Пептид

Авторы патента:


Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
Пептид
C07K2319/21 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Изобретение относится к области биотехнологии, конкретно к апитопным пептидам, и может быть использовано в медицине для терапии демиелинизирующего заболевания, такого как рассеянный склероз. Получены пептидные фрагменты из миелинового олигодендроцитарного гликопротеина (MOG): MOG 44-58: FSRVVHLYRNGKDQD (SEQ ID No. 3) и 45-59: SRVVHLYRNGKDQDG (SEQ ID No. 4). Изобретение обеспечивает получение пептидного апитопа MOG, способного связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена. 5 н. и 3 з.п. ф-лы, 7 ил., 2 табл., 3 пр.

 

Настоящее изобретение относится к пептидам из миелинового олигодендроцитарного гликопротеина (MOG). В частности, изобретение относится к пептидам, содержащим часть области 40-60 MOG, которые способны связываться с молекулой MHC и быть представленными T-клетке in vitro без процессинга антигена. Изобретение также относится к применению таких пептидов в лечении и/или профилактике заболевания.

УРОВЕНЬ ТЕХНИКИ

Рассеянный склероз (РС) это хроническое дегенеративное заболевание, поражающее центральную нервную систему, которое характеризуется демиелинизацией аксонов. РС может вызывать многочисленные физические и психические симптомы, и часто прогрессирует до состояния физической и когнитивной инвалидности. Заболевание, как правило, возникает у молодых людей (20-40 лет), чаще встречается у женщин и поражает более 1 миллиона человек по всему миру.

Заболевание РС протекает по-разному и может быть латентным или неуклонно прогрессировать с течением времени. Описано несколько подтипов РС в зависимости от характера прогрессирования. У больного РС может развиваться практически любой неврологический симптом или признак, в том числе изменения ощущений, такие как потеря чувствительности или покалывание, ощущение колющей боли или онемение (гипестезия и парестезия), мышечная слабость, подергивание мышц, мышечные спазмы или затруднения при движении; нарушение координации и равновесия (атаксия); проблемы с речью (дизартрия) или глотанием (дисфагия), проблемы со зрением (нистагм, неврит зрительного нерва, включая фосфены или двоение в глазах), утомляемость, острая или хроническая боль, а также проблемы с мочевым пузырем и кишечником.

В настоящее время РС считают иммуноопосредованным заболеванием, при котором собственная иммунная система организма атакует и повреждает миелин.

Для РС не существует известного лечения. Несколько современных методов лечения оказались полезными для восстановления функции после приступа (рецидива), предотвращения или снижения степени тяжести или частоты новых приступов (рецидивов), либо предотвращения или снижения степени инвалидности. Однако многие современные методы лечения РС связаны с неблагоприятными эффектами или плохо переносятся. Таким образом, существует потребность в альтернативных методах лечения РС, эффективных для лечения РС и для облегчения или уменьшения симптомов РС.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Авторы настоящего изобретения идентифицировали ряд пептидов, полученных из миелинового олигодендроцитарного гликопротеина, которые могут быть представлены фиксированными антигенпредставляющими клетками T-клеткам. Эти пептиды могут быть полезны для профилактики и/или лечения демиелинизирующих заболеваний, таких как рассеянный склероз.

Таким образом, в первом аспекте настоящее изобретение относится к пептиду, способному связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена (то есть, апитопу), который содержит часть области 40-60 миелинового олигодендроцитарного гликопротеина (MOG).

Пептид может содержать часть области 41-59 миелинового олигодендроцитарного гликопротеина.

Пептид можно выбирать из следующих пептидов миелинового олигодендроцитарного гликопротеина: MOG 41-55, 43-57, 44-58 и 45-59.

Пептид может представлять собой MOG 41-55.

Во втором аспекте изобретение относится к пептиду по первому аспекту изобретения, предназначенному для использования в лечении и/или профилактике демиелинизирующего заболевания.

В третьем аспекте настоящее изобретение относится к фармацевтической композиции, содержащей один или более пептидов по первому аспекту изобретения.

В четвертом аспекте настоящее изобретение относится к способу лечения и/или профилактики демиелинизирующего заболевания у субъекта, который нуждается в этом, включающему этап введения пептида по первому аспекту изобретения субъекту.

В пятом аспекте настоящее изобретение относится к использованию пептида по первому аспекту изобретения в производстве лекарственного средства, предназначенного для использования в профилактике и/или лечении демиелинизирующего заболевания.

В случае второго, четвертого и пятого аспектов изобретения заболевание может представлять собой рассеянный склероз.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фигуре 1 приведен график, демонстрирующий пептидную специфичность различных MOG-специфичных гибридомных клонов.

На фигуре 2 представлены результаты анализа вторичной пролиферации для тестирования эффекта введения мышам ROK5 (MOG 41-55) перед иммунизацией MOG 35-55 с последующей повторной стимуляцией in vitro MOG 35-55.

На фигуре 3 приведены профили цитокинов из супернатантов от спленоцитов мышей, предварительно получавших in vivo ROK5 или PBS и иммунизированных MOG 35-55, с последующей повторной стимуляцией in vitro MOG 35-55.

На фигуре 4 представлена схематическая иллюстрация протоколов профилактики ЭАЭ in vivo.

На фигуре 5 показано, что пептид MOG 35-55 вызывает ЭАЭ в модели на мышах.

На фигуре 6 показано, что как мышиные, так и человеческие эпитопы ROK5 способны снижать степень тяжести заболевания, индуцируемого MOG 35-55.

На фигуре 7 показано, что huROK5 снижает степень тяжести заболевания и вызывает отсрочку пика тяжести заболевания.

ПОДРОБНОЕ ОПИСАНИЕ

В первом аспекте настоящее изобретение относится к пептиду.

Пептиды

Термин «пептид» используют в обычном смысле для обозначения последовательности остатков, как правило, L-аминокислот, связанных друг с другом, как правило, пептидными связями между α-амино и карбоксильными группами расположенных рядом аминокислот. Термин включает модифицированные пептиды и синтетические пептидные аналоги.

Пептид по настоящему изобретению имеет такую длину, что он способен связываться с молекулой главного комплекса гистосовместимости (MHC) класса I или II in vitro и быть представленным T-клетке без процессинга антигена. Иными словами, пептиды способны связываться непосредственно с пептидсвязывающей бороздкой молекулы MHC без необходимости какого-либо укорочения с одного или обоих концов.

Пептиды, которые связываются с молекулами MHC класса I, как правило, имеют длину 7-13, чаще 8-10 аминокислот. Связывание пептида стабилизируется на обоих его концах за счет контактов между атомами в основной цепи пептида и инвариантными сайтами в пептидсвязывающей бороздке всех молекул MHC класса I. На обоих концах бороздки существуют инвариантные сайты, которые связывают амино и карбоксильные концы пептида. Вариации длины пептидов приходятся на сгибы пептидного каркаса, часто на остатки пролина или глицина, что придает необходимую гибкость.

Пептиды, которые связываются с молекулами MHC класса II, имеют длину, как правило, 8-20 аминокислот, чаще 10-17 аминокислот. Эти пептиды располагаются в вытянутой конформации вдоль пептидсвязывающей бороздки MHC II, которая (в отличие от пептидсвязывающей бороздки MHC класса I) открыта на обоих концах. Пептид удерживается на месте в основном за счет контактов атомов основной цепи с консервативными остатками, которые выстилают пептидсвязывающую бороздку.

Пептид по настоящему изобретению можно получать химическими методами (Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin). Например, пептиды можно синтезировать твердофазным методом (Roberge J.Y. et al. (1995) Science 269: 202-204), отщеплять от смолы и очищать препаративной высокоэффективной жидкостной хроматографией (например, Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York NY). Автоматический синтез можно осуществлять, например, с использованием пептидного синтезатора ABI 431A (Perkin Elmer) в соответствии с инструкциями производителя.

Альтернативно, пептид можно получать рекомбинантными методами или путем расщепления более длинного полипептида. Например, пептид можно получать путем отщепления от основного белка миелина. Состав пептида можно подтверждать аминокислотным анализом или секвенированием (например, методом деградации по Эдману).

Миелиновый олигодендроцитарный гликопротеин (MOG)

Миелиновый олигодендроцитарный гликопротеин (MOG) представляет собой интегрированный мембранный белок типа I, имеющий единственный внеклеточный Ig вариабельный домен (Ig-V). Аминокислотная последовательность MOG высококонсервативна у разных видов животных (>90%), что является показателем важной биологической функции. MOG специфически экспрессируется в ЦНС на внешнем тонком слое миелиновой оболочки, а также в клеточном теле и отростках олигодендроцитов.

Последовательность зрелого MOG (лишенная 29-аминокислотного сигнального пептида) приведена ниже (SEQ ID No. 5).

SEQ ID No. 5

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF

Пептид по изобретению получают из области 40-60 миелинового олигодендроцитарного гликопротеина (MOG). Пептид можно получать из фрагмента антигена, возникающего в результате естественного процессинга антигена антигенпрезентирующей клеткой. Область 40-60 MOG имеет следующую последовательность:

SEQ ID No. 6

YRPPFSRVVHLYRNGKDQDGD

Пептид может содержать минимальный эпитоп из следующих пептидов: MOG 41-55, 43-57, 44-58 и 45-59.

Последовательности MOG 41-55, 43-57, 44-58 и 45-59 являются следующими:

MOG 41-55: RPPFSRVVHLYRNGK (SEQ ID No. 1)

MOG 43-57: PFSRVVHLYRNGKDQ (SEQ ID No. 2)

MOG 44-58: FSRVVHLYRNGKDQD (SEQ ID No. 3)

MOG 45-59: SRVVHLYRNGKDQDG (SEQ ID No. 4).

Пептид может содержать минимальный эпитоп из MOG 41-55. Пептид может состоять из MOG 41-55.

Апитопы

При адаптивном иммунном ответе T-лимфоциты способны узнавать внутренние эпитопы белкового антигена. Антигенпредставляющие клетки (АПК) поглощают белковые антигены и расщепляют их на короткие пептидные фрагменты. Пептид может связываться с молекулой главного комплекса гистосовместимости (MHC) класса I или II внутри клетки и переноситься на поверхность клетки. Будучи представленным на поверхности клетки в сочетании с молекулой MHC, пептид может узнаваться T-клеткой (с помощью T-клеточного рецептора (TCR)), в этом случае пептид представляет собой T-клеточный эпитоп.

T-клеточные эпитопы играют центральную роль в адаптивном иммунном ответе на любой антиген, как собственный, так и чужеродный. Центральная роль T-клеточных эпитопов в заболеваниях гиперчувствительности (включающих аллергию, аутоиммунные заболевания и отторжение трансплантата) была продемонстрирована на экспериментальных моделях. Можно индуцировать воспалительные или аллергические заболевания путем инъекции синтетических пептидов (на основе структуры T-клеточных эпитопов) в сочетании с адъювантом.

Напротив, показано, что можно индуцировать иммунологическую толерантность в отношении конкретных пептидных эпитопов путем введения пептидных эпитопов в растворимой форме. Показано, что введение растворимых пептидных антигенов является эффективным способом ингибирования заболевания при экспериментальном аутоиммунном энцефаломиелите (ЭАЭ - модель для рассеянного склероза (РС)) (Metzler and Wraith (1993) Int. Immunol. 5: 1159-1165; Liu and Wraith (1995) Int. Immunol. 7: 1255-1263; Anderton and Wraith (1998) Eur. J. Immunol. 28: 1251-1261) и в экспериментальных моделях артрита, диабета и увеоретинита (обзор в Anderton and Wraith (1998), выше). Также была продемонстрирована эффективность этого метода для лечения текущего заболевания при ЭАЭ (Anderton and Wraith (1998), выше).

Использование толерогенных пептидов для лечения или профилактики заболевания привлекло значительное внимание. Одной из причин этого является то, что было показано, что некоторые толерогенные эпитопы способны подавлять ответы T-клеток на другие антигены в той же ткани. Это явление, известное как «подавление иммунного ответа неродственным антигеном», означает, что должна быть возможность индуцировать толерантность к более чем одному эпитопу (предпочтительно, ко всем эпитопам) в конкретном антигене, и к более чем одному антигену для конкретного заболевания с использованием конкретного толерогенного пептида (Anderton and Wraith (1998), выше). Это избавило бы от необходимости определения всех патогенных антигенов при конкретном заболевании.

Пептиды также являются подходящим вариантом для терапии вследствие их относительно низкой стоимости и того факта, что можно получать пептидные аналоги с измененными иммунологическими свойствами. Пептиды, таким образом, можно модифицировать для изменения их взаимодействий либо с MHC, либо с TCR.

Одна из возможных проблем этого подхода заключается в том, что было показано, что не все пептиды, которые действуют в качестве T-клеточных эпитопов, способны вызывать толерантность. Пептид 89-101 основного белка миелина (ОБМ) является иммунодоминантным антигеном после иммунизации и также является очень эффективным иммуногеном как с точки зрения примирования для реакционной способности T-клеток, так и индукции ЭАЭ. Однако показано, что данный пептид неэффективен для индукции толерантности при введении в растворе (Anderton and Wraith (1998), выше).

Был предложен целый ряд объяснений для наблюдаемой иерархии в способности T-клеточных эпитопов индуцировать толерантность (обзор в Anderton and Wraith (1998), выше). В частности, было высказано предположение, что существует корреляция между аффинностью пептида в отношении MHC и толерогенностью (Liu and Wraith (1998), выше), но это не согласуется с некоторыми из наблюдений. Например, MBP [89-101], который не является толерогенным, связывается с I-AS с относительно высокой аффинностью. Таким образом, не просто предсказать, какие пептиды будут индуцировать толерантность.

Авторы настоящего изобретения показали, что если пептидный эпитоп имеет соответствующий размер, чтобы быть представленным незрелой АПК без процессинга антигена, он может индуцировать иммунологическую толерантность (международная патентная заявка номер PCT/GB01/03702). То наблюдение, что некоторые T-клеточные эпитопы являются толерогенными, а другие неспособны индуцировать толерантность, таким образом, может быть объяснено тем фактом, что некоторые эпитопы нуждаются в процессинге антигена прежде, чем они смогут быть представлены молекулой MHC. Эти эпитопы, которым необходим дополнительный процессинг, не индуцируют толерантность при введении в растворимой форме, несмотря на их способность индуцировать заболевание при введении в сочетании с адъювантом.

Эпитопы, которым не нужен дополнительный процессинг, способны индуцировать толерантность, и они были названы авторами изобретения «апитопами» (независящими от процессинга антигена эпитопами).

Независящая от процессинга антигена система представления (APIPS)

Пептиды по настоящему изобретению способны связываться с молекулой MHC in vitro и быть представленными T-клетке без процессинга антигена.

Можно тестировать способность пептида связываться с молекулой MHC без процессинга антигена, используя «беспроцессинговую» систему. Такая система должна быть способна представлять антиген с помощью молекул MHC T-клеткам, но не способна процессировать антиген. Таким образом, пептиды можно тестировать на их способность связываться с молекулой MHC in vitro и быть представленными T-клетке без процессинга антигена с использованием независящей от процессинга антигена системы представления (APIPS).

Примеры APIPS включают:

a) фиксированные АПК (с антителами к CD28 или без них);

b) липидные мембраны, содержащие молекулы MHC класса I или II (с антителами к CD28 или без них); и

c) очищенные природные или рекомбинантные молекулы MHC, связанные с планшетом (с антителами к CD28 или без них).

Известно, что фиксированные АПК используют для изучения T-клеточных ответов, например, в исследованиях с целью определения минимального эпитопа в полипептиде путем измерения ответа на укороченные пептиды (Fairchild et al. (1996) Int. Immunol. 8: 1035-1043). АПК можно фиксировать при помощи, например, формальдегида (как правило, параформальдегида) или глутаральдегида.

Липидные мембраны (которые могут быть плоскими мембранами или липосомами) могут быть получены с использованием искусственных липидов или могут представлять собой плазматические мембранные/микросомальные фракции из АПК.

На практике, APIPS можно наносить в лунки планшета для культивирования тканей. Затем добавляют пептидные антигены, и связывание пептида с MHC частью APIPS определяют, добавляя выбранные T-клеточные линии или клоны. Активацию T-клеточной линии или клона можно измерять любыми методами, известными в данной области, например, по включению 3H-тимидина или секреции цитокинов.

Если пептид может быть представлен T-клетке при помощи APIPS, тогда он способен связываться с молекулой MHC без процессинга антигена и является апитопом.

Толерантность

Пептиды по настоящему изобретению способны индуцировать толерантность к миелиновому олигодендроцитарному гликопротеину (MOG).

Используемый в настоящем документе термин «толерогенный» означает способный индуцировать толерантность.

Толерантность это неспособность реагировать на антиген. Толерантность к собственным антигенам является важной особенностью иммунной системы, если она теряется, может развиться аутоиммунное заболевание. Адаптивная иммунная система должна поддерживать способность реагировать на огромное разнообразие инфекционных агентов, при этом избегая аутоиммунной атаки на собственные антигены, содержащиеся в собственных тканях организма. В значительной степени это контролируется за счет подверженности незрелых T-лимфоцитов клеточному апоптозу в тимусе (центральная толерантность). Однако не все собственные антигены обнаруживаются в тимусе, так что гибели аутореактивных тимоцитов недостаточно. Вследствие этого, существуют дополнительные механизмы, за счет которых толерантность могут приобретать зрелые аутореактивные T-лимфоциты в периферических тканях (периферическая толерантность). Обзор механизмов центральной и периферической толерантности приведен в Anderton et al. (1999) (Immunological Reviews 169: 123-137).

Толерантность может возникать вследствие, или характеризоваться индукцией, анергии по меньшей мере в части CD4+ T-клеток. Для активации T-клетки пептид должен связываться с «профессиональной» АПК, способной доставлять два сигнала к T-клеткам. Первый сигнал (сигнал 1) доставляется MHC-пептидным комплексом на клеточную поверхность АПК и воспринимается T-клеткой через рецептор TCR. Второй сигнал (сигнал 2) доставляется на поверхность АПК костимулирующими молекулами, такими как CD80 и CD86, и воспринимается CD28 на поверхности T-клетки. Считается, что когда T-клетка получает сигнал 1 в отсутствие сигнала 2, она не активируется и, фактически, становится анергической. Анергические T-клетки невосприимчивы к последующему воздействию антигена и могут быть способны подавлять другие иммунные ответы. Считается, что анергические T-клетки вовлечены в опосредование T-клеточной толерантности.

Пептиды, которым необходим процессинг прежде, чем они смогут быть представлены в сочетании с молекулами MHC, не индуцируют толерантность, поскольку они должны подвергаться процессингу зрелыми антигенпредставляющими клетками. Зрелые антигенпредставляющие клетки (такие как макрофаги, B-клетки и дендритные клетки) способны к процессингу антигена, но также и к доставке обоих сигналов 1 и 2 к T-клетке, что приводит к активации T-клетки. Апитопы, с другой стороны, способны связывать MHC класса II на незрелых АПК. Таким образом, они будут представлены T-клеткам без костимулирования, что приводит к анергии T-клеток и толерантности.

Безусловно, апитопы также способны связываться с молекулами MHC на клеточной поверхности зрелых АПК. Однако в иммунной системе имеется намного больше незрелых, чем зрелых АПК (было высказано предположение, что менее 10% дендритных клеток являются активированными, Summers et al. (2001) Am. J. Pathol. 159: 285-295). Таким образом, по умолчанию, основное действие апитопа будет заключаться в индукции анергии/толерантности, а не активации.

Показано, что, если толерантность индуцирована ингаляцией пептида, способность антигенспецифических CD4+ T-клеток к пролиферации снижена. Кроме того, продуцирование IL-2, IFN-γ и IL-4 этими клетками снижено, однако продуцирование IL-10 повышено. Показано, что нейтрализация IL-10 у мышей в состоянии индуцированной пептидом толерантности полностью восстанавливает восприимчивость к заболеванию. Было высказано предположение, что популяция регуляторных клеток сохраняется в толерантном состоянии, при котором продуцируется IL-10 и опосредуется иммунная регуляция (Burkhart et al. (1999) Int. Immunol. 11: 1625-1634).

Таким образом, индукцию толерантности можно отслеживать различными способами, включая:

(a) уменьшение восприимчивости к заболеванию, для которого пептид является эпитопом-мишенью in vivo;

(b) индукцию анергии в CD4+ T-клетках (которая может быть обнаружена при последующей стимуляции антигеном in vitro);

(c) изменения в популяции CD4+ T-клеток, включая

(i) снижение пролиферации;

(ii) уменьшение продуцирования IL-2, IFN-γ и IL-4; и

(iii) увеличение продуцирования IL-10.

Целевые заболевания

Пептид по изобретению можно использовать в лечении и/или профилактике заболевания. Заболевание может представлять собой демиелинизирующие заболевания, такие как адренолейкодистрофия, болезнь исчезновения белого вещества или рассеянный склероз (РС).

Пептиды по настоящему изобретению особенно полезны в лечении и/или профилактике рассеянного склероза (РС). Рассеянный склероз (РС) представляет собой хроническое воспалительное заболевание, характеризующееся наличием множественных очагов демиелинизации, диссеминированных по всему белому веществу ЦНС и возникающих в различных участках в разное время (McFarlin and McFarland, 1982 New England J. Medicine 307: 1183-1188 и 1246-1251). Считается, что РС опосредуется аутореактивными Т-клетками.

Фармацевтическая композиция

Во втором аспекте настоящее изобретение относится к фармацевтической композиции, содержащей один или более пептидов по первому аспекту изобретения.

Авторы настоящего изобретения прогнозируют, что, несмотря на «подавление иммунного ответа неродственным антигеном», может быть необходимым воздействие на ряд различных T-клеточных клонов, чтобы эффективно индуцировать толерантность. Таким образом, индивидууму можно вводить несколько пептидов для лечения или профилактики заболевания.

Фармацевтическая композиция может, например, содержать от 1 до 20 апитопов, например, 1-15, 2-8 или 4-6 апитопов.

В случае двух или более апитопов фармацевтическая композиция может быть в виде набора, в котором некоторые или все апитопы предоставлены отдельно для одновременного, раздельного или последовательного введения.

Альтернативно (или дополнительно), если фармацевтическую композицию (или любую ее часть) предстоит вводить в нескольких дозах, каждая доза может быть упакована отдельно. Фармацевтическая композиция может содержать терапевтически или профилактически эффективное количество каждого апитопа и, необязательно, фармацевтически приемлемый носитель, разбавитель или наполнитель.

Кроме того, в фармацевтической композиции по настоящему изобретению каждый апитоп можно смешивать с любым подходящим связующим веществом(ами), смазывающим веществом(ами), суспендирующим веществом(ами), покрывающим средством(ами) или солюбилизирующим средством(ами).

Введение

Пептид можно вводить в растворимой форме без адъюванта.

Пептид можно вводить трансмукозальным путем введения.

Исследования показали, что пептид при введении в растворимой форме внутрибрюшинно (в/б), внутривенно (в/в), интраназально (и/н) или перорально может индуцировать толерантность T-клеток (Anderton and Wraith (1998), выше; Liu and Wraith (1995), выше; Metzler and Wraith (1999) Immunology 97: 257-263).

Пептид можно вводить интраназально.

Исследования на мышах показали, что продолжительность введения пептида, необходимая для индукции толерантности, зависит от частоты предшественников T-клеток у реципиента (Burkhart et al. (1999), выше). Во многих экспериментальных исследованиях было показано, что для индукции толерантности необходимы повторные дозы пептида (Burkhart et al. (1999), выше). Таким образом, точная доза и число доз пептида будет зависеть от индивидуума, однако в предпочтительном варианте осуществления вводят несколько доз.

Если несколько пептидов вводят одновременно, они могут находиться в виде «коктейля», подходящего для введения в одной или нескольких дозах. Альтернативно, может быть предпочтительным введение нескольких доз, но с варьирующими от дозы к дозе относительными концентрациями пептидов.

В предпочтительном варианте осуществления можно следовать протоколу «эскалации дозы», согласно которому несколько доз вводят пациенту в возрастающих концентрациях. Такой подход был использован, например, для пептидов фосфолипазы A2 в иммунотерапии против аллергии на пчелиный яд (Mtiller et al. (1998) J. Allergy Clin Immunol. 101: 747-754 и Akdis et al. (1998) J. Clin. Invest. 102: 98-106).

ПРИМЕРЫ

Следующие далее примеры служат для иллюстрации настоящего изобретения, но их не следует рассматривать в качестве его ограничения. Изобретение, в частности, относится к конкретным вариантам осуществления, описанным в этих примерах.

ПРИМЕР 1 - Идентификация апитопов в миелиновом олигодендроцитарном гликопротеине (MOG)

Материалы и методы

Антигены

Последовательность нуклеиновой кислоты, кодирующую 125-аминокислотную N-концевую часть MOG человека, которая представляет собой внеклеточный домен, клонировали в бактериальный экспрессионный вектор (система pET). Этот рекомбинантный внеклеточный домен MOG человека (rhMOGED) был экспрессирован в бактериальной системе в виде слитого белка с His-меткой на C-конце.

Синтезировали панель 15-членных перекрывающихся пептидов, охватывающих rhMOGED, с использованием стандартной Fmoc-технологии. 15-членные пептиды имели сдвиг на 5 ак и область перекрывания 10 ак.

Получение клонов Т-клеток

MOG-специфические гибридомные клоны T-клеток получали путем иммунизации мышей DR2+. Мышей DR2+ иммунизировали либо пулом перекрывающихся пептидов MOG, либо rhMOGED в полном адъюванте Фрейнда (CFA). Через 10 дней селезенки и дренирующие лимфатические узлы удаляли, CD4+ T-клетки очищали и повторно стимулировали смесью антиген/CFA in vitro. Через неделю T-клетки повторно стимулировали in vitro антигеном для увеличения количества активированных антигенспецифических клеток.

Через 3 дня проводили слияние активированных T-клеток с клетками линии BW 5147 тимомы. Затем отбирали гибридомные клоны с использованием селективной среды HAT и проводили скрининг на пептидную специфичность с помощью IL-2 ELISA.

Анализ пролиферации

Живые или фиксированные п-формальдегидом клетки Mgar (HLA-DR2 +ve) инкубировали с пептидами в сыворотке или в сыворотке без пептидов совместно с T-клетками в течение 48 часов. Пролиферативный ответ T-клеток измеряли по продуцированию IL-2.

Результаты

Ответ различных MOG-специфических гибридомных клонов на представление встроенных пептидов MOG представлен на фигуре 1. Пептид MOG 41-55 («ROK5») был определен как апитоп, поскольку он мог быть представлен фиксированными АПК T-клеткам без дополнительного процессинга. Затем проводили подробное исследование с использованием перекрывающихся пептидов в области 25-60, используя пептиды, сдвинутые на одну аминокислоту. Пептиды MOG 41-55, 43-57, 44-58 и 45-59 были идентифицированы как апитопы (фигура 1).

Последовательности этих пептидов приведены в таблице 1.

Таблица 1
Последовательность пептидов MOG, идентифицированных как апитопы
Пептид MOG Аминокислотная последовательность
ROK5 MOG 41-55 RPPFSRVVHLYRNGK
ROK19 MOG 43-57 PFSRVVHLYRNGKDQ
ROK20 MOG 44-58 FSRVVHLYRNGKDQD
ROK21 MOG 45-59 SRVVHLYRNGKDQDG

ПРИМЕР 2 - Ex vivo анализ толерантности

Для определения того, способны ли пептиды, идентифицированные как апитопы, индуцировать толерантность к антигену, проводили исследование ex vivo. Трансгенных по HLA-DR2 мышей иммунизировали либо 100 мкг ROK5 (MOG 41-55), 100 мкг MOG 35-55, либо PBS в дни - 8, -4 и -2. В день 0 мышам вводили инъекцией в основание хвоста 100 мкг MOG 35-55 в сочетании с CFA.

В день 10 спленоциты и дренирующие лимфатические узлы собирали, из них выделяли соответствующие клеточные популяции и проводили анализ вторичной пролиферации с MOG 35-55. Клетки от отдельных мышей обрабатывали отдельно и по данным строили отдельные графики на фигуре 2. Для вторичного ответа клетки обрабатывали ex vivo MOG 35-55 в диапазоне доз (100, 10, 1, 0,1, 0,01, 0 мкг) и определяли пролиферацию по включению 3H-тимидина. Индекс стимуляции (по сравнению с пролиферацией без антигена) рассчитывали для каждого случая.

Как показано на фигуре 2, ROK5 (MOG 41-55) был способен подавлять иммунный ответ на стимуляцию MOG 35-55.

Также изучали эффект предварительной обработки ROK5 на профили различных цитокинов. Как показано на фигуре 3, на продуцирование IFNγ, IL-2, GM-CSF, IL6 спленоцитами отчетливо влияла предварительная обработка ROK5.

ПРИМЕР 3 - Предотвращение ЭАЭ с помощью ROK5

ЭАЭ (экспериментальный аутоиммунный энцефаломиелит) является широко используемой моделью РС, и может быть индуцирован у целого ряда генетически предрасположенных видов лабораторных животных (включая грызунов и приматов) путем иммунизации миелином или компонентами миелина (в том числе MOG) в сильных адъювантах.

Для проверки способности ROK5 предотвращать индуцированный MOG ЭАЭ у трансгенных по HLA-DR2 мышей создавали модель заболевания у мышей этой линии. Для индукции заболевания использовали энцефалитогенный пептид MOG, MOG 35-55 мыши (mMOG 35-55). Затем тестировали ROK5 в экспериментах по предотвращению ЭАЭ следующим образом:

Эксперимент 1: с 3 предварительными введениями дозы ROK5 и последующей иммунизацией mMOG 35-55.

Эксперимент 2: с 5 предварительными введениями дозы ROK5 и последующей иммунизацией mMOG 35-55.

В каждом эксперименте использовали по 10 мышей на группу.

Последовательности пептидов:

mMOG 35-55: MEVGWYRSPFSRVVHLYRNGK (SEQ ID No. 7)

hROK5 (41-55): RPPFSRVVHLYRNGK (SEQ ID No. 1)

mROK5 (41-55): RSPFSRVVHLYRNGK (SEQ ID No. 8).

Человеческий и мышиный MOG различаются за счет аминокислотной замены в положении 42, замены остатка пролина на серин. Оба пептида MOG 35-55 являются иммуногенными, однако мышиный MOG 35-55 является более энцефалитогенным, таким образом, мышиный MOG 35-55 был выбран для индукции ЭАЭ в модели.

Протоколы предотвращения ЭАЭ in vivo приведены на фигурах 4A и 4B.

Модель индуцированного MOG ЭАЭ:

Использовали две группы трансгенных мышей DR2, в нулевой день животные (n=7) в группе «100 мкг» получали 100 мкг mMOG 35-55 в полном адъюванте Фрейнда (CFA) (100 мкл, п/к инъекция в основание хвоста), животные (n=8) в группе «200 мкг» получали 200 мкг mMOG 35-55 в CFA. В нулевой день и день 2 все животные получали инъекцию коклюшного токсина (200 нг в PBS, в/б). Каждый день регистрировали клинические признаки ЭАЭ в баллах и измеряли массу тела животных. Как показано на фигурах 5A, 5B и в таблице 2 ниже, mMOG 35-55 в обеих дозах способен индуцировать ЭАЭ с хорошей частотой возникновения заболевания.

Таблица 2
Группа Частота случаев заболевания Средний день начала заболевания
100 нг 4/7 12,25
200 нг 7/8 12

Эксперименты по предотвращению ЭАЭ с помощью ROK5:

На базе данной модели тестировали способность ROK5 предотвращать индуцированный MOG ЭАЭ.

A/Первый эксперимент

Первый эксперимент проводили, предварительно вводя животным 3 раза (с 3-дневными промежутками) либо ROK5 мыши, ROK5 человека, либо PBS, 100 мкг в объеме 100 мкл в CFA (подкожная инъекция в бок), затем всех животных иммунизировали 200 мкг mMOG 35-55 в CFA (п/к инъекция в основание хвоста) и вводили 200 нг коклюшного токсина (200 нг в PBS, в/б) в нулевой день и день 2.

Каждый день регистрировали клинические признаки ЭАЭ в баллах и измеряли массу тела животных. На фигуре 6 показано, что как мышиный, так и человеческий апитоп ROK5 способен снижать тяжесть заболевания, индуцированного MOG. Интересно, что ROK5 человека был более эффективен.

Как показано на фигуре 6A и 6B, эксперимент 1 продемонстрировал, что как мышиный, так и человеческий апитопы ROK5 способны снижать тяжесть заболевания, индуцированного MOG 35-55.

B/Второй эксперимент

Второй эксперимент проводили, предварительно вводя животным 5 раз (с 3-дневными промежутками) либо ROK5 человека, либо PBS, 100 мкг в объеме 100 мкл в CFA (подкожная инъекция в бок), затем всех животных иммунизировали 200 мкг mMOG 35-55 в CFA (п/к инъекция в основание хвоста) и вводили 200 нг коклюшного токсина (200 нг в PBS, в/б) в нулевой день и день 2. Каждый день регистрировали клинические признаки ЭАЭ в баллах.

В эксперименте 2 (фигура 7), huROK5 приводил к снижению тяжести заболевания и вызывал отсрочку пика тяжести заболевания.

В заключение, апитоп ROK5 человека был способен снижать тяжесть заболевания в обоих экспериментах с ЭАЭ.

Для специалистов в данной области будут очевидны различные модификации и вариации описанных способов и системы по изобретению без отклонения от объема и сущности изобретения. Хотя изобретение описано применительно к конкретным вариантам осуществления, следует понимать, что заявленное изобретение не должно быть ограничено такими конкретными вариантами осуществления. Действительно, различные модификации описанных способов осуществления изобретения, которые очевидны для специалистов в области химии или молекулярной биологии, или родственных областях, должны входить в объем настоящего изобретения. Все публикации, упомянутые в приведенном выше описании, включены в настоящий документ посредством ссылки.

1. Пептид, способный связываться с молекулой MHC класса I или II in vitro и быть представленным T-клетке без процессинга антигена, который выбран из следующих пептидов миелинового олигодендроцитарного гликопротеина (MOG):

MOG 44-58: FSRVVHLYRNGKDQD (SEQ ID No. 3); и

45-59: SRVVHLYRNGKDQDG (SEQ ID No. 4).

2. Применение пептида по п.1 для лечения или профилактики демиелинизирующего заболевания.

3. Применение пептида по п.2, где заболевание представляет собой рассеянный склероз.

4. Фармацевтическая композиция, содержащая эффективное количество одного или более пептидов по п.1, для применения в лечении или профилактике демиелинизирующего заболевания.

5. Способ лечения или профилактики демиелинизирующего заболевания у пациента, включающий стадию введения пациенту пептида по п.1.

6. Способ по п.5, где заболевание представляет собой рассеянный склероз.

7. Применение пептида по п.1 в производстве лекарственного средства, предназначенного для профилактики или лечения демиелинизирующего заболевания.

8. Применение по п.7, где заболевание представляет собой рассеянный склероз.



 

Похожие патенты:

Данное изобретение относится к области биотехнологии и иммунологии. Предложена нуклеотидная композиция для получения гетеродимерной конструкции Fc, имеющей замены в CH3 доменах, обеспечивающие повышение температуры плавления.

Настоящее изобретение относится к области биотехнологии, конкретно к полипептидному биомаркеру эффективности применения ингибитора FGFR при лечении рака мочевого пузыря и рака легких, что может быть использовано в медицине.

Изобретение относится к области биохимии, в частности к мини-антителу для связывания с простата-специфичным мембранным агентом (PSMA), содержащему последовательность scFv, которая может связываться с PSMA, причем указанная scFv содержит вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) линкерной последовательностью; искусственную шарнирную область и последовательность СН3 IgG человека; и изолированному полинуклеотиду, который кодирует вышеуказанное мини-антитело.

Настоящее изобретение относится к иммунологии. Предложен иммуноконъюгат, включающий рекомбинантное антитело IgG1 к эпидермальному фактору роста человека (hEGFR), ковалентно присоединенное к цитотоксическому средству.

Изобретение относится к области биотехнологии, а именно к разработке технологий производства защитных иммунобиологических препаратов, и касается получения иммуноглобулина Эбола из сыворотки крови лошадей, иммунизированных вирусом Эбола, методом спиртового осаждения по Кону.

Изобретение относится к способам получения гликоконъюгатов, пригодных для использования в медицине. Предложены способы получения гликоконъюгата с молекулярной массой от 1000 до 20000 кДа, содержащего бактериальный капсульный полисахарид, конъюгированный с белком-носителем, где указанный полисахарид ковалентно присоединен к указанному белку-носителю, включающий стадии: а) приведения бактериального капсульного полисахарида, имеющего происхождение из S.

Предложенная группа изобретений относится к области медицины. Предложены способы выделения белкового высокомолекулярного комплекса активации каспазы-2 человека, формирующегося в раковых клетках в ответ на обработку ДНК-повреждающим химиотерапевтическим препаратом.

Настоящее изобретение относится к области иммунологии. Предложена композиция для лечения IL-13 опосредованного расстройства, включающая анти-IL13 антитело и остаточное количество PLBL2 хомячка.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению человеческих белков в клетках СНО, и может быть использовано для получения человеческого антитела к гемагглютинину вируса гриппа А (ВГА) изотипа IgA2m1.

Изобретение относится к области биотехнологии, конкретно к вариантам антигена 4 цитотоксических Т-лимфоцитов (CTLA-4), что может быть использовано в медицине. Получают полипептид CTLA-4 с мутациями, его конъюгат с Fc IgG, клетку-хозяина для получения полипептида, композицию, содержащую полипептид, которые применяются для лечения аутоиммунного заболевания и/или ослабления ответа Т-клеток у пациента.

Изобретение относится к области биотехнологии, конкретно к комплексу антиген-МНС-наночастицы, где антигеном является связанный с рассеянным склерозом антиген, и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к терапевтическим пептидам из TLT-1 (Trem-подобный транскрипт-1), и может быть использовано в медицине. Полученные пептидные фрагменты TLT-1 эффективны в лечении сердечно-сосудистых заболеваний, выбранных из группы, включающей миокардиальный или церебральный инфаркт, острый инфаркт миокарда, болезни коронарных сосудов сердца, инсульт, аневризму, стабильную стенокардию или стенокардию напряжения, кардиомиопатию, гипертензивную кардиопатию, сердечную недостаточность (хроническую или острую), легочное сердце, сердечные аритмии, воспалительные заболевания сердца, такие как эндокардит, миокардит, заболевания периферических артерий, ССВО (синдром системного воспалительного ответа)-ассоциированную миокардиальную и сосудистую дисфункцию, атеросклероз.

Изобретение относится к области биотехнологии, конкретно к терапевтическим пептидам из TLT-1 (Trem-подобный транскрипт-1), и может быть использовано в медицине. Полученные пептидные фрагменты TLT-1 эффективны в лечении сердечно-сосудистых заболеваний, выбранных из группы, включающей миокардиальный или церебральный инфаркт, острый инфаркт миокарда, болезни коронарных сосудов сердца, инсульт, аневризму, стабильную стенокардию или стенокардию напряжения, кардиомиопатию, гипертензивную кардиопатию, сердечную недостаточность (хроническую или острую), легочное сердце, сердечные аритмии, воспалительные заболевания сердца, такие как эндокардит, миокардит, заболевания периферических артерий, ССВО (синдром системного воспалительного ответа)-ассоциированную миокардиальную и сосудистую дисфункцию, атеросклероз.

Изобретение относится к области биотехнологии, конкретно к вариантам антигена 4 цитотоксических Т-лимфоцитов (CTLA-4), что может быть использовано в медицине. Получают полипептид CTLA-4 с мутациями, его конъюгат с Fc IgG, клетку-хозяина для получения полипептида, композицию, содержащую полипептид, которые применяются для лечения аутоиммунного заболевания и/или ослабления ответа Т-клеток у пациента.

Изобретение относится к области биотехнологии, конкретно к вариантам антигена 4 цитотоксических Т-лимфоцитов (CTLA-4), что может быть использовано в медицине. Получают полипептид CTLA-4 с мутациями, его конъюгат с Fc IgG, клетку-хозяина для получения полипептида, композицию, содержащую полипептид, которые применяются для лечения аутоиммунного заболевания и/или ослабления ответа Т-клеток у пациента.

Изобретение относится к области биохимии, в частности к генетически модифицированному животному-грызуну, экспрессирующему гуманизированный белок April, а также к способу его получения.

Изобретение относится к области биохимии, в частности к генетически модифицированному животному-грызуну, экспрессирующему гуманизированный белок April, а также к способу его получения.

Группа изобретений относится к области биотехнологии. Предложен способ контроля паттерна гликозилирования рекомбинантного гликопротеина, включающий культивирование микроорганизма, содержащего полинуклеотид, кодирующий рекомбинантный гликопротеин, в культуральной среде, содержащей инсулин.

Изобретение относится к биотехнологии. Описан способ очистки слитого белка TNFR-Fc от примесей с получением белка с заданной долей гидрофобного хроматографического пика 3, включающий: (а) внесение образца, содержащего жидкую смесь слитого белка TNFR-Fc, полученную из клеток млекопитающих, частично очищенного аффинной хроматографией, анионообменной хроматографией или той и другой, в колонку, заполненную средой для хроматографии гидрофобного взаимодействия (HIC), содержащей ароматическую функциональную группу, предварительно уравновешенной уравновешивающим (EQ) буфером, содержащим хлорид натрия в концентрации от 1 М до 1,4 М или сульфат аммония в концентрации от 0,45 М до 0,55 М; и (б) сбор элюата путем элюирования белка элюирующим буфером, содержащим хлорид натрия или сульфат аммония в той же концентрации, что и уравновешивающий буфер, где заданная доля гидрофобного хроматографического пика 3 составляет от 9% до 18%.

Изобретение относится к биотехнологии. Описан способ очистки слитого белка TNFR-Fc от примесей с получением белка с заданной долей гидрофобного хроматографического пика 3, включающий: (а) внесение образца, содержащего жидкую смесь слитого белка TNFR-Fc, полученную из клеток млекопитающих, частично очищенного аффинной хроматографией, анионообменной хроматографией или той и другой, в колонку, заполненную средой для хроматографии гидрофобного взаимодействия (HIC), содержащей ароматическую функциональную группу, предварительно уравновешенной уравновешивающим (EQ) буфером, содержащим хлорид натрия в концентрации от 1 М до 1,4 М или сульфат аммония в концентрации от 0,45 М до 0,55 М; и (б) сбор элюата путем элюирования белка элюирующим буфером, содержащим хлорид натрия или сульфат аммония в той же концентрации, что и уравновешивающий буфер, где заданная доля гидрофобного хроматографического пика 3 составляет от 9% до 18%.

Изобретение относится к области биотехнологии, конкретно к комплексу антиген-МНС-наночастицы, где антигеном является связанный с рассеянным склерозом антиген, и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к апитопным пептидам, и может быть использовано в медицине для терапии демиелинизирующего заболевания, такого как рассеянный склероз. Получены пептидные фрагменты из миелинового олигодендроцитарного гликопротеина : MOG 44-58: FSRVVHLYRNGKDQD и 45-59: SRVVHLYRNGKDQDG. Изобретение обеспечивает получение пептидного апитопа MOG, способного связываться с молекулой MHC in vitro и быть представленным T-клетке без процессинга антигена. 5 н. и 3 з.п. ф-лы, 7 ил., 2 табл., 3 пр.

Наверх