компонент, который прибавляет массу лиофилизированной смеси и вносит вклад в физическую структуру лиофилизата. Например, наполнитель может улучшить внешний вид лиофилизированной таблетки (т.е. например, обеспечить по существу однородный лиофилизат). Подходящие наполнители включают, но не ограничиваются перечисленными: хлорид натрия, лактозу, маннитол, глицин, сахарозу, трегалозу, гидроксиэтиловый крахмал. Примерные концентрации наполнителей составляют от примерно 1% до примерно 10% (т.е. 1,0%, 1,5%, 2,0%, 2,5%, 3,0%, 3,5%, 4,0%, 4,5%, 5,0%, 5,5%, 6,0%, 6,5%, 7,0%, 7,5%, 8,0%, 8,5%, 9,0%, 9,5% и 10,0%).

Поверхностно-активные вещества

[0159] В некоторых вариантах реализации желательно добавление в составы поверхностно-активного вещества. Примеры поверхностно-активных веществ включают неионные поверхностно-активные вещества, такие как полисорбаты (например, полисорбат 20 или 80); полоксамеры (например, полоксамер 188); тритон; додецилсульфат натрия (ДСН); лаурил сульфаты натрия; октил гликозиды натрия; лаурилсульфат; миристил-, линолеил-, или стеариловый-сульфобетаин; лаурил-, миристил-, линолеил- или стеариловый-саркозин; линолеил-, миристил- или цетил-бетаин; лауроамидопропил; кокамидопропил, линолеамидопропил; миристамидопропил; пальмидопропил или изостеарамидопропил-бетаины (например, лауроамидопропил); миристарнидопропил-, пальмидопропил- или изостеарамидопропил-диметиламины; метил натрия кокоил- или динатрия метил-офеил таураты и серии MONAQUATTM (Mona Industries, Inc, Патерсон, штат Нью-Джерси), полиэтилен гликоль, полипропил гликоль и сополимеры этилена и пропилен гликоля (например, Pluronics, PF68 и т.д.). Обычно количество поверхностно-активного вещества является таким, что оно уменьшает агрегацию белка и сводит к минимуму образование частиц или вспенивание. Например, поверхностно-активное вещество может присутствовать в составе в концентрации примерно 0,001-0,5% (например, примерно 0005-0,05%, или примерно 0,005-0,01%). В частности, поверхностно-активное вещество может присутствовать в составе в концентрации примерно 0,005%, 0,01%, 0,02%, 0,1%, 0,2%, 0,3%, 0,4%, или примерно 0,5%, и т.д. Дополнительно поверхностно-активное вещество может добавляться в лиофилизированный состав, пре-лиофилизированный состав и/или в восстановленный состав.

[0095] Другие фармацевтически приемлемые носители, вспомогательные вещества или стабилизаторы такие, как те, которые описаны в Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980), могут быть включены в состав (и/или в лиофилизированный состав и/или в восстановленный состав) при условии, что они не оказывают побочного действия на желаемые характеристики состава. Приемлемые носители, вспомогательные вещества или стабилизаторы являются нетоксичными для реципиента в применяемых дозах и концентрациях и включают, но не ограничиваются перечисленными: дополнительные буферные агенты, консерванты; вспомогательные растворители; антиоксиданты, включая аскорбиновую кислоту и метионин; хелатирующие агенты, такие как ЕДТА; комплексы металлов (например, комплексы Zn-белок); биодеградируемые полимеры, такие как полиэфиры; и/или образующие соли противоионы, такие как натрий.

[0161] Составы, находящиеся либо в жидкой, либо в пре-лиофилизированной, либо в лиофилизированной, либо в восстановленной форме, в соответствии с настоящим изобретением могут быть оценены на основе анализа качества продукции, времени восстановления (если состав лиофилизирован), качества восстановления (если состав лиофилизирован), большой молекулярной массы, влажности и температуры стеклования. Обычно анализ качества белка и продуктов включает анализ скорости разрушения продукта с использованием методов, включающих, но не ограниченных ими: эксклюзионную ВЭЖХ (SE-HPLC), катионообменную ВЭЖХ (CEX-HPLC), рентгеновскую дифракцию (РД), модулируемую дифференциальную сканирующую калориметрию (ИДСК), ВЭЖХ с обратной фазой (RP-HPLC), многоугловое светорассеяние (MALS), флуоресценцию, поглощение в ультрафиолете, нефелометрию, капиллярный электрофорез (КЭ), электрофорез в ПААГ с ДСН и их комбинации. В некоторых вариантах реализации оценка продукта в соответствии с настоящим изобретением может включать в себя этап оценки внешнего вида (внешний вид жидкости или таблетки).

[0162] Обычно составы (лиофилизированные или водные) могут храниться в течение длительного времени при комнатной температуре. Температура хранения может колебаться от 0°C до 45°C (например, 4°C, 20°C, 25°C, 45°C и т.д.). Составы могут храниться в течение периода от нескольких месяцев до нескольких лет. Срок хранения, как правило, составляет 24 месяцев, 12 месяцев, 6 месяцев, 4,5 месяца, 3 месяца, 2 недели или 1 месяц. Составы могут храниться непосредственно в контейнере, применяемом для введения, что позволяет исключить этап переноса.

[0163] Составы могут храниться непосредственно в лиофилизационном контейнере (если они лиофилизированы), который может функционировать в качестве сосуда для восстановления, чтобы исключить этап переноса. Кроме того, лиофилизированный лекарственный состав может быть дозирован с небольшим инкрементом для хранения. В процессе хранения в целом необходимо избегать воздействий, которые приводят к разрушению белков, в том числе, без ограничений, воздействий солнечных лучей, ультрафиолетового излучения и других форм электромагнитного излучения, чрезмерного тепла или холода, быстрого теплового шока и механического шока.

Лиофилизация

[0096] Способы согласно изобретению согласно настоящему изобретению могут применяться для лиофилизации любых материалов, в частности, терапевтических агентов. Обычно пре-лиофилизированный состав дополнительно содержит выбранные соответствующим образом вспомогательные вещества или другие компоненты, такие как стабилизаторы, буферные агенты, наполнители и поверхностно-активные вещества для предотвращения деградации целевого компонента (например, агрегации белка, деамидирования и/или окисления) во время замораживания-сушки и хранения. Составы для лиофилизации могут включать один или более дополнительных компонентов, включая лиопротекторы или стабилизирующие агенты, буферы, наполнители, изотонические агенты и поверхностно-активные вещества.

[0097] После того, как целевая субстанция и любой дополнительный компонент смешаны вместе, состав лиофилизируют. Лиофилизация обычно включает три основных стадии: замораживание, первичная сушка и вторичная сушка. Замораживание необходимо для преобразования воды в лед или определенного аморфного компонента в кристаллическую форму. Первичная сушка - этап процесса, во время которого лед удаляется из замороженного продукта путем прямой сублимации при низком давлении и температуре. Вторичная сушка - этап процесса, во время которого связанная вода удаляется из матрицы продукта с применением диффузии остаточной воды к испаряющей поверхности. Температура продукта на протяжении вторичной сушки обычно выше, чем на протяжении первичной сушки. См. Tang X. et al. (2004) "Design of freeze-drying processes for pharmaceuticals: Practical advice," Pharm. Res., 21:191-200; Nail S.L. et al. (2002) "Fundamentals of freeze-drying," in Development and manufacture of protein pharmaceuticals. Nail S.L. editor. New York: Kluwer Academic/Plenum Publishers, pp 281-353; Wang et al. (2000) "Lyophilization and development of solid protein pharmaceuticals," Int. J. Pharm., 203:1-60; Williams N.A. et al. (1984) "The lyophilization of pharmaceuticals; A literature review." J. Parenteral Sci. Technoi, 38:48-59. Вообще говоря, любой процесс лиофилизации может быть использован совместно с настоящим изобретением.

[0098] В некоторых вариантах реализации этап отжига может быть включен на протяжении начального замораживания продукта. Этап отжига может сократить общее время цикла. Не будем вдаваться в теорию, но логично предположить, что этап отжига может помочь стимулировать кристаллизацию вспомогательного вещества и формирования больших кристаллов льда благодаря рекристаллизации малых кристаллов, сформированных во время охлаждения, что, в свою очередь, улучшает восстановление. Обычно этап отжига включает интервал или колебание температуры во время замораживания. Например, температура замораживания может быть -40°C, и температура на этапе отжига будет повышена до, например, -10°C, и данная температура будет поддерживаться на протяжении определенного периода времени. Время этапа отжига может находиться в диапазоне от 0,5 часов до 8 часов (т.е. 0,5, 1,0 1,5, 2,0, 2,5, 3, 4, 6 и 8 часов). Температура отжига может находиться между температурой замораживания и 0°C.

[0099] Лиофилизация может осуществляться в емкости, такой как туба, контейнер, бутыль, ванна, виала (например, стеклянная виала), шприц или другая подходящая емкость. Емкости могут быть одноразового использования. Лиофилизацию также можно осуществлять в большом масштабе либо в малом масштабе. В некоторых случаях может быть желательно лиофилизировать белок в той же емкости, в которой будет осуществляться восстановление белка с целью избежать этап переноса. Емкостью в таком случае может быть, например, виала объемом 3, 4, 5, 10, 20, 50 или 100 см3.

[0100] Множество разнообразных лиофилизаторов доступно для данных целей, таких как лабораторные лиофилизаторы Hull pilot scale dryer (SP Industries, США), Genesis (SP Industries) или любые лиофилизаторы, способные контролировать заданные параметры процесса лиофилизации. Лиофилизация сопровождается замораживанием состава и последующей сублимацией льда из замороженного содержимого при температуре, подходящей для первичной сушки. Начальное замораживание обеспечивает температуру состава ниже примерно -20°C (т.е. -50°C, -45°C, -40°C, -35°C, -30°C, -25°C, и т.д.) обычно не более чем на приблизительно 4 часа (т.е.., не более чем на приблизительно 3 часа, не более чем на приблизительно 2,5 часа, не более чем на приблизительно 2 часа). В данных условиях температура продукта обычно ниже эвтектической точки или температуры разрушения состава. Обычно температура для первичной сушки находится в диапазоне от примерно -30 до 25°C (обеспечивая нахождение продукта ниже точки плавления на протяжении вторичной сушки) при подходящем давлении, которое обычно находится в диапазоне от примерно 20 до 250 мТорр. Состав, размер и тип емкости, содержащей образец (т.е. стеклянной виалы) и объем жидкости будут обуславливать время, необходимое для сушки, которое может находиться в диапазоне от нескольких часов до нескольких дней. Этап вторичной сушки проходит при температуре примерно 0-60°C, в зависимости, преимущественно, от типа и размера емкости и типа используемого терапевтического белка. Аналогично, объем жидкости будет главным образом зависеть от времени, необходимого для сушки, которое может находиться в диапазоне от нескольких часов до нескольких дней.

[0101] В конечном счете, в результате лиофилизации получают лиофилизированный состав, в котором содержание влаги составляет менее чем примерно 5%, менее чем примерно 4%, менее чем примерно 3%, менее чем примерно 2%, менее чем примерно 1% и менее чем примерно 0,5%.

Восстановление

[0102] Хотя фармацевтические композиции согласно настоящему изобретению обычно находятся в жидкой форме во время введения субъекту, в определенных вариантах реализации фармацевтические композиции согласно настоящему изобретению являются лиофилизированными. Такие композиции должны быть восстановлены путем добавления в них одного или более восстановителей перед введением субъекту. На желаемом этапе, обычно в соответствующее время перед введением пациенту, лиофилизированный состав может быть восстановлен с помощью восстановителя с получением желательной концентрации белка в восстановленном растворе.

[0103] Различные восстановители могут использоваться в соответствии с настоящим изобретением. В некоторых вариантах реализации подходящим восстановителем для восстановления является вода. Вода, используемая в качестве восстановителя, может быть обработана с использованием множества способов, включая обратный осмос, дистилляцию, деионизацию, фильтрацию (например, фильтрацию с использованием активированного угля, микрофильтрацию, нанофильтрацию) и комбинацию этих способов обработки. Обычно вода является подходящей для инъекций, включая стерильную воду или бактериостатическую воду для инъекций, но не ограничиваясь ими.

[0104] Дополнительные примеры восстановителей включают буферные растворы с постоянным pH (например, фосфатно-буферный солевой раствор), стерильные солевые растворы, раствор Эллиота, раствор Рингера или раствор декстрозы. Подходящие восстановители могут дополнительно содержать консервант. Консерванты, приводимые для примера, включают ароматические спирты, такие как бензиловый спирт или фенол. Количество консерванта, которое необходимо применить, определяется путем оценки совместимости разных концентраций консервантов с белком и исследованием эффективности консервантов. Например, если консервантом выступает ароматический спирт (такой как бензиловый спирт), он может присутствовать в количестве от примерно 0,1-2,0%, от примерно 0,5-1,5%) или примерно 1.0-1,2%.

[0105] Восстановители, пригодные для применения для настоящего изобретения, могут включать разнообразные добавки, включая, но не ограничиваясь ими: буферные агенты, обеспечивающие постоянное значение рН (например, Трис, гистидин), соли (например, хлорид натрия) и другие добавки (например, сахароза), включая описанные выше (например, стабилизирующие агенты, изотоничные агенты).

[0106] Согласно настоящему изобретению лиофилизированная субстанция (например, белок) может быть восстановлена до концентрации по меньшей мере 25 мг/мл (например, по меньшей мере 50 мг/мл, по меньшей мере 75 мг/мл, по меньшей мере 100 мг/мл) и до любого диапазона концентраций между ними. В некоторых вариантах реализации лиофилизированная субстанция (например, белок) может быть восстановлена до концентрации, находящейся в диапазоне от примерно 1 мг/мл до 100 мг/мл (например, от примерно 1 мг/мл до 50 мг/мл, от 1 мг/мл до 100 мг/мл, от примерно 1 мг/мл до примерно 5 мг/мл, от примерно 1 мг/мл до примерно 10 мг/мл, от примерно 1 мг/мл до примерно 25 мг/мл, от примерно 1 мг/мл до примерно 75 мг/мл, от примерно 10 мг/мл до примерно 30 мг/мл, от примерно 10 мг/мл до примерно 50 мг/мл, от примерно 10 мг/мл до примерно 75 мг/мл, от примерно 10 мг/мл до примерно 100 мг/мл, от примерно 25 мг/мл до примерно 50 мг/мл, от примерно 25 мг/мл до примерно 75 мг/мл, от примерно 25 мг/мл до примерно 100 мг/мл, от примерно 50 мг/мл до примерно 75 мг/мл, от примерно 50 мг/мл до примерно 100 мг/мл). В некоторых вариантах реализации концентрация белка в восстановленном составе может быть выше, чем концентрация в пре-лиофилизированном составе. Предполагается, что высокая концентрация белка в восстановленном составе особенно полезна, когда желательной является подкожная или внутримышечная доставка восстановленного состава. В некоторых вариантах реализации концентрация белка в восстановленном составе может быть в примерно 2-50 раз большей, чем в пре-лиофилизированном составе (например, в примерно 2-20, в примерно 2-10 раз, или в примерно 2-5 раз). В некоторых вариантах реализации концентрация белка в восстановленном составе может быть, по меньшей мере, в примерно 2 раза большей, чем в пре-лиофилизированном составе (например, по меньшей мере, в примерно 3, 4, 5, 10, 20, 40 раз).

[0107] Восстановление согласно настоящему изобретению может осуществляться в любой емкости. Емкости, пригодные для применения для настоящего изобретения, например, включают, но не ограничиваются перечисленными: тубы, виалы, шприцы (например, однокамерные или двухкамерные), контейнеры, бутылки и ванны. Подходящие емкости могут быть сделаны из любых материалов, таких как стекло, пластик, металл. Емкости могут быть одноразового или многоразового использования. Восстановление также может осуществляться в большом масштабе или в малом масштабе.

[0108] В некоторых случаях может быть желательно лиофилизировать белковую композицию в той же емкости, в которой будет проводиться восстановление белка с целью исключения этапа переноса. Емкостью в таком случае может быть, например, виала объемом 3, 4, 5, 10, 20, 50 или 100 см3. В некоторых вариантах реализации подходящей емкостью для лиофилизации и восстановления является двухкамерный шприц (например, шприцы Lyo-Ject((Vetter)). Например, двухкамерный шприц может содержать как лиофилизированную субстанцию, так и восстановитель, каждый в отдельной камере, разделенной перегородкой (см. Пример 5). Для восстановления плунжер может быть присоединен к перегородке со стороны восстановителя и надавлен для перемещения восстановителя в камеру с продуктом таким образом, чтобы восстановитель мог контактировать с лиофилизированной субстанцией и восстановление могло пройти, как описано в настоящей заявке (см. Пример 5).

[0109] Фармацевтические композиции, составы и связанные способы настоящего изобретения пригодны для доставки множества терапевтических агентов в ЦНС субъекта (например, интратекально, интравентрикулярно или интрацистернально) и для лечения сопутствующих заболеваний. Фармацевтические композиции согласно настоящему изобретению особенно полезны для доставки белков и ферментов (например, в заместительной ферментной терапии) субъекту, страдающему лизосомными болезнями накопления. Лизосомные болезни накопления представляют группу относительно редких наследственных метаболических заболеваний, вызывающих нарушения лизосомной функции. Лизосомные заболевания характеризуются накоплением нерасщепленных макромолекул в лизосомах, что вызывает увеличение размера и количества лизосом и, в конечном счете, клеточную дисфункцию и клинические отклонения.

Доставка в ЦНС

[0110] Предполагается, что различные стабильные составы, описанные в настоящей заявке, являются в целом подходящими для доставки в ЦНС терапевтических агентов. Стабильные составы согласно настоящему изобретению могут быть, использованы для доставки в ЦНС посредством различных способов и путей, включающих, но не ограничивающихся перечисленным: интрапаренхимальное, интрацеребральное, интраветрикулярное церебральное (ИЦВ), интратекальное (например, ИТ-люмбальное, ИТ-мостомозжечковое) введения и любой другой способ и путь для введения прямо или непрямо в ЦНС и/или СМЖ.

Интратекальная доставка

[0111] В некоторых вариантах реализации замещающий фермент доставляют в ЦНС в составе, описанном в настоящей заявке. В некоторых вариантах реализации замещающий фермент доставляют в ЦНС путем введения в спинномозговую жидкость (СМЖ) субъекта, нуждающегося в лечении. В некоторых вариантах реализации интратекальное введение используют для доставки желаемого замещающего фермента (например, белка ASA) в СМЖ. В контексте данной заявки, интратекальное введение (также называемое интратекальной инъекцией) относится к инъекции в спинномозговой канал (интратекальное пространство вокруг спинного мозга). Могут быть использованы различные способы, включая, без ограничений, латеральную церебровентрикулярную инъекцию через трепанационное отверстие или цистерновую или поясничную пунктуру и т.п. Типичные методы описаны в Lazorthes et al. Advances in Drug Delivery Systems and Applications in Neurosurgery, 143-192 и Omaya et al., Cancer Drug Delivery, 1:169-179, содержание которых включено в настоящую заявку посредством ссылки

[0112] В соответствии с настоящим изобретением фермент может быть инъецирован в любую область вокруг спинномозгового канала. В некоторых вариантах реализации фермент инъецируют в поясничную область или цистерну, или интравентрикулярно в пространство мозгового желудочка. В настоящей заявке термин "поясничный (люмбальный) отдел" или "поясничная область" относится к области между третьим и четвертым поясничными (нижняя часть спины) позвонками и, более строго, к отделу позвоночника L2-S1. Обычно интратекальные инъекции через поясничный отдел или поясничную область также называют "поясничной ИТ доставкой" или "поясничным ИТ введением". Термин "цистерна" относится к пространству вокруг и ниже мозжечка через отверстие между черепом и в верхней части позвоночника. Обычно интратекальное введение через цистерну, также упоминается как "доставка в большую цистерну". Термин "желудочек мозга" относится к полости мозга, которая продолжается в центральный канал спинного мозга. Обычно инъекции через мозговую полость желудочка называют интравентрикулярной церебральной (ИЦВ) доставкой.

[0113] В некоторых вариантах реализации "интратекальное введение" или "интратекальная доставка" в соответствии с настоящим изобретением относится к поясничному ИТ введению или доставке, например, доставке между третьим и четвертым поясничными (нижняя часть спины) позвонками и, более конкретно, L2-S1 отдела позвоночника. Предполагается, что поясничное ИТ введение или доставка отличается от доставки в большую цистерну тем, что поясничное ИТ введение или доставка в соответствии с настоящим изобретением обеспечивает лучшую и более эффективную доставку к дистальному каналу позвоночника, Хотя цистерновая доставка, помимо всего прочего, как правило, не обеспечивает доставку состава в дистальный канал позвоночника.

Устройство для интратекального введения

[0182] Различные устройства можно применять для интратекальной доставки в соответствии с настоящим изобретением. В некоторых вариантах реализации устройство для интратекального введения содержит порт ввода жидкости (например, инъекционный порт): полую основную часть (например, катетер), включающую первое отверстие для жидкости, сообщающееся с портом ввода жидкости, и второе отверстие для жидкости, выполненную с возможностью введения в спинной мозг, и блокирующее приспособление для блокировки введения полой основной части в спинной мозг. В качестве примера, но не ограничения, на Фигуре 42 показано, что подходящий механизм блокировки приспособление для блокировки включает одну или более выпуклостей, выполненных на поверхности полой основной части, и блокирующее кольцо, выполненное с возможностью установки над одной или большим числом выпуклостей, для предотвращения выскальзывания полой основной части (например, катетера) из спинного мозга. В различных вариантах реализации, порт ввода жидкости включает резервуар. В некоторых вариантах реализации порт ввода жидкости включает механический насос (например, инфузионный насос). В некоторых вариантах реализации имплантированный катетер соединяют с резервуаром (например, для болюсной доставки) или с инфузионным насосом. Порт ввода жидкости может быть имплантируемым или внешним.

[0183] В некоторых вариантах реализации интратекальное введение может быть выполнено либо с использованием спинномозговой пункции (т.е. медленный болюс) или через систему доставки порт-катетер (например, инфузия или болюс). В некоторых вариантах реализации катетер вводят между пластинками поясничных позвонков, и наконечник вставлен в межоболочечное пространство до желаемого уровня (как правило, L3-L4) (На Фигуре 56C).

[0184] Однократная доза, подходящая для интратекального введения, обычно является небольшой по сравнению с внутривенным введением. Обычно интратекальная доставка в соответствии с настоящим изобретением поддерживает баланс состава СМЖ, а также внутричерепное давление субъекта. В некоторых вариантах реализации интратекальная доставка осуществляется в отсутствие соответствующего извлечения СМЖ у субъекта. B некоторых вариантах реализации подходящий для однократной дозы объем может быть, например, менее 10 мл, 8 мл, 6 мл, 5 мл, 4 мл, 3 мл, 2 мл, 1,5 мл, 1 мл, 0,5 мл или в некоторых вариантах реализации, подходящих для однократной дозы, может составлять примерно 0,5-5 мл, 0,5-4 мл, 0,5-3 мл, 0,5-2 мл, 0,5-1 мл, 1-3 мл, 1-5 мл, 1,5-3 мл, 1-4 мл или 0,5-1,5 мл. В некоторых вариантах реализации интратекальная доставка в соответствии с настоящим изобретением включает стадию предварительного извлечения необходимого количества спинномозговой жидкости. В некоторых вариантах реализации перед ИТ введением удаляют менее чем 10 мл (например, менее, чем 9 мл, 8 мл, 7 мл, 6 мл, 5 мл, 4 мл, 3 мл, 2 мл, 1 мл) СМЖ. В тех случаях, подходящий объем однократной дозы может составлять, например, более 3 мл, 4 мл, 5 мл, 6 мл, 7 мл, 8 мл, 9 мл, 10 мл, 15 мл или 20 мл.

[0185] Различные другие устройства могут быть использованы для осуществления интратекального введения терапевтической композиции. Например, составы, содержащие желаемые ферменты, могут быть предоставлены для использования с резервуаром. Оммайя, который обычно применяют для интратекального введения лекарственных средств при менингеальном карциноматозе (Lancet 2:983-84, 1963). В частности, в этом способе вентрикулярную трубку вводят через отверстие, сформированное в переднем роге спинного мозга, и подключают к резервуару Оммайя, установленному под кожей головы, и резервуар прокалываю подкожно для интратекальной доставки замещающего фермента, который вводят в резервуар. Другие устройства для интратекального введения терапевтических композиций или составов описаны в патентах США №6217552, включенных в настоящую заявку посредством ссылки. Кроме того, состав может быть введен интратекально, например, путем однократной инъекции или инфузии. Следует понимать, что лечебная доза может представлять собой либо однократную дозу, либо многократную дозу.

[0186] Для инъекции составы настоящего изобретения могут быть приготовлены в виде жидких растворов. Кроме того, фермент может входить в состав состава в твердом виде и может быть повторно растворен или суспендирован непосредственно перед применением. Лиофилизированные формы также предусмотрены. Инъекция может быть, например, в виде болюсной инъекции или непрерывной инфузии фермента (например, с использованием инфузионных насосов).

[0187] В одном варианте реализации настоящего изобретения фермент вводят путем латеральной церебровентрикулярной инъекции в головной мозг субъекта. Инъекцию можно осуществить, например, через трепанационное отверстие в черепе субъекта. В другом варианте реализации фермент и/или другой фармацевтический состав вводят через хирургически введенные шунт в желудочек мозга субъекта. Например, инъекция может быть осуществлена в боковые желудочки, имеющие больший размер. В некоторых вариантах реализации может быть также осуществлена инъекция в третий и четвертый желудочки, размер которых меньше.

[0188] В еще одном варианте реализации фармацевтические композиции, применяемые в настоящем изобретении, вводят в виде инъекций в большую цистерну или поясничную область субъекта.

[0189] В другом варианте реализации способа согласно настоящему изобретению фармацевтически приемлемый состав обеспечивает непрерывную доставку субъекту, например, "медленное высвобождение" фермента или другой фармацевтической композиции, применяемой в настоящем изобретении, в течение по меньшей мере, одной, двух, трех, четырех недель или более длительного периода времени, после того как фармацевтически приемлемые составы вводят субъекту.

[0190] В настоящей заявке термин "непрерывная доставка" относится к непрерывной доставке фармацевтической композиции согласно настоящему изобретению in vivo в течение продолжительного периода времени после введения, предпочтительно, по меньшей мере нескольких дней, недели или нескольких недель. Непрерывная доставка композиции может проявляться, например, в продолжительном терапевтическом эффекте вводимого фермента в течение продолжительного периода времени (например, устойчивая доставка фермента может проявляться в продолжающемся уменьшении объема запасных гранул у субъекта). Кроме того, непрерывная доставка фермента может проявляться в обнаружения присутствия фермента in vivo в течение продолжительного периода времени.

Доставка в ткани-мишени

[0191] Как уже говорилось выше, один из неожиданных и важных признаков настоящего изобретения состоит в том, что терапевтические агенты, в частности, замещающие ферменты, вводимые с использованием способов согласно настоящему изобретению, и композиции согласно настоящему изобретению, способны эффективно и широко диффундировать через поверхность мозга и проникать в различные слои или области мозга, в том числе в глубокие области мозга. Кроме того, способы согласно настоящему изобретению и композиции согласно настоящему изобретению относятся к эффективной доставке терапевтических агентов (например, фермента ASA) в различные ткани или нейроны спинного мозга, в том числе в поясничную область, в которую трудно осуществлять направленную доставку с использованием существующих способов доставки в ЦНС, таких как ИЦВ инъекция. Кроме того, способы согласно настоящему изобретению и композиции согласно настоящему изобретению обеспечивают доставку достаточного количества терапевтических агентов (например, фермента ASA) в кровь и различные периферические органы и ткани.

[0192] Таким образом, в некоторых вариантах реализации терапевтические белки (например, фермент ASA) поступают в центральную нервную систему субъекта. В некоторых вариантах реализации терапевтические белки (например, фермент ASA) поступают в одну или более ткань-мишень головного мозга, спинного мозга и/или периферического органа. В настоящей заявке термин "ткань-мишень/целевая ткань" относится к любой ткани, пораженной лизосомной болезнью накопления, которую лечат, или любой ткани, в которой лизосомных фермент, уровень которого понижен, экспрессируется в норме. В некоторых вариантах реализации ткани-мишени включают ткани, в которых обнаружено аномально высокое количество субстрата фермента, например, накопленного в лизосомах клеток ткани, у пациентов, страдающих или предрасположенных к лизосомной болезни накопления. В некоторых вариантах реализации ткани-мишени включают ткани, демонстрирующие патологии, симптомы или признаки, ассоциированные с такой болезнью. В некоторых вариантах реализации ткани-мишени включают ткани, в которых недостаточный лизосомальный фермент в норме эксперссируется на высоком уровне. В настоящей заявке ткань-мишень может представлять собой ткань-мишень головного мозга, ткань-мишень спинного мозга и/или периферическую ткань-мишень. Примеры тканей-мишеней подробно описаны ниже.

Ткани-мишени головного мозга

[0193] В целом, головной мозг может быть разделен на различные отделы, слои и ткани. Например, менингеальные ткани представляют собой систему мембран, включающую центральную нервную систему, в том числе головной мозг. Мозговые оболочки содержат три слоя, в том числе твердую мозговую оболочку, паутинную ткань и мягкую мозговую оболочку. Обычно основной функцией мозговых оболочек и спинномозговой жидкости является защита центральной нервной системы. В некоторых вариантах реализации терапевтический белок в соответствии с настоящим изобретением доставляют в один или несколько слоев мозговых оболочек.

[0194] Головной мозг состоит из трех основных отделов, в том числе полушарий головного мозга, мозжечка и ствола мозга. Полушария головного мозга расположены выше большинства других структур головного мозга и покрыты корковым слоем. Под полушариями головного мозга лежит ствол мозга, который напоминает стебель, к которому прикреплены полушария головного мозга. В задней части мозга под полушариями головного мозга и за стволом мозга находится мозжечок.

[0195] Промежуточный мозг, который находится недалеко от средней линии головного мозга и выше среднего мозга, включает таламус, метаталамус, гипоталамус, эпиталамус, преталамус и претектум. Средний мозг, который также называют мезенцефалон, содержит крышу, тегумент, вентрикулярный мезоцелий и церебральные ножки, красное ядро и черепные нервы III ядра. Средний мозг связан со зрением, слухом, управлением движением, сном/ бодрствованием, внимательностью и регуляцией температуры.

[0196] Области тканей центральной нервной системы, включая головной мозг, могут быть охарактеризованы на основании глубины тканей. Например, ткани ЦНС (например, головной мозг) могут быть охарактеризованы как поверхностные ткани или неглубокие, ткани средней глубины и/или глубокие ткани.

[0197] В соответствии с настоящим изобретением терапевтический белок (например, замещающий фермент) может быть доставлен в любую подходящую ткань-мишень мозга, связанную с болезнью субъекта, которую лечат. В некоторых вариантах реализации терапевтические белки (например, замещающие ферменты) в соответствии с настоящим изобретением доставляют к поверхностным или неглубоким тканям-мишеням мозга. В некоторых вариантах реализации терапевтические белки в соответствии настоящим изобретением доставляются к тканям-мишеням мозга на средней глубине. В некоторых вариантах реализации терапевтические белки в соответствии с настоящим изобретением доставляют в глубокие ткани-мишени мозга. В некоторых вариантах реализации терапевтические белки в соответствии настоящим изобретением доставляют в комбинацию поверхностных или неглубоких тканей-мишеней головного мозга, тканей-мишеней средней головного мозга глубины и/или глубоким тканям-мишеням мозга. В некоторых вариантах реализации терапевтические белки в соответствии настоящим изобретением доставляют в глубокие ткани мозга, лежащие по меньшей мере на 4 мм, 5 мм, 6 мм, 7 мм, 8 мм, 9 мм, 10 мм и глубже (или внутренние) от внешней поверхности мозга.

[0198] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в одну или более поверхностных или неглубоких тканей головного мозга. В некоторых вариантах реализации целевые поверхностные или неглубокие ткани головного мозга находятся в пределах 4 мм от поверхности головного мозга. В некоторых вариантах реализации целевые поверхностные или неглубокие ткани головного мозга выбраны из группы, включающей ткани мягкой мозговой оболочки, коры головного мозга, гиппокампа, пространства Вирхова-Робина, кровеносных сосудов в пространстве BP, гиппокампа, частей гипоталамуса на нижней поверхности мозга, зрительных нервов и путей, обонятельной луковицы и проекций, и их комбинации.

[0199] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в одну или более глубоких тканей головного мозга. В некоторых вариантах реализации целевые поверхностные или неглубокие ткани головного мозга расположены на 4 мм (например, 5 мм, 6 мм, 7 мм, 8 мм, 9 мм, или 10 мм), глубже (или внутрь относительно) поверхности головного мозга. В некоторых вариантах реализации целевые глубокие ткани головного мозга включают кору головного мозга. В некоторых вариантах реализации целевые глубокие ткани головного мозга включают одну или более тканей промежуточного мозга (например, гипоталамус, таламус, вентральный таламус, субталамус и т.д.), заднего мозга, чечевицеобразные ядра, базальные ганглии, хвостатое ядро, скорлупу, миндалевидное тело, бледный шар и их комбинации.

[0200] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в одну или более тканей мозжечка. В некоторых вариантах реализации одна или более тканей-мишеней мозжечка выбраны из группы, включающей ткани молекулярного слоя, тканей слоя клеток Пуркинье, тканей зернистого слоя, ножки мозжечка, и их комбинации. В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в одну или более глубоких тканей мозжечка, включая, без ограничений, ткани слоя клеток Пуркинье, ткани зернистого слоя клеток, глубокого белого вещества мозжечка (например, глубокие по отношению к зернистому слою клеток) и глубокие ткани ядер мозжечка.

[0201] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют к одной или более ткани мозга. В некоторых вариантах реализации одна или более тканей-мишеней мозга включают ткани белого вещества ствола головного мозга и/или ткани ядер ствола мозга.

[0202] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в различные ткани головного мозга, включая, без ограничений, серое вещество, белое вещество, перивентрикулярные области, мягкую паутинную оболочку, в мозговую оболочку, кору головного мозга, мозжечок, в глубокие ткани коры головного мозга, молекулярный слой, дорсальный стриатум, средний мозг, глубинные области моста и продолговатого мозга, а также их комбинации.

[0203] В некоторых вариантах терапевтические агенты (например, ферменты) поступают в различные клетки в мозге, включая, но не ограничиваясь перечисленными: нейроны, глиальные клетки, периваскулярные клетки и/или менингеальные клетки. В некоторых вариантах терапевтический белок доставляют в олигодендроциты глубокого белого вещества.

Спинной мозг

[0204] В целом, области или ткани спинного мозга можно охарактеризовать в зависимости от глубины тканей. Например, ткани спинного мозга могут быть охарактеризованы как поверхностные или неглубокие ткани, ткани средней глубины и/или глубокие ткани.

[0205] В некоторых вариантах реализации терапевтические агенты (например, ферменты) доставляют в одну или более поверхностных или неглубоких тканей спинного мозга. В некоторых вариантах реализации целевые поверхностные или неглубокие ткани спинного мозга находятся в пределах 4 мм от поверхности спинного мозга. В некоторых вариантах реализации целевые поверхностные или неглубокие ткани спинного мозга включают мягкую оболочку и/или участки белого вещества.

[0206] В некоторых вариантах терапевтические агенты (например, ферменты) доставляют в одну или более глубокую тканей спинного мозга. В некоторых вариантах реализации целевые глубокие ткани спинного мозга расположены внутри на глубине 4 мм от поверхности спинного мозга. В некоторых вариантах целевые глубокие ткани спинного мозга включают серое вещество спинного мозга и/или эпендимные клетки.

[0207] В некоторых вариантах терапевтические агенты (например, ферменты) доставляют к нейронам спинного мозга.

Периферические ткани-мишени

[0208] В настоящей заявке периферические органы или ткани относятся к любому органу или ткани, которые не являются частью центральной нервной системы (ЦНС). Периферические ткани-мишени могут включать, без ограничений, кровеносную систему, печень, почки, сердце, эндотелий, костный мозг и клетки-производные костного мозга, селезенку, легких, лимфатические узлы, кости, хрящи, яичники и семенники. В некоторых вариантах терапевтические белки (например, замещающий фермент) в соответствии с настоящим изобретением доставляют в одну или более периферических тканей.

Биораспределение и биодоступность

[0209] В различных вариантах реализации после доставки в ткань-мишень терапевтический агент (например, фермент ASA) локализуется внутриклеточно. Например, терапевтический агент (например, фермент) может локализоваться в экзонах, аксонах, лизосомах, митохондриях и вакуолях клетки-мишени (например, нейрона, такого как клетка Пуркинье). Например, в некоторых вариантах реализации интратекально вводимые ферменты характеризуются такой динамикой перемещения, что фермент движется по периваскулярному пространству (например, путем конвективных механизмов с пульсацией). Кроме того, распространение интратекально вводимого белка или фермента в более глубокие ткани центральной нервной системы может обеспечиваться или каким-либо способом облегчаться механизмами активного аксонного транспорта, связанных с ассоциацией вводимого белка или фермента с нейрофиламентами.

[0210] В некоторых вариантах реализации терапевтический агент (например, фермент ASA), доставляемый в соответствии с настоящим изобретением, может достигать терапевтически или клинически эффективного уровня или активности в различных тканях-мишенях, описанных в настоящей заявке. В настоящей заявке терапевтически или клинически эффективный уровень или активность представляет собой уровень или активность, которые достаточны для оказания терапевтического эффекта в ткани-мишени. Терапевтический эффект может быть объективным (то есть измеряемым с использованием ряда тестов или с использованием маркера) или субъективным (т.е. сам субъект сообщает об эффекте или ощущает такой эффект). Например, терапевтически или клинически эффективный уровень или активность могут представлять собой уровень или активность фермента, которые являются достаточными для облегчения симптомов, связанных с заболеванием в ткани-мишени (например, накопление ГАГ).

[0211] В некоторых вариантах реализации терапевтический агент (например, замещающий ферментов), доставляемый в соответствии с настоящим изобретением, может достигать уровня или ферментативной активности, составляющей по меньшей мере 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% от нормального уровня или активности соответствующего лизосомального фермента в ткани-мишени. В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, может достигать уровня или ферментативной активности, которая увеличена по меньшей мере в 1 раз, в 2 раза, в 3 раза, в 4 раза, 5 раз, 6 раз, 7 раз, 8 раз, 9 раз или 10 раз, по сравнению с контролем (например, эндогенный уровень или активность без лечения). В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, может достигать повышенного уровня или ферментативной активности по меньшей мере примерно 10 нмоль/ч/мг, 20 нмоль/ч/мг, 40 нмоль/ч/мг, 50 нмоль/ч/мг, 60 нмоль/ч/мг, 70 нмоль/ч/мг, 80 нмоль/ч/мг, 90 нмоль/ч/мг, 100 нмоль/ч/мг, 150 нмоль/ч/мг, 200 нмоль/ч/мг, 250 нмоль/ч/мг, 300 нмоль/ч/мг, 350 нмоль/ч/мг, 400 нмоль/ч/мг, 450 нмоль/ч/мг, 500 нмоль/ч/мг, 550 нмоль/ч/мг или 600 нмоль/ч/мг в ткани-мишени.

[0212] В некоторых вариантах реализации способы согласно настоящему изобретению в особенности применимы для направленной доставки (таргетинга) в поясничную область. В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, может достигать повышенного уровня или ферментативной активности в поясничной области, составляющей по меньшей мере примерно 500 нмоль/ч/мг, 600 нмоль/ч/мг, 700 нмоль/ч/мг, 800 нмоль/ч/мг, 900 нмоль/ч/мг, 1000 нмоль/ч/мг, 1500 нмоль/ч/мг, 2000 нмоль/ч/мг, 3000 нмоль/ч/мг, 4000 нмоль/ч/мг, 5000 нмоль/ч/мг, 6000 нмоль/ч/мг, 7000 нмоль/ч/мг, 8000 нмоль/ч/мг, 9000 нмоль/ч/мг или 10000 нмоль/ч/мг.

[0213] В целом, терапевтические агенты (например, замещающий фермент), доставляемые в соответствии с настоящим изобретением, имеют достаточно длительный период полужизни в спинномозговой жидкости и тканях головного мозга, спинного мозга и периферических органов. В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, может иметь период полужизни по меньшей мере, 30 минут, 45 минут, 60 минут, 90 минут, 2 часа, 3 часа, 4 часа, 5 часа, 6 часов, 7 часов, 8 часов, 9 часов, 10 часов, 12 часов, 16 часов, 18 часов, 20 часов, 25 часов, 30 часов, 35 часов, 40 часов, до 3 дней, до 7 дней, до 14 дней, до 21 дней или до месяца. В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, может сохраняться на детектируемом уровне или при детектируемой активности в спинномозговой жидкости или крови после 12 часов, 24 часов, 30 часов, 36 часов, 42 часов, 48 часов, 54 часов, 60 часов, 66 часов, 72 часов, 78 часов, 84 часов, 90 часов, 96 часов, 102 часов или недели после введения. Детектируемый уровень или детектируемая активность может быть определена с использованием различных способов, известных в данной области.

[0214] В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, достигает концентрации по меньшей мере 30 мкг/мл в тканях и клетках ЦНС у субъекта после введения (например, одной недели, 3 дней, 48 часов, 36 часов, 24 часа, 18 часов, 12 часа, 8 часов, 6 часов, 4 часа, 3 часов, 2 часа, 1 час, 30 минут или менее, после интратекального введения фармацевтической композиции субъекту). В некоторых вариантах реализации терапевтический агент (например, замещающий фермент), доставляемый в соответствии с настоящим изобретением, достигает концентрации по меньшей мере 20 мкг/мл, по меньшей мере 15 мкг/мл, по меньшей мере 10 мкг/мл, по меньшей мере 7.5 мкг/мл, по меньшей мере 5 мкг/мл, по меньшей мере 2,5 мкг/мл, по меньшей мере 1,0 мкг/мл или по меньшей мере 0,5 мкг/мл в целевых тканях или клетках субъекта (например, ткани мозга или нейронов) после введения такому субъекту (например, через одну неделю, 3 дня, 48 часов, 36 часов, 24 часа, 18 часов, 12 часа, 8 часов, 6 часов, 4 часа, 3 часов, 2 часа, 1 час, 30 минут или меее после интратекального введения такой фармацевтической композиции субъекту).

Лечение метахроматической лейкодистрофии (МЛД)

[0215] Метахроматическая лейкодистрофия (МЛД) представляет собой аутосомно-рецессивное заболевание, обусловленное недостаточностью фермента арилсульфатазы (ASA). ASA, кодируемая геном ARSA человека, представляет собой фермент, расщепляющий цереброзид-3-сульфат или сфинголипид 3-O-сульфогалактозилцерамид (сульфатид) на цереброзид и сульфат. В отсутствие фермента, сульфатиды накапливаются в нервной системе (например, в миелиновых оболочках, нейронах и глиальных клетках) и в меньшей степени в висцеральных органах. Следствием таких молекулярных и клеточных событий является прогрессирующая демиелинизация и потеря аксонов в ЦНС и ПНС, сопровождающиеся моторными и когнитивными нарушениями с тяжелым клиническим проявлением.

[0216] Определяющим клиническим признаком этого заболевания является дегенерация центральной нервной системы (ЦНС), которая приводит к когнитивным нарушениям (например, умственной отсталости, нервным расстройствам и слепоте, и др.).

[0217] МЛД может проявляться у детей раннего возраста (поздняя инфантильная форма), при этом у больных детей симптомы проявляются обычно сразу после первого года жизни (например, примерно 15-24 месяцев), и, как правило, такие дети не живут более 5 лет. МЛД может проявляться у детей (ювенильная форма), при этом у больных детей когнитивные нарушения проявляются обычно примерно в возрасте 3-10 лет, а продолжительность жизни может варьировать (например, в диапазоне 10-15 лет после появления симптомов). МЛД может проявляться у взрослых (взрослая форма) и может появляться у людей любого возраста (например, обычно в возрасте 16 лет и старше), а прогрессирование заболевания может сильно варьировать.

[0114] Композиции и способы согласно настоящему изобретению могут быть использованы для эффективного лечения индивидов, страдающих от или предрасположенных к МЛД. В настоящей заявке термины «лечить» или «лечение», используемые в настоящей заявке, относятся к улучшению одного или более симптомов, ассоциированных с заболеванием, предотвращению или задержке наступления одного или более симптомов заболевания и/или уменьшению тяжести или частоты одного или более симптома заболевания. Примеры симптомов включают, но не ограничиваются перечисленными: повышенное внутричерепное давление, гидроцефалию вследствие атрофии вещества головного мозга, накопление сульфатированных гликолипидов в миелиновых оболочках центральной и переферической нервных систем и во внутренних органах, прогрессивную демиелинизацию, утрату аксонов в ЦНС и ПНС и/или моторную и познавательную дисфункцию.

[0115] В некоторых вариантах реализации лечение относится к частичному или полному улучшению, облегчению, торможению, задержке начала, снижению тяжести и/или частоты неврологических нарушений у пациента с МЛД. В настоящей заявке термин «неврологические нарушения» включает различные симптомы, связанные с нарушением центральной нервной системы (например, головного и спинного мозга). Симптомы неврологических нарушений могут включать, например, задержку развития, прогрессирующие когнитивные нарушения, ослабление слуха, нарушение развития речи, дефицит моторных навыков, гиперактивность, агрессивность и/или нарушение сна, наряду с другими симптомами. В некоторых вариантах реализации различные симптомы МЛД являются ассоциированными с нарушениями периферической нервной системы (ПНС). В некоторых вариантах реализации неврологические нарушения у пациента с МЛД характеризуются ухудшением общей моторики. Очевидно, что общую моторику можно оценивать любым подходящим методом. Например, в некоторых вариантах реализации общая моторика измеряется как изменение относительно базовой линии с использованием the Gross Motor Function Measure-88 (GMFM-88) и общей исходной оценки.

[0116] В некоторых вариантах реализации лечение относится к уменьшению накопления сульфатидов в различных тканях. В некоторых вариантах реализации лечение относится к уменьшению накопления сульфатидов в тканях-мишенях головного мозга, в нейронах спинного мозга и/или периферической ткани-мишени. В определенных вариантах реализации накопление сульфатидов уменьшается примерно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% и более, по сравнению с контролем. В некоторых вариантах реализации накопление сульфатидов уменьшается по меньшей мере в 1 раз, 2 раза, 3 раза, 4 раза, 5 раз, 6 раз, 7 раз, 8 раз, 9 раз или 10 раз, по сравнению с контролем. Желательно, чтобы уровень накопления сульфатидов оценивался любым подходящим методом. Например, в некоторых вариантах реализации накопление сульфатидов измеряется с помощью, окрашивания альциановым синим. В некоторых вариантах реализации накопление сульфатидов измеряется с помощью окрашивания LAMP-1.

[0117] В некоторых вариантах реализации лечение относится к снижению вакуолизации в нейронах (например, нейронах, включающих клетки Пуркинье). В некоторых вариантах реализации вакуолизация в нейронах уменьшается примерно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% и более, по сравнению с контролем. В некоторых вариантах реализации вакуолизация уменьшается по меньшей мере в 1 раз, 2 раза, 3 раза, 4 раза, 5 раз, 6 раз, 7. раз, 8 раз, 9 раз или 10 раз, по сравнению с контролем.

[0118] В некоторых вариантах реализации лечение относится к увеличенной активности фермента ASA в различных тканях. В некоторых вариантах реализации лечение относится к увеличенной активности фермента ASA в тканях-мишенях головного мозга, нейронов спинного мозга и/или периферических тканях-мишенях. В некоторых вариантах реализации активность фермента ASA увеличена на примерно 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%., 300%, 400%, 500%, 600%, 700%, 800%, 900% 1000% или более в сравнении с контролем. В некоторых вариантах реализации активность фермента ASA увеличена по меньшей мере в 1 раз, 2 раза, 3 раза, 4 раза, 5 раз, 6 раз, 7 раз, 8 раз, 9 раз или 10 раз, по сравнению с контролем. В некоторых вариантах реализации активность фермента ASA составляет по меньшей мере примерно 10 нмоль/ч/мг, 20 нмоль/ч/мг, 40 нмоль/ч/мг, 50 нмоль/ч/мг, 60 нмоль/ч/мг, 70 нмоль/ч/мг, 80 нмоль/ч/мг, 90 нмоль/ч/мг, 100 нмоль/ч/мг, 150 нмоль/ч/мг, 200 нмоль/ч/мг, 250 нмоль/ч/мг, 300 нмоль/ч/мг, 350 нмоль/ч/мг, 400 нмоль/ч/мг, 450 нмоль/ч/мг, 500 нмоль/ч/мг, 550 нмоль/ч/мг, 600 нмоль/ч/мг или более. В некоторых вариантах реализации ферментативная активность ASA увеличивается в люмбальном участке. В некоторых вариантах реализации увеличенная ферментативная активность ASA в люмбальном участке составляет по меньшей мере, примерно 2000 нмоль/ч/мг, 3000 нмоль/ч/мг, 4000 нмоль/ч/мг, 5000 нмоль/ч/мг, 6000 нмоль/ч/мг, 7000 нмоль/ч/мг, 8000 нмоль/ч/мг, 9000 нмоль/ч/мг, 10000 нмоль/ч/мг или более.

[0223] В некоторых вариантах реализации лечение относится к снижению прогрессирования потери когнитивных способностей. В некоторых вариантах прогрессирование потери познавательной способности уменьшается примерно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% и более, по сравнению с контролем. В некоторых вариантах лечение относится к снижению задержки в развитии. В некоторых вариантах задержка развития уменьшается примерно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% и более, по сравнению с контролем.

[0224] В некоторых вариантах реализации лечение относится к увеличению выживаемости (например, продолжительности жизни). Например, лечение может приводить к увеличению продолжительности жизни пациентов. В некоторых вариантах реализации лечение согласно настоящему изобретению приводит к увеличению продолжительности жизни пациентов более чем на примерно 5%, примерно 10%, примерно 15%, примерно 20%, примерно 25%, примерно 30%, примерно 35%, примерно 40%, примерно 45%, примерно 50%, примерно 55%, примерно 60%, примерно 65% примерно 70%, примерно 75%, примерно 80%, примерно 85%, примерно 90%, примерно 95%, примерно 100%, примерно 105%, 110%, примерно 115%, примерно 120%, примерно 125%, примерно 130%, примерно 135%, примерно 140%, примерно 145%, примерно 150%, примерно 155%, примерно 160%, примерно 165%, примерно 170%, примерно 175%, примерно 180%, примерно 185%, примерно 190%, примерно 195%, 200% или более, по сравнению со средней продолжительностью жизни одного или более пациентов, страдающих таким же заболеванием, но не подвергавшихся лечению. В некоторых вариантах реализации лечение согласно настоящему изобретению приводит к увеличению продолжительности жизни пациента более чем на 6 месяцев, примерно на 7 месяцев, примерно на 8 месяцев, примерно на 9 месяцев, примерно на 10 месяцев, примерно на 11 месяцев, примерно на 12 месяцев, примерно на 2 года, примерно на 3 года, примерно на 4 года, примерно на 5 лет, примерно на 6 лет, примерно на 7 лет, примерно на 8 лет, примерно на 9 лет, примерно 10 лет или более, по сравнению со средней продолжительностью жизни одного или более пациентов, страдающих таким же заболеванием, но не подвергавшихся лечению. В некоторых вариантах реализации лечение в соответствии с настоящим изобретением приводит к длительной выживаемости пациента. В настоящей заявке термин "длительная выживаемость" относится к выживаемости или продолжительности жизни более 40 лет, 45 лет, 50 лет,. 55 лет, 60 лет или дольше.

[0225] Термины "улучшить", "увеличить" или "уменьшить" в настоящей заявке указывают на значения относительно контроля. В некоторых вариантах реализации подходящий контроль представляет собой базовое (фоновое) измерение, например, измерение у того же самого индивида до начала лечения, описанного в настоящей заявке, или измерение у контрольного индивида (или нескольких контрольных индивидов) в отсутствие лечения, описанного в настоящей заявке. "Контрольный индивид" представляет собой индивида, страдающего такой же формой МЛД (например, в поздней инфантильной; ювенильной или взрослой форме), примерно такого же возраста и/или пола, как и индивид, получающего лечение (для того, чтобы стадии заболевания индивида, получающего лечение, и контрольного индивида (индивидов) были сопоставимыми).

[0226] Индивид (также называемый «пациентом» или «субъектом»), получающий лечение, представляет собой индивида (плод, младенец, ребенок, подросток или взрослый человек), имеющего МЛД или имеющего вероятность развития МЛД. Такой индивид может иметь остаточную эндогенную экспрессию и/или активность ASA, либо измеряемая активность ASA может отсутствовать. Например, индивид, имеющий МЛД, может иметь уровень экспрессии ASA, который составляет менее 30-50%, менее примерно 25-30%, менее примерно 20-25%, менее примерно 15-20%, менее примерно 10-15%, менее примерно 5-10%, менее примерно 0,1-5% от нормального уровня экспрессии ASA.

[0119] В некоторых вариантах реализации индивид является индивидом, у которого недавно была диагностирована болезнь. Обычно раннее лечение (лечение, начинающееся как можно более быстро после установления диагноза) является важным для минимизации влияния болезни и максимизации преимуществ лечения.

Иммунная толерантность

[0228] Обычно интратекальное введение терапевтического агента (например, замещающего фермента) в соответствии с настоящим изобретением не вызывает тяжелых побочных эффектов у субъекта. В настоящей заявке тяжелые побочные эффекты включают, но не ограничены перечисленными: значительный иммунный ответ, токсичность или смерть. В настоящей заявке термин «существенный иммунный ответ» относится к тяжелым или серьезным формам иммунных ответов, таким как адаптивный T-клеточный иммунный ответ.

[0229] Таким образом, во многих вариантах реализации способы в соответствии с настоящим изобретением не включают проведение сопутствующей терапии иммунодепрессантами (т.е. любой терапии иммунодепрессантами, используемой в качестве предварительного лечения/предварительной обработки или одновременно со способом настоящего изобретения). В некоторых вариантах реализации способы согласно настоящему изобретению не связаны с индукцией иммунной толерантности у субъекта, который проходит лечение. В некоторых вариантах реализации способы в соответствии с настоящим изобретением включают предварительное лечение или предварительную обработку субъекта с применением агентов, иммуносупрессирующих T-клетки.

[0230] В некоторых вариантах реализации интратекальное введение терапевтических агентов может вызвать иммунный ответ против этих агентов. Таким образом, в некоторых вариантах реализации может быть необходимо вызвать у субъекта, получающего замещающий фермент, толерантность к заместительной ферментной терапии. Иммунная толерантность может быть индуцирована с применением различных способов, известных в данной области. Например, может быть назначен начальный 30-60-дневный режим приема агента, иммуносупрессирующего T-клетки, такого как циклоспорин A (CsA), и антипролиферативного агента, такого как азатиоприн (Aza), в сочетании с еженедельными интратекальными инфузиями малых доз желаемого замещающего фермента.

[0231] В комбинированном лечении согласно настоящему изобретению можно применять любой иммуносупрессирующий агент, известный специалистам в данной области. Такие иммуносупрессирующие агенты включают, но не ограничены перечисленными циклоспорин, FK506, рапамицин, CTLA4-Ig, и агенты, действующий против TNF, такие как этанерцепт (см., например, Moder, 2000, Ann. Allergy Asthma Immunol. 84, 280-284; Nevins, 2000, Curr. Opin. Pediatr. 12, 146-150; Kurlberg et al., 2000, Scand. J. Immunol. 51, 224-230; Ideguchi et al., 2000, Neuroscience 95, 217-226; Potteret al., 1999, Ann. N.Y. Acad. Sci. 875, 159-174; Slavik et al., 1999, Immunol. Res. 19, 1-24; Gaziev et al., 1999, Bone Marrow Transplant. 25, 689-696; Henry, 1999, Clin. Transplant. 13, 209-220; Gummert et al., 1999, J. Am. Soc. Nephrol. 10, 1366-1380; Qi et al., 2000, Transplantation 69, 1275-1283).. В качестве иммуносупрессирующих агентов также можно применять антитело к рецептору IL2 (альфа-субъединице) - даклизумаб (например, Zenapax.™.), который показал эффективность у пациентов после трансплантации (см., например, Wiseman et al., 1999, Drugs 58, 1029-1042; Beniaminovitz et al., 2000, N. Engl J. Med. 342, 613-619; Ponticelli et al., 1999, Drugs R. D. 1, 55-60; Berard et al., 1999, Pharmacotherapy 19, 1127-1137; Eckhoff et al., 2000, Transplantation 69, 1867-1872; Ekberg et al., 2000, Transpl. Int. 13, 151-159). Другие иммуносупрессирующие агенты включают, но не ограничены перечисленными, лиганды, действующие против CD2 (Branco et al., 1999, Transplantation 68, 1588-1596; Przepiorka et al., 1998, Blood 92, 4066-4071), против CD4 (Marinova-Mutafchieva et al., 2000, Arthritis Rheum. 43, 638-644; Fishwild et al., 1999, Clin. Immunol. 92, 138-152), и против CD40 (Hong et al., 2000, Semin. Nephrol. 20, 108-125; Chirmule et al., 2000, J. Virol. 74, 3345-3352; Ito et al., 2000, J. Immunol. 164, 1230-1235).

Введение

[0232] Способы согласно настоящему изобретению предусматривают как однократное, так и множественное введение терапевтически эффективного количества терапевтических агентов (например, замещающих ферментов), описанных в настоящей заявке. Терапевтические агенты (например, замещающие ферменты) можно вводить через регулярные промежутки времени, в зависимости от характера, степени тяжести и состояние субъекта (например, лизосомной болезни накопления). В некоторых вариантах реализации терапевтически эффективное количество терапевтического агента (например, замещающего фермента) согласно настоящему изобретению можно вводить интратекально периодически через равные промежутки времени (например, раз в год, раз в полгода, раз в пять месяцев, раз в три месяца, раз в два месяца, ежемесячно (раз в месяц), раз в две недели, еженедельно.

[0233] В некоторых вариантах интратекальное введение можно применять в сочетании с другими путями введения (например, внутривенно, подкожно, внутримышечно, парентерально, трансдермально или через слизистую оболочку (например, перорально или назально)). В некоторых вариантах реализации такие другие способы введения (например, внутривенное введение) могут осуществляться не чаще, чем раз в две недели, один раз в месяц, раз в два месяца, раз в три месяца, раз в четыре месяца, раз в пять месяцев, раз в шесть месяцев, ежегодно.

[0234] В настоящей заявке термин «терапевтически эффективное количество» в основном определяют на основании общего количества терапевтического агента, содержащегося в фармацевтической композиции согласно настоящему изобретению. Обычно терапевтически эффективное количество является достаточным для достижения значимого благоприятного эффекта у субъекта (например, лечение, модуляция, излечение, предотвращении и/или улучшение рассматриваемого заболевания или патологического состояния). Например, терапевтически эффективное количество может представлять собой количество, достаточное для достижения желаемого терапевтического и/или профилактического эффекта, например, количество, достаточное для модуляции лизосомных рецепторов, ферментов или их активности, для лечения лизосомной болезни накопления или ее симптомов (например, уменьшение или устранение наличия или распространения «полосатых телец» или клеточной вакуолизация после введения композиции согласно настоящему изобретению субъекту). Обычно количество терапевтического агента (например, рекомбинантного лизосомального фермента), вводимого субъекту, нуждающемуся в этом, будет зависеть от характеристик субъекта. Такие характеристики включают состояние, степень тяжести заболевания, общее состояние здоровья, возраст, пол и массу тела субъекта. Специалист в данной области сможет легко определить нужных дозировки в зависимости от этих и других факторов. Кроме того, можно применять как объективные, так и субъективные тесты для определения оптимального диапазона дозы.

[0235] Терапевтически эффективное количество обычно вводят, используя введения, включающий множество однократных доз. Для любого конкретного терапевтического белка, терапевтически эффективное количество (и/или соответствующая доза в пределах эффективного режима введения) может варьировать, например, в зависимости от пути введения, комбинации с другими фармацевтическими средствами. Кроме того, конкретное терапевтически эффективное количество (и/или доза) для каждого конкретного пациента может зависеть от различных факторов, в том числе от конкретного нарушения, которое лечат, и тяжести заболевания; активности конкретного применяемого фармацевтического средства; конкретной применяемой фармацевтической композиции, возраста, массы тела, общего состояния здоровья, пола и рациона пациента, времени введения, пути введения и/или скорости выведения или метаболизма конкретного применяемого гибридного белка, продолжительности лечения, и других подобных факторов, хорошо известных специалистам в области медицины.

[0236] В некоторых вариантах реализации терапевтически эффективная доза находится в диапазоне от примерно 0,005 мг/кг массы головного мозга до 500 мг/кг массы головного мозга, например, от примерно 0,005 мг/кг массы головного мозга до 400 мг/кг массы головного мозга, от примерно 0,005 мг/кг массы головного мозга до 300 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 200 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 100 мг/кг массы головного мозга, примерно от 0,005 мг/кг вес мозга до 90 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 80 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 70 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 60 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 50 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 40 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 30 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 25 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 20 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 15 мг/кг массы головного мозга, примерно от 0,005 мг/кг массы головного мозга до 10 мг/кг массы головного мозга.

[0237] В некоторых вариантах реализации терапевтически эффективная доза больше чем примерно 0,1 мг/кг массы головного мозга, больше чем примерно 0,5 мг/кг массы головного мозга, больше чем примерно 1,0 мг/кг массы головного мозга, больше чем примерно 3 мг/кг мозга вес, больше чем примерно 5 мг/кг массы головного мозга, больше чем примерно 10 мг/кг массы головного мозга, больше чем примерно 15 мг/кг массы головного мозга, больше чем примерно 20 мг/кг массы головного мозга, больше чем примерно 30 мг/кг массы головного мозга, больше чем примерно 40 мг/кг массы головного мозга, больше чем примерно 50 мг/кг массы головного мозга, больше чем примерно 60 мг/кг массы головного мозга, больше чем примерно 70 мг/кг массы головного мозга, больше чем примерно 80 мг/кг массы головного мозга, больше чем примерно 90 мг/кг массы головного мозга, больше чем примерно 100 мг/кг массы головного мозга, больше чем примерно 150 мг/кг массы головного мозга, больше чем примерно 200 мг/кг массы головного мозга, больше чем примерно 250 мг/кг массы головного мозга, больше чем примерно 300 мг/кг массы головного мозга, больше чем примерно 350 мг/кг массы головного мозга, больше чем примерно 400 мг/кг массы головного мозга, больше чем примерно 450 мг/кг массы головного мозга, больше чем примерно 500 мг/кг массы головного мозга.

[0238] В некоторых вариантах реализации терапевтически эффективные дозы также могут быть определены в мг/кг массы тела. Как понятно специалисту в данной области, вес мозга и вес тела могут коррелировать. Dekaban AS. "Changes in brain weights during the span of human life: relation of brain weights to body heights and body weights," Ann Neurol 1978; 4:345-56. Таким образом, в некоторых вариантах реализации дозировки могут быть преобразованы, как показано в Таблице 5.

Таблица 5
Корреляция между весом головного мозга, весом тела и возрастом у мужчин
Возраст (годы) Вес головного мозга (кг) Вес тела (кг)
3 (31-43 месяцев) 1,27 15,55
4-5 1,30 19,46

[0239] В некоторых вариантах реализации терапевтически эффективные дозы также может быть определены в мг/15 см3 СМЖ. Как понятно специалисту в данной области терапевтически эффективные дозы, рассчитанные на основании веса головного мозга и веса тела, могут быть переведены в мг/15 см3 СМЖ. Например, объем СМЖ у взрослого человека составляет примерно 150 мл (Johanson CE, et al. "Multiplicity of cerebrospinal fluid functions: New challenges in health and disease," Cerebrospinal Fluid Res. 2008 May 14; 5:10). Таким образом, инъекция в дозе от 0,1 мг до 50 мг белка для взрослого человека будет составлять примерно 0,01 мг/15 см3 СМЖ (0,1 мг) до 5,0 мг/15 см3 СМЖ (50 мг) для взрослого.

[0240] Следует также понимать, что для любого конкретного субъекта конкретные режимы введения должны быть скорректированы с течением времени в соответствии с индивидуальными потребностями и мнением специалиста или лица, осуществляющего контроль за проведением фермент-заместительной терапии, и диапазоны дозировок, установленные в настоящем документе, приведены только для примера и не предназначены для ограничения объема или осуществления на практике заявленного изобретения.

Наборы

[0241] Настоящее изобретение также предусматривает наборы или другие изделия, содержащие состав согласно настоящему изобретению и инструкции по его восстановлению (если состав лиофилизирован) и/или применению. Наборы или другие изделия производства может включать в себя контейнер, УИДЛС, катетер и любые другие изделия, устройства или оборудование, применимые для интратекального введения и связанных с ним операций. Подходящие контейнеры включают, например, бутылки, флаконы, шприцы (например, предварительно заполненные шприцы), ампулы, картриджи, резервуары или шприцы «lyo-jects». Контейнер может быть изготовлен из различных материалов, таких как стекло или пластик. В некоторых вариантах реализации контейнер представляет собой предварительно заполненный шприц. Подходящие предварительно заполненные шприцы, включают, но не ограничены перечисленным: шприцы из боросиликатного стекла с термически обработанным силиконовым покрытием, шприцы из боросиликатного стекла с нанесенным слоем силикона или пластиковые шприцы без силикона.

[0242] Обычно контейнер может включать состав и этикетку, прикрепленную или прилагаемую к контейнеру, на которой может быть указаны инструкции по восстановлению и/или применению составу. Например, на этикетке может быть указано, что состав необходимо восстановить до концентрации белка, описанной выше. Этикетка может также содержать информацию о том, для чего применим или предназначен состав, например, для ИТ введения. В некоторых вариантах реализации контейнер может содержать одну дозу стабильного состава, содержащего терапевтический агент (например, замещающий фермент). В различных вариантах реализации разовая доза стабильного состава присутствует в объеме менее 15 мл, 10 мл, 5,0 мл, 4,0 мл, 3,5 мл, 3,0 мл, 2,5 мл, 2,0 мл, 1,5 мл, 1,0 мл, или 0,5 мл. Кроме того, контейнер, содержащий состав, может представлять собой флакон для многократного применения, позволяющий проводить повторные введения (например, от 2-6 введений) состава. Наборы или другие изделия могут дополнительно включать второй контейнер, содержащий подходящий растворитель (например, БВДИ, физиологический раствор, буферный раствор). После смешивания с растворителем и подготовки состава конечная концентрация белка в восстановленном составе, как правило, составляет не менее 1 мг/мл (например, по меньшей мере 5 мг/мл, по меньшей мере 10 мг/мл, по меньшей мере 25 мг/мл, по меньшей мере 50 мг/мл по меньшей мере 75 мг/мл по меньшей мере 100 мг/мл). Наборы или другие изделия производства могут дополнительно включать другие вещества, желательные с коммерческой точки зрения и с точки зрения удобства пользователя, в том числе другие буферы, разбавители, фильтры, иглы, УИДЛС, катетеры, шприцы и вкладыши с инструкциями по применению.

[0243] Настоящее изобретение будет более понятным при рассмотрении следующих примеров. Примеры не должны рассматриваться как ограничивающие объем настоящего изобретения. Все процитированные источники включены посредством ссылок.

ПРИМЕРЫ

ПРИМЕР 1: ИССЛЕДОВАНИЕ ТОКСИЧНОСТИ ИНТРАТЕКАЛЬНОГО ВВЕДЕНИЯ АРИСЛУЛЬФАТАЗЫ A

[0120] Чтобы оценить способность других вводимых интратекально ферментов к распределению в клетки и ткани ЦНС, проводили исследование в соответствии с GLP (надлежащей лабораторной практикой), в котором оценивали многократное интратекальное (ИТ) введение рекомбинантной арилсульфатазы A человека (rhASA) с точки зрения токсикологии и фармакологической безопасности в течение одного месяца у молодых (моложе 12 месяцев) длиннохвостых макак. Лекарственную форму rhASA готовили и составляли с применением основы из 154 мМ NaCl, 0,005% полисорбата 20 при pH 6,0.

[0121] Для достижения цели исследования девять самцов и девять самок молодых длиннохвостых макак случайным образом распределяли в зависимости от массы тела в одну из трех групп, как указано в Таблице 6. Указанные животные (за исключением 1 самца в группе дозы 1) получали краткосрочную инфузию объемом 0,6 мл с 0, 3 или 31 мг/мл rhASA (суммарная доза 0, 1,8 или 18,6 мг) раз в две недели - всего три дозы на одно животное. Следили за массой тела, клиническими признаками, показателями неврологического и физикального обследования, данными лабораторной диагностики, данными офтальмологического обследования и токсикокинетическими пробами. Всех указанных животных подвергали вскрытию в День 29, 30 или 31 (~24 часа после последнего ИТ введения препарата). Выбранные ткани отбирали, сохраняли и подвергали микроскопическому исследованию.

Таблица 6
Группа Количество животных Номинальная концентрация в дозе (мг/мл) Объем дозы (мл) Вводимая доза (мг)
1 3М, 3Ж 0 0,6 0
2 3М, 3Ж 3 0,6 1,8
3 3М, 3Ж 31 0,6 18,6

[0122] Концентрации rhASA, определяемые в тканях ЦНС длиннохвостых макак, определяли посредством ELISA и сравнивали с терапевтическим целевым значением 10% от нормальной концентрации rhASA у человека, что соответствует примерно 2,5 нг/мг ткани. Пробы ткани или биопсические образцы извлекали из разных областей головного мозга длиннохвостых макак и далее анализировали на наличие rhASA. Фигура 24 иллюстрирует ткани, из которых брали биопсию. Полученные при биопсии пробы ткани продемонстрировали увеличение концентрации rhASA, что отражено на Фигуре 25A-G, и был выявлен градиент отложения от коры больших полушарий до глубоких слоев белого вещества и глубоких слоев серого вещества.

[0123] Концентрации rhASA, определяемые с использованием одинаковой биопсии, как и при ИТ, так и при ИЦВ пути введения у 6 обезьян, получавших дозу rhASA 18,6 мг, проиллюстрированы на Фигуре 26 A-B. Концентрации rhASA, определяемые в глубоких слоях белого вещества (Фигура 25 A) и в глубоких слоях серого вещества (Фигуре 26 B) головного мозга взрослых и молодых длиннохвостых макак, получавших rhASA интратекально (ИТ) или интрацеребровентрикулярно (ИЦВ), были сопоставимы.

[0124] Затем полученные при биопсии пробы ткани головного мозга взрослых и молодых длиннохвостых макак анализировали с целью определения концентрации rhASA, отложившейся в извлеченной пробе ткани, и сравнивали полученные концентрации с терапевтической целевой концентрацией 2,5 нг rhASA на мг белка (соответствует 10% от нормальной концентрации rhASA у здорового человека). Как проиллюстрировано на Фигуре 27 A, в каждой анализируемой пробе ткани, полученной при биопсии, ИТ введение rhASA в дозе 18,6 мг приводило к концентрации rhASA, превосходившей целевую терапевтическую концентрацию 2,5 нг/мг белка. Аналогично, когда rhASA в дозе 1,8 мг ИТ вводили молодым длиннохвостым макакам, в каждой анализируемой пробе ткани, полученной при биопсии, концентрация rhASA была в пределах либо превышала целевую терапевтическую концентрацию 2,5 нг/мг белка, а медианы концентрации rhASA были выше терапевтического целевого уровня для тестируемых тканей, полученных при биопсии (Фигура 27B).

[0125] Чтобы определить, распределилась ли введенная ИТ rhASA в соответствующие клетки, анализировали ткань из глубоких слоев белого вещества яванской макаки, получавшей rhASA в дозе 1,8 мг ИТ, из области, показанной на Фигуре 28A. Иммунное окрашивание глубоких слоев белого вещества выявило распределение rhASA в олигодендроциты длиннохвостых макак, что иллюстрирует Фигура 28B. Аналогично, Фигура 28C иллюстрирует, что введенный ИТ rhrASA демонстрирует совместную локализацию в глубоких слоях белого вещества длиннохвостых макак. В частности, при окрашивании явно видна совместная локализация с целевыми органеллами, такими как лизосома (Фигура 28C), что подтверждает вывод о том, что вводимый ИТ rhASA способна распределяться в соответствующие клетки, ткани и органеллы ЦНС, включая лизосомы олигодендроцитов. Вышеизложенное подтверждает вывод о том, что различие между ИЦВ и ИТ доставкой также оказалось минимальным при доставке rhASA.

ПРИМЕР 2: БИОРАСПРЕДЕЛЕНИЕ РАДИОАКТИВНО-МЕЧЕНОГО БЕЛКА

[0126] rhASA, меченный излучателем позитронов – 124I, готовили и составляли с применением основы из 154 мМ NaCl, 0,005% полисорбата 20 при pH 6,0. Взрослым длиннохвостым макакам интрацеребровентрикулярно (ИЦВ) и интратекально (IT) вводили объем лекарственной формы, эквивалентный 3 мг rhASA (соответствующий примерно 38 мг/кг головного мозга). Длиннохвостых макак подвергали позитронно-эмиссионной томографии с высоким разрешением (микроПЭТ P4) с целью оценки распределения введенной 124I-меченой rhASA.

[0127] Данные ПЭТ (Фигура 29) подтверждают, что вводимая ИТ 124I-меченый rhASA эффективно распределялась в ткани ЦНС и, в частности, 124I-меченый rhASA, вводимая через ИТ-катетер в поясничном отделе незамедлительно и равномерно распространялась по спинномозговой жидкости (СМЖ) по всей длине позвоночника. В частности, как показано на Фиг.29 после ИЦВ и ИТ введения в тканях ЦНС испытуемых длиннохвостых макак, включая головной мозг, спинной мозг и СМЖ, определялись терапевтические концентрации 124I-меченого rhASA. Концентрации rhASA, определяемые в указанных тканях ЦНС, и в частности, в тканях головного мозга, превышали целевую терапевтическую концентрацию 2,5 нг/мг белка.

[0128] Хотя распределение белка rhASA было сопоставимым при ИТ и ИЦВ пути введения, ИЦВ путь введения приводил к значительно меньшему отложению в позвоночном столбе, что подтверждается Фигурой 29.

[0129] Через двадцать четыре часа после введения лекарственной формы вводимая как ИЦВ, так и ИТ 124I-меченый ASA эффективно распределялась в ткани ЦНС. В частности, через двадцать четыре часа после ИТ введения 12,4% введенной дозы обнаруживалось в головном отделе, тогда как при ИЦВ введении в головном отделе обнаруживалось 16,7% от введенной дозы. Соответственно, концентрации rhASA, определяемые в указанных тканях ЦНС, и в частности, в тканях головного мозга, в случае ИТ введения rhASA, приближались к концентрациям, определяемым после ИЦВ введения такой же дозы.

[0130] ИЦВ инъекция 124I-меченого rhASA приводит к незамедлительному переносу вводимого объема к мостомозжечковой цистерне, мостовой цистерне, межножковой цистерне и проксимальному отделу позвоночника, как проиллюстрировано на Фигуре 30. На Фигуре 30 также проиллюстрирован тот факт, что через 2-5 часов после ИТ введения 124I-меченый rhASA доставляется к тем же начальным компартментам (цистернам и проксимальному отделу позвоночника), доставка к которым была показана и при ИЦВ введении. Через двадцать четыре часа после как ИЦВ, так и ИТ введения распределение 124I-меченого rhASA в области цистерн и проксимального отдела позвоночника было сопоставимым, что проиллюстрировано на Фигуре 31. Соответственно, вышеизложенные результаты свидетельствуют, что, в отличие от низкомолекулярных лекарственных препаратов, для rhASA ИЦВ введение сопровождается минимальными преимуществами по сравнению с ИТ-введением.

[0131] Указанные результаты подтверждают, что rhASA можно доставлять в организм субъекта с применением менее инвазивного ИТ пути введения и при этом достигать терапевтических концентраций в клетках и тканях-мишенях.

[0132] Лизосомные болезни накопления представляют собой семейство генетических нарушений, вызываемых отсутствием или дефектом ферментом, которые приводят к аномальному накоплению субстратов. Хотя периферические симптомы, связанные с некоторыми из указанных заболеваний, можно эффективно облегчать путем внутривенного введения рекомбинантных ферментов, нельзя ожидать, что внутривенное введение таких рекомбинантных ферментов значительно повлияет на проявления со стороны ЦНС, связанные с большинством лизосомных болезней накопления. Например, рекомбинантная идуронат-2-сульфатаза человека (идурсульфаза, Элапраза®; «Shire Human Genetic Therapies, Inc.» Лексингтон, Массачусетс) одобрена для лечения соматических симптомов синдрома Хантера, но не является средством медикаментозной терапии неврологических проявлений, которые включают задержку развития и прогрессирующее снижение умственной деятельности. Отчасти это связано с природой I2S, которая представляет собой крупный фермент с высокой степенью гликозилирования и с молекулярной массой примерно 76 кДа, который не проходит через гематоэнцефалический барьер после внутривенного введения.

[0133] Таким образом, авторы настоящего изобретения разработали программу для изучения интратекальной доставки лекарственных форм для интратекального введения рекомбинантных ферментов человека, например, таких как идуронат-2-сульфатаза (I2S), арилсульфатаза (rhASA) и альфа-N-ацетилгликозамидаза (Naglu). Результаты, представленные в настоящей заявке, обнародуются впервые, чтобы продемонстрировать, что ИТ введение рекомбинантных лизосомальных ферментов в поясничный отдел приводит к доставке существенной доли вводимого белка в головной мозг, и, в частности, приводит к масштабному отложению таких белков в нейронах головного мозга и спинного мозга как у длиннохвостых макак, так и у собак. Иммуногистохимический анализ тканей ЦНС продемонстрировал, что белки направляются в лизосомы, - участок патологического накопления гликозаминогликанов при лизосомных болезнях накопления. Кроме того, морфологические улучшения, продемонстрированные в модели синдрома Хантера на мышах IKO, в модели болезни Санфилиппо типа B на Naglu-дефицитных мышах и в модели метахроматической лейкодистрофии (МЛД) на нокаутных мышах, подтверждают тот экспериментальный факт, что вводимый ИТ фермент распределяется в соответствующие ткани и транспортируется в соответствующие компартменты и органеллы клетки.

[0134] Сходства характера распределения, наблюдаемого после ИТ и ИЦВ введения I2S, позволяют предположить массовое передвижение и активное перемешивание СМЖ. Таким образом в клинических условиях и ИТ, и ИЦВ путь введения потенциально применимы, однако, наблюдаемое отложение I2S в спинном мозге после ИТ введения обеспечивает явное преимущество данного пути введения при борьбе со спинномозговыми последствиями и компонентами лизосомных болезней накопления, таких как синдром Хантера. Кроме того, порты для инъекций в спинной мозг менее инвазивны, и предполагается, что они больше подходят для длительного применения, особенно у педиатрических пациентов.

[0135] Данные, полученные при окрашивании периваскулярных клеток и при оценке динамики транслокации белков, наблюдаемые при вышеупомянутых ПЭТ исследованиях, указывают на то, что фермент движется по периваскулярному пространству, предположительно посредством конвекционных механизмов, сопровождающихся пульсацией. На основании наблюдаемой взаимосвязи I2S с нейрофиламентами можно предположить, что дополнительным механизмом транспорта является аксональный транспорт. Последний, предположительно, начинается с взаимодействия белка с нейрональными рецепторами манноза-6-фосфата (M6P), которые повсеместно экспрессируются в клетках спинного и головного мозга и которые при прямом введении в паренхиму головного мозга могут приводить к тому, что фермент I2S будет легко всасываться в клетки-мишени. (Begley, et al., Curr Pharm Des (2008) 14:1566-1580).

[0136] Хотя указания на аксональный транспорт лизосомальных ферментов ранее уже получали косвенными методами in vivo и путем визуализации in vitro, в настоящих исследованиях были получены первые прямые подтверждения аксонального транспорта невирусных или экспрессируемых ферментов, доставляемых через СМЖ. Таким образом, доставка белков из СМЖ к поверхности головного мозга из более глубоких тканей головного мозга, по-видимому, зависит от процессов активного переноса, ни один из которых ранее не был описан или объяснен для доставки белков или ферментов к клеткам, тканям и органеллам головного мозга.

[0137] В противоположность преобладающей точке зрения о том, что динамика потока в интерстиции паренхимы и СМЖ может препятствовать распределению вводимых интратекально в поясничный отдел белков в белое вещество головного мозга, настоящие исследования явно демонстрируют, что ИТ доставка лизосомальных ферментов приводит к распределению и накоплению белка во всех тканях головного мозга и к отложению их в лизосомальном компартменте клеток-мишеней, которые являются участком патологического накопления гликозаминогликанов. (См., например, Fenstermacher et al., Ann N Y Acad Sci (1988) 531:29-39 and DiChiro et al., Neurology (1976) 26:1-8.) В совокупности с менее инвазивным характером ИТ-поясничной доставки данный путь введения обеспечивает клинически значимый способ доставки биопрепаратов к головному мозгу, в частности, у детей.

ПРИМЕР 3: СОСТАВЫ ДЛЯ ИТ ВВЕДЕНИЯ АРИЛСУЛЬФАТАЗЫ A

[0138] Данный пример обобщает работу по разработке жидкой лекарственной формы с высокой концентрацией rhASA (арилсульфатазы A) и составление лекарственной субстанции и лекарственного продукта для лечения метахроматической лейкодистрофий (МЛД) через интратекальный (ИТ) путь введния.

[0139] Данные по изучению стабильности демонстрируют, что составы лекарственной субстанции и лекарственного продукта на основе солевых растворов (без ФБР 20) являются стабильными в течение 18 месяцев при (-65°C и 18 месяцев при 2-8°. Во время фармацевтической разработки данного белка были исследованы растворимость и стабильность rhASA в условиях ограниченности буферного раствора и вспомогательных веществ в результате его предполагаемой доставки в ЦНС. Ранее были проведены предварительные исследования по разработке состава для внутривенного (ВВ) введения. Основываясь на результатах данных экспериментов, состав, содержащий 30 мг/мл rhASA в ЮмМ цитратно-фосфатном буфере, pH 5,5 с добавлением 137 мМ NaCl и 0,15% полоксомера 188 был выбран для состава для ВВ введения. Также был разработан состав для ИТ доставки rhASA в трех вариантах, и данные по изучению стабильности этого белка были изучены в этих условиях. Были использованы пробы rhASA, произведенные на одном участке из исходного сырья. Результаты показали, что rhASA был стабильным в 154 мМ растворе хлорида натрия с добавлением 0,005% полисорбата 20 (P20), pH 6,0 на протяжении, по меньшей мере, 18 месяцев при 2-8°C. Кроме этого, были проведены исследования, показывающие стабильность при замораживании-оттаивании и деградации, вызываемой тряской.

[0140] Партии для разработки были очищены, подвержены ультрафильтрации и диафильтрации (УФ/ДФ) в 10 мМ цитратно-фосфатный буфер, 137 мМ NaCl, pH 5,5 с последующей УФ/ДФ в конечный солевой раствор с концентрацией примерно 40 мг/мл. Процедуры УФ/ДФ подытожены в Таблице 7.

ТАБЛИЦА 7
Отобранные составы для процедур УФ/ДФ из Xcellerex-Derived
Состав Исходный буфер и УФ/ДФ в солевой раствор Добавка
A 10 мМ цитратно-фосфатный, 137 мМ NaCl, pH 5,5. Последующая УФ/ДФ в 154 мМ NaCl. Конечный pH 5,9 0,005% полисорбат 20*
B 10 мМ цитратно-фосфатный, 137 мМ NaCl, pH 5,5. Последующая УФ/ДФ в 5 мМ фосфат натрия, 145 мМ NaCl, pH 6,.0. Конечный pH 6,0 0,005% полисорбат 20*
C 10 мМ цитратно-фосфатный, 137 мМ NaCl, pH 5,5. Последующая УФ/ДФ в 10mM цитратно-фосфатный, 137 мМ NaCl, pH 7,0, и вторая УФ/ДФ в 154 мМ NaCl. Конечный pH 6,5 0,005% полисорбат 20*

rhASA

[0141] rhASA в составе 40 мг/мл rhASA в 10 мМ цитрат-фосфате натрия с 137 мМ NaCl, pH 5,6 диализовали в пять составов, которые были использованы для исследований составов для ИТ введения (Таблица 8).

ТАБЛИЦА 8
Буферы, выбранные для изучения составов, совместимых с ИТ введением
Номер состава Буфер pH
1 154 мМ NaCl * 5,9
2 154 мМ NaCl ** 7,0
3 5 мМ фосфатный буфер с 145 мМ NaCl 6,0
4 5 мМ фосфатный буфер с 145 мМ NaCl 7,0
5 1 мМ фосфатный буфер с 2 мМ CaCl2 и 137 мМ NaCl 7,0

Методы

[0142] Для определения температуры плавления (Тп) с помощью

дифференциальной сканирующей калориметрии (ДСК) был использован капиллярный ДСК-микрокалориметр (MicroCal) с частотой сканирования 60°C/ч и диапазоном температуры 10-110°C. Базовые линии буфера вычитались с графиков белка. Изображения нормировали по концентрации белка в каждом образце (измеренной с помощью УФ-поглощения при 280 нм с использованием коэффициента экстинкции 0,69 (мг/мл)-1.см-1). Для первоначальных экспериментов по изучению краткосрочной стабильности лекарственная субстанция rhASA была подвержена воздействию либо 40°C в течение двух недель, либо 40°C в течение одного месяца. Дополнительные образцы были помещены на 2-8°C на 3 месяца для изучения краткосрочной стабильности. Образцы фильтровали (Millipore, P/N SLGV033RS) и аликвоты объемом 0,5 мл были распределены в пробирки объемом 2 мл с 13 мм пробками Flurotec.

[0143] Влияние состава композиции (Таблица 8) на Тп (температурная серединная точка денатурации, вызванной температурой) исследовали, используя ДСК. Значения Тп для различных композиций составов показаны на Фигуре 5. Значения Тп демонстрировали схожие температуры денатурации для большинства составов, за исключением низких значений Тп, наблюдаемых для rhASA в составе с 5 мМ фосфатом натрия с добавлением 154 мМ NaCl, рН 7,0 или 1 мМ фосфат натрия с 2 мМ CaCl2 и 137 мМ NaCl, pH 7,.0.

[0144] Влияние температурного разрушения на rhASA в пяти выбранных составах (Таблица 8) также было исследовано. Образцы хранили либо в течение 2 недель, либо в течение одного месяца при 40°C, либо в течение 3 месяцев при 2-8°C. Анализ методом электрофореза в ПААГ с ДСН (окрашивание Кумасси) образцов, хранившихся в течение 2 недель при 40°C показал фрагментацию rhASA в составе с 5 мМ фосфатом натрия с 154 мМ NaCl, pH 7,0, также как и с 1 мМ фосфатом натрия с 2 мМ CaCl2 и 137 мМ NaCl, pH 7,0 (Фигура 6). Подобная деградация не наблюдалась для остальных составов.

[0145] Присутствие продуктов деградации согласуется с меньшим содержанием основного пика, наблюдаемым с помощью ВЭЖХ с обратной фазой (RP-HPLC) для тех же временных точек (Таблица 10). Также было установлено, что rhASA в составе в 1 мМ ФБР с 2 мМ CaCl2, pH 7,0 не поддерживал pH в начале и в течение краткосрочного воздействия условий температурного стресса.

[0146] Системы для ВЭЖХ производства Waters были использованы для анализа методами эксклюзионной ВЭЖХ и ВЭЖХ с обратной фазой. Для начального анализа методом эксклюзионной ВЭЖХ 50 мкг rhASA вводили на колонку Agilent Zorbax GF-250 (4,6 мм×250 мм) и анализировали в изократическом режиме при скорости потока 0,24 мл/мин, используя в качестве подвижной фазы 100 мМ цитрат натрия, pH 5,5 (определение октомера) с длиной волны детектора 280 нм. Анализы повторяли, используя в качестве подвижной фазы 100 мМ цитрат натрия, pH 7,0 (определение димера).

[0147] Все смены буфера и этапы концентрирования осуществляли с использованием пробирок Centricon-Plus 20 (Millipore, 10 kDa MWCO).

Исследование составов - влияние вида буфера и pH

[0148] В связи с ограниченным количеством подходящих композиций, применяемых для введения в ЦНС, только пять изотонических композиций растворов, перечисленные в Таблице 8, были отобраны для изучения.

Память pH

[0149] Перед выбором буферов для изучения долговременной стабильности были проведены два эксперимента по «памяти pH» для того, чтобы установить способность белка, буфер которого был заменен на солевой раствор, поддерживать pH начального буфера. В начальном эксперименте rhASA в концентрации примерно 8 мг/мл сначала диализовали в 10 мМ цитратно-фосфатный буфер с 137 мМ NaCl, pH или 5,5, или 7,0, после чего последовал второй диализ в солевой раствор. Во втором эксперименте rhASA сначала диализовали в 10 мМ цитратно-фосфатный буфер с 137 мМ NaCl, pH или 5,5, или 7,0 с последующей заменой буфера и концентрированием в солевом растворе до концентрации примерно 35 мг/мл.

[0150] Когда rhASA в 10 мМ цитратно-фосфатном буфере с 137 мМ NaCl, pH или 5,5, или 7,0 диализовали в солевой раствор, не наблюдалось повышения мутности. pH конечного солевого раствора был схожим с pH предшествующего цитратно-фосфатного буфера, в котором он содержался. Когда rhASA в 10 мМ цитратно-фосфатном буфере с 137 мМ NaCl, pH или 5,5, или 7,0 диализовали в солевой раствор и затем концентрировали до концентрации примерно 35 мг/мл, используя пробирки Centricon, pH солевого раствора белка смещался от 5,5 до 5,8 или от 7,0 до 6,8, соответственно. Оба концентрированных раствора rhASA в солевых растворах имели слабую опалесценцию и значения оптической плотности при длине волны 320 в диапазоне от 0,064 (pH 6,8) до 0,080 (pH 5,5).

Выбор вспомогательных веществ

[0151] Полисорбат 20 (P20) был включен во все 5 выбранные растворимые композиции в конечной концентрации 0,005%. Выбор поверхностно-активного вещества был сделан, основываясь на предшествующих экспериментах in vivo по переносимости P20 в концентрации 0,005% для доставки в ЦНС других белков. Готовили раствор 5% P20 (объем/объем), и необходимый объем добавляли к каждому составу белка для получения конечной концентрации 0,005%.

Исследование устойчивости состава - Изучение стабильности

[0152] Основываясь на первоначальных результатах, полученных при изучении разных видов буфера и значений pH, три состава растворов были отобраны для изучения долгосрочной стабильности (приготовление образцов проводили в соответствии с Таблицей 8). Исследование длительностью один год было начало для предложенных составов (Таблица 9). Стабильность образцов в каждой временной точке анализировали методами эксклюзионной ВЭЖХ, ВЭЖХ с обратной фазой, электрофореза в ПААГ с ДСН (окрашивание Кумасси), измерения оптической плотности при 320 нм (OD320), а также по параметрам концентрации белка, pH, удельной активности и внешнего вида.

ТАБЛИЦА 9
Составы для изучения долгосрочной стабильности
Состав Состав композиции с 0,005% полисорбатом 20 Условия исследования
A 154 мМ NaCl, pH 5,9 5°C, 25°C, 40°C, и заморозка Базовая линия при ≤-65°C
B 5 мМ фосфат натрия, 145 мМ NaCl, pH 6,0
C 154 мМ NaCl, pH 6,5

ТАБЛИЦА 10
СТАБИЛЬНОСТЬ ВЫБРАННЫХ СОСТАВОВ ПОСЛЕ ХРАНЕНИЯ В ТЕЧЕНИЕ 2 НЕДЕЛЬ ПРИ 40±2°C
Состав Внешний вид Концентрация белка (мг/мл) OD320 Эксклюзи-онная ВЭЖХ (основного пика) при pH 5,5 Эксклюзи-онная ВЭЖХ (основного пика) при рН 7,0 ВЭЖХ с обратной фазой (% основного пика) pH Удельная активность (ЕД./мг)
Солевой раствор, pH 5,9
Точка отсчета Прозрачный до слегка опалесцирующего 29,9 0,044 >99,9 99,7 99,8 5,6 74
Стресс-условия Прозрачный до слегка опалесцирующего 31,1 0,062 99,8 99,6 99,9 5,7 88
Солевой раствор, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,0 0,038 >99,9 99,6 >99,9 6,7 83
Стресс-условия Прозрачный до слегка опалесцирующего 32,1 0,041 99,1 99,7 97,0 6,5 66
5 мМ ФБР, pH 6,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,8 0,058 >99,9 99,7 99,9 5,9 102
Стресс-условия Прозрачный до слегка опалесцирующего 30,5 0,076 98,8 99,7 99,7 5,9 95
5 мМ ФБР, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,7 0,035 >99,9 99,7 >99,7 6,9 86
Стресс-условия Слегка опалесцирующий до опалесцирующего 30,5 0,041 95,4 99,4 98,0 6,8 94
1 мМ ФБР, pH 7,0 с 2 мМ CaCl2, pH 7,0

Точка отсчета Прозрачный до слегка опалесцирующего 27,5 0,040 >99,9 99,7 >99,9 5,6 90
Стресс-условия Слегка опалесцирующий до опалесцирующего 27,7 0,042 94,8 99,8 99,0 6,6 93

[0153] Никаких существенных изменений в удельной активности образцов, подверженных стресс-условиям, не было выявлено (Таблица 10). Анализ методом эксклюзионной ВЭЖХ обнаружил некоторую деградацию образца в 5 мМ фосфате натрия с 154 мМ NaCl, pH 7,0, который подвергался температурному стрессу в течение 2 недель. Деградация была более выраженной при анализе методом эксклюзионной ВЭЖХ с использованием подвижной фазы с pH 5,5 - т.е. условий, вызывающих ассоциацию rhASA в октамер. В условиях этой подвижной фазы rhASA в составе лекарственной формы с pH 7,0 в 1 мМ ФБР с 2 мМ CaCl2 также демонстрировал значительную деградацию.

[0154] Образцы в составе лекарственной формы в 5 мМ ФБР, pH 7,0 и 1 мМ ФБР, pH 7,0 с 2 мМ CaCl2 г, выдержанные в течение месяца при 40°C, демонстрировали фрагментацию при анализе методом электрофореза в ПААГ с ДСН (данные не показаны). В дополнение к этому исследованию, уменьшение процентного содержания основного пика также наблюдалось при анализе методами ВЭЖХ с обратной фазой и эксклюзионной ВЭЖХ для образцов, хранившихся в лекарственной форме с этими двумя составами с pH 7 (Таблица 11). Снижение удельной активности, тем не менее, было выявлено только для rhASA в лекарственной форме в 5 мМ ФБР, pH 7,0.

ТАБЛИЦА 11
СТАБИЛЬНОСТЬ ВЫБРАННЫХ СОСТАВОВ ДЛЯ ИТ ВВЕДЕНИЯ ПОСЛЕ ХРАНЕНИЯ В ТЕЧЕНИЕ 1 МЕСЯЦА ПРИ 40±2°C
Состав Внешний вид Концентрация белка (мг/мл) OD320 Эксклюзи-онная ВЭЖХ (основного пика) при pH 5,5 Эксклюзи-онная ВЭЖХ (основного пика) при pH 7,0 ВЭЖХ с обратной фазой (% основного пика) pH Удельная активность (ЕД./мг)
Солевой раствор, pH 5,9
Точка отсчета Прозрачный до слегка опалесци-рующего 29,9 0,044 >99,9 99,7 99,8 5,6 74
Стресс-условия Прозрачный до слегка опалесци-рующего 28,3 0,061 >99,9 99,5 99,9 5,7 107
Солевой раствор, pH 7,0
Точка отсчета Прозрачный до слегка опалесци-рующего 29,0 0,038 >99,9 99,6 >99,9 6,7 83
Стресс-условия Прозрачный до слегка опалесци-рующего 25,7 0,189 95,7 99,8 99,5 6,6 100
5 ММ ФБР, pH 6,0
Точка отсчета Прозрачный до слегка опалесци-рующего 29,8 0,058 >99,9 99,7 99,9 5,9 102
Стресс-условия Прозрачный до слегка опалесци-рующего 28,0 0,059 >99,9 99,6 99,9 6,0 94
5 мМ ФБР, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,7 0,035 >99,9 99,7 >99,9 6,9 86
Стресс-условия Слегка опалесцирующий до опалесцирующего 27,3 0,142 91,8 89,6 97,1 6,9 48
1 мМ ФБР, pH 7,0 с 2 мМ CaCl2, pH 7,0

Точка отсчета Прозрачный до слегка о палесцирующего 27,5 0,040 >99,9 99,7 >99,9 5,6 90
Стресс-условия Слегка опалесцирующий до опалесцирующего 28,3 0,053 90,6 88,7 97,9 6.7 133

[0155] После хранения в течение 3 месяцев при 2-8°C rhASA сохранял активность в лекарственной форме для всех составов (Таблица 12). Кроме того, rhASA сохранял >99,8% площади основного пика, что было установлено методом эксклюзионной ВЭЖХ в условиях обеих подвижных фаз. Данные по стабильности в течение 3 месяцев подытожены в Таблице 12.

ТАБЛИЦА 12
СТАБИЛЬНОСТЬ ВЫБРАННЫХ ВАРИАНТОВ БУФЕРА В ТЕЧЕНИЕ 3 МЕСЯЦЕВ ПРИ 2-8°C
Состав Внешний вид Концентрация белка (мг/мл) OD320 Эксклюзи-онная ВЭЖХ (основного пика) при pH 5,5 Эксклюзи-онная ВЭЖХ (основного пика) при pH 7,0 ВЭЖХ с обратной фазой (% основного пика) pH Удельная активность (ЕД./мг)
Солевой раствор, pH 5,9
Точка отсчета Прозрачный до слегка опалесцирующего 29,9 0,044 >99,9 99,7 99,8 5,6 74
Стресс-условия Прозрачный до слегка опалесцирующего 29,4 0,056 99,8 >99,9 99,9 5,6 97
Солевой раствор, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,0 0,038 >99,9 99,6 >99,9 6,7 83
Стресс-условия Прозрачный до слегка опалесцирующего 25,5 0,040 99,8 >99,9 >99,9 6,6 127
5 мМ ФБР, pH 6,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,8 0,058 >99,9 99,7 99,9 5,9 102
Стресс-условия Прозрачный до слегка опалесцирующего 29,9 0,045 99,8 >99,9 >99,9 5,9 109
5 мМ ФБР, pH 7.0
Точка отсчета Прозрачный до слегка опалесцирующего 29,7 0,035 >99,9 99,7 >99,9 6,9 86
Стресс-условия Прозрачный до слегка опалесцирующего 29,0 0,038 99,8 >99,9 >99,9 6,9 110

1 мМ ФБР, pH 7,0 с 2 mM CaCl2
Точка отсчета Прозрачный до слегка опалесци-рующего 27,5 0,040 >99,9 99,7 >99,9 5,6 90
Стресс-условия Прозрачный до слегка опалесци-рующего 28,0 0,042 99,8 99,9 >99,9 6,6 105

[0156] RhASA в лекарственной форме с солевым буфером, pH 7,0 и 1 мМ ФБР, pH 7,0 с 2 мМ CaCl2 также исследовали после хранения в течение 3 месяцев в ускоренных условиях при 25°C. Как показано на Фигуре 7, rhASA в лекарственной форме с этими составами подвергся незначительной фрагментации (с интенсивностью, равной пику примерно 0,5% примеси БСА).

[0157] В совокупности исследования составов продемонстрировали, что стабильность rhASA сохраняется при значении pH в диапазоне от 5,5 до 6,0. Во всех исследованиях с использованием составов растворов с pH 7,0 rhASA демонстрировал фрагментацию, являющуюся одним из механизмов его деградации. Результаты по изучению температурного стресса, полученные для потенциальных составов для ИТ введения при pH 7,0, были подобны результатам по изучению температурного стресса, полученным для составов для ВВ введения (10 мМ цитрат-фосфат натрия с 137 мМ NaCl) при pH 7,0, где также наблюдалась фрагментация. Основываясь на этих исследованиях, три состава, приведенные в Таблице 9, были выбраны для изучения долгосрочной стабильности.

Исследование замораживания-оттаивания

[0158] Эксперименты по замораживанию-оттаиванию проводили с осуществлением трех циклов контролируемого замораживания-оттаивания от комнатной температуры до -50°C со скоростью 0,1°C/мин на полках лиофилизатора Vertis Genesis 35EL. Аликвоты лекарственной субстанции объемом 1 мл с концентрацией 30 мг/мл в лекарственной форме каждой из пяти композиций раствора (Таблица 8) были помещены в стеклянные виалы объемом 3 мл для исследования.

[0159] Для всех экспериментов замораживания-оттаивания использовали лекарственную субстанцию (38±4 мг/мл). Для экспериментов по контролируемому замораживания-оттаивания малого масштаба аликвоты лекарственной субстанции объемом 2 мл помещали в стеклянные виалы объемом 5 мл с 20 мм пробками Flurotec. Эксперименты по изучению стресс-условий замораживания-оттаивания проводились или на полках лиофилизатора Virtis Genesis 35EL, или на полках программируемой криоморозильной камеры (Tenney Jr Upright Test Chamber, модель: TUJR-A-VERV). Три цикла замораживания до 50°C и оттаивания до 25°C были осуществлены или со скоростью замораживания и оттаивания 0,1°C/мин (используя программируемую криокамеру), или со скоростью замораживания 0,1°C/мин и со скоростью оттаивания 0,03°C /мин (используя лиофилизатор). Для основной массы исследований замораживания-оттаивания 90 мл лекарственной субстанции помещали в бутыли из поликарбоната объемом 250 мл.

Для исследований замораживания-оттаивания на сухом льду 3 мл лекарственной субстанции помещали в виалы из поликарбоната объемом 5 мл (Biotainer P/N 3500-05) с полипропиленовыми завинчивающимися крышками и без них. Образцы были заморожены в течение ночи до ≤-65°C и затем помещены на сухой лед в закрытом лотке. В этих экспериментах стеклянные виалы, закрытые пробкой, содержащие тот же объем образца, были использованы в качестве контроля. Для исследований замораживания-оттаивания разбавленной лекарственной субстанции аликвоты объемом 1 мл с концентрацией 1 и 5 мг/мл помещали в полипропиленовые тубы и замораживали до ≤-65°C. Замороженные образцы затем оттаивали на рабочей поверхности стола. Цикл повторяли более 10 раз для имитации любого потенциального стресс-влияния, которое может возникнуть при манипуляциях с аликвотами образца сравнения.

[0160] Влияние замораживания-оттаивания на качество rhASA в предложенных составах с 0,005% P20 было исследовано после 3 циклов замораживания-оттаивания с контролируемой скоростью (0,1°C/мин). Никаких изменений во внешнем виде rhASA не было зафиксировано, и никаких растворимых агрегатов или продуктов деградации не было выявлено с использованием методов эксклюзионной ВЭЖХ и ВЭЖХ с обратной фазой. Кроме этого, никаких полос, соответствующих продуктам фрагментации или агрегации, не было выявлено при анализе методом электрофореза в ПААГ с ДСН в редуцирующих условиях (данные не показаны). В Таблице 13 подытожены результаты этих исследований.

ТАБЛИЦА 13
Влияние замораживания-оттаивания в малом масштабе на качество лекарственной субстанции rhASA
Состав Внешний вид Концентрация белка (мг/мл) Эксклюзионная ВЭЖХ (основного пика) при pH 5,5 Эксклюзионная ВЭЖХ (основного пика) при pH 7,0 ВЭЖХ с обратной фазой (% основного пика) pH Удельная активность (ЕД./мг)
Солевой раствор, pH 5,9
Точка отсчета Прозрачный до слегка опалесцирующего 29,9 НА* НА НА 5,6 102
Стресс-условия Прозрачный до слегка опалесцирующего 29,4 >99,9 99,6 99,4 5,5 86
Солевой раствор, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,0 НА НА НА 6,7 94
Стресс-условия Прозрачный до слегка опалесцирующего 25,0 >99,9 99,6 99,2 6,6 96
5 мМ ФБР, pH 6,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,8 НА НА НА 5,9 92
Стресс-условия Прозрачный до слегка опалесцирующего 31,1 >99,9 99,7 99,5 5,9 95
5 мМ ФБР, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,7 НА НА НА 6,9 99
Стресс-условия Прозрачный до слегка опалесцирующего 29,9 >99,9 99,6 99,0 6,9 112
1 мМ ФБР, pH 7,0 с 2 мМ CaCl2
Точка отсчета Прозрачный до слегка опалесцирующего 27,5 НА НА НА 5,6 90
Стресс-условия Прозрачный до слегка опалесцирующего 27,3 >99,9 99,6 99,3 6,7 103
*Не анализировали

[0161] Результаты исследований по замораживанию-оттаиванию с контролируемой скоростью в малом масштабе были осуществлены в трех повторах на аликвотах лекарственной субстанции объемом 2 мл и подытожены в Таблице 14. Никаких изменений качества субстанции не было зафиксировано. Внешний вид замороженной и оттаянной лекарственной субстанции был сравним с внешним видом базового образца. Не было выявлено никакого снижения концентрации или чистоты материала.

ТАБЛИЦА 14
ВЛИЯНИЕ ЗАМОРАЖИВАНИЯ-ОТТАИВАНИЯ В МАЛОМ МАСШТАБЕ НА КАЧЕСТВО ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ RHASA
Скорость замораживания/оттаивания Точка отсчета 0,1°C/мин замораживание - 0,1°C/мин оттаивание
0,1°C/мин замораживание - 0,03°C/мин оттаивание С использованием лиофилизатора
с использованием программируемой криоморозильной камеры
Внешний вид Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего
Концентрация белка (мг/мл) 42 37 36
Оптическая плотность при 320 нм 0,044 0,045 0,043
Эксклюзионная ВЭЖХ (основного пика) 99,6% 99,7% 99,7%
ВЭЖХ с обратной фазой (% основного пика) >99,9% >99,9% >99,9%
pH 5,9 5,9 5,9
Специфическая активность (ЕД./мг) 65 69 71

[0162] Все эксперименты продемонстрировали, что rhASA сохраняет параметры качества после замораживания-оттаивания. Следует отметить, что тенденция к незначительному понижению была отмечена для активности и процентного содержания основного пика при анализе методом ВЭЖХ с обратной фазой для образца rhASA с концентрацией 1 мг/мл после десяти циклов замораживания-оттаивания, как показано в Таблице 15.

ТАБЛИЦА 15
ВЛИЯНИЕ ЗАМОРАЖИВАНИЯ-ОТТАИВАНИЯ В МАЛОМ МАСШТАБЕ НА КАЧЕСТВО ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ RHASA, РАЗБАВЛЕННОЙ ДО КОНЦЕНТРАЦИИ 1 МГ/МЛ
Образец Точка отсчета 1 цикл З/О 5 циклов З/О 10 циклов З/О
3 цикла З/О
Концентрация белка (мг/мл) 1,0 1,0 1,0 1,0 1,0
Оптическая плотность при 320 нм 0,013 0,005 0,010 0,006 0,017
Эксклюзионная ВЭЖХ (основного пика) 99,5% 99,5% 99,5% 99,5% 99,6%
ВЭЖХ с обратной фазой (% основного пика) 99,2% 99,2% 99,1% 99,0% 98,9%
pH 5,8 5,8 5,8 5,8 5,8
Специфическая активность (ЕД,/мг) 78 76 75 69 65

Эксперименты по встряхиванию

[0163] Аликвоты объемом 1,0 мл стерильного отфильтрованного белка в лекарственной форме с концентрацией 30 мг/мл в каждой из пяти выбранных композиций растворов (Таблица 8) с P20 помещали в стеклянные виалы объемом 3 мл с 13 мм пробкой Flurotec. Виалы в горизонтальном положении помещали на орбитальный встряхиватель (Labline Orbital Shaker) и встряхивали в течение 24 часов при 100 об/мин. Затем частоту повышали до 200 об/мин в течение следующих 24 часов встряхивания.

[0164] С целью изучить чувствительность rhASA к встряхиванию проводили изучение встряхивания и перемешивания как для лекарственной субстанции, так и для лекарственного препарата в концентрации 35,4 и 30 мг/мл, соответственно. Для данных исследований аликвоты лекарственной субстанции объемом 1,0 мл помещали в стеклянные виалы объемом 3 мл с 13 мм пробками Flurotec. Виалы, которые подвергали встряхиванию, проверяли каждый час в течение первых 8 часов и затем во временных точках 24 и 48 часов. Виалы вынимали при появлении первых признаков помутнения и анализировали. Оценивали внешний вид образцов, затем образцы анализировали методом эксклюзионной ВЭЖХ, а также по параметрам pH, удельной активности и оптической плотности при 320 нм. Исследования встряхивания лекарственного препарата проводили в трех повторах (в 154 мМ NaCl, pH 6,0 с 0,005% P20) и сравнивали с исследованием лекарственной субстанции в одном повторе (в 154 мМ NaCl, pH 6,0). Исследования втряхивания также повторяли без включения P20 в состав солевого раствора. Для этих исследований аликвоты лекарственного препарата с концентрацией 30 мг/мл объемом 1 или 3 мл помещали в виалы объемом 3 мл для исследования влияния встряхивания, а также объема свободного пространства над продуктом на качество rhASA. Для этих исследований влияния встряхивания была использована скорость 220 об/мин.

[0165] Начальные исследования встряхивания, проведенные для разработки составов для ВВ введения rhASA, продемонстрировали потенциальное преимущество присутствия поверхностно-активного вещества. При разработке составов для ИТ введения 0,005% P20 был выбран и включен в составы для исследования встряхивания. После 15-24 часов встряхивания при 100 об/мин не было установлено никаких визуальных изменений ни в одном составе, и скорость встряхивания увеличили до 200 об/мин. Никаких изменений внешнего вида образцов, подвергавшихся встряхиванию, в предложенных вариантов составов не было зафиксировано после суммарного встряхивания в течение 48 часов при 100 и 200 об/мин. Образцы тестировали по окончании этого периода; полученные результаты подытожены в Таблице 16. Никаких изменений не было зафиксировано ни одним из анализов. Анализ методом электрофореза в ПААГ с ДСН в редуцирующих условиях при окрашивании Кумасси также не выявил дополнительных полос с большей или меньшей молекулярной массой в образцах, подвергавшихся, встряхиванию (данные не показаны).

ТАБЛИЦА 16
РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЙ ВСТРЯХИВАНИЯ ВЫБРАННЫХ СОСТАВОВ ДЛЯ ИТ ВВЕДЕНИЯ
Состав Внешний вид Концентрация белка (мг/мл) OD320 Эксклюзионная ВЭЖХ (основного пика) при pH 5,5* ВЭЖХ с обратной фазой (% основного пика) Удельная активность (ЕД./мг)
Солевой раствор, pH 5,9
Точка отсчета Прозрачный до слегка опалесцирующего 29,9 0,044 НА** НА 111
Стресс-условия Прозрачный до слегка опалесцирующего 28,5 0,041 >99,9 99,9 111
Солевой раствор, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,0 0,038 НА НА 115
Стресс-условия Прозрачный до слегка опалесцирующего 24,7 0,032 >99,9 >99,9 110
5 мМ ФБР, pH 6,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,8 0,058 НА НА 103
Стресс-условия Прозрачный до слегка опалесцирующего 30,4 0,047 >99,9 99,9 116
5 мМ ФБР, pH 7,0
Точка отсчета Прозрачный до слегка опалесцирующего 29,7 0,035 НА НА 92
Стресс-условия Прозрачный до слегка опалесцирующего 26,5 0,029 >99,9 99,9 110
1 мМ ФБР, pH 7,0 с 2 мМ CaCl2
Точка отсчета Прозрачный до слегка опалесцирующего 27,5 0,040 НА НА 147
Стресс-условия Прозрачный до слегка опалесцирующего 27,0 0,038 >99,9 99,9 107
*В связи с проблемами с колонкой, профиль димерных форм методом эксклюзионной ВЭЖХ с подвижной фазой с pH 7,0 не был получен.

**Не анализировали

[0166] Никаких изменений лекарственной субстанции (в 154 мМ NaCl, pH 6,0) или лекарственного продукта (в 154 мМ NaCl, pH 6,0 с 0,005% P20) не было выявлено после первых 4 часов перемешивания. После 6 часов перемешивания как лекарственная субстанция, так и лекарственный препарат стали слегка мутными (данные не показаны). Помутнение стало более выраженным после 48 часов перемешивания в случае, если P20 не присутствовал в составе. К тому же, лекарственная субстанция и лекарственный препарат, которые подвергали встряхиванию, стали мутными через 24 часа. Фигура 8 демонстрирует результаты исследования встряхивания в течение 48 часов.

[0167] Таблица 17 и Таблица 18 подытоживают результаты исследований встряхивания.

ТАБЛИЦА 17
ВНЕШНИЙ ВИД ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ И ЛЕКАРСТВЕННОГО ПРЕПАРАТА (С P20) rhASA ПОСЛЕ ПЕРЕМЕШИВАНИЯ
Часы Лекарственная субстанция после перемешивания Лекарственный препарат после перемешивания
Точка отсчета Бесцветный, опалесцирующий, свободный от частиц. Бесцветный, опалесцирующий, свободный от частиц.
2 Без изменений Без изменений
4 Без изменений Без изменений
6 Хлопья (1-2), слегка мутный Волокнистый материал, слегка мутный
8 Хлопья (1-2), слегка мутный Волокнистый материал, слегка мутный
24 Хлопья (1-2), очень мутный Волокнистый материал, мутный
48 Хлопья (1-2), очень мутный Волокнистый материал, очень мутный

ТАБЛИЦА 18
ВНЕШНИЙ ВИД ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ И ЛЕКАРСТВЕННОГО ПРЕПАРАТА (С P20) rhASA ПОСЛЕ ВСТРЯХИВАНИЯ
Часы Лекарственная субстанция после встряхивания Лекарственный препарат после встряхивания
Точка отсчета Бесцветный, опалесцирующий, свободный от частиц. Бесцветный, опалесцирующий, свободный от частиц.
2 Без изменений Без изменений
4 Без изменений Без изменений
6 Без изменений Без изменений
8 Без изменений Без изменений
24 Хлопья (1-2) Волокна (1-2)
48 Волокнистый материал Волокна (1-2)

[0168] Образцы, которые подвергали встряхиванию, были проанализированы методами эксклюзионной ВЭЖХ и ВЭЖХ с обратной фазой, а также по параметрам OD320, pH, удельной активности. Результаты представлены в Таблице 19 и Таблице 20. В целом. Не было выявлено никаких существенных изменений в качестве rhASA после перемешивания и встряхивания, за исключением изменений внешнего вида.

ТАБЛИЦА 19
ВЛИЯНИЕ 48-ЧАСОВОГО ВСТРЯХИВАНИЯ НА ЛЕКАРСТВЕННУЮ СУБСТАНЦИЮ И ЛЕКАРСТВЕННЫЙ ПРЕПАРАТ
Скорость замораживания/оттаивания Точка отсчета Лекарственная субстанция после 48 часов встряхивания (n=1) Лекарственный препарат после 48 часов встряхивания (n=3)
Оптическая плотность при 320 нм 0,080 0,053 0,048
Эксклюзионная ВЭЖХ (основного пика) 99,7% 99,7% 99,7%
ВЭЖХ с обратной фазой (% основного пика) >99,9% >99,9% >99,9%
pH 6,0 6,0 5,9
Специфическая активность (ЕД,/мг) 96 71 72

[0169] В ходе перемешивания лекарственного препарата с 0,005% P20 через 6 часов один из трех образцов в параллели стал мутным. Этот образец был удален, а оставшиеся два образца перемешивали до 48 часов. Таблица 20 демонстрирует средние результаты анализа образцов в двух повторах.

ТАБЛИЦА 20
ВЛИЯНИЕ 48-ЧАСОВОГО ПЕРЕМЕШИВАНИЯ НА ЛЕКАРСТВЕННУЮ СУБСТАНЦИЮ И ЛЕКАРСТВЕННЫЙ ПРЕПАРАТ
Скорость замораживания/оттаивания Точка отсчета Лекарственная субстанция после 6 часов перемешивания (n=1) Лекарственный препарат после 48 часов перемешивания (n=2)
Оптическая плотность при 320 нм 0,080 0,244 0,103
Эксклюзионная ВЭЖХ (основного пика) 99,7% 99,7% 99,7%
ВЭЖХ с обратной фазой (% основного пика) >99,9% >99,9% >99,9%
pH 6,0 6,0 6.0
Специфическая активность (ЕД,/мг) 69 73 73

[0170] На основе полученных результатов и визуального исследования лекарственная субстанция и лекарственный препарат не являются высоко чувствительными к деградации, вызванной встряхиванием, если последнее представляет собой непрерывное перемешивание в течение 4 часов (при установке №5) или непрерывное энергичное встряхивание в течение 8 часов (при 220 об/мин) до проявления изменений их внешнего вида.

[0171] Исследования влияния встряхивания были проведены повторно с лекарственным препаратом без добавления P20. Для этих исследований каждую виалу наполняли либо 1 мл, либо 3 мл лекарственного препарата с целью изучения влияния встряхивания, а также объема свободного пространства над продуктом на качество rhASA. Для 1 мл препарата, помещенного в виалу объемом 3 мл, никаких изменений во внешнем виде лекарственного препарата не было выявлено на протяжении 8 часов перемешивания при 220 об/мин (n=2, данные не показаны). В виалах без свободного пространства над продуктом (n=1) наблюдалось образование мелких хлопьев, нескольких волокон и сгустка быстрее, в сравнении с виалами с большим свободным пространством над продуктом. Результаты 48-часового исследования представлены на Фигуре 9.

[0172] Результаты визуального определения также подытожены в Таблице 21 и Таблице 22.

ТАБЛИЦА 21
ВНЕШНИЙ ВИД ЛЕКАРСТВЕННОГО ПРЕПАРАТА В ОТСУТСТВИЕ ПОЛИСОРБАТА 20 ПОСЛЕ 48 ЧАСОВ ВСТРЯХИВАНИЯ С НАПОЛНЕНИЕМ ВИАЛ 1 МЛ И 3 МЛ
Часы Лекарственный препарат после встряхивания MLD-200L-001 без P20 Лекарственный препарат после встряхивания MLD-200L-003 без P20 Контроль (лекарственный препарат после встряхивания MLD-200L-001 с P20)
Точка отсчета Бесцветный, опалесцирующий, преимущественно свободный от частиц.
2 Без изменений Без изменений Без изменений
4 Без изменений Без изменений Без изменений
6 Без изменений Без изменений Без изменений
8 Без изменений Без изменений Без изменений
24 Хлопьеобразование Существенное хлопьеобразование Без изменений
48 Хлопьеобразование Существенное хлопьеобразование Без изменений

ТАБЛИЦА 22
ВНЕШНИЙ ВИД ЛЕКАРСТВЕННОГО ПРЕПАРАТА В ОТСУТСТВИЕ ПОЛИСОРБАТА 20 ПОСЛЕ 48 ЧАСОВ ВСТРЯХИВАНИЯ С НАПОЛНЕНИЕМ ВИАЛ 1 МЛ И 3 МЛ
Часы Лекарственный препарат после встряхивания MLD-200L-001 без P20 Контроль (лекарственный препарат после встряхивания MLD-200L-001 с P20)
Точка отсчета Бесцветный, опалесцирующий, преимущественно свободный от частиц.
2 Без изменений Без изменений
4 Небольшие хлопья, несколько волокон и сгусток Без изменений
6 Небольшие хлопья, несколько волокон и сгусток Без изменений
8 Небольшие хлопья, несколько волокон и сгусток Без изменений
24 Небольшие хлопья, несколько волокон и сгусток Без изменений
48 Небольшие хлопья, несколько волокон и сгусток Без изменений

Никаких изменений концентрации белка не было выявлено. Кроме того, никаких растворимых агрегатов не было обнаружено с использованием метода эксклюзионной ВЭЖХ для объемов наполнения 1 мл или 3 мл (Таблица 23 и Таблица 24). Анализ методом электрофореза в ПААГ с ДСН в редуцирующих условиях при окрашивании

Кумасси также не выявил дополнительных полос с большей или меньшей молекулярной массой в образцах, подвергшихся встряхиванию (данные не показаны).

ТАБЛИЦА 23
РЕЗУЛЬТАТЫ 48 ЧАСОВ ВСТРЯХИВАНИЯ ЛЕКАРСТВЕННОГО ПРЕПАРАТА В ОТСУТСТВИЕ ПОЛИСОРБАТА 20 С НАПОЛНЕНИЕМ ВИАЛ 1 МЛ И 3 МЛ
Анализ Точка отсчета Лекарственный препарат после 24 часов встряхивания (n=2) без P20 Лекарственный препарат после 48 часов встряхивания (n=2) без P20
Контроль (n=1) с P20
Концентрация (мг/мл) 32,3 32,9 33,8 31,8
Оптическая плотность при 320 нм 0,164 0,160 0,163 0,169
Эксклюзионная ВЭЖХ (основного пика) 99,5 99,5 99,5 99,6
pH 6,1 6,1 6,0 6,0
Специфическая активность (ЕД,/мг) 64 63 62 72

ТАБЛИЦА 24
РЕЗУЛЬТАТЫ 48 ЧАСОВ ВСТРЯХИВАНИЯ ЛЕКАРСТВЕННОГО ПРЕПАРАТА В ОТСУТСТВИЕ ПОЛИСОРБАТА 20 С НАПОЛНЕНИЕМ ВИАЛ 1 МЛ И 3 МЛ
Анализ Точка отсчета Лекарственный препарат после 48 часов встряхивания (n=1) без P20 Лекарственный препарат после 48 часов встряхивания (n=1) без P20
Контроль (n=1) с P20
Концентрация (мг/мл) 31,02 34,4 32,1 32,6
Оптическая плотность при 320 нм 0,152 0,163 0,166 0,151
Эксклюзионная ВЭЖХ (основного пика) 99,6 99,6 99,6 99,6
pH 6,0 6,0 5,9 6,0.
Специфическая активность (ЕД,/мг) 70 64 65 71

Исследования буферной емкости

[0173] Для определения буферной емкости rhASA продукт титровали в трех повторах либо разбавленной кислотой, либо разбавленной щелочью. Аликвоты лекарственной субстанции объемом 10 мл с концентрацией 38 либо 30 мг/мл (последняя для имитации лекарственного препарата) помещали в стеклянные виалы объемом 20 мл, в которые была положена магнитная микромешалка. Аликвоты объемом 1 мкл 1 н хлористоводородной кислоты (HCl) прибавляли к раствору белка, перемешивали содержимое и измеряли pH. Эксперимент продолжили с добавлением по 1 мкл HCl без промывки pH-чувствительного электрода между измерениями для избежания разведения, до достижения величины pH примерно 5,5. Эксперимент проводили в трех повторах; 5 мМ фосфатный буфер, содержащий 150 мМ хлорид натрия, pH 6,0, параллельно титровали для сравнения. Аналогично, лекарственную субстанцию в обеих концентрациях титровали 1М гидроксидом натрия (NaOH) до достижения конечной величины pH примерно 6,5. С целью исследовать наличие любого остаточного фосфата в rhASA лекарственную субстанцию анализировали с помощью метода масс-спектрометриии с индуктивно-связанной плазмой (ИСП-МС). Буферную емкость разбавленной лекарственной субстанции rhASA также изучали для того, чтобы убедиться, что значение рН раствора не изменяется в результате разбавления раствора белка. Разбавленные образцы с диапазоном концентраций от 30 мг/мл до 1 мг/мл готовили в пробирках эппендорф объемом 1,5 мл, и измеряли значение pH после разведения и через одну неделю хранения при 2-8°C.

[0174] Результаты изучения титрования разбавленной кислотой и разбавленной щелочью продемонстрировали соответствующую буферную емкость растворов rhASA. В исследовании титрования с использованием HCl первоначальное добавление примерно 2 мкл 1 М кислоты не изменяло рН ни лекарственной субстанции, ни и контрольного буфера. При увеличении объемов кислоты, тем не менее, наблюдалось стремительное снижение pH буфера по сравнению с лекарственной субстанцией rhASA. После прибавления 13 мкл 19 М HCl, pH контрольного буфера был более чем на 2 единицы pH ниже, чем pH лекарственной субстанции. Лекарственная субстанция с концентрацией 30 мг/мл была также включена в эти эксперименты для имитации концентрации лекарственного препарата. Фигура 10 иллюстрирует буферную емкость лекарственной субстанции rhASA в сравнении с 5 мМ натрий-фосфатным буфером, pH 6,3 с 150 мМ хлоридом натрия при титровании кислотой.

[0175] Титрование лекарственной субстанции rhASA гидроксидом натрия демонстрировало относительно отличные результаты (Фигура 11) в отношении поддержания pH. Степень изменения pH существенно не отличалась между лекарственной субстанцией и контрольным буфером.

[0176] На основании полученных результатов, не вдаваясь в теорию, можно предположить, что rhASA вносит вклад в буферную емкость раствора, поскольку боковые цепи аспарагиновой кислоты, глутаминовой кислоты и гистидина обладают способностью выступать в качестве акцепторов и/или доноров протонов с целью поддержания pH раствора. Буферная емкость этого белка также ранее изучалась во время предварительных исследований составов, когда был обнаружен эффект «памяти pH». Поддержание pH было продемонстрировано несколько раз как в лабораторном масштабе, так и в процедурах большого масштаба. В совокупности результаты, полученные в этих двух экспериментах, свидетельствуют, что буферная емкость rhASA в солевом растворе преобладает в кислотном направлении. Согласно литературным данным, буферная емкость при более низких значениях pH является прямым свидетельством большого числа остатков аспарагиновой кислоты и глутаминовой кислоты в данном белке по сравнению с остатками гистидина. Не будем вдаваться в теорию, но это может действительно иметь место в случае арилсульфатазы A, которая содержит в общей сложности 45 остатков глутаминовой и аспарагиновой кислот в сравнении с 18 остатками гистидина.

[0177] Буферная емкость лекарственной субстанции может также обуславливаться остаточными связанными фосфатами, присутствие которых в лекарственной субстанции было показано с использованием ИСП-МС. Таблица 25 демонстрирует количество остаточного фосфата, присутствующего в трех различных пробах лекарственной субстанции, произведенных в крупном научно-исследовательском лабораторном масштабе. Эти данные также подтверждают необходимость этапов ультрафильтрации и диафильтрации для процессов пилотного масштаба.

ТАБЛИЦА 25
ОСТАТОЧНОЕ КОЛИЧЕСТВО ФОСФАТА В ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ, ПРОИЗВЕДЕННОЙ В КРУПНОМ НАУЧНО-ИССЛЕДОВАТЕЛЬСКОМ ЛАБОРАТОРНОМ МАСШТАБЕ
Номер пробы rhASA Концентрация фосфата (миллионные доли)
001 27
002 31
003 31

[0178] С целью дальнейшего выяснения буферной емкости данного белка, также исследовали влияние разведения на pH. При разведении лекарственной субстанции rhASA солевым раствором до меньших концентраций белка никаких изменений значения pH лекарственной субстанции не было выявлено. Затем разбавленную лекарственную субстанцию хранили при 2-8°C в течение одной недели, после чего было проведено изменение pH. Полученные данные представлены в Таблице 26. Результаты показывают, что разбавление и хранение при 2-8°C не влияют на значение pH разбавленной лекарственной субстанции. Эти исследования поддерживают вывод исследований по кислотному и щелочному титрованию, продемонстрировавших соответствующую буферную емкость лекарственной субстанции rhASA, приготовленной в лекарственную форму в солевом растворе.

ТАБЛИЦА 26
ЗНАЧЕНИЕ PH РАЗБАВЛЕННОЙ ЛЕКАРСТВЕННОЙ СУБСТАНЦИИ rhASA
Номинальная концентрация лекарственной субстанции (мг/мл) Концентрация лекарственной субстанции, измеренная с помощью спектрофотометрического метода при длине волны 280 нм (мг/мл) Начальное значение pH Значение pH после хранения в течение недели при 2-8°C
37,0 38,8 6,00 6,20
30,0 33,4 6,07 6,10
25,0 28,3 6,04 6,09
20,0 20,1 6,02 6,12
10,0 9,2 6,04 6,10
5,0 4,5 6,03 6,11
1,0 1,0 6,00 6,07

[0179] Во время исследования разбавления и pH rhASA было установлено, что во внешнем виде разбавленных образцов наблюдалось снижение опалесценции, зависящее от концентрации, т.е. образцы rhASA с большими концентрациями были более опалесцирующими по сравнению с образцами с меньшими концентрациями, которые были практически прозрачными. Фигура 12 показывает наблюдаемый внешний вид разбавленного rhASA. Раствор rhASA с концентрацией 1 мг/мл имел внешний вид, схожий с водой, тогда как внешний вид раствора с концентрацией 30 мг/мл был оценен в диапазоне между Раствором сравнения II и III или III и IV.

Исследование стабильности

[0180] Для исследования стабильности лекарственную субстанцию готовили в концентрации 38±4 мг/мл в 154 мМ NaCl, pH 6,0, лекарственный препарат готовили в концентрации 30±3 мг/мл в 154 мМ NaCl, pH 6,0 при наличии и отсутствии 0,005% полисорбата 20. Аликвоты лекарственной субстанции объемом 1 мл помещали в бутыли из поликарбоната объемом 5 мл с полипропиленовыми закручивающимися крышками и хранили при ≤ -65°C, от -15°C до -25°C, и 2-8°C. Аликвоты лекарственного препарата объемом от 1,0 до 1,1 мл помещали в стеклянные виалы объемом 3 мл с 13 мм пробками Flurotec и хранили при 2-8°C, 25±2°C, и 40±2°C. Виалы с лекарственным препаратом хранили в вертикальном положении для начальных исследований стабильности и меняли на противоположную ориентацию для последующих исследований, используя лекарственный препарат без P20. В каждой временной точке образцы, стабильность которых исследовалась, анализировали методами эксклюзионной ВЭЖХ и ВЭЖХ с обратной фазой, электрофореза в ПААГ с ДСН (окрашивание Кумассии), а также по параметрам оптической плотности при длине волны 320 нм, концентрации белка, pH, удельной активности и внешнего вида. Пептидное картирование, анализ состава полисахаридов и процентного содержания формилглицина проводили ежегодно. Кроме того, последние анализы были также проведены для стресс-условий и условий ускоренного хранения. В совокупности результаты предварительных исследований составов, замораживания-оттаивания и исследования встряхивания свидетельствуют, что только три состава были приемлемыми для дальнейшей разработки. Исследования долгосрочной стабильности были начаты для этих трех составов в присутствии 0,005% P20. В Таблице 27, Таблице 28 и Таблице 29 подытожены данные по изучению стабильности трех составов в выбранных временных точках.

ТАБЛИЦА 27
ДОЛГОСРОЧНАЯ СТАБИЛЬНОСТЬ RHASA B 154 MM NACL, PH 5,9 ПРИ 2-8°C
Анализ Точка отсчета 3 мес. 6 мес. 11 мес.
Внешний вид Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего
Концентрация белка (мг/мл) 25,6 24,3 26,5 27,3
Эксклюзионная ВЭЖХ (основного пика) при pH 5,5 >99,9 99,8 99,9 99,8,
Эксклюзионная ВЭЖХ (основного пика) при pH 7,0 99,1 99,0 99,4 99,7
ВЭЖХ с обратной фазой (% основного пика) 99,6 99,7 99,8 >99,9
pH 5,9 6,0 6,0 6,0
Специфическая активность (ЕД,/мг) 95 79 90 87
Электрофорез в ПААГ с ДСН (окрашивание Кумасси) Соответствует стандартному образцу с отсутствием дополнительных полос с большей интенсивностью, чем у контроля 1% Соответствует Соответствует Соответствует

ТАБЛИЦА 28
ДОЛГОСРОЧНАЯ СТАБИЛЬНОСТЬ RHASA B 154 MM NACL, PH 7,0 ПРИ 2-8°C
Анализ Точка отсчета 3 мес. 6 мес. 11 мес.
Внешний вид Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего
Концентрация белка (мг/мл) 27,3 26,9 28,1 29,2
Эксклюзионная ВЭЖХ (основного пика) при pH 5,5 99,9 97,5 99,8 >99,9
Эксклюзионная ВЭЖХ (основного пика) при pH 7,0 99,4 99,0 99,2 99,8
ВЭЖХ с обратной фазой (% основного пика) 99,6 99,7 99,9 >99,9
pH 6,5 6,6 6,7 6,5
Специфическая активность (ЕД,/мг) 112 88 98 86
Электрофорез в ПААГ с ДСН (окрашивание Кумасси) Соответствует стандартному образцу с отсутствием дополнительных полос с большей интенсивностью, чем у контроля 1% Соответствует Соответствует Соответствует

ТАБЛИЦА 29
ДОЛГОСРОЧНАЯ СТАБИЛЬНОСТЬ RHASA B 5 ММ ФОСФАТНОМ БУФЕРЕ, PH 6,0 ПРИ 2-8°C
Анализ Точка отсчета 3 мес. 6 мес. 11 мес.
Внешний вид Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего Прозрачный до слегка опалесцирующего
Концентрация белка (мг/мл) 27,9 27,4 27,1 29,3
Эксклюзионная ВЭЖХ (основного пика) при pH 5,5 99,9 97,8 99,8 99,9
Эксклюзионная ВЭЖХ (основного пика) при pH 7,0 98,9 98,9 99,2 99,9
ВЭЖХ с обратной фазой (% основного пика) 99,7 99,6 99,8 >99,9
pH 5,9 6,0 6,0 5,9
Специфическая активность (ЕД,/мг) 87 88 95 90
Электрофорез в ПААГ с ДСН (окрашивание Кумасси) Соответствует стандартному образцу с отсутствием дополнительных полос с большей интенсивностью, чем у контроля 1% Соответствует Соответствует Соответствует

[0181] Исследования стабильности, проведенные в течение более чем 11 месяцев при 2-8°C, свидетельствуют, что качество rhASA поддерживается в пилотных вариантах составов. Показательные профили rhASA в солевом растворе, pH 5,9, полученные методом эксклюзионной ВЭЖХ, представлены на Фигурах 13 и 14. Методом эксклюзионной ВЭЖХ не было зарегистрировано ни одного существенного изменения в ассоциированном состоянии rhASA после хранения в течение 11 месяцев при 2-8°C.

[0182] В целом, качество лекарственного препарата во всех трех вариантах составов поддерживалось при хранении в течение 11 месяцев при 2-8°C.

ПРИМЕР 4 - ТОКСИКОЛОГИЧЕСКИЕ ИССЛЕДОВАНИЯ

[0183] В данном примере проиллюстрировано многократное интратекальное (ИТ) введение rhASA в течение 6 месяцев с точки зрения токсикологии и фармакологической безопасности. В данном исследовании тестируемым веществом, вводимым ИТ, была rhASA. 36 самцов и 36 самок длиннохвостых макак случайным образом распределяли в пять лечебных групп. Животные группы 1 служили контролем вживления устройства (порт и катетер) без введения препарата, и им не вводили ни основу, ни тестируемое вещество, указанным животным вводили 0,6 мл ФБР по графику, соответствующему графику введения тестируемого вещества. Животным групп 2-5 производили ИТ инфузии 0,6 мл раствора с 0, 3, 10 или 31 мг/мл rhASA (суммарная доза 0, 1,8, 6,0 или 18,6 мг) раз в две недели (т.е. всего 12 доз). Животных подвергали вскрытию через 6 месяцев (через 24 часа после последнего ИТ введения препарата), а оставшихся 4 животных/пол/группу подвергали вскрытию в конце 4-недельного периода восстановления. Выбранные ткани отбирали, сохраняли и подвергали микроскопическому исследованию.

[0184] В целом, вызываемые тестируемым веществом изменения можно было отнести к двум основным типам, и возникали они при всех уровнях доз (1,8, 6,0 или 18,6 мг/дозу). Увеличение инфильтратов (лейкоцитов, обычно с выраженным эозинофильным компонентом) в оболочках мозга, паренхиме головного мозга, паренхиме спинного мозга тройничном узле и редко в корешках спинномозговых нервов/спинальных ганглиях (или эпиневрии, окружающем указанные структуры). Не вдаваясь в теорию, предположим, что указанное увеличение интерпретировали как связанное с наличием тестируемого вещества (белка) в интратекальном пространстве и в тканях нервной системы. Легкое, очаговое увеличение числа клеток микроглии в спинном и головном мозге у некоторых животных (микроглиоз не наблюдался ни у одного животного, получавшего высокую дозу). Не вдаваясь в теорию, обе категории морфологических изменений интерпретировали как реакцию на наличие тестируемого вещества. Ни у одного животного не было признаков некроза нейронов. Никакие связанные с тестируемым веществом изменения не были связаны с какими-либо биологически значимыми нежелательными реакциями в головном и спинном мозге, корешках спинномозговых нервов или ганглиях. Более конкретно, не было выявлено никаких признаков некроза нейронов или биологически значимой реакции со стороны глии. В тканях вне нервной системы никаких связанных с тестируемым веществом поражений не было.

[0185] После месячного периода восстановления (период без введения препарата) вызываемые тестируемым веществом изменения либо полностью разрешались, либо сводились к остаточному увеличению воспалительной реакции, связанному с наличием тестируемого вещества. У животных, прошедших период восстановления, никаких нежелательных морфологических эффектов не было. По данным слепого микроскопического исследования, в котором полуколичественно оценивали степень окрашивания, иммуногистохимическое окрашивание на арилсульфатазу A (rhASA; тестируемое вещество) при конечном вскрытии увеличивалось в головном и спинном мозге в клетках разных типов, за исключением нейронов, во всех группах, получавших тестируемое вещество. Указанное увеличение также было явным в купферовских клетках печени. После месячного периода восстановления окрашивание на rhASA у животных, получавших тестируемое вещество (группы всех доз), возвращалось к контрольному уровню (контроль введения устройства/контроль с введением основы). У одного самца из группы, получавшей низкую дозу, обнаруживались множественные очаги астроцитоза и потери нейронов, что указывает на множественные области предшествующей ишемии, в коре больших полушарий. Хотя точный патогенез указанных поражений у данного животного не ясен, отсутствие аналогичных поражений у каких-либо других животных, получавших тестируемое вещество, включая тех животных, которые получали в 10 раз более высокую дозу, говорит о том, что указанные поражения не были связаны с тестируемым веществом.

[0186] В данном исследовании вводимым ИТ тестируемым веществом была rhASA. 36 самцов и 36 самок длиннохвостых макак случайным образом распределяли в пять лечебных групп. Животные группы 1 служили контролем вживления устройства (порт и катетер) без введения препарата, и им не вводили ни основу, ни тестируемое вещество; однако указанным животным вводили 0,6 мл ФБР по графику, соответствующему графику введения тестируемого вещества. Животным групп 2-5 производили ИТ инфузии 0,6 мл раствора с 0, 3, 10 или 31 мг/мл rhASA (суммарная доза 0, 1,8, 6,0 или 18,6 мг) раз в две недели (т.е. всего 12 доз). Животных подвергали вскрытию через 6 месяцев (через 24 часа после последнего ИТ введения препарата), а оставшихся 4 животных/пол/группу подвергали вскрытию в конце 4-недельного периода восстановления. Выбранные ткани отбирали, сохраняли и подвергали микроскопическому исследованию. В нижеследующей таблице представлена схема эксперимента, поскольку она имеет отношение к патологическому аспекту настоящего исследования.

[0187] Во время вскрытия освобождали матрикс головного мозга, срезая фронтальный срез толщиной примерно 3 мм. Первый срез и далее каждый последующий срез фиксировали в формалине для гистопатологической оценки и иммуногистохимического анализа. С головным мозгом работали в форме полных фронтальных срезов. Указанные срезы включали по меньшей мере следующие отделы головного мозга.

- Срезы новой коры головного мозга (включая лобные, теменные, височные и затылочные доли): от 1 до 8 (и срез 9, если присутствовал)

- Срезы древней коры головного мозга (обонятельные луковицы и/или грушевидная доля): от 1 до 3

- Срезы базальных ганглиев головного мозга (включая хвостатое ядро и скорлупу): от 1 до 3

- Срезы лимбической системы головного мозга (включая гиппокамп и поясные извилины): 4 и 5

- Срезы таламуса/гипоталамуса и областей среднего мозга головного мозга: 4 и 5

- Срезы мозжечка, моста и продолговатого мозга головного мозга: от 6 до 8 (и срез 9, если присутствовал)

[0188] Срезы головного мозга перечислены в таблице данных под номерами 1-8/9 (срез 9 предоставлялся тестирующей лабораторией для некоторых животных). Получение срезов несколько различалось у разных животных. Срезы головного мозга (1-8/9), указанные выше, имели примерное расположение в разных анатомических областях. Срезы головного мозга перечислены в таблице данных как отдельные срезы, с указанием диагноза, относящегося к данному срезу, чтобы облегчить возможный дальнейший анализ срезов (если таковой будет проводиться). Во время интерпретации данных индивидуальные анатомические участки головного мозга (перечисленные выше) сравнивали, чтобы идентифицировать уникальные эффекты тестируемого вещества (то есть уникальные для конкретного отдела головного мозга). Для исследования токсичности все срезы головного мозга от всех животных заключали в парафин, нарезали с шагом 5 микрон, окрашивали гематоксилином и эозином (Г и Э) и проводили микроскопическое исследование. Кроме того, головной мозг контрольных животных и животных из группы, получавшей высокую дозу, окрашивали Fluoro-Jade B (краситель, повышающий чувствительность оценки на дегенерацию нейронов в головного мозге) и серебряным красителем Бильшовского (способ, который позволяет прямо визуализировать аксоны, дендриты и филаменты нейронов) и проводили оценку.

[0189] Из спинного мозга (шейный, грудной и поясничный отделы) изготавливали срезы толщиной один сантиметр. Первый срез и каждый последующий срез фиксировали в формалине для гистопатологической оценки и иммуногистохимического анализа. Срезы спинного мозга (шейный, грудной (включая кончик катетера) и поясничный отдел) у всех животных разрезали с шагом примерно 5 микрон, окрашивали Г и Э и исследовали поперечный и косой срез, полученный на каждом уровне. Серии срезов спинного мозга от контрольных животных и животных, получавших высокие дозы, дополнительно окрашивали серебряным красителем Билыиовского (иммуногистохимический краситель, который позволяет прямо визуализировать звездчатые клетки и их отростки).

[0190] Задние корешки спинномозговых нервов и ганглии (взятые из середины шейного, середины грудного и середины поясничного отдела) заключали в парафин, и серии срезов окрашивали Г и Э. Кроме того, серии срезов, полученных от контрольных животных и животных, получавших высокие дозы, окрашивали серебряным красителем Билыиовского.

[0191] Для срезов седалищного, большеберцового и икроножного нерва, полученных от всех животных: продольный срез каждого нерва заключали в парафин, получали срезы с приблизительным шагом 5 микрон и окрашивали Г и Э. Поперечный срез каждого нерва впоследствии фиксировали в осмии, заключали в смолу Спурра, получали срезы с приблизительным шагом 1-2 микрона и окрашивали толлуидиновым синим. Последующая фиксация в осмии и заключение в смолу обеспечивает более надежное сохранение миелина в периферических нервах, а, значит, возможно более подробное исследование нерва.

[0192] Все отобранные ткани и очаги макроскопических поражений, отобранные при вскрытии у всех животных, также заключали в парафин, окрашивали Г и Э, и подвергали микроскопическому исследованию. Гистопатологическая обработка и оценка, а также иммуногистохимический анализ проводили посредством TPS.

Окрашивание на арилсульфатазу A (rhASA)

[0193] Срезы для положительного контроля предоставлял спонсор. Указанные срезы представляли собой срезы печени мышей, которым вводили rhASA. На срезах для положительного контроля были получены достаточные подтверждения того, что rhASA присутствует в купферовских клетках (синусоидальных макрофагах) в печени. Срезы для положительного контроля хранили с другими срезами, полученными в ходе данного исследования. Все виды оценки окрашенных на rhASA срезов сначала проводили слепым способом в отношении лечебной группы, к которой принадлежало животное. Это достигалось благодаря тому, что патоморфолог сначала регистрировал показатели окрашивания на rhASA на срезах, и при этом маркировка с указанием номера животного была от него скрыта (с использованием ассистента, который знал, срез какого животного анализируется), диктовал балл (степень тяжести) во время оценки, а тот же ассистент сразу же записывал балл окрашивания (степень тяжести) в таблицы данных. Чтобы гарантировать точность ввода данных, затем идентификационный номер животного сверяли невропатолог исследования и указанный ассистент. Данную процедуру проводили так, чтобы не вносить никакой необъективности в оценку общей интенсивности окрашивания иммуногистохимическим красителем при определении внутриклеточной rhASA. Во всех срезах головного и спинного мозга оценивали относительную степень окрашивания нейронов, оболочечных макрофагов, периваскулярных макрофагов и клеток глии (астроцитов и клеток микроглии, но, вероятно, преимущественно клеток микроглии). Средние баллы тяжести на каждом уровне головного и спинного мозга для каждой группы суммировали (по группам) и регистрировали в виде суммы в графе тканей головного мозга, общее окрашивание на rhASA, и в графе спинного мозга, общее окрашивание на rhASA.

[0194] В целом, окрашивание на rhASA в нейронах головного мозга служило показателем в отношении нейронов коры больших полушарий и других ядер в головном мозге. Окрашивание на rhASA в оболочечных макрофагах указывало на захват тестируемого вещества оболочечными макрофагами и/или на эндогенную rhASA в оболочечных макрофагах. Окрашивание на rhASA периваскулярных макрофагов служило показателем захвата rhASA макрофагами в головном/спинном мозге (или эндогенной rhASA), хотя следует отметить, что периваскулярное пространство в головном и спинном мозге (пространство Вирхова - Робена) сообщается с оболочками головного мозга. В целом, оценка интенсивности окрашивания на rhASA в клетках глии преимущественно служила показателем захвата тестируемого вещества/проникновения тестируемого вещества в серое и/или белое вещество, особенно, в кору больших полушарий (лучистый венец в белом веществе под корой больших полушарий). Окрашивание на rhASA в белом веществе, по-видимому, соответствовало астроцитам и клеткам микроглии.

[0195] Для оценки степени окрашивания на rhASA клеток разных типов (нейронов, клеток глии, макрофагов), применяли следующую оценочную шкалу.

Пояснения к шкале (% от возможной окраски клеток)

1 Меньше 10%

2 Более 10,до 25%

3 Более 25, до 50%

4 Более 50, до 75%

5 Более 75%

[0196] Следует отметить, что указанная шкала не является строго количественной. Ее применяли в качестве эффективного полуколичественного способа оценки окрашивания на rhASA тканей головного и спинного мозга. Невропатолог исследования заметил, что не все области нейронов проявляли одинаковое окрашивание на rhASA. Также было отмечено, что у некоторых контрольных животных имело место эндогенное окрашивание нейронов, и что клетки сосудистого сплетения и нейроны ганглиев задних корешков имели тенденцию к сильному окрашиванию на rhASA даже у контрольных животных. Окрашивание сосудистого сплетения и ганглиев задних корешков не оценивали по указанной шкале, но невропатолог исследования отметил, что оно было выраженным, даже у контрольных животных.

[0197] Примечание: группы, получавшие все дозы: низкая доза=1,8 мг/дозу; средняя доза=6,0 мг/дозу; высокая доза=18,6 мг/дозу. В тканях вне нервной системы не было поражений, связанных с тестируемым веществом, за исключением повышенного окрашивания на rhASA в печени в группах, получавших все дозы (самцы и самки; см. ниже).

УМЕРЩВЛЕНИЕ ЖИВОТНЫХ В КОНЦЕ ИССЛЕДОВАНИЯ (ВВЕДЕНИЕ ПРЕПАРАТА В ТЕЧЕНИЕ 6 МЕСЯЦЕВ РАЗ В ДВЕ НЕДЕЛИ): ОКРАШИВАНИЕ СРЕЗОВ НА rhASA

[0198] В следующих типах тканей/клеток имела место повышенная интенсивность окрашивания на rhASA. При оценке действия тестируемого вещества на степень окрашивания на rhASA в конкретном типе клеток в группе, получавшей конкретную дозу, для сравнения оценивали уровень окрашивания в сопутствующем контроле основы и контроле вживления устройства (умерщвленные одновременно с животными, которые прошли период восстановления).

[0199] Головной мозг, оболочки мозга, макрофаги (группы, получавшие все дозы, самцы и самки)

- Головной мозг, периваскулярное пространство, макрофаги (группы, получавшие все дозы, самцы и самки)

- Головной мозг, клетки глии (группы, получавшие все дозы, самцы и самки)

- Спинной мозг, оболочки мозга, макрофаги (группы, получавшие все дозы, самцы и самки)

- Спинной мозг, периваскулярное пространство, макрофаги (группы, получавшие все дозы, самцы и самки)

- Спинной мозг, клетки глии (группы, получавшие среднюю и высокую дозы, самцы и самки)

- Печень, купферовские клетки (группы, получавшие все дозы, самцы и самки)

[0200] Из-за эндогенного окрашивания уровень окрашивания на rhASA в нейронах головного и спинного мозга определить точно было наиболее трудно. Был продемонстрирован неизменно повышенный уровень rhASA в макрофагах оболочек мозга и периваскулярных макрофагах головного/спинного мозга, а также в клетках глии. Заметных различий в окрашивании на rhASA нейронов у контрольных и получавших тестируемое вещество животных выявлено не было.

УМЕРЩВЛЕНИЕ ЖИВОТНЫХ ПОСЛЕ ПЕРИОДА ВОССТАНОВЛЕНИЯ (ВВЕДЕНИЕ ПРЕПАРАТА В ТЕЧЕНИЕ 6 МЕСЯЦЕВ РАЗ В ДВЕ НЕДЕЛИ И ПОСЛЕДУЮЩИЙ ПЕРИОД ВОССТАНОВЛЕНИЯ ДЛИТЕЛЬНОСТЬЮ ОДИН МЕСЯЦ БЕЗ ВВЕДЕНИЯ ПРЕПАРАТА)

[0201] В целом у животных, которые перед вскрытием восстанавливались в течение одного месяца без введения препарата, изменения, связанные с тестируемым веществом, либо полностью разрешались, либо заметно уменьшались. Присутствовали следующие микроскопические изменения с частотой/тяжестью, которая указывает на возможную взаимосвязь с тестируемым веществом.

[0202] Микроскопические изменения, связанные с тестируемым веществом (животные, прошедшие период восстановления)

- Головной мозг, оболочки мозга, инфильтраты (группы, получавшие среднюю и высокую дозы, оба пола) (Фигура 16 и Фигура 17)

- Головной мозг, оболочки мозга, инфильтраты, % эозинофилов (самцы, получавшие среднюю дозу; самки, получавшие высокую дозу)

- Головной мозг, периваскулярное пространство, инфильтраты (самцы, получавшие среднюю дозу; самки, получавшие высокую дозу) (Фигура 18)

- Головной мозг, периваскулярное пространство, инфильтраты, % эозинофилов (самцы, получавшие среднюю дозу; самки, получавшие высокую дозу)

- Головной мозг, серое вещество, инфильтраты (группы, получавшие все дозы, оба пола)

- Головной мозг, серое вещество инфильтраты, % эозинофилов (самцы, получавшие низкую дозу)

- Головной мозг, серое вещество, эозинофилы, некроз (самцы, получавшие низкую дозу)

- Спинной мозг, оболочки мозга, инфильтраты (самцы, получавшие среднюю и высокую дозы; самки, получавшие низкую и высокую дозы)

- Спинной мозг, оболочки мозга, инфильтраты, % эозинофилов (самцы, получавшие среднюю дозу; самки, получавшие низкую дозу)

- Спинной мозг, серое вещество, инфильтраты (самки, получавшие низкую дозу)

- Спинной мозг, серое вещество, инфильтраты, % эозинофилов (самки, получавшие низкую дозу)

- Задние корешки и ганглии спинномозговых нервов, эпиневрий, инфильтраты (самки, получавшие среднюю дозу)

- Корешки и ганглии спинномозговых нервов, инфильтраты, эозинофилы (самцы, получавшие среднюю и высокую дозы; самки, получавшие все дозы)

- Тройничный узел, инфильтраты, эозинофилы (самцы и самки, получавшие среднюю дозу)

[0203] Все указанные изменения интерпретировали как остаточные явления выраженных воспалительных изменений, выявляемых у животных, умерщвленных после окончания введения препарата. Хотя у животных, умерщвленных после окончания введения препарата, не было признаков выраженных инфильтратов воспалительных клеток, они все же присутствовали у некоторых животных, прошедших период восстановления, указывая на морфологические изменения, которые вызывали какие-то нежелательные эффекты. В тканях вне нервной системы поражений, связанных с тестируемым веществом, не обнаруживалось.

УМЕРЩВЛЕНИЕ ЖИВОТНЫХ ПОСЛЕ ПЕРИОДА ВОССТАНОВЛЕНИЯ (ВВЕДЕНИЕ ПРЕПАРАТА В ТЕЧЕНИЕ 6 МЕСЯЦЕВ РАЗ В ДВЕ НЕДЕЛИ И ПОСЛЕДУЮЩИЙ ПЕРИОД ВОССТАНОВЛЕНИЯ ДЛИТЕЛЬНОСТЬЮ ОДИН МЕСЯЦ БЕЗ ВВЕДЕНИЯ ПРЕПАРАТА): ОКРАШИВАНИЕ НА rhASA

[0204] У самцов и самок, прошедших период восстановления, по сравнению с контролем вживления устройства и контролем основы никаких указаний на более сильное окрашивание на rhASA не было. В головном мозге самцов, получавших низкую, среднюю и высокую дозы и прошедшие период восстановления, в некоторых типах клеток (они варьировали среди лечебных групп) были реальные указания на более сильное окрашивание на rhASA по сравнению с контролем вживления устройства и контролем основы. Причина этого не ясна, в том числе не ясно, оказывало ли это реальное действие. Одно из возможных объяснений может состоять в том, что введение экзогенной rhASA может приводить к снижению выработки эндогенной rhASA. В спинном мозге указанных самцов аналогичного результата не было. У самцов и самок, прошедших период восстановления, окрашивание серебром давало результат, аналогичный результату в контролях.

[0205] В целом, изменения, связанные с тестируемым веществом, можно было отнести к двум основным типам, и присутствовали они при всех уровнях доз (1,8, 6,0 и 18,6 мг/дозу).

[0206] Увеличение инфильтратов (лейкоциты, обычно с выраженным эозинофильным компонентом) в оболочках мозга, паренхиме головного мозга, паренхиме спинного мозга, тройничном узле и редко - в корешках/ганглиях спинномозговых нервов (или эпиневрии, окружающем указанные структуры). Указанное увеличение интерпретировали как связанное с наличием тестируемого вещества (белка) в интратекальном пространстве и в тканях нервной системы.

[0207] Легкое, очаговое увеличение числа клеток микроглии в спинном и головном мозге у некоторых животных (микроглиоз не наблюдался ни у одного животного, получавшего высокую дозу). Обе категории морфологических изменений интерпретировали как реакцию на наличие тестируемого вещества. Ни у одного животного не было признаков некроза нейронов. Никакие связанные с тестируемым веществом изменения не были связаны с какими-либо биологически значимыми нежелательными реакциями в головном и спинном мозге, корешках спинномозговых нервов или ганглиях. Более конкретно, не было выявлено никаких признаков некроза нейронов или биологически значимой реакции со стороны глии. В тканях вне нервной системы никаких связанных с тестируемым веществом поражений не было. После месячного периода восстановления (период без введения препарата) вызываемые тестируемым веществом изменения либо полностью разрешались, либо сводились к остаточному увеличению воспалительной реакции, связанному с наличием тестируемого вещества. У животных, прошедших период восстановления, никаких нежелательных морфологических эффектов не было.

[0208] По данным слепого микроскопического исследования, в котором полуколичественно оценивали степень окрашивания, иммуногистохимическое окрашивание на арилсульфатазу A (rhASA; тестируемое вещество) увеличивалось в головном и спинном мозге в клетках разных типов, за исключением нейронов, во всех группах, получавших тестируемое вещество. Указанное увеличение также было явным в купферовских клетках печени. После месячного периода восстановления окрашивание на rhASA у животных, получавших тестируемое вещество (группы всех доз), возвращалось к контрольному уровню (контроль введения устройства/контроль с введением основы). У одного самца из группы, получавшей низкую дозу, обнаруживались множественные очаги астроцитоза и потери нейронов, что указывает на множественные области предшествующей ишемии, в коре больших полушарий. Хотя точный патогенез указанных поражений у данного животного не ясен, отсутствие аналогичных поражений у каких-либо других животных, получавших тестируемое вещество, включая тех животных, которые получали дозу в 10 раз выше, говорит о том, что указанные поражения не были связаны с тестируемым веществом. Строго основываясь на макроскопических и микроскопических результатах (на срезах тканей, заключенных в парафин, окрашенных гематоксилином и эозином), полученных в настоящем исследовании, уровнем отсутствия наблюдаемых нежелательных эффектов (NOAEL) был признан уровень 18,6 мг.

ПРИМЕР 5 - ФАРМАКОКИНЕТИЧЕСКИЕ ДАННЫЕ

Результаты 6-месячного введения

[0209] В настоящем примере описан интерпретированный анализ концентраций rhASA и сывороточных анти-rhASA антител (от компании «Northern Biomedical Research, Inc.») в сыворотке и СМЖ.

[0210] Цель настоящего примера состояла в оценке многократного интратекального (ИТ) введения rhASA токсикологии и фармакологической безопасности у молодых (моложе 12 месяцев) длиннохвостых макак. Всего за период шесть месяцев вводили 12 доз. Животных подвергали вскрытию через 24 часа после введения последней дозы препарата. Схема эксперимента показана в Таблице 30.

Таблица 30
Схема эксперимента
Схема эксперимента
Группа Кол-во животных Номинальная концентрация в дозе (мг/мл) Вводимая доза (мг) Кол-во животных, умерщвленных через 6 месяцев Кол-во животных, умерщвленных после месячного периода восстановления
1 4М, 4Ж DC 0 - 4М, 4Ж
2 8М, 8Ж 0 0 4М, 3Жa 4М, 4Ж
3 8М, 8Ж 3 1,8 4М, 4Ж 4М, 4Ж
4 8М, 8Ж 10 6,0 4М, 4Ж 4М, 4Ж
5 8М, 8Ж 31 18,6 4М, 4Ж 4М, 4Ж
DC=контроль устройства; животные в группе 1 не получали ни основы, ни тестируемого вещества.
a Животное из группы контроля введения основы №044 было умерщвлено в день 50 из-за утечки в катетере.

Способы количественного определения - анализ антител

[0211] Количественное определение анти-rhASA антител в сыворотке и СМЖ длиннохвостых макак проводили с использованием способа, прошедшего валидацию. Если кратко, количественное определение начинали с блокирования планшета, покрытого стрептавидином MSD, после чего проводили инкубацию с rhASA, меченной биотином. После этапа отмывки в планшет добавляли разведенные пробы, калибровочные стандарты и стандарты для контроля качества, и инкубировали его. После дополнительного этапа промывки добавляли лекарственное вещество, меченное SULFO TAG, и инкубировали. Проводили окончательный этап отмывки и добавляли буфер считывания MSD. Считывание показателей с планшета проводили незамедлительно. данные по сигнале в относительных единицах люминесценции (RLU) анализировали с использованием шаблонов SOFTMax Pro.

Концентрации в сыворотке и СМЖ

[0212] Количественное определение анти-rhASA антител в сыворотке и СМЖ длиннохвостых макак проводили с использованием метода, прошедшего валидацию. Указанный способ основан на технологии твердофазного иммуноферментного анализа (ELISA). Если кратко, титрационный микропланшет покрывали поликлональными антителами кролика (SH040), образовавшимися на рекомбинантную арилсульфатазу A человека (ASA). После инкубации со стандартным образцом ASA и тестируемыми пробами связавшийся белок ASA определяли с использованием конъюгированного с пероксидазой хрена (ПХ) анти-ASA моноклонального антитела (клон 19-16-3). Затем планшет инкубировали с субстратом ПХ, ТМВ. Указанную реакцию «фермент-субстрат» останавливали путем добавления 2H серную кислоту (H2SO4), и поглощение каждой лунки определяли на длине волны 150 нм с опорной длиной волны 655 нм. Концентрации ASA в пробах рассчитывали на основании калибровочной кривой для ASA, зарегистрированной в том же планшете.

[0213] Итоговые данные по концентрациях rhASA в сыворотке и СМЖ и о концентрации антител против rhASA в сыворотке и СМЖ а также частота обнаружения антител в зависимости от группы и пола приведены в Таблицах 33-39 ниже.

Таблица 33
Итоговые данные по концентрациях rhASA в сыворотке длиннохвостых макак
Группа 1: Контроль с введением основы Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 4 0 0 4
После введения дозы 2 0 0 4 0 0 4
Перед введением дозы 4 0 0 4 0 0 4
После введения дозы 4 0 0 4 0 0 4
Перед введением дозы 6 0 0 4 0 0 4
После введения дозы 6 0 0 4 0 0 4
Перед введением дозы 8 0 0 4 0 0 4
После введения дозы 8 0 0 4 0 0 4
Перед введением дозы 10 0 0 4 0 0 4
После введения дозы 10 0 0 4 0 0 4
Перед введением дозы 12 0 0 4 0 0 4
После введения дозы 12 0 0 4 0 0 4
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 2: 0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 7
После введения дозы 2 0 0 8 0 0 7
Перед введением дозы 4 0 0 8 0 0 7
После введения дозы 4 0 0 8 0 0 7
Перед введением дозы 6 0 0 8 0 0 8
После введения дозы 6 0 0 8 0 0 8
Перед введением дозы 8 0 0 8 0 0 8
После введения дозы 8 0 0 8 0 0 8
Перед введением дозы 10 0 0 8 0 0 7
После введения дозы 10 0 0 8 0 0 7
Перед введением дозы 12 0 0 8 0 0 7
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 8 0 0 8
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 33 (продолжение)
Итоговые данные по концентрациях rhASA в сыворотке длиннохвостых макак
Группа 3: 1,8 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
После введения дозы 2 49,2 46,8 8 40,3 27,3 8
Перед введением дозы 4 0 0 8 0 0 8
После введения дозы 4 0 0 8 0 0 8
Перед введением дозы 6 0 0 8 0 0 8
После введения дозы 6 0 0 8 0 0 8
Перед введением дозы 8 0 0 8 0 0 8
После введения дозы 8 0 0 8 0 0 8
Перед введением дозы 10 0 0 8 0 0 8
После введения дозы 10 0 0 8 0 0 8
Перед введением дозы 12 0 0 8 0 0 8
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 8 0 0 8
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 4: 6,0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
После введения дозы 2 173,6 69,5 8 143,2 89,0 8
Перед введением дозы 4 0 0 8 0 0 8
После введения дозы 4 17 49 8 63,8 119,9 8
Перед введением дозы 6 0 0 8 0 0 8
После введения дозы 6 0 0 8 0 0 8
Перед введением дозы 8 0 0 8 0 0 8
После введения дозы 8 0 0 8 0 0 8
Перед введением дозы 10 0 0 8 0 0 8
После введения дозы 10 0 0 8 0 0 8
Перед введением дозы 12 0 0 8 0 0 8
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 8 0 0 8
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 33 (продолжение)
Итоговые данные по концентрациях rhASA в сыворотке длиннохвостых макак
Группа 5: 18,6 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
После введения дозы 2 348,0 272,9 8 562,3 204,3 8
Перед введением дозы 4 0 0 8 0 0 8
После введения дозы 4 105,7 274,6 8 172,0 141,3 8
Перед введением дозы 6 0 0 8 0 0 8
После введения дозы 6 20,4 38,4 8 88,6 121,4 8
Перед введением дозы 8 0 0 8 0 0 8
После введения дозы 8 0 0 8 54,0 89,4 8
Перед введением дозы 10 0 0 8 0 0 8
После введения дозы 10 0 0 8 6 18 8
Перед введением дозы 12 0 0 8 0 0 8
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 8 0 0 8
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 34
Итоговые данные по концентрациях rhASA в СМЖ длиннохвостых макак
Группа 1: Контроль с введением основы Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 4 0 0 4
После введения дозы 2 0 0 4 0 0 4
Перед введением дозы 4 0 0 4 0 0 4
После введения дозы 4 0 0 4 0 0 4
Перед введением дозы 6 0 0 4 0 0 4
После введения дозы 6 0 0 4 0 0 4
Перед введением дозы 8 0 0 4 0 0 4
После введения дозы 8 0 0 4 0 0 4
Перед введением дозы 10 0 0 4 0 0 4
После введения дозы 10 0 0 3 0 0 4
Перед введением дозы 12 0 0 3 0 0 4
После введения дозы 12 0 0 3 0 0 4
Середина периода восстановления 0 0 3 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 2: 0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 6 0 0 7
После введения дозы 2 0 0 5 0 0 7
Перед введением дозы 4 0 0 5 0 0 6
После введения дозы 4 0 0 5 0 0 5
Перед введением дозы 6 0 0 5 0 0 5
После введения дозы 6 0 0 5 0 0 5
Перед введением дозы 8 0 0 5 0 0 5
После введения дозы 8 0 0 5 0 0 5
Перед введением дозы 10 0 0 4 0 0 5
После введения дозы 10 0 0 4 0 0 5
Перед введением дозы 12 0 0 4 0 0 5
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 5 0 0 5
Середина периода восстановления 0 0 2 0 0 3
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 34 (продолжение)
Итоговые данные по концентрациях rhASA в СМЖ длиннохвостых макак
Группа 3: 1,8 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 42491 59255 7 42217 47300 6
После введения дозы 2 95886 22626 7 125717 61723 6
Перед введением дозы 4 17664 24372 6 50829 41891 6
После введения дозы 4 106783 42823 6 138400 49908 6
Перед введением дозы 6 39400 50105 4 45817 38404 6
После введения дозы 6 95275 12836 4 104080 37423 5
Перед введением дозы 8 25799 31589 4 58086 43821 5
После введения дозы 8 148750 34664 4 119200 66556 5
Перед введением дозы 10 25927 31380 4 30380 30328 5
После введения дозы 10 89975 29494 4 105200 44603 5
Перед введением дозы 12 29746 34267 4 82780 65906 5
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 32030 39155 7 47331 49015 6
Середина периода восстановления 0 0 3 0 0 2
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 4: 6,0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 75203 67002 8 146979 233673 6
После введения дозы 2 360000 179276 8 267667 103369 6
Перед введением дозы 4 58064 77210 8 53285 73340 5
После введения дозы 4 369250 241251 8 305517 152232 6
Перед введением дозы 6 77253 91407 8 97987 146762 6
После введения дозы 6 418600 200098 5 369000 232238 5
Перед введением дозы 8 66342 80374 5 11592 23072 4
После введения дозы 8 329400 209841 5 340500 135128 4
Перед введением дозы 10 119420 148408 5 74031 104609 2
После введения дозы 10 412000 149278 5 245500 161927 2
Перед введением дозы 12 68651 92902 5 74577 105251 2
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 141833 173933 7 58986 99016 4
Середина периода восстановления 0 0 3 0 НП 1
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 34 (продолжение)
Итоговые данные по концентрациях rhASA в СМЖ длиннохвостых макак
Группа 5: 18,6 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 289917 291188 7 201339 250774 8
После введения дозы 2 734429 298352 7 920143 448409 7
Перед введением дозы 4 150238 210302 7 169895 185675 6
После введения дозы 4 984857 570039 7 965167 425924 6
Перед введением дозы 6 265479 252067 7 288879 226889 6
После введения дозы 6 758143 102009 7 1270000 558533 6
Перед введением дозы 8 190529 240081 7 196021 199396 6
После введения дозы 8 1003429 538271 7 989800 585072 5
Перед введением дозы 10 176297 272500 7 168864 191087 6
После введения дозы 10 1013000 390673 7 773400 103717 5
Перед введением дозы 12 142334 196793 5 430542 436534 6
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 291525 350251 7 252142 381200 6
Середина периода восстановления 0 0 3 0 0 2
Вскрытие после периода восстановления 0 0 4 0 0 4

Таблица 35
Итоговые данные по концентрациях анти-rhASA антител в сыворотке
Группа 1: Контроль с введением основы Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 4 0 0 4
Перед введением дозы 4 0 0 4 0 0 4
Перед введением дозы 6 0 0 4 0 0 4
Перед введением дозы 8 0 0 4 0 0 4
Перед введением дозы 10 0 0 4 0 0 4
Перед введением дозы 12 0 0 4 0 0 4
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 2: 0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
Перед введением дозы 4 0 0 8 0 0 8
Перед введением дозы 6 0 0 8 0 0 7
Перед введением дозы 8 0 0 8 0 0 7
Перед введением дозы 10 0 0 8 0 0 7
Перед введением дозы 12 0 0 8 0 0 7
Вскрытие (через 24 часа после введения последней дозы) 0 0 4 0 0 4
Середина периода восстановления 0 0 4 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4

Группа 3: 1,8 мг Самцы Самки
Среднее CO n Среднее CO N
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
Перед введением дозы 4 18409 21371 8 27648 37504 8
Перед введением дозы 6 75913 64863 8 85625 79871 8
Перед введением дозы 8 132163 95576 8 151900 97818 8
Перед введением дозы 10 392338 606626 8 290675 186213 8
Перед введением дозы 12 499438 735028 8 524438 569523 8
Вскрытие (через 24 часа после введения последней дозы) 261625 157865 4 733550 928411 4
Середина периода восстановления 339250 265888 4 377175 218955 4
Вскрытие после периода восстановления 712500 1107129 4 295525 174718 4

Таблица 35 (продолжение)
Итоговые данные по концентрациях анти-rhASA антител в сыворотке
Группа 4: 6,0 мг Самцы Самки
Среднее CO n Среднее CO N
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
Перед введением дозы 4 30419 30561 8 64000 89510 8
Перед введением дозы 6 143693 128094 8 191750 150511 8
Перед введением дозы 8 325750 190651 8 305850 224707 8
Перед введением дозы 10 669125 515458 8 832188 846241 8
Перед введением дозы 12 946125 651530 8 1060775 1088889 8
Вскрытие (через 24 часа после введения последней дозы) 713500 598812 4 1047568 1132048 4
Середина периода восстановления 1566000 708132 4 975500 1149734 4
Вскрытие после периода восстановления 1113250 554510 4 793000 991450 4
Группа 5: 18,6 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
Перед введением дозы 4 56873 39107 8 39994 53411 8
Перед введением дозы 6 311638 237796 8 193263 208952 8
Перед введением дозы 8 482875 270130 8 399363 360425 8
Перед введением дозы 10 1006750 857916 8 866875 894776 8
Перед введением дозы 12 1419000 1382276 8 1341500 1373771 8
Вскрытие (через 24 часа после введения последней дозы) 165000 147463 4 407300 268570 4
Середина периода восстановления 2884250 1363128 4 2101500 2090420 4
Вскрытие после периода восстановления 2504250 1118042 4 1506000 1524682 4

Таблица 36
Итоговые данные по концентрациях анти-rhASA антител в СМЖ
Группа 1: Контроль с введением основы Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 4 0 0 4
Перед введением дозы 2 0 0 4 0 0 4
Перед введением дозы 4 0 0 4 0 0 4
Перед введением дозы 6 0 0 4 0 0 4
Перед введением дозы 8 0 0 4 0 0 4
Перед введением дозы 10 0 0 4 0 0 4
Перед введением дозы 12 0 0 3 0 0 4
Середина периода восстановления 0 0 3 0 0 4
Вскрытие после периода восстановления 0 0 4 0 0 4
Группа 2: 0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 7 0 0 6
Перед введением дозы 2 0 0 6 0 0 7
Перед введением дозы 4 0 0 5 0 0 6
Перед введением дозы 6 0 0 5 0 0 5
Перед введением дозы 8 0 0 5 0 0 5
Перед введением дозы 10 0 0 4 0 0 5
Перед введением дозы 12 0 0 4 0 0 5
Вскрытие (через 24 часа после введения последней дозы) 0 0 3 0 0 2
Середина периода восстановления 0 НП 1 0 0 3
Вскрытие после периода восстановления 0 0 4 0 0 4

Группа 3: 1,8 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 7 0 0 8
Перед введением дозы 2 0 0 7 0 0 6
Перед введением дозы 4 0 0 6 41 101 6
Перед введением дозы 6 685 1317 4 632 1413 5
Перед введением дозы 8 2238 2596 4 2180 4875 5
Перед введением дозы 10 3393 5038 4 5560 12433 5
Перед введением дозы 12 6436 8266 4 12700 28398 5
Вскрытие (через 24 часа после введения последней дозы) 14848 12401 4 21442 32382 4
Середина периода восстановления 29307 40617 3 18700 283 2
Вскрытие после периода восстановления 21060 30010 3 13078 7181 4

Таблица 36 (продолжение)
Итоговые данные по концентрациях анти-rhASA антител в СМЖ
Группа 4: 6,0 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 7 0 0 8
Перед введением дозы 2 0 0 7 0 0 6
Перед введением дозы 4 99 172 7 84 187 5
Перед введением дозы 6 1117 1862 8 1473 2775 6
Перед введением дозы 8 3987 5580 5 20824 27320 4
Перед введением дозы 10 6600 9679 5 2715 1237 2
Перед введением дозы 12 5285 7279 5 955 1237 2
Вскрытие (через 24 часа после введения последней дозы) 16870 16350 4 63000 63000 3
Середина периода восстановления 66233 42238 3 16800 НП 1
Вскрытие после периода восстановления 53600 14388 3 28880 29890 4
Группа 5: 18,6 мг Самцы Самки
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 7 0 0 6
Перед введением дозы 2 0 0 7 0 0 8
Перед введением дозы 4 102 192 7 0 0 6
Перед введением дозы 6 233 351 7 1506 3234 6
Перед введением дозы 8 3378 5931 7 6367 9865 6
Перед введением дозы 10 16327 24035 7 19567 27542 6
Перед введением дозы 12 11596 16406 5 15143 24351 6
Вскрытие (через 24 часа после введения последней дозы) 5168 7427 4 12135 10341 4
Середина периода восстановления 54700 26439 3 46315 62770 2
Вскрытие после периода восстановления 50725 29217 4 37790 35967 4

Таблица 37
Концентрации rhASA в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 1: Контроль с введением основы rhASA в сыворотке (нг/мл) rhASA в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Момент времени Среднее CO n Среднее CO n
нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 8 0 0 8
После введения дозы 2 0 0 8 0 0 8
Перед введением дозы 4 0 0 8 0 0 8
После введения дозы 4 0 0 8 0 0 8
Перед введением дозы 6 0 0 8 0 0 8
После введения дозы 6 0 0 8 0 0 8
Перед введением дозы 8 0 0 8 0 0 8
После введения дозы 8 0 0 8 0 0 8
Перед введением дозы 10 0 0 8 0 0 8
После введения дозы 10 0 0 8 0 0 7
Перед введением дозы 12 0 0 8 0 0 7
После введения дозы 12 0 0 8 0 0 7
Середина периода восстановления 0 0 8 0 0 7
Вскрытие после периода восстановления 0 0 8 0 0 8
Группа 2: 0 мг rhASA в сыворотке (нг/мл) rhASA в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Момент времени Среднее CO n Среднее CO n
нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 16 0 0 13
После введения дозы 2 0 0 16 0 0 12
Перед введением дозы 4 0 0 16 0 0 11
После введения дозы 4 0 0 16 0 0 10
Перед введением дозы 6 0 0 15 0 0 10
После введения дозы 6 0 0 15 0 0 10
Перед введением дозы 8 0 0 15 0 0 10
После введения дозы 8 0 0 15 0 0 10
Перед введением дозы 10 0 0 15 0 0 9
После введения дозы 10 0 0 15 0 0 9
Перед введением дозы 12 0 0 15 0 0 9
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 15 0 0 10
Середина периода восстановления 0 0 8 0 0 5
Вскрытие после периода восстановления 0 0 8 0 0 8

Таблица 37 (продолжение)
Концентрации rhASA в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 3: 1,8 мг rhASA в сыворотке (нг/мл) rhASA в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Момент времени Среднее CO n Среднее CO n
нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 16 42365 51844 13
После введения дозы 2 44.7 37.3 16 109654 45639 13
Перед введением дозы 4 0 0 16 34247 36982 12
После введения дозы 4 0 0 16 122592 47311 12
Перед введением дозы 6 0 0 16 43250 40831 10
После введения дозы 6 0 0 16 100167 27992 9
Перед введением дозы 8 0 0 16 43736 40298 9
После введения дозы 8 0 0 16 132333 53926 9
Перед введением дозы 10 0 0 16 28401 28890 9
После введения дозы 10 0 0 16 98433 37220 9
Перед введением дозы 12 0 0 16 59209 58253 9
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 16 39092 42786 13
Середина периода восстановления 0 0 8 0 0 5
Вскрытие после периода восстановления 0 0 8 0 0 8
Группа 4: 6,0 мг rhASA в сыворотке (нг/мл) rhASA в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Момент времени Среднее CO n Среднее CO n
нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 16 105964 157408 14
После введения дозы 2 158,4 78,7 16 320429 153832 14
Перед введением дозы 4 0 0 16 56226 72638 13
После введения дозы 4 40,6 91,7 16 341936 203284 14
Перед введением дозы 6 0 0 16 86139 113563 14
После введения дозы 6 0 0 16 393800 206033 10
Перед введением дозы 8 0 0 16 42009 65286 9
После введения дозы 8 0 0 16 334333 169995 9
Перед введением дозы 10 0 0 16 106452 130375 7
После введения дозы 10 0 0 16 364429 160707 7
Перед введением дозы 12 0 0 16 70344 87227 7
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 16 111707 151129 11
Середина периода восстановления 0 0 8 0 0 4
Вскрытие после периода восстановления 0 0 8 0 0 8

Таблица 37 (продолжение)
Концентрации rhASA в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 5: 18,6 мг rhASA в сыворотке (нг/мл) rhASA в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Момент времени Среднее CO n Среднее CO n
нг/мл нг/мл нг/мл нг/мл
Перед введением дозы 2 0 0 16 242676 264338 15
После введения дозы 2 455,1 257,8 16 827286 378379 14
Перед введением дозы 4 0 0 16 159311 191264 13
После введения дозы 4 138,8 213,7 16 975769 488021 13
Перед введением дозы 6 0 0 16 276279 231010 13
После введения дозы 6 54,5 93,8 16 994385 453568 13
Перед введением дозы 8 0 0 16 193064 213058 13
После введения дозы 8 27,0 67,1 16 997750 531567 12
Перед введением дозы 10 0 0 16 172866 228817 13
После введения дозы 10 3,2 13 16 913167 319975 12
Перед введением дозы 12 0 0 16 299538 365275 11
После введения дозы 12 (перед вскрытием по истечении 6 месяцев) 0 0 16 273348 349718 13
Середина периода восстановления 0 0 8 0 0 5
Вскрытие после периода восстановления 0 0 8 0 0 8

Таблица 38
Концентрация анти-rhASA антител в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 1: Контроль с введением основы Анти-rhASA антитела в сыворотке (нг/мл) Анти-rhASA антитела в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 8
Перед введением дозы 2 0 0 8 0 0 8
Перед введением дозы 4 0 0 8 0 0 8
Перед введением дозы 6 0 0 8 0 0 8
Перед введением дозы 8 0 0 8 0 0 8
Перед введением дозы 10 0 0 8 0 0 8
Перед введением дозы 12 0 0 8 0 0 7
Середина периода восстановления 0 0 8 0 0 7
Вскрытие после периода восстановления 0 0 8 0 0 8
Группа 2: 0 мг Анти-rhASA антитела в сыворотке (нг/мл) Анти-rhASA антитела в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 13
Перед введением дозы 2 0 0 16 0 0 13
Перед введением дозы 4 0 0 16 0 0 11
Перед введением дозы 6 0 0 15 0 0 10
Перед введением дозы 8 0 0 15 0 0 10
Перед введением дозы 10 0 0 15 0 0 9
Перед введением дозы 12 0 0 15 0 0 9
Вскрытие (через 24 часа после введения последней дозы) 0 0 8 0 0 5
Середина периода восстановления 0 0 8 0 0 4
Вскрытие после периода восстановления 0 0 8 0 0 8

Таблица 38 (продолжение)
Концентрация анти-rhASA антител в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 3: 1,8 мг Анти-rhASA антитела в сыворотке (нг/мл) Анти-rhASA антитела в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 15
Перед введением дозы 2 0 0 16 0 0 13
Перед введением дозы 4 23028 29871 16 21 72 12
Перед введением дозы 6 80769 70467 16 656 1284 9
Перед введением дозы 8 142031 93979 16 2206 3796 9
Перед введением дозы 10 341506 436656 16 4597 9386 9
Перед введением дозы 12 511938 635340 16 9916 20970 9
Вскрытие (через 24 часа после введения последней дозы) 497588 666122 8 18145 22972 8
Середина периода восстановления 358213 226397 8 25064 29302 5
Вскрытие после периода восстановления 504013 766860 8 16499 18552 7
Группа 4: 6,0 мг Анти-rhASA антитела в сыворотке (нг/мл) Анти-rhASA антитела в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 15
Перед введением дозы 2 0 0 16 0 0 13
Перед введением дозы 4 47209 66899 16 93 170 12
Перед введением дозы 6 167721 137276 16 1269 2205 14
Перед введением дозы 8 315800 201572 16 11470 19344 9
Перед введением дозы 10 750656 682110 16 5490 8143 7
Перед введением дозы 12 1003450 868860 16 4048 6328 7
Вскрытие (через 24 часа после введения последней дозы) 880534 857199 8 36640 45439 7
Середина периода восстановления 1270750 938646 8 53875 42430 4
Вскрытие после периода восстановления 953125 763122 8 39474 26274 7

Таблица 38 (продолжение)
Концентрация анти-rhASA антител в сыворотке и СМЖ, объединенные данные по самцам и самкам (нг/мл)
Группа 5: 18,6 мг Анти-rhASA антитела в сыворотке (нг/мл) Анти-rhASA антитела в СМЖ (нг/мл)
Группа в совокупности Группа в совокупности
Среднее CO n Среднее CO n
Момент времени нг/мл нг/мл нг/мл нг/мл
Операция 0 0 13
Перед введением дозы 2 0 0 16 0 0 15
Перед введением дозы 4 48433 46054 16 55 146 13
Перед введением дозы 6 252450 224723 16 821 2204 13
Перед введением дозы 8 441119 310702 16 4757 7781 13
Перед введением дозы 10 936813 849893 16 17822 24652 13
Перед введением дозы 12 1380250 1331905 16 13531 20189 11
Вскрытие (через 24 часа после введения последней дозы) 286150 238760 8 8652 9129 8
Середина периода восстановления 2492875 1686472 8 51346 36819 5
Вскрытие после периода восстановления 2005125 1347857 8 44258 31114 8

ТАБЛИЦА 39
ЧАСТОТА ОБНАРУЖЕНИЯ АНТИТЕЛ ПРИ ВСКРЫТИИ
Группа Животные с сывороткой, положительной по антителам (положительные/всего протестировано) Животные с СМЖ, положительной по антителам (положительные/всего протестировано)
М Ж М Ж
Вскрытие по истечении 6 месяцев Вскрытие после периода восстановления Вскрытие по истечении 6 месяцев Вскрытие после периода восстановления Вскрытие по истечении 6 месяцев Вскрытие после периода восстановления Вскрытие по истечении 6 месяцев Вскрытие после периода восстановления
1 (DC) НП 0/4 НП 0/4 НП 0/4 НП 0/4
2(основа) 0/4 0/4 0/4 0/4 0/3 0/4 0/2 0/4
3 (1,8 мг ИТ) 4/4 4/4 4/4 4/4 4/4 3/3 3/4 4/4
4 (6,0 мг ИТ) 4/4 4/4 4/4 4/4 4/4 3/3 2/3 4/4
5 (18,6 мг ИТ) 4/4 4/4 4/4 4/4 3/4 4/4 4/4 4/4

[0214] Предел количественного определения rhASA в сыворотке длиннохвостых макак составляет 39,1 нг/мл, и во всех пробах сыворотки из групп 1 и 2 концентрации были выше предела количественного определения (BQL), см. Таблицу 33. Уровень rhASA в сыворотке определяли перед введением доз 2, 4, 6, 8, 10 и 12 и через 24 часа после введения указанных проб (вскрытие по истечении 6-месячного периода), в середине периода восстановления и перед вскрытием после периода восстановления. Уровень rhASA в группе 3 (1,8 мг/дозу), группе 4 (6,0 мг/дозу) и группе 5 (18,6 мг/дозу) был неопределимым перед введением доз 2, 4, 6, 8, 10 и 12, после введения дозы 12, в середине периода восстановления и перед вскрытием после периода восстановления. После введения дозы 2 уровень rhASA был дозозависимым. После введения дозы 4 (группа 3), доза 6 (группы 3 и 4) и дозы 8 и 10 (группы 3 и 4, и самцы группы 5) уровень rhASA был неопределимым. Уровень rhASA в сыворотке снижался в группе 4 (6,0 мг/дозу) после введения дозы 4 и в группе 5 (18,6 мг/дозу) после доз 4 и 6 у самцов, и после введения доз 4, 6, 8 и 10 у самок. Указанное кажущееся снижение уровня rhASA в сыворотке могло быть связано с увеличением концентрации анти-hASA антител. Явных половых различий в уровне rhASA в сыворотке выявлено не было с учетом вариабельности между пробами и малого числа групп в данном исследовании.

[0215] Предел количественного определения rhASA в СМЖ длиннохвостых макак составляет 19,5 нг/мл, и во всех пробах СМЖ из групп 1 и 2 концентрации были BQL, см. Таблицу 34. Концентрация rhASA была определимой в СМЖ перед введением доз 2, 4, 6, 8, 10 и 12 и после введения всех указанных доз (вскрытие по истечении 6-месячного периода) во всех группах, получавших препарат. Указанный уровень был выше после введения доз (примерно через 24 часа после введения) и зависел от дозы. Уровень rhASA в СМЖ был гораздо выше, чем в сыворотке. Явных половых различий в уровне rhASA в сыворотке выявлено не было с учетом вариабельности между пробами и малого числа групп в данном исследовании. Во всех группах, получавших препарат, в середине периода восстановления и перед вскрытием после периода восстановления rhASA не определялась. Уровень rhASA в СМЖ при отборе во время дозы 12 (вскрытие) в группах, получавших rhASA, был ниже, чем уровень после дозы 8 и 11. Возможные причины более низкого уровня rhASA при вскрытии включают взятие объема (~2,25 мл всего для определения лейкоцитарной формулы, биохимии, уровня rhASA и анти-rhASA антител) при вскрытии, большего чем объем, отбираемый в моменты времени прижизненного отбора проб (до 0,5, мл перед или после введения дозы для оценки концентрации rhASA). Кроме того, у некоторых животных при вскрытии просвет катетера был закрыт, и пробы отбирали посредством спинномозговой пункции, а не через катетер. В пробах, отобранных таким путем, определяемые концентрации rhASA были неизменно ниже, чем в пробах, отобранных через катетер. Вероятно, это связано с ограниченным рострокаудальным направлением объемного потока СМЖ, который, как предполагается, имеет место у животных с вертикальной ориентацией тела, таких как обезьяны и человек (например, хорошо известно, что компоненты СМЖ проявляют выраженный рострокаудальный градиент на протяжении всей жизни особи).

[0216] У каждого животного, получавшего rhASA, в какой-либо момент времени в сыворотке определялись анти-rhASA антитела, см. Таблицу 34. Животных считали положительными по анти-rhASA антителам, если уровень анти-rhASA антител был выше предела количественного определения (78,1 нг/мл). После того, как животные становились сероконвертированными, они оставались положительными по анти-rhASA антителам. В момент времени перед введением дозы 2 ни одно животное не было положительным по анти-rhASA антителам. Все животные, получавшие rhASA, за исключением самца №026 (группа 4; 6,0 мг/дозу) демонстрировали анти-rhASA антитела в сыворотке в момент времени перед введением дозы 4. Самец №026 был положительным по анти-rhASA антителам в сыворотке в момент времени перед введением дозы 6. В, группе 5 (18,6 мг/кг) в пробах, отобранных при вскрытии, уровень антител был ниже; Указанное кажущееся снижение может быть связано с присутствием rhASA, препятствующим количественному определению. В целом титр был выше в группах, получавших высокие и средние дозы (6,0 и 18,6 мг/дозу), чем у животных, получавших низкую дозу (1,8 мг/дозу). Присутствие анти-rhASA антител - результат, ожидаемый на основании данных лечения длиннохвостых макак рекомбинантными белками человекаi. С учетом вариабельности результатов явных половых различий выявлено не было.

[0217] У всех животных с определимым уровнем анти-rhASA антител в СМЖ был также определимый уровень анти-rhASA антител в сыворотке за исключением самок №049 (группа 3; 18,6 мг/дозу) и 057 (группа 4; 6,0 мг/дозу). Вариабельность концентрации антител и частота их образования препятствовала определению зависимости «доза-ответ». Животных считали положительными по анти-rhASA антителам, если уровень анти-rhASA антител был выше предела количественного определения (78,1 нг/мл).

[0218] Объединенные для самцов и самок значения уровня rhASA в сыворотке и СМЖ и уровня анти-rhASA антител приведены в Таблице 36 и Таблице 37. Объединенные для самцов и самок результаты сходны с результатами для отдельных полов, которые обсуждались выше.

ПРИМЕР 6 - ЭФФЕКТИВНОСТЬ

[0219] В данном примере 11 контрольных мышей дикого типа (mASA +/+hASA -/-) распределили в группу A, которая не получала препарата. Тридцать четыре (34) мыши hASAC69S/ASA -/- распределили в 5 разных групп, получавших основу (группа B) или rhASA (rhASA)в дозах 20 мг/кг (внутривенно [BB]; группа C), 0,04, 0,012 и 0,21 мг (Группы D, E и F, соответственно) в дни 1,9, 15/16 и 22. Все внутривенные дозы вводили в хвостовую вену. Все интратекальные (ИТ) дозы вводили в виде инфузии в объеме 12 мкл с примерной скоростью 2 мкл/20 секунд (Таблица 40).

ТАБЛИЦА 40
СХЕМА ЭКСПЕРИМЕНТА
Группа Кол-во животных Тип животных Препарат Доза Путь введения Общее кол-во инъекций Умерщвление Доза в мг/кг массы головного мозгаa
A 11 Контроль дикого типа (mASA +/+ hASA -/-) Нет н/п н/п н/п н/п н/п
B 9 Контроль с введением основы основа ИТ поясничный отдел 4 (Дни 1,9, 15/16b и 22) Через 24 часа после введения четвертой дозы 0
C 5 rhASA 20 мг/кг ВВ (хвостовая вена) н/п
D 5 hASAC69S/ ASA -/- rhASA 0,04 мг ИТ поясничный отдел 100
E 5 rhASA 0,12 мг ИТ поясничный отдел 300
F 10 rhASA 0,21 мг ИТ поясничный отдел 520
Н/п=не применимо; ИТ=интратекально; ВВ=внутривенно.
a Масса головного мозга у мыши составляет примерно 0,0004 кг.
b Группы C, D и E получали препарат в день 15; Группы В и Е получали препарат в день 16.

[0220] Мыши с нокаутированным геном ASA-hASAC69S/ASA(-/-) являются общепринятой моделью метахроматической лейкодистрофии, и их широко применяют для тестирования потенциальных средств лечения указанного заболевания. Интратекальный путь введения является планируемым путем введения у человека. Внутривенный путь введения тестировали для данного соединения и аналогичного соединения у мышей с метахроматической лейкодистрофией. Контрольную группу с внутривенным введением добавили в качестве положительного контроля для оценки гистологических изменений, ожидаемых в периферических органах. Животные получали 100, 300 или 520 мг/кг массы головного мозга (0,04, 0,12, 0,21 мг, соответственно) rhASA. Выбранный для данного исследования уровень доз, нормированный на массу головного мозга, соответствует дозам, которые планируется применять у человека, или применялся в токсикологических исследования или в предшествующих моделях лизосомных болезней накопления для оценки эффективности. Ожидается, что указанные дозы не обладают какой-либо токсичностью.

Объект

Вид Мышь (Mus musculus)
Линия мыши hASAC69S/ASA (-/-) и контроль дикого типа
Возраст по прибытии примерно 14-17 месяцев
Кол-во групп 6
Кол-во животных 34 мыши, нокаутные по ASA+11 контрольных животных дикого типа

После прибытия каждое животное осматривали, оценивая состояние его здоровья.

Содержание

Животных содержали по группам в клетках из поликарбоната с верхом-фильтром, подстилка была выполнена из бумаги CareFresh, в клетках стояли флаконы с водой. Каждую клетку четко маркировали с использованием таблички с указанием проекта, группы, номеров животных и их пола. Каждое животное идентифицировали уникальным кодом с применением системы прокалывания ушной раковины. Животных содержали в соответствии с федеральными указаниями.

Целевые условия окружающей среды в помещении, где содержали животных, и световой период были следующими:

Температура 22 ±3°C
Влажность 50±20%
Цикл свет-темнота 12 часов света и 12 часов темноты

[0221] Во время и после введения препарата световой период может временно прерываться для проведения запланированных мероприятий. Такие перерывы считаются не влияющими на результат или качество данного исследования.

Всех имеющихся в распоряжении животных дикого типа (11) распределили в группу A, и им присвоили номера от 35 до 45. Животным с генотипом ASA (-/-) hASA (+/-) присвоили номера по порядку (от 1 до 34), для чего их брали из их клеток, взвешивали и проводили прокалывание ушной раковины в период акклиматизации. Затем животных распределяли в группы лечения с использованием инструмента Research Randomizer (www.randomizer.org) 3 января 2011 г. Первые 9 номеров были присвоены группе B, последующие 5 - группе C, последующие 5 - группе D, последующие 5 - группе E, и последние 10 номеров - группе F. Животных распределили в группы следующим образом, как описано в Таблице 41:

ТАБЛИЦА 41
РАСПРЕДЕЛЕНИЕ ЖИВОТНЫХ В ГРУППЫ
Группа N Номера животных
A 11 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45
B 9 7, 13, 17, 22, 23, 24, 28, 29, 30
C 5 6, 16, 19a, 21, 32
D 5 5, 9, 14, 18, 27
E 5 1, 2, 4, 8, 11
F 10 3b, 10, 12, 15, 20, 25, 26, 31, 33, 34
a Животное №19 не могли найти во время введения препарата.
b Животное №3 погибло до начала введения препарата.

Тестируемое вещество и основа

Тестируемое вещество

Наименование rhASA
Описание рекомбинантная арилсульфатаза A человека (ARSA)
Условия хранения около 4°C

Основа

Наименование основа для rhASA (154 мМ NaCl, 0,005% полисорбат 20, pH ~6,0)
Условия хранения около 4°C

Приготовление основы

[0222] Указанную основу применяли в установленном порядке. Ее нагревали на поверхности рабочего стола (комнатная температура). Как только основа нагревалась, вещество смешивали посредством аккуратного вращения и переворачивания флаконов. Флаконы не взбалтывали и не встряхивали. Перед отбором вещества флакон высушивали. Любой остаток основы возвращали в холодильник (1°C-8°C).

Приготовление лекарственной формы для введения

[0223] rhASA разводили в основе с получением требуемой концентрации.

Тестируемое вещество нагревали на поверхности рабочего стола (комнатная температура). Как только тестируемое вещество нагревалось, вещество смешивали посредством аккуратного вращения и переворачивания флаконов. Флаконы не взбалтывали и не встряхивали.

Красители для отслеживания вводимого вещества:

[0224] Для отслеживания вводимого вещества применяли краситель, поглощающий в инфракрасной области (такой как IRDye®, «LI-COR Biosciences)), Линкольн, Небраска). Такие красители широко применялись при йнтратекальных инъекциях в качестве способа оценки «выживаемости» вещества после интратекального введения. Указанный краситель смешивали с тестируемым веществом перед введением; к тестируемому веществу добавляли 1 нМ красителя в объеме 1 мл. Для отслеживания вводимого вещества помимо красителя, поглощающего в инфракрасной области, применяли 1 мкл FD&C blue №1 (0,25%). Указанный синий краситель является общепринятой пищевой добавкой и, в целом, считается безопасным и нетоксичным.

ИТ введение rhASA или основы в пояснично-крестцовый отдел

[0225] Животным из групп B, D, E и F производили интратекальные инъекции в дни 1, 9, 15 или 16, и 22.

[0226] Взрослых мышей подвергали анестезии посредством внутрибрюшинной инъекции 1,25% 2,2,2-трибромэтанола (авертина) в концентрации 200-300 мл/10 грамм массы тела (250-350 мг/кг). Шерсть на спине срезали от основания хвоста до области лопаток с использованием ножниц. Обритую область протирали тампоном со скрабом на основе повидина/бетадина, и далее - изопропиловым спиртом. Над пояснично-крестцовым отделом позвоночника делали маленький разрез кожи по срединной линии (1-2 см), и находили место пересечения срединной линии спины и ближнего к голове края крыльев подвздошной кости (одиночная подвздошная кость). Мышца в подвздошной ямке (средняя ягодичная) представляет собой мышцу в форме сердца. Две стороны верхушки «сердца» указывают примерное расположение крыльев подвздошной кости. Иглу 32 калибра, присоединенную к герметичному стеклянному шприцу Гамильтона объемом 10-20 мкл, вводили до тех пор, пока не возникало сопротивление со стороны нижележащей кости. Затем проводили инъекцию 10 мкл тестируемого вещества, 1 мкл красителя, поглощающего в инфракрасной области и 1 мкл FD&C blue #1 (суммарный вводимый объем 12 мкл) с примерной скоростью 2 мкл/20 секунд (12 мкл/2 минуты). Разрез кожи зашивали путем наложения клипс. Успешность введения оценивали посредством визуализации, определяя, распределился ли краситель, поглощающий в инфракрасной области, а также синий краситель по ЦНС. После визуализации животному давали восстановиться в реабилитационной камере.

Внутривенная инъекция rhASA

[0227] Животным из группы C производили внутривенные инъекции в дни 1,9, 15 и 22.

[0228] Для проведения ВВ инъекций животных подвергали анестезии с использованием изофлурана, при необходимости, и помещали в ограничитель. Для расширения хвостовой вены, хвост разогревали, аккуратно постукивая по нему пальцем. Участок инъекции протирали 70% этанолом. В качестве альтернативы животное помещали в теплую камеру (40°C) на 1-1,5 минут. Для введения тестируемого вещества применяли иглу 28-30 калибра. Вводимый объем составлял 5-10 мл/кг.

[0229] Приблизительно через 24 часа после введения четвертой дозы животных из групп B-F подвергали эвтаназии. Далее проводили разные процедуры отбора тканей у животных, как описано ниже. Животным из группы A никакие препараты не вводили; однако их подвергли эвтаназии 27 или 28 января 2011 г., и были выполнены процедуры отбора тканей, как описано ниже.

Сыворотка (все животные)

[0230] Терминальную пробу крови (около 0,5 мл) отбирали у всех животных (группы A-F) посредством ретроорбитальной пункции под изофлуорановой анестезией. В глазницу вводили стеклянную трубку, аккуратно проводили ее в область за глазным яблоком и, тем самым, нарушали венозный отток позади глазного яблока. Кровь собиралась благодаря капиллярному эффекту и/или движению самотеком. После отбора крови на глазницу надавливали, чтобы прекратить кровотечение.

[0231] Пробы цельной крови обрабатывали, получали сыворотку и замораживали ее при <-80°C. Сыворотку хранили при -80°C и анализировали на наличие антител.

Ткани для исследования под световым микроскопом (Группы A-F; 5 мышей на группу)

[0232] После отбора крови животных подвергали эвтаназии посредством удушения CO2. Перед перфузией отбирали фрагмент хвоста и замораживали его для возможного генотипирования. Полость перикарда подвергали обработке. Трем (3) мышам на группу проводили транскардиальную перфузию гепаринизированным физиологическим раствором (1 Е/мл гепарина натрия в 0,9% NaCl, после стерильной фильтрации), охлажденным на льду, а затем 4% параформальдегидом примерно при 4°C. Извлекали головной мозг и вскрывали брюшную полость для последующей работы с внутренними органами. Головной мозг и тушку помещали в параформальдегид, за исключением фрагмента хвоста, который замораживали.

Ткани для анализа липидного состава (группы A, B и F; животные 6, 4 и 5, соответственно)

[0233] После отбора крови животных подвергали эвтаназии посредством удушения CO2. Перед перфузией отбирали фрагмент хвоста и замораживали его для возможного генотипирования. Полость перикарда подвергали обработке. Для анализа липидного состава 4-6 мышам на группу проводили транскардиальную перфузию гепаринизированным физиологическим раствором (1 Е/мл гепарина натрия в 0,9% NaCl, после стерильной фильтрации), охлажденным на льду. Примеры тканей, отобранных для анализа липидов, представлены в Таблице 42.

ТАБЛИЦА 42
ТКАНИ, ОТБИРАЕМЫЕ ДЛЯ АНАЛИЗА ЛИПИДНОГО СОСТАВА
Ткани, отбираемые для анализа липидного состава
Головной мозг (разделенный на левое и правое полушарие и взвешенный) Почки (2)
Спинной мозг (извлеченный из позвоночника)
Седалищный нерв (2) (отделенный от мышц) Фрагмент хвоста (перед перфузией)

При отборе ткани взвешивали, а затем замораживали, либо на сухом льде, либо помещая в морозильник с температурой -80°C. Головной мозг разделяли на левое и правое полушарие. Правое полушарие применяли для анализа липидного состава методом MC. Левое полушарие предназначалось для возможного анализа на N-ацетил-L-аспартат (NAA). Ткани хранили при -80°C до проведения анализа (см. Таблицу 43).

ТАБЛИЦА 43
УСЛОВИЯ ХРАНЕНИЯ ПРОБ
Тип пробы Температура хранения
сыворотка заморожена примерно при -80°C
ткани для анализа липидного состава заморожены примерно при -80°C
фрагменты хвоста заморожены примерно при -80°C
ткани для световой микроскопии примерно 4°C

[0234] rhASA снижала накопление сульфатидов в спинном мозге мышей с МЛД, особенно в белом веществе, Фигура 19. Морфометрический анализ спинного мозга продемонстрировал, что оптическая плотность окрашивания альциановым синим статистически значимо снижалась после введения rhASA, Фигура 20. У мышей с МЛД, получавших rhASA, также была снижена активность лизосом в головном мозге, Фигура 21. Указанное снижение было статистически значимым в группе, получавшей высокую дозу (0,21 мг-520 мг/кг массы головного мозга) по сравнению с мышами, получавшими только основу, Фигура 22.

[0235] Иммунотолерантные мыши с МЛД (hASAC9S/ASA(-/-)) старше 1 года олучали rhASA интратекально в поясничный отдел один раз в неделю в течение 4 недель (всего 4 дозы). Дозы включали основу (154 мМ NaCl, 0,005% полисорбата 20, pH ~6,0), 0,04, 0,12, 0,21 мг/дозу (нормированные дозы составляли 100, 300 и 520 мг/кг массы головного мозга, соответственно). В терминальные моменты времени эффективность определяли посредством иммуногистохимической оценки клиренса сульфатидов и активности лизосом в головном и спинном мозге. Срезы спинного и головного мозга окрашивали альциановым синим, который нацелен на сульфатиды в тканях. Срезы головного мозга также окрашивали на наличие ассоциированного с лизосомами мембранного белка (LAMP) в качестве индикатора лизосомальных процессов. Кроме того, на срезах спинного и головного мозга, окрашенных альциановым синим и LAMP, проводили морфометрический анализ.

[0236] Указанные предварительные результаты демонстрируют эффективность интратекального введения rhASA в поясничный отдел. По сравнению с мышами, получавшими только основу, у мышей с МЛД, получавших rhASA, были получены подтверждения улучшения на основании гистологических маркеров заболевания, таких как сокращение накопления сульфатидов (выявляется по окрашиванию альциановым синим) и лизосомальной активности в головном мозге. Указанные гистопатологические изменения наблюдались вблизи участка введения (спинной мозг), а также в дистальных отделах головного мозга.

ПРИМЕР 7 - БИОРАСПРЕДЕЛЕНИЕ 2

Краткий обзор

[0237] В данном исследовании 36 самцов и 36 самок молодых длиннохвостых макак (возраст <12 месяцев в начале исследования) случайным образом распределяли в 5 лечебных групп, и они получали rhASA (rhASA) в дозах 0 (контроль вживления устройства; животные получали 0,6 мл ФБР), 0 (контроль с введением основы) 1,8, 6,0 или 18,6 мг (группы 1, 2, 3, 4 и 5, соответственно) раз в две недели в течение 6 месяцев: всего 12 доз. Все дозы вводили в форме инфузии в объеме 0,6 мл, после чего устройство введения промывали 0,5 мл ФБР приблизительно в течение 10 минут (Таблица 44).

ТАБЛИЦА 44
СХЕМА ЭКСПЕРИМЕНТА
Схема эксперимента
Группа Кол-во животных Номинальная концентрация в дозе (мг/мл) Вводимая доза (мг) Кол-во животных, умерщвленных через 6 месяцев Кол-во животных, умерщвленных после месячного периода восстановления
1 4М, 4Ж DC 0 - 4М, 4Ж
2 8М, 8Ж 0 0 4М, 3Жa 4М, 4Ж
3 8М, 8Ж 3 1.8 4М, 4Ж 4М, 4Ж
4 8М, 8Ж 10 6,0 4М, 4Ж 4М, 4Ж
5 8М, 8Ж 31 18,6 4М, 4Ж 4М, 4Ж
DC=контроль устройства; животные в группе 1 не получали ни основы, ни тестируемого вещества.
a Животное из группы контроля введения основы №044 было умерщвлено в день 50 из-за утечки в катетере.

материалы и методы

Отбор тканей

[0238] Головни мозг нарезали в специальной среде с толщиной фронтального среза примерно 3 мм. Из каждого головного мозга получали полные фронтальные срезы, включающие новую кору (включая кору лобных, теменных, височных и затылочных долей), древнюю кору (обонятельные луковицы и/или грушевидную долю), базальные ганглии (включая хвостатое ядро и скорлупу), лимбическую систему (включая гиппокамп и поясные извилины), таламус, гипоталамус, отделы среднего мозга (включая черное вещество), мозжечок, мост и продолговатый мозг. Места, откуда были получены индивидуальные пробы ткани (через биопсический прокол 4 мм), показаны на Фигурах 32-37. Изображения на Фигурах 32-37 получены из Университета Висконсина и Мичиганской Государственной Сравнительной Коллекции Мозга Млекопитающих (также называемой Национальным музеем здоровья и медицины). Образец из прокола №22 не отбирали, поскольку данной структуры не было во время вскрытия. Все пробы тканей головного мозга замораживали и хранили при -60°C или ниже до проведения анализа на rhASA с использованием твердофазного иммуноферментного анализа.

[0239] Первый срез головного мозга и далее каждый последующий срез фиксировали в формалине для гистопатологической оценки и иммуногистохимического анализа. Второй срез головного мозга и каждый последующий второй срез замораживали для анализа тестируемого вещества. Перед замораживанием пробы тканей головного мозга для анализа биораспределения брали из правой части срезов головного мозга для анализа тестируемого вещества под четными номерами. Локализацию проб головного мозга фотографировали при вскрытии и записывали номера срезов головного мозга. Пробы отбирались либо через 4 мм круговой прокол, либо через разрез, выполненный скальпелем, чтобы оптимизировать количество отбираемого белого вещества. Все биопсические образцы замораживали при -60°C или ниже для проведения анализа тестируемого вещества. Остаток среза головного мозга замораживали и хранили при -60°C или ниже для возможного проведения анализа тестируемого вещества. Расположение биопсических образцов показано в Приложении В.

[0240] Из спинного мозга (шейный, грудной и поясничный отделы) изготавливали срезы толщиной один сантиметр. Первый срез и каждый последующий срез фиксировали в формалине для гистопатологической оценки и иммуногистохимического анализа. Второй срез спинного мозга и каждый последующий второй срез замораживали и хранили при -60°C или ниже для анализа тестируемого вещества. Распределение срезов корректировали так, чтобы срез с кончиком интратекального катетера (срез 0) можно было фиксировать в формалине и подвергнуть гистопатологическому анализу.

Приготовление экстрактов головного мозга, печени и спинного мозга и определение концентрации rhASA

[0241] Биопсические образцы головного мозга, пробы спинного мозга и печени анализировали с использованием прошедшего валидацию способа в соответствии с принципами Надлежащей лабораторной практики (GLP) Управления по контролю за пищевыми продуктами и лекарственными препаратами США (FDA)21 CFR, Часть 58, и в соответствии с применимыми Стандартными операционными процедурами биологических исследований на Среднем Западе. Пробы ткани гомогенизировали в лизирующем буфере, центрифугировали для удаления обломков тканей и хранили при -80°C до проведения анализа. Концентрацию rhASA в растворимых фракциях гомогенатов определяли с использованием ELISA с применением поликлонального антитела кролика SH040 в качестве иммобилизованного антитела, и конъюгированного с ПХ (пероксидазой хрена) моноклонального анти-ASA антитела 19-16-3 в качестве детекторного антитела. После этапа отмывки, направленного на удаление несвязавшегося вещества, раствор субстрата тетраметилбензидина (ТМВ) реагировал с пероксидазой в присутствии ПХ-конъюгированного антитела, формируя колориметрический сигнал, который был пропорционален количеству rhASA, связанному анти-ASA антителом на первом этапе Итоговое количество rhASA в гомогенате каждой ткани вычисляли путем интерполяций стандартной кривой.

[0242] Пробы также анализировали с использованием способа определения белков с участием бицинхониновой кислоты (ВСА), чтобы узнать концентрацию белка в испытуемой пробе. Концентрацию белка в каждой пробе определяли путем интерполяции стандартной кривой для альбумина. Затем результаты определения концентрации ASA нормировали на общее содержание белка в экстрактах ткани, которое определили помощи способа с участием бицинхониновой кислоты.

[0243] Уровень ASA во всех биопсических образцах для групп, получавших основу, 1,8 мг/дозу, 6,0 мг/дозу и 18,6 мг/дозу, показаны на Фигуре 23, Фигуре 24, Фигуре 25 и Фигуре 26, соответственно. Уровень ASA во всех биопсических образцах у животных, прошедших период восстановления из групп контроля введения устройства, основы, 1,8 мг/дозу, 6,0 мг/дозу и 18,6 мг/дозу, показаны на Фигуре 27, Фигуре 28, Фигуре 29, Фигуре 30 и Фигуре 31, соответственно.

[0244] Уровень ASA в избранных биопсических образцах, которые отбирали вблизи поверхности (оболочки мозга) головного мозга показаны на Фигуре 32. Уровень ASA в избранных биопсических образцах, которые, как предполагается, должны содержать в основном глубокие слои белого вещества головного мозга, показаны на Фигуре 33. Белое вещество состоит из пучков миелинизированных нервных клеток (или аксонов). Выбранные пучки, которые содержат в основном глубокие слои белого вещества головного мозга, показаны на Фигуре 34. Серое вещество содержит тела нервных клеток, в отличие от белого вещества. Значения концентрации ASA в избранных биопсических образцах с поверхности, из глубоких слоев белого вещества и глубоких слоев серого вещества для каждой группы показаны на Фигуре 35.

[0245] Данные по концентрации в спинном мозге приведены на Фигуре 36.

[0246] Данные по концентрации в печени приведены на Фигуре 37.

[0247] В некоторых случаях уровень ASA в печени, спинном и головном мозге группы контроля устройства и контрольной группы, получающей основу, был определимым. Уровень в печени и спинном мозге был ниже, чем в любой из групп, получавших rhASA (Фигура 23, Фигура 32 и Фигура 33). Уровень rhASA в группе контроля устройства и контрольной группе, получающей основу, отражает перекрестную реактивность между анти-rhASA антителом, применяемым в ELISA, с нативным белком длиннохвостых макак. Приводимые значения в тканях группы контроля устройства и контрольной группы, получающей основу, не отражает количественные показатели rhASA в тканях длиннохвостых макак, поскольку степень перекрестной реактивности между антителом и rhASA длиннохвостых макак неизвестен, и в связи с тем фактом, что в стандартах анализа применяется ASA человека. Не будем вдаваться в теорию, однако колебания уровня ASA, определяемые между тканями группы контроля устройства и контрольной группы, получающей основу, можно интерпретировать как демонстрируемую вариабельность относительных количеств ASA у длиннохвостых макак в разных тканях и анатомических отделах.

[0248] Уровень ASA в срезах спинного мозга варьировал в диапазоне 160-2352, 1081-6607 и 1893-9252 нг/мг белка у самцов и в диапазоне 0-3151, 669-6637 и 1404-16424 у самок из групп, получавших 1,8, 6,0 и 18,6 мг/дозу, соответственно (Фигура 32). Уровень ASA был выше в поясничном отделе спинного мозга, чем в шейном отделе. Уровень белка ASA, определяемый в печени, в группах, получавших ASA, зависел от дозы и был очень низким в группе, получавшей основу. Средний уровень ASA составлял 88, 674 и 2424 у самцов и 140, 462 и 1996 нг/мг белка у самок для групп, получавших 1,8, 6,0 и 18,6 мг/дозу, соответственно (Фигура 33).

[0249] В целом, представляется, что уровень ASA зависит от дозы в пробах приготовленных из срезов спинного мозга и печени животных из групп, получавших ASA. Во многих из тестируемых отделов спинного мозга была продемонстрирована зависимость уровня ASA от вводимой дозы, хотя в других отделах зависимость от дозы была менее определенной. В целом, уровень ASA в головном мозге повышался с увеличением дозы ASA.

ПРИМЕР 8: ИЗУЧЕНИЕ ФАРМАКОКИНЕТИКИ И БИОРАСПРЕДЕЛЕНИЯ

[0250] Цель данного исследования состояла в оценке фармакокинетики (ФК) и биораспределения разных ферментов для заместительной ферментной терапии после интратекального (ИТ) и внутривенного (ВВ) введения длиннохвостым макакам.

[0251] В данном исследовании всего двенадцать самцов и самок длиннохвостых макак с запатентованным интратекальным катетером в поясничном отделе (ИТ-П) и интратекальным катетером в мостомозжечковой цистерне (ИТ-МЦ) случайным образом распределяли в зависимости от массы тела в четыре лечебных группы для Фазы 1a (введение IS2) и Фазы 1b (введение ASA).

[0252] В обеих фазах пробы крови и СМЖ (из ИТ-П катетера) отбирали через заданные интервалы времени после введения препарата. После отбора последних проб в Фазе 1a животных оставляли на 7-дневный период отмывки, после чего начинали Фазу 1b.

[0253] После отбора последних проб в Фазе 1b животных оставляли на 7-дневный период отмывки, после чего начинали Фазу 2. Всего 12 самцов и самок длиннохвостых макак из Фазы 1b случайным образом распределяли в зависимости от массы тела в двенадцать лечебных групп для получения IS2 (группы 1a-6a) и ASA (группы 1b-6b).

[0254] Абсолютная биодоступность ASA в сыворотке после ИТ-П введения составила ~30-40%. В отличие от этого, при ВВ ведении биодоступными в СМЖ были лишь 0,5% от введенной дозы.

[0255] Воздействие ASA в сыворотке после ИТ-П введения увеличивалось более чем пропорционально дозе.

[0256] После ИТ-П введения воздействие ASA в СМЖ при увеличении дозы возрастало менее чем пропорционально дозе. ФК показатели rhASA в сыворотке, ФК показатели rhASA в сыворотке в СМЖ и биодоступность показаны в Таблицах 45-47.

ТАБЛИЦА 45
ИТОГОВЫЕ ФК ПОКАЗАТЕЛИ ASA В СЫВОРОТКЕ ДЛИННОХВОСТЫХ МАКАК
СРЕДНЕЕ (КВ%) АРИЛСУЛЬФАТАЗА A В СЫВОРОТКЕ
АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:BB 1 МГ/КГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П 1,8 МГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П6 МГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П 18,6 МГ)
N 8 6 8 8
AUC0-T (НГ⋅Ч/МЛ) 10505(16,9) 2219(41,9) 10352(31,9) 17583(28,2)
AUC0-∞ (НГ⋅Ч/МЛ) 11069(17,2) HO(HO)B 9634(28,9)C 20789(27,8)D
CMAX (НГ/МЛ) 11911(20,0) 363(40,4) 1160(29,9) 1621(25,1)
TMAX (Ч) 0,08(0,08, 0,08) 4,00(2,00, 4,00) 4,00(1,00, 4,00) 3,00(1,00, 4,00)
T1/2 (Ч) 6,55(31,8) HO(HO)B 6,77(21,4)C 7,40(32,8)D
CL ИЛИ CL/F (МЛ/Ч) 261(17,0) HO(HO)B 654(25,0)C 944(25,4)D
VZ или VZ/F (МЛ) 2418(32,4) HO(HO)B 6523(41,3)C 9686(25,8)D

ТАБЛИЦА 46
ИТОГОВЫЕ ФК ПОКАЗАТЕЛИ RHASA В СМЖ ДЛИННОХВОСТЫХ МАКАК
СРЕДНЕЕ (КВ%) АРИЛСУЛЬФАТАЗА A В СМЖ
АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:BB 1 МГ/КГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П 1,8 МГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П6 МГ) АРИЛСУЛЬФАТАЗА А (ФАЗА 1B:ИТ-П 18,6 МГ)
AUC0-T (НГ⋅Ч/МЛ) 4 6 8 8
AUC0-∞ (НГ⋅Ч/МЛ) 1629(179,8) 1267266(86,6) 5334329(68,8) 8028775(71,2)
CMAX (НГ/МЛ) 8221(HO)b 1595942(79,1)c 4291829(84,2)d 9406664(64,5)e
TMAX (Ч) 69,3(94,2) 345167(48,7) 1039079(73,6) 1841125(62,8)
Tmaxa (ч) 6,00(1,00, 8,00) 0,08(0,08, 4,00) 0,29(0,08, 4,00) 2,04(0,08, 4,00)
t1/2 (ч) 37,6(HO)b 23,6(68,3)c 17,1(31,3)d 13,4(29,3)e
CL или CL/F (МЛ/Ч) 392(HO)b 1,95(74,1)c 38,1(214,8)d* 3,04(66,1)e
VZ ИЛИ VZ/F (МЛ) 21237(HO)b 80,6(110,4)c 1090(215,1)d 67,6(81,2)e

ТАБЛИЦА 47
БИОДОСТУПНОСТЬ RHASA В СЫВОРОТКЕ И СМЖ
Сравнение абсолютной биодоступности
АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П 1,8 МГ) АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П6 МГ) АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П 18,6 МГ)
Fabs (%) HO 39,9 27,3

[0257] Биодоступность rhASA в сыворотке после ИТ-П введения составила ~30-40%. В отличие от этого, при ВВ ведении биодоступными в СМЖ были лишь 0,5% от введенной дозы.

ТАБЛИЦА 48
РАСПРЕДЕЛЕНИЕ СМЖ: СЫВОРОТКА
РАСПРЕДЕЛЕНИЕ СМЖ: СЫВОРОТКА
АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:BB 1 МГ/КГ) АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П 1,8 МГ) АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П 6 МГ) АРИЛСУЛЬФАТАЗА A (ФАЗА 1B:ИТ-П 18,6 МГ)
0,74 HO 445 452

ПРИМЕР 9 - ЛЕЧЕНИЕ ПАЦИЕНТОВ С МЛД

[0258] Прямое введение в ЦНС, например, посредством ИТ доставки, можно применять для эффективного лечения пациентов с МЛД. Данный пример иллюстрирует многоцентровое исследование с увеличением дозы, направленное на оценку безопасности 3 уровней доз rhASA, вводимых раз в две недели (p/2 нед) в течение 40 недель через устройство интратекальной доставки лекарственных препаратов (IDDD) пациентам с инфантильной формой МЛД. Разные варианты устройств интратекальной доставки лекарственных препаратов, применимых для лечения людей, показаны на Фигурах 45-48.

[0259] Всего в исследование было включено до 20 пациентов:

Когорта 1: 5 пациентов (Минимальная доза)

Когорта 2: 5 пациентов (Средняя доза)

Когорта 3: 5 пациентов (Максимальная доза)

5 пациентов были рандомизированы в группу, не получающую препарат.

[0260] Для участия в исследовании пациентов отбирали на основании следующих критериев включения: (1) наличие первых симптомов до наступления возраста 30 месяцев; (2) ходячее состояние на момент отбора (определяется как способность самостоятельно вставать и проходить вперед 10 шагов (при поддержке за одну руку); (3) наличие неврологических признаков в момент скрининга. Обычно пациентов с трансплантацией гемопоэтических стволовых клеток в анамнезе исключают.

[0261] Хотя некоторые соединения, композиции и способы, описываемые в настоящей заявке, были описаны специфически в рамках определенных вариантов реализации, следующие примеры служат только для иллюстрирования соединений согласно настоящему изобретению, но не должны ограничиваться только такими же соединениями.

[0262] Применяемые в настоящем документе в описании и в прилагаемой формуле изобретения формы единственного числа, если явно не указано другое, включают множественное число. Формула изобретения или описание, в которых встречается «или» между одним или более членами группы, считаются удовлетворенными, если один, более одного или вся группа челнов присутствуют, используются или другим образом относятся к данному продукту или способу, если не указано противоположенное, или другое не следует явно из контекста. Настоящее изобретение включает варианты реализации, в которых один член указанной группы точно присутствует, используется или другим образом относится к данному продукту или способу. Настоящее изобретение также включает варианты реализации, в которых более одного, или целая группа членов присутствует, используется или другим образом относится к данному продукту или способу. Кроме того, следует понимать, что настоящее изобретение охватывает все варианты, комбинации и преобразования, в которых одно или более ограничений, элементов, условий, описательных выражений, и др., из одного или более перечисленных пунктов формулы изобретения введено в другой пункт изобретения, зависимый от того же основного пункта формулы изобретения (или, если значимо, любого другого пункта формулы изобретения), если не указано другое, или если специалисту в данной области техники не очевидно, что может возникнуть противоречие или несоответствие. Когда элементы присутствуют в перечнях (например, группа Маркуша или аналогичная форма), следует понимать, что также раскрывается каждая подгруппа элементов, и любые элементы из данной группы можно удалить. Следует понимать, что обычно там, где настоящее изобретение или аспекты изобретения описываются как содержащие конкретные элементы, признаки, и др., определенные варианты реализации настоящего изобретения или аспектов изобретения включают, или по существу включают такие элементы, признаки, и др. В целях упрощения в настоящей заявке указанные варианты реализации не были в каждом случае описаны так буквально. Следует понимать, что любой вариант реализации или аспект настоящего изобретения можно в явной форме исключить из формулы изобретения, независимо от того, ограничено ли такое конкретное исключение в описании. Публикации, нтернет-сайты и прочие справочные материалы, на которые ссылается настоящий документ в целях описания уровня техники в области изобретения и для предоставления дополнительных подробностей касательно его внедрения в практику, включены в настоящий документ посредством ссылки.

1. Стабильный состав для интратекального введения, содержащий белок арилсульфатазу A (ASA) в концентрации от по меньшей мере 5 до 50 мг/мл, полисорбат и фосфат, при этом указанный фосфат содержится в количестве не более 10 мМ.

2. Стабильный состав по п. 1, отличающийся тем, что белок ASA присутствует в концентрации, выбранной из 10, 30 или 50 мг/мл.

3. Стабильный состав по п. 1, отличающийся тем, что указанный стабильный состав дополнительно содержит NaCl.

4. Стабильный состав по п. 1, отличающийся тем, что белок ASA содержит аминокислотную последовательность SEQ ID NO: 1.

5. Стабильный состав по любому из пп. 1-4, отличающийся тем, что белок ASA получен из линии клеток человека.

6. Стабильный состав по любому из пп. 1-4, отличающийся тем, что белок ASA получен из клеток СНО.

7. Стабильный состав по п. 3, отличающийся тем, что NaCl присутствует в концентрации до 300 мМ.

8. Стабильный состав по п. 3, отличающийся тем, что NaCl присутствует в диапазоне концентраций приблизительно 137-154 мМ.

9. Стабильный состав по п. 8, отличающийся тем, что NaCl присутствует в концентрации приблизительно 154 мМ.

10. Стабильный состав по любому из пп. 1-4, отличающийся тем, что указанное полисорбатное поверхностно-активное вещество выбрано из группы, состоящей из полисорбата 20, полисорбата 40, полисорбата 60, полисорбата 80 и их комбинаций.

11. Стабильный состав по п. 10, отличающийся тем, что указанное полисорбатное поверхностно-активное вещество представляет собой полисорбат 20.

12. Стабильный состав по п. 11, отличающийся тем, что полисорбат 20 присутствует в концентрации до 0,2%.

13. Стабильный состав по п. 12, отличающийся тем, что полисорбат 20 присутствует в концентрации приблизительно 0,005%.

14. Стабильный состав по п. 1, дополнительно содержащий буферный агент, выбранный из группы, состоящей из ацетата, гистидина, сукцината, цитрата, «Трис» и их комбинаций.

15. Стабильный состав по любому из пп. 1-4, отличающийся тем, что стабильный состав имеет рН приблизительно 3-8,0.

16. Стабильный состав по п. 15, отличающийся тем, что стабильный состав имеет рН приблизительно 6,0-6,5.

17. Стабильный состав по п. 16, отличающийся тем, что указанный стабильный состав имеет рН приблизительно 6,0.

18. Стабильный состав по любому из пп. 1-4, отличающийся тем, что указанный состав представляет собой жидкий состав.

19. Стабильный состав по любому из пп. 1-4, отличающийся тем, что указанный состав выполнен в форме лиофилизированного сухого порошка.

20. Стабильный состав по п. 1, отличающийся тем, что указанный состав дополнительно содержит стабилизирующий агент.

21. Стабильный состав по п. 20, отличающийся тем, что указанный стабилизирующий агент выбран из группы, состоящей из сахарозы, глюкозы, маннитола, сорбитола, ПЭГ 4000, гистидина, аргинина, лизина, фосфолипидов и их комбинаций.

22. Способ лечения болезни метахроматической лейкодистрофии (МЛД), включающий этап интратекального введения нуждающемуся в этом субъекту состава по любому из пп. 1-21.

23. Способ по п. 22, отличающийся тем, что интратекальное введение осуществляют раз в две недели.

24. Способ по п. 22, отличающийся тем, что интратекальное введение осуществляют раз в месяц.

25. Способ по п. 22, отличающийся тем, что интратекальное введение осуществляют раз в два месяца.

26. Способ по п. 22, отличающийся тем, что интратекальное введение применяют в сочетании с внутривенным введением.

27. Способ по п. 26, отличающийся тем, что внутривенное введение осуществляют не чаще чем один раз в месяц.

28. Способ по п. 26, отличающийся тем, что внутривенное введение осуществляют не чаще чем раз в два месяца.

29. Способ по п. 22, отличающийся тем, что интратекальное введение применяют в отсутствие внутривенного введения.

30. Способ по п. 22, отличающийся тем, что интратекальное введение применяют в отсутствие сопутствующей иммуносупрессорной терапии.



 

Похожие патенты:

Изобретение относится к области органической химии, а именно к гетероциклическим соединениям указанных ниже структур и к их фармацевтически приемлемым солям. Также изобретение относится к фармацевтической композиции на основе указанных соединений, их применению и способу лечения или профилактики состояния, развитие и симптомы которого связаны с субстратом фермента FAAH.

Изобретение относится к медицине и касается фармацевтической лекарственной формы для лечения нейропсихиатрического расстройства. Лекарственная форма содержит 800 мг акампросата, его кальциевую соль или другую его фармацевтически приемлемую соль, и карбомер гомополимера типа В, который присутствует в количестве от 5 до 20 % от массы лекарственной формы, без какого-либо покрытия.

Изобретение относится к полипептидам, которые действуют как модуляторы активности комплемента, фармацевтическим композициям, содержащим указанные полипептиды, и к способам применения таких модуляторов в качестве терапевтических средств, для лечения связанных с комплементом заболеваний, например, таких как воспалительное заболевание, рана, повреждение.

Изобретение относится к области биотехнологии. Предложен способ генетической регистрации и коррекции нейрогенеза на основе генетических конструкций для трансфекции нейронов, при котором осуществляют трансфекцию катехоламинергических нейронов генетической конструкцией SEQ ID NO: 4, обладающей способностью к стимуляции нейрогенеза и (или) ингибированию нейрональной дегенерации.

Изобретение относится к области органической химии, а именно к гетероциклическому соединению формулы I или к его фармацевтически приемлемой соли присоединения кислоты, где R1 представляет собой фенил, замещенный одним, двумя или тремя заместителями, выбранными из галогена, низшего алкила, замещенного галогеном, низшего алкокси, низшего алкокси, замещенного галогеном, циано или S(O)2-низшего алкила, или представляет собой морфолинил, дигидропиранил, пиридинил или пиперидинил, где пиридинил и пиперидинил замещены галогеном, или представляет собой С(O)O-низший алкил, R2 представляет собой водород; R3 представляет собой водород, низший алкил, замещенный галогеном, -(СН2)n-S(O)2-низший алкил, -(СН2)n-циклоалкил, -(СН2)n-низший алкокси или -бензил-S(O)2-низший алкил; R4 представляет собой водород или низший алкил, n равно 1 или 2.

Изобретение относится к медицине, а именно к нейрохирургии, и может быть использовано для регулирования положения капсулы опухоли в эндоскопической транссфеноидальной хирургии аденомы гипофиза.

Изобретение относится к медицине и касается средства для терапии токсической энцефалопатии, вызванной монооксидом углерода, содержащего синергетически действующие компоненты: дельта-сон индуцирующий пептид с последовательностью Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu, нуклеоспермат натрия, дипептид карнозин и аминокислоту глицин, при массовом соотношении 1:(1-100):(1-100):(1-100) соответственно.

Изобретение относится к медицине, а именно к фармацевтике, и может быть использовано для получения комплекса биологически активных пептидов, проявляющих нейротропную активность.

Изобретение относится к области биохимии. Описана группа изобретений, включающая гликозилированный полипептид, обладающий активностью интерферона β и имеющий лучшее удерживание в крови по сравнению с природным человеческим интерфероном β (варианты), и фармацевтическая композиция, содержащая вышеуказанный гликозилированный полипептид.

Предложенная группа изобретений относится к области медицины. Предложены фармацевтические композиции, рецептированные для введения в спинномозговую жидкость и полезные для лечения боли или модуляции ноцицептивного сигнала, включающие олигонуклеотидную ловушку, имеющую один или более сайтов связывания факторов транскрипции EGR1 и in vivo стабилизирующее количество иона кальция.

Настоящее изобретение относится к иммунологии. Предложен полипептид, способный связываться с поверхностным антигеном вируса гепатита B (HBV) и поверхностным антигеном, презентируемым иммунными эффекторными клетками.

Группа изобретений относится к области медицины, в частности к применению комбинации или композиции обинутузумаба с конъюгатом антитело к CD79b-лекарственное средство, который представляет собой aнти-CD79b-MC-vc-PAB-ММАЕ, для лечения рака, где aнти-CD79b антитело в указанном конъюгате представляет собой huMA79b.v28, включающее вариабельный домен легкой цепи SEQ ID NО: 69 и вариабельный домен тяжелой цепи SEQ ID NO: 70.

Группа изобретений относится к медицине и касается цитотоксического конъюгата антитела с лекарственным агентом, содержащего цитотоксическое вещество, присоединенное к N-концевому аминокислотному остатку тяжелой или легкой цепи антитела, в котором цитотоксическое вещество сайт-специфично присоединено к N-концевой α-аминогруппе нативного первого аминокислотного остатка тяжелой или легкой цепи антитела, и цитотоксическое вещество присоединено к антителу через линкер, содержащий реакционноспособную группу альдегида, посредством реакции восстановительного алкилирования указанной альдегидной группы.

Настоящее изобретение относится к фармацевтической композиции для интраназального введения в виде спрэя, содержащей 0,1-5,0 мас.% янтарнокислой соли 2-этил-6-метил-3-оксипиридина и воду в качестве растворителя.

Группа изобретений относится к области биохимии. Предложена наночастица для трансфекции клеток, а также способ модификации внутриклеточных полинуклеотидов.

Настоящее изобретение относится к области биотехнологии, конкретно к проникающим в клетку пептидам, и может быть использовано в медицине путем доставки терапевтической карго-молекулы в клетку млекопитающего.

Группа изобретений относится к области фармации, в частности к жидкой композиции длительно действующего конъюгата инсулина. Жидкая композиция содержит фармацевтически эффективное количество длительно действующего конъюгата инсулина, где инсулин является физиологически активным пептидом, связан с Fc-областью иммуноглобулина посредством полиэтиленгликоля, и не содержит альбумина стабилизатор, который содержит буфер, сахарный спирт, неионное поверхностно-активное вещество и изотонический агент, где буфер представляет собой ацетатный буфер, имеющий рН в диапазоне от 5,6 до 7, сахарный спирт представляет собой маннит или сахарозу, неионное поверхностно-активное вещество представляет собой полисорбат 20, имеющий концентрацию от 0,001 до 0,02% (мас./об.), изотонический агент представляет собой неорганическую соль.

Изобретение относится к области биотехнологии, конкретно к самособирающейся в наночастицу олигонуклеотидной конструкции, и может быть использовано в медицине. Олигонуклеотидная конструкция согласно настоящему изобретению может быть полезной в качестве системы доставки на основе олигонуклеотида нового типа, а также инструмента для лечения злокачественных заболеваний, инфекционных заболеваний и т.п.

Изобретение относится к конъюгатам антитело-лекарственное средство для лечения солидных опухолей и гематологических злокачественных образований, в котором лекарственное средство с линкером сайт-специфичным образом конъюгировано с антителом или его антигенсвязывающим фрагментом, которое связывается с антигеном-мишенью, экспрессируемом опухолевой клеткой, через встроенный цистеин в указанном антителе или его антигенсвязывающем фрагменте в положении 41 тяжелой цепи согласно нумерации Kabat, где указанное лекарственное средство с линкером представляет собой цитотоксическое средство с линкером.

Изобретение относится к области биотехнологии и биохимии, в частности к проникающему в клетки пептиду. Указанный пептид состоит из аминокислотной последовательности SEQ ID NO: 1 и обладает способностью опосредовать внутриклеточную доставку легкой цепи ботулотоксина.

Изобретение относится к биотехнологии и представляет собой антитело, способное специфически связываться с белком Axl, а также подвергаться интернализации после связывания.

Группа изобретений относится к медицине и касается стабильного состава для интратекального введения, содержащего белок арилсульфатазу A, полисорбат и фосфат. При этом указанный фосфат содержится в количестве не более 10 мМ. Группа изобретений также касается способа лечения болезни метахроматической лейкодистрофии, включающего этап интратекального введения нуждающемуся в этом субъекту указанного состава. Группа изобретений обеспечивает успешное интратекальное введение состава без возникновения значительной токсичности и иммунного ответа. 2 н. и 28 з.п. ф-лы, 9 пр., 46 табл., 56 ил.

Наверх