Способы модуляции гомеостаза желчных кислот и лечение расстройств и заболеваний, ассоциированных с желчными кислотами

Изобретение относится к биотехнологии. Описан способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, включающий введение пептида. При этом пептид содержит: a) N-концевую область, включающую по меньшей мере семь аминокислотных остатков, и b) C-концевую область. При этом N-концевая область содержит DSSPL (SEQ ID NO:121) или DASPH (SEQ ID NO:122). C-концевая область содержит: (i) первую последовательность С-концевой области, содержащую WGDPIRLRHLYTSG (аминокислотные остатки 16-29 последовательности SEQ ID NO:99 [FGF19]), где остаток W соответствует положению первой аминокислоты указанной С-концевой области, или (ii) вторую последовательность С-концевой области, содержащую PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (аминокислотные остатки 30-194 последовательности SEQ ID NO: 99 [FGF19]), или последовательность, содержащую от 1 до 5 аминокислотных замен, делеций или инсерций. Пептид (i) связывается с рецептором фактора роста фибробластов 4 (FGFR4) c аффинностью, равной или большей, чем аффинность связывания FGF19 с FGFR4; (ii) активирует FGFR4 в степени или количестве, равном или большем, чем FGF19; (iii) обладает одним из пониженного образования гепатоцеллюлярной карциномы (ГЦК), повышенной активности в отношении снижения уровня глюкозы, пониженной активности в отношении увеличения уровня липидов, пониженной активности в отношении увеличения уровня триглицеридов, пониженной активности в отношении увеличения уровня холестерина, пониженной активности в отношении увеличения уровня не-ЛВП или ЛВП по сравнению с FGF19 или по сравнению с последовательностью варианта FGF19, где последовательность WGDPI в положениях аминокислот 16-20 FGF19 (SEQ ID NO:99) заменена любыми из GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP; и/или (iv) имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21. Также представлен способ модуляции гомеостаза желчных кислот. 4 н. и 146 з.п. ф-лы, 7 ил., 14 табл., 12 пр.

 

Перекрестная ссылка на родственные заявки

В настоящей заявке испрашивается преимущество заявки на патент США рег. No. 61/746499, поданной 27 декабря, 2012; заявки на патент США рег. No. 61/779604, поданной 13 марта 2013; и заявки на патент США рег. No. 61/887129, поданной 4 октября 2013, каждая из которых во всей своей полноте вводится в настоящее описание посредством ссылки.

Область, к которой относится изобретение

Настоящее изобретение относится к вариантам (и пептидомиметикам) белковых и пептидных последовательностей фактора роста фибробластов 19 (FGF19), к гибридам (и пептидомиметикам) белковых и пептидных последовательностей FGF19 и/или фактора роста фибробластов 21 (FGF21) и к вариантам гибридов (и пептидомиметиков) белковых и пептидных последовательностей FGF19 и/или FGF21, которые модулируют гомеостаз желчных кислот, а также к способам и применениям этих вариантов и гибридов для лечения расстройств, связанных и ассоциированных с желчными кислотами.

Введение

Желчные кислоты, то есть, стероидные кислоты, которые преобладают в желчи млекопитающих, регулируют гомеостаз холестерина, триглицеридов, глюкозы и энергии, и облегчают гидролиз и абсорбцию липидов в тонком кишечнике. Эмульгирование липидов и жирорастворимых витаминов в кишечнике способствует образованию мицелл, которые затем могут транспортироваться через систему млечных сосудов. Другими функциями желчных кислот являются запуск потока желчи, способствующей элиминации катаболитов из печени и снижению уровня бактериальной флоры, присутствующей в тонком кишечнике и в желчных путях. Желчные кислоты также участвуют в регуляции своего собственного синтеза и циркуляции веществ в кишечнике и печени. См., например, Staels et al, Diabetes Care (2009) vol. 32 no. suppl 2 S237-S245.

У человека, продуцирование желчных кислот происходит, главным образом, в перивенозных гепатоцитах посредством серии ферментативных реакций, которые обеспечивают превращение холестерина в желчные кислоты двух основных видов, такие как холевая кислота и хенодезоксихолевая кислота. Первичные желчные кислоты синтезируются по двум различным путям. В «классическом» или «нейтральном» пути, первичные желчные кислоты продуцируются посредством гидроксилирования холестерина в результате катализа под действием фермента цитохрома, то есть, холестерин-7α-гидроксилазы (cyp7a1), которая катализирует первую и скорость-ограничивающую стадию классического пути синтеза желчных кислот. (см., например, Inagaki et al., Cell Metabolism 2:217-25 (Oct. 2005)).

Как описано ниже, активность cyp7a1 ингибируется холевой кислотой и усиливается под действием холестерина, и таким образом, cyp7a1 регулируется самими желчными кислотами. Превращение холестерина в желчные кислоты осуществляется, главным образом, по этому пути. Кроме того, у большинства индивидуумов, приблизительно 6% желчных кислот синтезируется по «альтернативному» или «кислотному» пути. Этот путь регулируется ферментом cyp27al, который превращает оксистеролы в желчные кислоты. В отличие от cyp7a1, cyp27al не регулируется самими желчными кислотами.

Если холевая кислота и хенодезоксихолевая кислота секретируются в просвет кишечника, то кишечные бактерии осуществляют дегидроксилирование части каждой из этих кислот с образованием вторичных желчных кислот, таких как дезоксихолевая кислота (происходящая от холевой кислоты) и литохолевая кислота (происходящая от хенодезоксихолевой кислоты). В клетках печени может происходить конъюгирование этих четырех желчных кислот с одной из двух аминокислот, таких как глицин или таурин, с образованием всего восьми возможных конъюгированных желчных кислот, называемых солями желчных кислот. Таким образом, в целом, первичными желчными кислотами являются холевая кислота, хенодезоксихолевая кислота, гликохолевая кислота, таурохолевая кислота, дезоксихолевая кислота и литохолевая кислота. Все четыре этих желчных кислоты могут снова транспортироваться в кровоток, а затем возвращаться в печень и повторно секретироваться посредством циркуляции веществ в кишечнике и печени. См., например, Staels et al, Diabetes Care (2009) vol. 32 suppl. 2 S237-S245.

Первичные желчные кислоты (холевая кислота и хенодезоксихолевая кислота) синтезируются в печени, а вторичные желчные кислоты (дезоксихолевая кислота и литохолевая кислота) образуются под действием бактерий. Эти четыре желчных кислоты секретируются в просвет желчного канальца и аккумулируются в желчном пузыре в виде смешанных мицелл с фосфолипидами и холестерином. После приема пищи, холецистокинин стимулирует сокращение желчного пузыря, что приводит к высвобождению мицеллярных желчных кислот в просвет кишечника и стимуляции пищеварения. Циркуляция веществ в кишечнике и печени позволяет приблизительно 90-95%-ам желчных кислот реабсорбироваться из дистального отдела подвздошной кишки и транспортироваться обратно в печень, и такое поглощение и транспорт желчных кислот осуществляется, главным образом, перицентральными гепатоцитами. Приблизительно 5% желчных кислот, которые не реабсорбируются, выводятся через фекалии, а потеря определенного количества этих желчных кислот в дальнейшем будет восполняться благодаря синтезу желчных кислот в печени de novo. См., например, Rose et al, Cell Metabolism, 14:1, pp 123-130 (6 июля 2011).

Первичные желчные кислоты (хенодезоксихолевая кислота и холевая кислота) представляют собой физиологические лиганды/активаторы фарнезоид-X-рецептора (FXR), прегнан-X-рецептора (PXR) и конститутивного рецептора андростина (CAR), а литохолевая кислота представляет собой лиганд для рецептора витамина D (VDR) и рецептора TGR5, сопряженного с G-белком. FXR обнаруживает высокую селективность к желчным кислотам, и наоборот, PXR и CAR действуют на ряд рецепторов, осуществляющих гомеостаз липидов в комбинации с метаболизмом ксенобиотиков. FXR, PXR, CAR и TGR5 обладают синергической активностью, направленной на регуляцию гомеостаза липидов и глюкозы, и на расход энергии, а также на регуляцию чувствительности к инсулину в печени и в периферических органах. Желчные кислоты, если они используются в качестве поверхностно-активных веществ или детергентов, могут быть токсичными по отношению к клеткам, а размер пула желчных кислот строго регулируется в печени и в кишечнике, что способствует предупреждению аккумуляции цитотоксических веществ. При увеличении размера пула желчных кислот активируется механизм обратной связи, участвующий во взаимодействии некоторых ядерных рецепторов, включая FXR, что приводит к ингибированию синтеза желчных кислот de novo. См., например, Fiorucci et al, Prog. Lipid Res. 2010 Apr; 49(2): 171-85. Epub 2009 Dec 2.

Синтез желчных кислот в печени ингибируется гормоном FGF19. FGF19 секретируется из кишечника и передает сигналы в печень, направленные на подавление Cyp7a1. Для сравнения, активация FXR в кишечнике, обусловленная потоком желчных кислот через кишечник после приема пищи, также индуцирует экспрессию FGF19, который высвобождается эпителиальными клетками тонкого кишечника и попадает в кровоток, где он связывается с рецепторами FGF4 (FGFR4) гепатоцитов; и сигнал, передаваемый этими рецепторами FGFR4, подавляет синтез желчных кислот посредством активации пути NH2-терминальной киназы с-Jun (JNK). Подавление CYP7A1 приводит к снижению уровня синтеза желчных кислот из холестерина печени в соответствии с суточным циклом приема пищи.

Терапевтические показания

Как описано в настоящей заявке, нарушение гомеостаза желчных кислот может приводить к развитию или обострению ряда расстройств, включая холестаз, портосистемный анастомоз, болезнь Крона и микроваскулярную дисплазию печени. Кроме того, желчные кислоты играют определенную роль в модуляции метаболического синдрома, то есть, группы факторов риска развития сердечно-сосудистых заболеваний, которая включает ожирение внутренних органов, инсулинорезистентность, дислипидемию, повышение кровяного давления и гиперкоагуляцию. Таким образом, модуляция активности желчных кислот может давать ряд благоприятных терапевтических эффектов.

Расстройства, ассоциированные с действием липидов и глюкозы

Активация FXR под действием желчных кислот (или нестероидных синтетических агонистов FXR) приводит к снижению уровня триглицеридов в плазме и, как было показано, к снижению уровня глюкозы в крови у мышей с диабетом. Желчные кислоты могут также регулировать расход энергии по FXR-независимому пути у мышей благодаря активации рецептора TGR5, сопряженного с G-белком. Таким образом, модуляция активности FXR и метаболизма желчных кислот может давать терапевтический эффект при лечении, например, метаболического синдрома и диабета типа 2. См., например, Lefebvre et al, Physiol Rev. 2009 Jan;89(l): 147-91.

Синтез желчных кислот (наряду к резекцией подвздошной кишки) приводит к нарушению циркуляции желчных кислот в кишечнике и печени, к снижению уровня общего холестерина и холестерина ЛНП в плазме и к повышению уровней холестерина ЛВП, аполипопротеина (apo)-AI и триглицеридов. В результате прерывания возвращения желчных кислот в печень начинает активироваться экспрессия cyp7a1, что приводит к стимуляции превращения холестерина в желчные кислоты. Таким образом, агенты, которые секвестрируют желчные кислоты в кишечнике (например, холестирамин), предотвращают их реабсорбцию, что приводит, в качестве механизма компенсации, к переключению продуцирования большего количества эндогенного холестерина на продуцирование желчных кислот, что, в свою очередь, приводит к снижению уровня холестерина.

Истощение холестерина печени, обусловленное повышенной вариабельностью синтеза желчных кислот, приводит к повышению уровня экспрессии рецептора ЛНП в печени, что, в свою очередь, приводит к экспрессии рецептора ЛНП, ответственного за снижение уровня общего холестерина и холестерина ЛНП, продуцируемых посредством синтеза желчных кислот или в результате резекции подвздошной кишки. При этом считается, что FXR независимо регулирует метаболизм холестерина ЛВП и триглицеридов.

Как уже указывалось, было также обнаружено, что синтез желчных кислот ассоциируется с диабетом типа 2. На регуляцию уровня глюкозы может влиять ряд факторов, включая размер и состав пула желчных кислот, FXR-опосредуемые изменения уровня продуцирования глюкозы в печени и абсорбции глюкозы в кишечнике, эффекты, влияющие на периферическую чувствительность к инсулину, инкретиновые эффекты и расход энергии. Модуляция систеза желчных кислот может быть применена не только для лечения диабета, но также и для лечения преддиабета.

Малабсорбция желчных кислот и диарея

Избыточная концентрация желчных кислот в толстом кишечнике, вызываемая, например, малабсорбцией желчных кислот, является причиной развития хронической диареи. При поступлении большого количества желчных кислот в толстый кишечник, эти желчные кислоты стимулируют секрецию воды и подвижность тонкого кишечника, что приводит к развитию хронической диареи, то есть, состояния, которое называется диареей, вызываемой желчными кислотами (BAD). Более конкретно, при снижении уровней экспрессии веществ-переносчиков желчных кислот, тонкий кишечник функционирует менее эффективно в отношении реабсорбции желчных кислот (малабсорбция желчных кислот типа 1). Аналогичнным образом, если перистальтика кишечника нарушается в результате хирургической операции на органах желудочно-кишечного тракта, или если желчные кислоты подвергаются деконъюгированию в результате избыточного размножения бактерий в тонком кишечнике, то абсорбция становится менее эффективной (малабсорбция желчных кислот типа 3). Также существует очень небольшая группа пациентов, у которых не наблюдается каких-либо явных признаков заболевания (малабсорбция желчных кислот типа 2). (В общих чертах см., Walters et al, Clin. Gastroenterol Hepatol. 7: 1 189-94 (Nov 2009)).

Холестаз и первичный билиарный цирроз

Состояние холестаза вызывается острым или хроническим прерыванием экскреции желчи (например, в результате обструкции) в печень или из печени. Нарушение образования желчи приводит к прогрессирующему холестатическому поражению печени и к летальному исходу. Обструкция приводит к аккумуляции солей желчных кислот, пигмента билирубина желчи и липидов в кровотоке, вместо их обычной элиминации. Симптомами хронического холестаза являются изменение цвета кожи, рубцы или повреждения кожи, вызываемые расчесыванием, боли в костях, ксантома или ксантелазма. Пациенты с прогрессирующим холестазом чувствуют недомогания, быстро устают и часто ощущают тошноту. Абдоминальная боль и такие системные симптомы, как анорексия, рвота и высокая температура обычно обусловлены сопутствующим заболеванием, вызываемым холестазом.

Внутрипеченочный холестаз обычно вызывается гепатитом или лекарственными препаратами, которые дают симптомы, напоминающие гепатит. Агенты, которые являются производными фенотиазина, включая хлорпромазин, могут внезапно вызывать высокую температуру и воспаление, хотя после прекращения приема этих средств, такие симптомы обычно исчезают. В редких случаях, состояние, напоминающее хронический билиарный цирроз печени, обсуждаемый ниже, сохраняется даже после прекращения приема этих лекарственных средств. У некоторых пациентов наблюдается аналогичная реакция, например, в ответ на прием трициклических антидепрессантов (например, амитриптилина и имипрамина) и фенилбутазона. Внутрипеченочный холестаз может также вызываться другими причинами, включая алкогольное поражение печени, первичный билиарный цирроз и метастазы рака.

Для сравнения можно отметить, что имеется несколько причин развития внепеченочного холестаза, включая побочный эффект некоторых лекарственных препаратов, осложнения после хирургической операции, серьезные повреждения, инфекция, разрушающая ткань, или внутривенное (искусственное) питание. Внепеченочный холестаз может быть вызван такими состояниями, как опухоли и образование желчных камней, которые блокируют поток желчи из желчного пузыря в двенадцатиперстную кишку (например, желчных камней, закупоривающих общий желчный проток). Внепеченочный холестаз может также вызываться раком поджелудочной железы, а реже не-раковыми сужениями общего протока, карциномой протоков или расстройствами поджелудочной железы.

Симптомами внутрипеченочного и внепеченочного холестаза являются желтуха, темная моча и бледный стул. При прогрессировании такого состояния может наблюдаться сильный кожный зуд.

Внутрипеченочный холестаз беременных (ICP) часто развивается во втором и в третьем триместрах беременности и является второй самой распространенной причиной желтухи во время беременности. Хотя такие симптомы обычно исчезают через 2-4 недели после рождения ребенка, однако, они могут появляться снова при повторной беременности. Аналогичное состояние возникает у некоторых женщин, которые принимают пероральные контрацептивы, однако, после прекращения приема таких пероральных контрацептивов, эти симптомы исчезают.

Врожденное нарушение синтеза желчных кислот представляет собой редкое генетическое заболевание, которое иногда проявляется как холестаз новорожденных. Это заболевание характеризуется недостаточным продуцированием обычных желчных кислот и аккумуляцией редко встречающихся желчных кислот и промежуточных соединений желчных кислот. Такое врожденное нарушение синтеза, если оно не было диагностировано или было диагностировано ошибочно, может приводить к печеночной недостаточности или к прогрессирующему хроническому заболеванию печени.

Холестаз, индуцируемый лекарственными средствами, может возникать как осложнение при химиотерапии или при лечении другими лекарственными средствами. Индуцированный лекарственными средствами холестаз двух основных типов представляет собой идиосинкратические реакции и прямое токсическое поражение. Идиосинкратические реакции могут возникать в начале лечения или после лечения. Аллергические реакции могут варьироваться и не ассоциируются с количеством вводимого лекарственного препарата.

В случае прямого токсического поражения, тяжесть симптомов непосредственно зависит от количества вводимого лекарственного средства. Такое состояние развивается за короткий промежуток времени после начала лечения, имеет предсказуемый характер и обычно приводит к поражению печени. Прямые токсические реакции наблюдаются у 1% от всех пациентов, которые принимают хлорпромазин.

Редко встречающееся состояние, такое как доброкачественный наследственный рецидивирующий холестаз, характеризуется кратковременными повторяющимися приступами зуда и желтухи, однако, эти симптомы часто исчезают, а поэтому такое состояние не вызывает цирроз. (В общих чертах см., Rose et al, Cell Metabolism 14(1): 123-30 (July 2011).

Первичный билиарный цирроз печени (ПБЦ) представляет собой прогрессирующее заболевание печени, обусловленное, главным образом, аутоиммунной деструкцией желчных протоков, по которым желчные кислоты переносятся из печени, и такая деструкция приводит к холестазу. По мере прогрессирования заболевания, непрерывное образование токсических желчных кислот приводит к прогрессирующему поражению печени, характеризующемуся хроническим воспалением и фиброзом.

Хотя ПБЦ встречается редко, однако, он является наиболее распространенным холестатическим заболеванием печени и занимает пятое место среди всех заболеваний, при которых требуется трансплантация печени в США. У большинства пациентов с ПБЦ, при первоначальной диагностике, это заболевание протекает бессимптомно, но со временем, у них часто появляются такие симптомы, как усталость и зуд. При прогрессировании заболевания может возникать желтуха. Для подтверждения диагноза ПБЦ может быть проведена, но необязательно, биопсия печени, а для определения функции печени часто проводят мониторинг на билирубин. Повышение уровней ALP в сыворотке, то есть, фермента, высвобождаемого клетками печени в ответ на токсическое действие желчных кислот, обычно при тщательном наблюдении пациентов, является показателем ответа на лечение и прогностическим критерием.

Несмотря на прием урсодиола, то есть, стандартного средства для терапии ПБЦ, у значительного числа пациентов с запущенной формой ПБЦ наблюдается прогрессирующая печеночная недостаточность, требующая трансплантации печени, или приводящая к летальному исходу через 5-10 лет. В результате этого, в настоящее время требуется разработка альтернативных методов терапии. Одним из перспективных средств является OCA, то есть, аналог желчной кислоты и агонист FXR, происходящий от первичной человеческой желчной кислоты, а именно, хенодезоксихолевой кислоты, или CDCA. OCA обнаруживается у пациентов, у которых вырабатывается неадекватный терапевтический ответ на урсодиол, или у которых наблюдается непереносимость урсодиола (Intercept Pharmaceuticals, New York).

Первичный склерозирующий холангит

Первичный склерозирующий холангит представляет собой хронический фиброзирующий воспалительный процесс, который приводит к деструкции общей системы желчных протоков и к билиарному циррозу. Стриктуры (резкое сужение) наблюдаются как во внутрипеченочном, так и во внепеченочном протоках у более 80% пациентов, однако, приблизительно у 10% этих пациентов наблюдаются только внутрипеченочные стриктуры, а у менее 5% пациентов наблюдаются только внепеченочные стриктуры. Течение такого заболевания характеризуется ремиссиями и рецидивами. Хотя причина возникновения первичного склерозирующего холангита пока не ясна, однако, считается, что поражение желчных путей обусловлено одним или более генетическими нарушениями регуляции иммунной системы, вирусной инфекцией, токсинами, вырабатываемыми кишечными бактериями, присутствием бактерий в системе воротной вены, ишемическим повреждением сосудов и присутствием токсических желчных кислот, продуцируемых кишечными бактериями.

У большинства пациентов с первичным склерозирующим холангитом наблюдается сопутствующее воспалительное заболевание кишечника (язвенный колит или болезнь Крона). У таких пациентов чаще наблюдается язвенный колит, чем болезнь Крона (85% и 15%, соответственно), при этом, приблизительно 2,5-7,5% всех пациентов с язвенным колитом страдают первичным склерозирующим холангитом. У некоторых пациентов, первичный склерозирующий холангит может не проявляться в течение длительного периода времени, однако, в большенстве случаев, такое заболевание является прогрессирующим.

Заболеваемость первичным склерозирующим холангитом в США составляет приблизительно 1-6 случаев на 100000 человек, и чаще всего это заболевание встречается у людей индоевропейской расы. Приблизительно 75% пациентов с первичным склерозирующим холангитом являются мужчины, средний возраст которых на время установления диагноза составляет приблизительно 40 лет. Лечение этого заболевания на ранних стадиях включает назначение лекарственных средств для предупреждения прогрессирования заболевания. Эндоскопия и хирургическое вмешательство применяются лишь при появлении симптомов. В конечном счете, может потребоваться трансплантация печени, которая дает лишь шанс на полное выздоровление. У пациентов с первичным склерозирующим холангитом имеется высокий риск развития холангиокарциномы (10-15%).

У большинства пациентов с первичным склерозирующим холангитом отсутствуют какие-либо симптомы, и обычно такое заболевание диагностируется при обнаружении нарушения функций печени путем проведения биохимических анализов или рутинных анализов крови. Появление симптомов указывает на обструкцию потока желчи, и такими симптомами являются желтуха, зуд, боли в правом верхнем квадранте брюшной полости, высокая температура и озноб. Такими симптомами могут быть также потеря веса и усталость. У таких пациентов, данное заболевание даже в запущенной форме может протекать бессимптомно в течение многих лет, и появление симптомов обычно указывает на наличие у этих пациентов запущенного заболевания.

Диагноз

Малабсорбция желчных кислот может быть легко диагностирована путем проведения медицинского теста на наличие в ядре SeHCAT (23-селено-25-гомотаурохолевой кислоты (селен-содержащей гомохолевой кислоты, таурина или тауроселхолевой кислоты). Альтернативный диагностический тест включает измерение уровня 7-альфа-гидрокси-4-холестен-3-она, то есть, предшественника желчной кислоты в сыворотке.

Лечение

Секвестранты желчных кислот (например, холестирамин и колестипол в порошкообразной форме) являются основными средствами, используемыми для лечения малабсорбции желчных кислот. К сожалению, у многих пациентов наблюдается непероносимость холестирамина и колестипола, что часто обусловлено грубой структурой и неприятным вкусом полимерного порошка. К счастью, секвестрант желчных кислот, а именно, колесевелам, выпускается в форме таблеток, а поэтому, в большинстве случаев, он переносится гораздо лучше.

Все секвестранты желчных кислот способны связываться с другими соединениями, при этом также возможно, что при дефиците жирорастворимых витаминов (A, D, E и K) может потребоваться введение витаминных добавок.

Было также подтверждено, что заместительная и восстановительная терапия может быть применена для лечения некоторых расстройств, ассоциированных с гомеостазом желчных кислот. В случае заместительной терапии, состав желчных кислот в кровотоке заменяют либо для снижения цитотоксичности эндогенных желчных кислот, либо для модуляции метаболизма холестерина в целях снижения уровня секреции билиарного холестерина. И наоборот, восполнение желчных кислот осуществляют для компенсации дефицита желчных кислот.

Заместительная терапия

Было показано, что введение первичных желчных кислот, таких как хенодезоксихолевая кислота (CDCA), приводит к снижению уровня секреции билиарного холестерина и к постепенному растворению желчных камней. CDCA постепенно заменяют урсодезоксихолевой кислотой (UDCA), поскольку эта кислота не вызывает какой-либо гепатотоксичности. Хенодезоксихолевая кислота обладает слабой гепатотоксичностью у человека, но она обладает высокой гепатотоксичностью у некоторых животных. Несмотря на эффективность и безопасность введения UDCA, которая способствует растворению холестерина желчных камней, эта кислота в настоящее время используется не часто, благодаря успеху лапароскопической холецистэктомии, которая обеспечивает быстрое устранение симптоматического заболевания. В противоположность этому, для успешной медикаментозной терапии требуются месяцы, и при этом, она не всегда приводит к растворению камней, а у некоторых пациентов может даже периодически вызывать рецидивы.

Было показано, что UDCA-терапия улучшает результаты печеночных тестов у пациентов с первичным билиарным циррозом, и этот эффект, очевидно, обусловлен множеством механизмов. Было также показано, что UDCA-терапия дает благоприятные эффекты при лечении других холестатических состояний, таких как холестаз, ассоциированный с беременностью, и холестаз, ассоциированный с общим парентеральным питанием.

Восстановительная терапия

Восполнение желчных кислот осуществляют в случае врожденного нарушения биосинтеза желчных кислот, обычно путем введения смеси хенодезоксихолевой кислоты (CDCA) или урсодезоксихолевой кислоты (UDCA) и холевой кислоты, в целях подавления синтеза цитотоксических предшественников желчных кислот и восстановления подачи первичных желчных кислот в кишечнопеченочный кровоток.

У пациентов с синдромом укороченной тонкой кишки, дефицит желчных кислот наблюдается в проксимальном отделе тонкой кишки, что приводит к нарушению мицеллярной солюбилизации. Такой дефицит, наряду с уменьшенной площадью поверхности и быстрым прохождением через кишечник, приводит к тяжелой малабсорбции жира. Было показано, что холилсаркозин (холил-N-метилглицин), то есть, синтетичесий аналог желчных кислот, способствует повышению уровня абсорбции липидов у пациента с синдромом укороченной тонкой кишки и является резистентным к деконъюгированию и к дегидроксилированию.

Пациенты с диареей, вызываемой желчными кислотами и возникающей на фоне илеита Крона, нуждаются в лечении глюкокортикоидами, причем, стероидами также лечат микроскопический колит. В некоторых случаях может оказаться эффективным введение будезонида и других агентов, включая антибиотики.

Как подробно описано выше, лечение ПБЦ, в основном, включает введение урсадиола, хотя пациентам, у которых наблюдается неадекватный терапевтический ответ на урсодиол, или у которых наблюдается непероносимость урсодиола, может быть проведена альтернативная терапия.

В соответствии с этим, необходимо разработать способ лечения расстройств, вызываемых желчными кислотами, таких как вышеупомянутые расстройства, которыми являются, но не ограничиваются ими, метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с нарушением метаболизма холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный билиарный цирроз (ПБЦ); первичный наследственный внутрипеченочный холестаз (ПНВХ) (например, прогрессирующий ПНВХ); первичный склерозирующий холангит (ПСХ); внутрипеченочный холестаз беременных (ВХБ); холестаз новорожденных; холестаз, индуцированный лекарственными средствами (например, эстрогеном); заболевания, ассоциированные с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ, а также рак ЖКТ, рак печени, и/или рак желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены, например, у млекопитающих, таких как человек. Настоящее изобретение удовлетворяет указанным требованиям и позволяет достичь соответствующих благоприятных эффектов.

Краткое описание изобретения

Настоящее изобретение частично основано на использовании вариантов пептидных последовательностей FGF19, гибридов пептидных последовательностей FGF19 и/или FGF21 и вариантов гибридов (химер) пептидных последовательностей FGF19 и/или FGF21, обладающих одной или более активностями, такими как активность, направленная на модуляцию гомеостаза желчных кислот. Такими вариантами и гибридами (химерами) пептидных последовательностей FGF19 и/или FGF21 являются последовательности, используемые для лечения расстройства, связанного или ассоциированного с действием желчных кислот. Такими вариантами и гибридами (химерами) пептидных последовательностей FGF19 и/или FGF21 также являются последовательности, которые, по существу или в основном, не стимулируют или не индуцируют образование гепатоцеллюлярной карциномы (ГЦК) или онкогенез ГЦК. Такими вариантами и гибридами (химерами) пептидных последовательностей FGF19 и/или FGF21 также являются последовательности, которые не индуцируют значительного повышения или увеличения уровня липидов.

В одном из вариантов осуществления изобретения, способ или применение модуляции гомеостаза желчных кислот или лечение расстройства, связанного или ассоциированного с действием желчных кислот, включает введение химерной пептидной последовательности, содержащей: a) N-концевую область, включающую по меньшей мере семь аминокислотных остатков; где указанная N-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет последовательность DSSPL или DASPH; и b) C-концевую область, содержащую часть SEQ ID NO:99 [FGF19], где указанная C-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет аминокислотные остатки 16-29 последовательности SEQ ID NO:99 [FGF19] (WGDPIRLRHLYTSG; SEQ ID NO:169), где остаток W соответствует положению первой аминокислоты указанной С-концевой области, где указанное введение осуществляют в целях модуляции гомеостаза желчных кислот или лечения расстройства, связанного или ассоциированного с действием желчных кислот.

В другом варианте осуществления изобретения, способ или применение модуляции гомеостаза желчных кислот или лечение расстройства, связанного или ассоциированного с действием желчных кислот, включает введение химерной пептидной последовательности, содержащей: a) N-концевую область, включающую часть SEQ ID NO:100 [FGF21], где N-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет аминокислотные остатки GQV, и где остаток V соответствует положению последней аминокислоты N-концевой области; и b) C-концевую область, содержащую часть SEQ ID NO:99 [FGF19], где указанная C-концевая область имеет, от положения первой аминокислоты до положения последней аминокислоты, аминокислотные остатки 21-29 последовательности SEQ ID NO:99 [FGF19], RLRHLYTSG (SEQ ID NO:185), и где остаток R соответствует положению первой аминокислоты C-концевой области; где указанное введение осуществляют в целях модуляции гомеостаза желчных кислот или лечения расстройства, связанного или ассоциированного с действием желчных кислот.

В другом варианте осуществления изобретения, способ или применение модуляции гомеостаза желчных кислот или лечение расстройства, связанного или ассоциированного с действием желчных кислот, включает введение химерной пептидной последовательности, содержащей: a) N-концевую область, включающую часть SEQ ID NO:100 [FGF21], где указанная N-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет по меньшей мере 5 смежных аминокислот SEQ ID NO:100 [FGF21], включая аминокислотные остатки GQV, где остаток V соответствует положению последней аминокислоты N-концевой области; и b) C-концевую область, содержащую часть SEQ ID NO:99 [FGF19], где указанная C-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет аминокислотные остатки 21-29 последовательности SEQ ID NO:99 [FGF19], RLRHLYTSG (SEQ ID NO:185), и где остаток R соответствует положению первой аминокислоты C-концевой области; где указанное введение осуществляют в целях модуляции гомеостаза желчных кислот или лечения расстройства, связанного или ассоциированного с действием желчных кислот.

В другом варианте осуществления изобретения, способ или применение модуляции гомеостаза желчных кислот или лечение расстройства, связанного или ассоциированного с действием желчных кислот, включает введение пептидной последовательности, содержащей или состоящей из них: a) вариант последовательности FGF19, имеющий одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF19 или последовательностью FGF19 дикого типа; b) вариант последовательности FGF21, имеющий одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF21 или последовательностью FGF21 дикого типа; c) часть последовательности FGF19, присоединенную к части последовательности FGF21; или d) часть последовательности FGF19, присоединенную к части последовательности FGF21, где часть(и) последовательности FGF19 и/или FGF21 имеет(ют) одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF19 и/или FGF21 или с последовательностью FGF19 и/или FGF21 дикого типа; где указанное введение осуществляют в целях модуляции гомеостаза желчных кислот или лечения расстройства, связанного или ассоциированного с действием желчных кислот.

В различных конкретных вариантах осуществления изобретения, химерная пептидная последовательность имеет N-концевую область, содержащую по меньшей мере 6 смежных аминокислот SEQ ID NO:100 [FGF21], включая аминокислотные остатки GQ; или N-концевую область, содержащую по меньшей мере 7 смежных аминокислот SEQ ID NO:100 [FGF21], включая аминокислотные остатки GQV.

В различных дополнительных вариантах осуществления изобретения, пептидная последовательность имеет амино-концевые аминокислоты 1-16 SEQ ID NO:100 [FGF21], присоединенные к карбокси-концевым аминокислотам 21-194 SEQ ID NO:99 [FGF19], либо пептидная последовательность имеет амино-концевые аминокислоты 1-147 SEQ ID NO:99 [FGF19], присоединенные к карбокси-концевым аминокислотам 147-181 SEQ ID NO:100 [FGF21] (M41), либо пептидная последовательность имеет амино-концевые аминокислоты 1-20 SEQ ID NO:99 [FGF19], присоединенные к карбокси-концевым аминокислотам 17-181 SEQ ID NO:100 [FGF21] (M44), либо пептидная последовательность имеет амино-концевые аминокислоты 1-146 SEQ ID NO:100 [FGF21], присоединенные к карбокси-концевым аминокислотам 148-194 SEQ ID NO:99 [FGF19] (M45), либо пептидная последовательность имеет амино-концевые аминокислоты 1-20 SEQ ID NO:99 [FGF19], присоединенные к внутренним аминокислотам 17-146 SEQ ID NO:100 [FGF21] или к карбокси-концевым аминокислотам 148-194 SEQ ID NO:99 [FGF19] (M46).

В различных других вариантах осуществления изобретения, пептидная последовательность имеет по меньшей мере одну аминокислотную замену на аминокислотные остатки 125-129 SEQ ID NO:99 [FGF19], EIRPD; по меньшей мере одну аминокислотную замену на аминокислотные остатки 126-128 SEQ ID NO:99 [FGF19], IRP; или по меньшей мере одну аминокислотную замену на аминокислотные остатки 127-128 SEQ ID NO:99 [FGF19], RP, или по меньшей мере одну аминокислотную замену на аминокислотные остатки 1-124 SEQ ID NO:99 [FGF19] и/или на аминокислотные остатки 130-194 SEQ ID NO:99 [FGF19]. Более конкретно, например, пептидная последовательность имеет замену на один из аминокислотных остатков 127-128 SEQ ID NO:99 [FGF19], IRP, где по меньшей мере одной аминокислотной заменой является R127L или P128E.

Способы и применения настоящего изобретения могут быть осуществлены с использованием описанной здесь пептидной или химерной последовательности. Так, например, такой последовательностью является последовательность, которая включает любую пептидную последовательность, или состоит из этой пептидной последовательности, представленную здесь как M1-M98 или M101-M160, или SEQ ID NN: 1-98, 101-135 или 138-196; пептидная последовательность, которая включает любую последовательность, или состоит из этой последовательности, представленную в таблицах 1-10; или пептидная последовательность, которая включает любую последовательность, или состоит из этой пептидной последовательности, представленную здесь в Списке последовательностей.

Способы и применения настоящего изобретения могут быть осуществлены с использованием пептидной или химерной последовательности, имеющей любую подходящую длину. В конкретных вариантах осуществления изобретения, N-концевая или С-концевая область пептидной или химерной последовательности имеет длину приблизительно от 20 до 200 аминокислотных остатков. В других конкретных аспектах изобретения, пептидная или химерная последовательность имеет 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 или более аминокислотных делеций у амино-конца, карбокси-конца или во внутренней области. В других конкретных вариантах осуществления изобретения, пептидная или химерная последовательность имеет N-концевую область или C-концевую область, которая включает аминокислотную последовательность или состоит из аминокислотной последовательности, имеющей приблизительно 5-10, 10-20, 20-30, 30-40, 40-50, 60-70, 70-80, 80-90, 90-100 или более аминокислот. В других более конкретных вариантах осуществления изобретения, пептидная или химерная последовательность имеет часть последовательности FGF19 или часть последовательности FGF21, которая включает аминокислотную последовательность или состоит из аминокислотной последовательности, имеющей приблизительно 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100 или более аминокислот FGF19 или FGF21.

В различных аспектах изобретения, пептидная последовательность имеет: мотив последовательности WGDPI (SEQ ID NO:170), соответствующий последовательности WGDPI аминокислот 16-20 SEQ ID NO:99 [FGF19]; замену, мутацию или делецию мотива последовательности WGDPI (SEQ ID NO:170), соответствующего последовательности WGDPI FGF19 (SEQ ID NO:170) и состоящего из аминокислот 16-20 FGF19; последовательность WGDPI (SEQ ID NO:170) с одной или более аминокислотными заменами, мутациями или делециями. В различных других аспектах изобретения, пептидная последовательность отличается от последовательности варианта FGF19 тем, что в ней последовательность WGDPI FGF19 (SEQ ID NO:170) в положениях аминокислот 16-20 заменена любой из последовательностей из GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184).

В различных других аспектах изобретения, N-концевая область содержит аминокислотные остатки VHYG (SEQ ID NO:101), где указанная N-концевая область содержит аминокислотные остатки DASPHVHYG (SEQ ID NO:102), либо указанная N-концевая область содержит аминокислотные остатки DSSPLVHYG (SEQ ID NO:103). Более конкретно, в одном из аспектов изобретения, остаток G соответствует остатку в последнем положении N-концевой области.

В различных дополнительных аспектах изобретения, N-концевая область содержит аминокислотные остатки DSSPLLQ (SEQ ID NO:104), где остаток Q представляет собой аминокислоту в последнем положении N-концевой области, или аминокислотные остатки DSSPLLQFGGQV (SEQ ID NO:105), где остаток V соответствует остатку в последнем положении N-концевой области.

Более конкретно, N-концевая область также включает: RHPIP (SEQ ID NO:106), где R представляет собой аминокислоту в первом положении N-концевой области; или HPIP (SEQ ID NO:107), где H представляет собой собой аминокислоту в первом положении N-концевой области; или RPLAF (SEQ ID NO:108), где R представляет собой аминокислоту в первом положении N-концевой области; или PLAF (SEQ ID NO:109), где P представляет собой аминокислоту в первом положении N-концевой области; или R, где R представляет собой аминокислоту в первом положении N-концевой области.

В различных других аспектах изобретения, пептидная или химерная последовательность имеет аминокислотные остатки HPIP (SEQ ID NO:107), которые представляют собой первые 4 аминокислотных остатка N-концевой области. В различных других аспектах изобретения, пептидная или химерная последовательность имеет: остаток R в первом положении N-концевой области; или остаток М в первом положении N-концевой области; или последовательность MR в первом и втором положениях N-концевой области; или последовательность RM в первом и втором положениях N-концевой области; или последовательность RD в первом и втором положениях N-концевой области; или последовательность DS в первом и втором положениях N-концевой области; или последовательность MD в первом и втором положениях N-концевой области; или последовательность MS в первом и втором положениях N-концевой области; или последовательность MDS в 1-3 положениях N-концевой области; или последовательность RDS в 1-3 положениях N-концевой области; или последовательность MSD в 1-3 положениях N-концевой области; или последовательность MSS в 1-3 положениях N-концевой области; или последовательность DSS в 1-3 положениях N-концевой области; или последовательность RDSS (SEQ ID NO:115) в 1-4 положениях N-концевой области; или последовательность MDSS (SEQ ID NO:116) в 1-4 положениях N-концевой области; или последовательность MRDSS (SEQ ID NO:117) в 1-5 положениях N-концевой области; или последовательность MSSPL (SEQ ID NO:113) в 1-5 положениях N-концевой области; или последовательность MDSSPL (SEQ ID NO:110) в 1-6 положениях N-концевой области; или последовательность MSDSSPL (SEQ ID NO:111) в 1-7 положениях N-концевой области.

В различных других конкретных аспектах изобретения, пептидная или химерная последовательность имеет N-концевую область, в которой аминокислотным остатком в первом положении является остаток «M», остаток «R», остаток «S», остаток «H», остаток «P», остаток «L» или остаток «D». В различных альтернативных конкретных аспектах изобретения, пептидная или химерная последовательность не имеет остатка «M» или остатка «R» в первом положении N-концевой области.

В различных других аспектах изобретения, пептидная или химерная последовательность имеет N-концевую область, содержащую любую из нижеследующих последовательностей: MDSSPL (SEQ ID NO:1 10), MSDSSPL (SEQ ID NO:111), SDSSPL (SEQ ID NO:112), MSSPL (SEQ ID NO:113) или SSPL (SEQ ID NO:114).

В различных дополнительных аспектах изобретения, пептидная или химерная последовательность имеет остаток в последнем положении С-концевой области, который приблизительно соответствует остатку 194 SEQ ID NO:99 [FGF19].

В различных более конкретных аспектах изобретения, пептидная последовательность имеет любую из нижеследующих последовательностей или состоит из этих последовательностей:

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M3) (SEQ ID NO:3);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIREDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M140) (SEQ ID NO:194);

RPLAFSDAGPHVHYGWGDPIRQRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M160) (SEQ ID NO:196);

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M69) (SEQ ID NO:69);

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M52) (SEQ ID NO:52);

RHPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M5) (SEQ ID NO:5);

HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M5-R) (SEQ ID NO:160);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHSLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (M71) (SEQ ID NO:71);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (M72) (SEQ ID NO:72);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVVQDELQGVGGEGCHMHPENCKTLLTDIDRTHTEKPVWDGITGE (M73) (SEQ ID NO:73);

RPLAFSDASPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M1) (SEQ ID NO:1 или 139);

RPLAFSDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M2) (SEQ ID NO:2 или 140);

RDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M48) (SEQ ID NO:48 или 6 или 148);

RPLAFSDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M49) (SEQ ID NO:49 или 7 или 149);

RHPIPDSSPLLQFGDQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M50) (SEQ ID NO:50);

RHPIPDSSPLLQFGGNVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M51) (SEQ ID NO:51 или 36 или 155);

MDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M53) (SEQ ID NO:192);

MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDS16MDPFGLVTGLEAVRSPSFEK (M70) (SEQ ID NO:70);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M139) (SEQ ID NO:193); или

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILCDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M141) (SEQ ID NO:195);

или подпоследовательности или фрагмента любой из вышеуказанных пептидных последовательностей. В некоторых вариантах любой из вышеуказанных пептидных последовательностей, концевой остаток R был делетирован.

В различных дополнительных конкретных аспектах изобретения, N-конец пептидной последовательности включает любую из нижеследующих последовательностей или состоит из этих последовательностей:

HPIPDSSPLLQFGGQVRLRHLYTSG (M5-R) (аминокислоты 1-25 SEQ ID NO:160);

DSSPLLQFGGQVRLRHLYTSG (M6-R) (аминокислоты 2-22 SEQ ID NO:6);

RPLAFSDSSPLLQFGGQVRLRHLYTSG (M7) (аминокислоты 1-27 SEQ ID NO:7);

HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (аминокислоты 2-26 SEQ ID NO:8);

HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (аминокислоты 2-28 SEQ ID NO:9);

HPIPDSSPHVHYGWGDPIRLRHLYTSG (M10-R) (аминокислоты 2-28 SEQ ID NO:10);

RPLAFSDAGPLLQWGDPIRLRHLYTSG (M11) (аминокислоты 1-27 SEQ ID NO:11);

RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (аминокислоты 1-29 SEQ ID NO:12);

RPLAFSDAGPLLQFGGQVRLRHLYTSG (M13) (аминокислоты 1-27 SEQ ID NO:13);

HPIPDSSPHVHYGGQVRLRHLYTSG (M14-R) (аминокислоты 2-26 SEQ ID NO:14);

RPLAFSDAGPHVHYGGQVRLRHLYTSG (M15) (аминокислоты 1-27 SEQ ID NO:15);

RPLAFSDAGPHVHWGDPIRLRHLYTSG (M16) (аминокислоты 1-27 SEQ ID NO:16);

RPLAFSDAGPHVGWGDPIRLRHLYTSG (M17) (аминокислоты 1-27 SEQ ID NO:17);

RPLAFSDAGPHYGWGDPIRLRHLYTSG (M18) (аминокислоты 1-27 SEQ ID NO:18);

RPLAFSDAGPVYGWGDPIRLRHLYTSG (M19) (аминокислоты 1-27 SEQ ID NO:19);

RPLAFSDAGPVHGWGDPIRLRHLYTSG (M20) (аминокислоты 1-27 SEQ ID NO:20);

RPLAFSDAGPVHYWGDPIRLRHLYTSG (M21) (аминокислоты 1-27 SEQ ID NO:21);

RPLAFSDAGPHVHGWGDPIRLRHLYTSG (M22) (аминокислоты 1-27 SEQ ID NO:22);

RPLAFSDAGPHHGWGDPIRLRHLYTSG (M23) (аминокислоты 1-27 SEQ ID NO:23);

RPLAFSDAGPHHYWGDPIRLRHLYTSG (M24) (аминокислоты 1-27 SEQ ID NO:24);

RPLAFSDAGPHVYWGDPIRLRHLYTSG (M25) (аминокислоты 1-27 SEQ ID NO:25);

RPLAFSDSSPLVHWGDPIRLRHLYTSG (M26) (аминокислоты 1-27 SEQ ID NO:26);

RPLAFSDSSPHVHWGDPIRLRHLYTSG (M27) (аминокислоты 1-27 SEQ ID NO:27);

RPLAFSDAGPHVWGDPIRLRHLYTSG (M28) (аминокислоты 1-26 SEQ ID NO:28);

RPLAFSDAGPHVHYWGDPIRLRHLYTSG (M29) (аминокислоты 1-28 SEQ ID NO:29);

RPLAFSDAGPHVHYAWGDPIRLRHLYTSG (M30) (аминокислоты 1-29 SEQ ID NO:30);

RHPIPDSSPLLQFGAQVRLRHLYTSG (M31) (аминокислоты 1-26 SEQ ID NO:31);

RHPIPDSSPLLQFGDQVRLRHLYTSG (M32) (аминокислоты 1-26 SEQ ID NO:32);

RHPIPDSSPLLQFGPQVRLRHLYTSG (M33) (аминокислоты 1-26 SEQ ID NO:33);

RHPIPDSSPLLQFGGAVRLRHLYTSG (M34) (аминокислоты 1-26 SEQ ID NO:34);

RHPIPDSSPLLQFGGEVRLRHLYTSG (M35) (аминокислоты 1-26 SEQ ID NO:35);

RHPIPDSSPLLQFGGNVRLRHLYTSG (M36) (аминокислоты 1-26 SEQ ID NO:36);

RHPIPDSSPLLQFGGQARLRHLYTSG (M37) (аминокислоты 1-26 SEQ ID NO:37);

RHPIPDSSPLLQFGGQIRLRHLYTSG (M38) (аминокислоты 1-26 SEQ ID NO:38);

RHPIPDSSPLLQFGGQTRLRHLYTSG (M39) (аминокислоты 1-26 SEQ ID NO:39);

RHPIPDSSPLLQFGWGQPVRLRHLYTSG (M40) (аминокислоты 1-28 SEQ ID NO:40);

DAGPHVHYGWGDPIRLRHLYTSG (M74-R) (аминокислоты 2-24 SEQ ID NO:74);

VHYGWGDPIRLRHLYTSG (M75-R) (аминокислоты 2-19 SEQ ID NO:75);

RLRHLYTSG (M77-R) (аминокислоты 2-10 SEQ ID NO:77);

RHPIPDSSPLLQFGWGDPIRLRHLYTSG (M9) (аминокислоты 1-28 SEQ ID NO:9);

RHPIPDSSPLLQWGDPIRLRHLYTSG (M8) (аминокислоты 1-26 SEQ ID NO:8);

RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (аминокислоты 1-29 SEQ ID NO:12);

RHPIPDSSPHVHYGWGDPIRLRHLYTSG (M10) (аминокислоты 1-28 SEQ ID NO:10);

RPLAFSDAGPLLQFGGQVRLRHLYTSG (M13) (аминокислоты 1-27 SEQ ID NO:13);

RHPIPDSSPHVHYGGQVRLRHLYTSG (M14) (аминокислоты 1-26 SEQ ID NO:14);

RPLAFSDAGPHVHYGGDIRLRHLYTSG (M43) аминокислоты 1-27 SEQ ID NO:43); или

RDSSPLLQFGGQVRLRHLYTSG (M6) (аминокислоты 1-22 SEQ ID NO:6).

В различных других конкретных аспектах изобретения, пептидная последовательность включает нижеследующие последовательности или состоит из нижеследующих последовательностей:

HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:160);

DSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:138 или 161);

RPLAFSDASPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:1 или 139);

RPLAFSDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK(SEQ ID NO:2 или 140); или

DSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:141);

или подпоследовательности или фрагменты любой из вышеуказанных пептидных последовательностей. В некоторых вариантах любой из вышеуказанных пептидных последовательностей, концевой остаток R был делетирован.

В различных других конкретных аспектах изобретения, к пептидной последовательности присоединяют дополнительные аминокислотные остатки 30-194 SEQ ID NO:99 [FGF19] у C-конца, что приводит к образованию химерного полипептида.

В различных других вариантах осуществления изобретения, пептидная или химерная последовательность имеет аминокислотные замену, добавление или инсерцию, либо она представляет собой подпоследовательность, в которой по меньшей мере одна аминокислота является делетированной. Такая пептидная последовательность может иметь 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более замен, добавлений, инсерций и делеций аминокислотных остатков (10-20, 20-30, 30-40, 40-50 и т.п.), например, у N- или C-конца или во внутренней области. Так, например, подпоследовательность имеет 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 или более делеций аминокислот у амино-конца, карбокси-конца или во внутренней области. В конкретном аспекте изобретения, аминокислотная замена или делеция присутствует в любом из положений аминокислот 8-20 FGF19 (AGPHVHYGWGDPI) (SEQ ID NO:187).

В различных более конкретных аспектах изобретения, пептидная или химерная последовательность включает всю представленную ниже последовательность FGF19:

PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPE EPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188), или ее часть, расположенные у С-конца пептида, либо в этих последовательностях, остаток «R» у амино-конца был делетирован.

В различных вариантах осуществления изобретения, пептидная или химерная последовательность имеет более высокую или более низкую функцию или активность по сравнению с исходной последовательностью. В конкретных вариантах осуществления изобретения, пептидная последовательность имеет пониженную способность к образованию ГЦК по сравнению с FGF19 или с вариантом последовательности FGF19, в которой, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); или повышенную активность, направленную на снижение уровня глюкозы, по сравнению с FGF19 или с вариантом последовательности FGF19, в которой, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); или пониженную активность в отношении повышения уровня липидов по сравнению с FGF19 или с вариантом последовательности FGF19, в которой, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); или пониженную активность в отношении повышения уровня триглицеридов, холестерина, не-ЛВП или ЛВП по сравнению с FGF19 или с вариантом последовательности FGF19, в которой, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); либо указанная пептидная последовательность обладает более низкой активностью, направленной на снижение потери массы, по сравнению с последовательностью FGF21. Такие функции и активности могут быть определены in vitro или in vivo, например, у мышей db/db.

В других различных вариантах осуществления изобретения, пептидная или химерная последовательность влияет на функцию или активность других молекул. В одном из аспектов изобретения, пептидная последовательность способствует сохранению или повышению FGFR4-опосредуемой активности. В другом аспекте изобретения, пептидная последовательность связывается с рецептором фактора роста фибробластов 4 (FGFR4) или активирует FGFR4, либо она не связывается с FGFR4 или не активирует FGFR4 на детектируемом уровне. В другом аспекте изобретения, пептидная последовательность связывается с FGFR4 с меньшей, сравнимой или с большей аффинностью, чем аффинность связывания FGF19 с FGFR4. В другом аспекте изобретения, пептидная последовательность активирует FGFR4 на более низком, сравнимом или более высоком уровне, чем FGF19.

В других различных вариантах осуществления изобретения, пептидная или химерная последовательность включает одну или более аминокислот, таких как L-аминокислоты, D-аминокислоты, не-природные аминокислоты или аминокислотные миметики, производные или аналоги. В других различных вариантах осуществления изобретения, пептидная или химерная последовательность имеет N-концевую область или С-концевую область, или часть последовательности FGF19 или часть последовательности FGF21, связанные посредством линкера или спейсера.

В других дополнительных вариантах осуществления изобретения, химерная или пептидная последовательность входит в фармацевтическую композицию, которая, в свою очередь, может быть использована в способах и применениях настоящего изобретения. Такие композиции включают комбинации неактивного ингредиента или других активных ингредиентов. В одном из вариантов осуществления изобретения, композиция, такая как фармацевтическая композиция, включает химерную пептидную последовательность или пептидную последовательность и агент, способствующие улучшению гомеостаза желчных кислот.

Настоящее изобретение также относится к применениям и способам лечения, которые включают введение или доставку химерной пептидной последовательность или пептидной последовательности. В конкретных вариантах осуществления изобретения, применение или способ лечения индивидуума включает введение химерной пептидной последовательность или пептидной последовательности согласно изобретению индивидууму, такому как индивидуум, страдающий расстройством или имеющий риск развития у него расстройства, которое может быть подвергнуто лечению пептидной последовательностью согласно изобретению, в количестве, эффективном для лечения указанного расстройства. В другом варианте осуществления изобретения, указанный способ или указанное применение включает введение химерной пептидной последовательность или пептидной последовательности согласно изобретению индивидууму, такому как индивидуум, страдающий расстройством, связанным или ассоциированным с действием желчных кислот.

В конкретных аспектах способов и применений настоящего изобретения, химерную пептидную последовательность или пептидную последовательность вводят индивидууму в количестве, эффективном для улучшения или обеспечения гомеостаза желчных кислот. Неограничивающими примерами расстройств, которые связаны или ассоциированы с действием желчных кислот, и которые могут быть подвергнуты лечению в соответствии с описанными здесь способами и применениями настоящего изобретения, являются метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); заболевания, ассоциированные с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены. В одном из вариантов осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является малабсорбция желчных кислот. В другом варианте осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является диарея. В другом варианте осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является холестаз (например, внутрипеченочный или внепеченочный холестаз). В другом варианте осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является перичный билиарный цирроз. В другом варианте осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является перичный склерозирующий холангит. В другом варианте осуществления изобретения, расстройством, связанным или ассоциированным с действием желчных кислот, является ПНВХ (например, прогрессирующий ПНВХ).

Настоящее изобретение также относится к способам и применениям анализа и/или идентификации химерной пептидной последовательность или пептидной последовательности, такой как химерные пептидные последовательности и пептидные последовательности, которые модулируют гомеостаз желчных кислот, но при этом обладают, но необязательно, высокой или статистически значимой активностью в отношении образования ГЦК. В одном из вариантов осуществления изобретения, способ или применение включают: a) получение последовательности пептида-кандидата; b) введение последовательности пептида-кандидата тестируемому животному; c) измерение уровней желчных кислот у животного после введения ему последовательности пептида-кандидата в целях определения способности последовательности модулировать гомеостаз желчных кислот; и d) анализ последовательности пептида-кандидата на индуцирование развития ГЦК у животного, или анализ на экспрессию маркера, коррелирующего с активностью в отношении образования ГЦК. Пептид-кандидат, который модулирует гомеостаз желчных кислот, но не обладает значительной активностью в отношении образования ГЦК, может быть идентифицирован как пептидная последовательность, которая модулирует гомеостаз желчных кислот, но не обладает значительной активностью в отношении образования ГЦК.

В конкретном аспекте изобретения, химерную пептидную последовательность или пептидную последовательность также анализируют на способность индуцировать образование ГЦК у животного (например, оценивают образец ткани печени, взятой у тестируемого животного) или на экспрессию маркера, коррелирующего с активностью в отношении образования ГЦК. Такие способы и применения позволяют идентифицировать данного кандидата как кандидата, обладающего активностью в отношении модуляции гомеостаза желчных кислот, но при этом обладающего, но необязательно, высокой или значимой активностью в отношении образования ГЦК.

Описание графического материала

На фиг. 1 показана экспрессия cyp7a1 у мышей db/db, которым были внутрибрюшинно введены дозы FGF19 и FGF21 (SEQ ID NN:99 и 100) в указанных концентрациях.

На фиг. 2A-2D показана экспрессия cyp7a1 в человеческих первичных гепатоцитах после введения дозы A) варианта Ml (SEQ ID NO:1); B) варианта M2 (SEQ ID NO:2); C) варианта M5 (SEQ ID NO:5); и D) варианта M32 (SEQ ID NO:32).

На фиг. 3A-3D показана экспрессия cyp7a1 в человеческих первичных гепатоцитах после введения дозы A) варианта M69 (SEQ ID NO:69); B) варианта M75 (SEQ ID NO:75); C) варианта M70 (SEQ ID NO:70); и D) варианта M76 (SEQ ID NO:76).

На фиг. 4A-4D показана экспрессия cyp7a1 в человеческих первичных гепатоцитах после введения дозы A) варианта M85 (SEQ ID NO:85); B) варианта M96 (SEQ ID NO:96); C) варианта M90 (SEQ ID NO:90); и D) варианта M98 (SEQ ID NO:98).

На фиг. 5 представлена таблица, в которой указаны IC50 cyp7a1 (пМ), относительный уровень экспрессии cyp7a1 и оценка образования ГЦК для указанных вариантов: Ml, M2, M5, M32, M69, M70, M75, M76, M85, M90, M96 и M98.

На фиг. 6 представлены результаты клинического испытания с участием человека, указывающие на то, что введение M70 приводит к ингибированию 7a-гидрокси-4-холестен-3-она (C4), то есть, маркера синтеза желчных кислот, по сравнению с введением плацебо.

На фиг. 7 показано, что экспрессия комплекса FGFR4/β-klotho в клетках L6 повышает активность путей передачи внутриклеточного сигнала под действием FGF19, M3 и M70.

Подробное описание изобретения

Настоящее изобретение относится к химерным и пептидным последовательностям, которые модулируют гомеостаз желчных кислот и могут быть использованы для лечения расстройства, связанного или ассоциированного с действием желчных кислот. В одном из вариантов осуществления изобретения, химерная пептидная последовательность включает, или состоит из них, N-концевую область, имеющую по меньшей мере семь аминокислотных остатков и N-концевую область, которая, от положения первой аминокислоты до положения последней аминокислоты, имеет последовательности DSSPL (SEQ ID NO:121) или DASPH (SEQ ID NO:122; и C-концевую область, содержащую часть FGF19, где указанная C-концевая область, от положения первой аминокислоты до положения последней аминокислоты, имеет аминокислотные остатки 16-29 FGF19 (WGDPIRLRHLYTSG; SEQ ID NO:169), где остаток W соответствует положению первой аминокислоты указанной С-концевой области.

В другом варианте осуществления изобретения, химерная пептидная последовательность включает, или состоит из них, N-концевую область, имеющую часть FGF21, где N-концевая область, , от положения первой аминокислоты до положения последней аминокислоты, имеет аминокислотные остатки GQV, и где остаток V соответствует положению последней аминокислоты N-концевой области; и C-концевую область, имеющую часть FGF19, где указанная C-концевая область, от положения первой аминокислоты до положения последней аминокислоты, включает аминокислотные остатки 21-29 последовательности FGF19 (RLRHLYTSG, SEQ ID NO:185), и где остаток R соответствует положению первой аминокислоты C-концевой области.

В других вариантах осуществления изобретения, пептидная последовательность включает, или состоит из него, вариант последовательности FGF19, имеющий одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF19 или последовательностью FGF19 дикого типа. В других вариантах осуществления изобретения, пептидная последовательность включает, или состоит из него, вариант последовательности FGF21, имеющий одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF19 или последовательностью FGF19 дикого типа. В дополнительных вариантах осуществления изобретения, пептидная последовательность включает, или состоит из нее, часть последовательности FGF19, присоединенную к части последовательности FGF21. В дополнительных вариантах осуществления изобретения, пептидная последовательность включает, или состоит из нее, часть последовательности FGF19, присоединенную к части последовательности FGF21, где часть(и) последовательности FGF19 и/или FGF21 имеет(ют) одну или более аминокислотных замен, инсерций или делеций по сравнению с исходной последовательностью FGF19 и/или FGF21 или с последовательностью FGF19 и/или FGF21 дикого типа.

Настоящее изобретение также относится к способам и применениям лечения индивидуума, страдающего расстройством или имеющего риск развития расстройства, которое может быть подвергнуто лечению с использованием вариантов и гибридов пептидных последовательностей FGF19 и/или FGF21. В одном из вариантов осуществления изобретения, способ или применение включают контактирование индивидуума с одним или более вариантами или гибридами пептидных последовательностей FGF19 и/или FGF21 или введение индивидууму этих вариантов или гибридов в количестве, эффективном для лечения расстройства, связанного или ассоциированного с действием желчных кислот. В другом варианте осуществления изобретения, способ или применение включают контактирование индивидуума с одной или более молекулами нуклеиновой кислоты, кодирующими вариант или гибрид пептидной последовательности FGF19 и/или FGF21, или введение индивидууму этих молекул нуклеиновой кислоты (например, элемента регуляции экспрессии, функционально присоединенного к нуклеиновой кислоте, кодирующей пептидную последовательность, включая, но необязательно, вектор) в количестве, эффективном для лечения расстройства, связанного или ассоциированного с действием желчных кислот.

Репрезентативная исходная последовательность FGF21 или последовательность FGF21 дикого типа представляет собой:

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:99).

Репрезентативная исходная последовательность FGF19 или последовательность FGF19 дикого типа представляет собой:

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPH RDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (SEQ ID NO:100). Аллельными вариантами FGF21 являются, например, M70, M71 и M72.

Используемые здесь термины «пептидная», «белковая» и «полипептидная» последовательность являются синонимами и означают две или более аминокислот или «остатков», включая химические модификации и производные аминокислот, ковалентно связанные амидной связью, или их эквиваленты. Аминокислоты, образующие весь пептид или его часть, могут быть выбраны из 21 известной природной аминокислоты, где указанные аминокислоты могут быть обозначены однобуквенным кодом или более распространенным трехбуквенным кодом. В пептидных последовательностях согласно изобретению, стандартные аминокислотные остатки имеют свое общепринятое значение. Так, например, «Leu» означает лейцин, «Ile» означает изолейцин, а «Nle» означает норлейцин и т.п.

В настоящем изобретении представлены репрезентативные пептидные последовательности, которые отличаются от описанных здесь исходных полипептидов FGF19 и FGF21 тем, что они модулируют гомеостаз желчных кислот in vivo (см., например, таблицы 1-10 и список последовательностей). Неограничивающими конкретными примерами являются пептидная последовательность, в которой амино-концевые аминокислоты 1-16 FGF21 присоединены к карбокси-концевым аминокислотам 21-194 FGF19; пептидная последовательность, в которой амино-концевые аминокислоты 1-147 FGF19 присоединены к карбокси-концевым аминокислотам 147-181 FGF21; пептидная последовательность, в которой амино-концевые аминокислоты 1-20 FGF19 присоединены к карбокси-концевым аминокислотам 17-181 FGF21; пептидная последовательность, в которой амино-концевые аминокислоты 1-146 FGF21 присоединены к карбокси-концевым аминокислотам 148-194 FGF19; и пептидная последовательность, в которой амино-концевые аминокислоты 1-20 FGF19 присоединены к внутренним аминокислотам 17-146 FGF21, которые, в свою очередь, присоединены к карбокси-концевым аминокислотам 148-194 FGF19.

Дополнительные конкретные пептидные последовательности имеют мотив последовательности WGDPI (SEQ ID NO:170), соответствующий последовательности аминокислот WGDPI 16-20 FGF19 (SEQ ID NO:99), не содержат мотива последовательности WGDPI (SEQ ID NO:170), соответствующего последовательности аминокислот WGDPI 16-20 FGF19 (SEQ ID NO:99); или имеют замененный (то есть, мутированный) мотив последовательности WGDPI (SEQ ID NO:170), соответствующий последовательности аминокислот WGDPI 16-20 FGF19 (SEQ ID NO:99).

Конкретные пептидные последовательности согласно изобретению также включают последовательности, отличающиеся от последовательностей FGF19 и FGF21 (например, описанных в настоящей заявке) и от последовательностей варианта FGF19 тем что в этих последовательностях, последовательность WGDPI (SEQ ID NO:170) в положениях аминокислот 16-20 FGF19 заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184). В соответствии с этим, последовательности FGF19 и FGF21 дикого типа (например, представленные здесь как SEQ ID NOS:99 и 100, соответственно) могут быть исключены, и может быть также исключена последовательность FGF19, в которой последовательность WGDPI (SEQ ID NO:170) в положениях аминокислот 16-20 FGF19 заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184). Однако, такое исключение не относится к последовательности, в которой, например, 3 остатка FGF21 присоединены к последовательности FGF19, имеющей, например, любую из последовательностей GQV, GQV, GDI, или GPI, или 2 остатка FGF21 присоединены к любой из WGPI (SEQ ID NO:171), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182) или WGDP (SEQ ID NO:183).

Конкретные неограничивающие примеры пептидных последовательностей включают, или состоят из них, полноразмерный вариант последовательности или ее часть, представленные здесь как M1-M98 (SEQ ID NN: l-52, 192 и 54-98, соответственно). Более конкретные неограничивающие примеры пептидных последовательностей включают, или состоят из них, полноразмерную последовательность или ее часть, представленные здесь как:

HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M5-R) (SEQ ID NO:160) (последовательности FGF21 могут также включать остаток «R» у амино-конца);

DSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:138 и 161);

RPLAFSDASPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M1) (SEQ ID NO:l или 139);

RPLAFSDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M2) (SEQ ID NO:2 или 140);

DSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:141);

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M69) (SEQ ID NO:69);

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M52) (SEQ ID NO:52);

HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M5-R) (SEQ ID NO:160);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHSLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (M71) (SEQ ID NO:71);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (M72) (SEQ ID NO:72);

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVVQDELQGVGGEGCHMHPENCKTLLTDIDRTHTEKPVWDGITGE (M73) (SEQ ID NO:73);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M3) (SEQ ID NO:3);

RDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M48) (SEQ ID NO:48, 6 или 148);

RPLAFSDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M49) (SEQ ID NO:49, 7 или 149);

RHPIPDSSPLLQFGDQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRS PSFEK (M50) (SEQ ID NO:50);

RHPIPDSSPLLQFGGNVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M51) (SEQ ID NO:51, 36 или 155);

MDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M53) (SEQ ID NO:192);

MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M70) (SEQ ID NO:70);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M139) (SEQ ID NO:193);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIREDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M140) (SEQ ID NO:194);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILCDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M141) (SEQ ID NO:195); или

RPLAFSDAGPHVHYGWGDPIRQRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M160) (SEQ ID NO:196);

или подпоследовательность или фрагмент любой из вышеуказанных пептидных последовательностей. В некоторых вариантах любой из вышеуказанных пептидных последовательностей, концевой остаток R был делетирован.

Другими конкретными неограничивающими примерами пептидных последовательностей являются пептидные последовательности, имеющие у N-конца пептидную последовательность, включающую или состоящую из них, нижеследующую полноразмерную последовательность или часть любой из нижеследующих последовательностей:

HPIPDSSPLLQFGGQVRLRHLYTSG (M5-R) (аминокислоты 1-25 SEQ ID NO:160);

DSSPLLQFGGQVRLRHLYTSG (M6-R) (аминокислоты 2-22 SEQ ID NO:6);

RPLAFSDSSPLLQFGGQVRLRHLYTSG (M7) (аминокислоты 1-27 SEQ ID NO:7);

HPIPDSSPLLQWGDPIRLRHLYTSG (M8-R) (аминокислоты 2-26 SEQ ID NO:8);

HPIPDSSPLLQFGWGDPIRLRHLYTSG (M9-R) (аминокислоты 2-28 SEQ ID NO:9);

HPIPDSSPHVHYGWGDPIRLRHLYTSG (M10-R) (аминокислоты 2-28 SEQ ID NO:10);

RPLAFSDAGPLLQWGDPIRLRHLYTSG (M11) (аминокислоты 1-27 SEQ ID NO:11);

RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (аминокислоты 1-29 SEQ ID NO:12);

RPLAFSDAGPLLQFGGQVRLRHLYTSG (M13) (аминокислоты 1-27 SEQ ID NO:13);

HPIPDSSPHVHYGGQVRLRHLYTSG (M14-R) (аминокислоты 2-26 SEQ ID NO:14);

RPLAFSDAGPHVHYGGQVRLRHLYTSG (M15) (аминокислоты 1-27 SEQ ID NO:15);

RPLAFSDAGPHVHWGDPIRLRHLYTSG (M16) (аминокислоты 1-27 SEQ ID NO:16);

RPLAFSDAGPHVGWGDPIRLRHLYTSG (M17) (аминокислоты 1-27 SEQ ID NO:17);

RPLAFSDAGPHYGWGDPIRLRHLYTSG (M18) (аминокислоты 1-27 SEQ ID NO:18);

RPLAFSDAGPVYGWGDPIRLRHLYTSG (M19) (аминокислоты 1-27 SEQ ID NO:19);

RPLAFSDAGPVHGWGDPIRLRHLYTSG (M20) (аминокислоты 1-27 SEQ ID NO:20);

RPLAFSDAGPVHYWGDPIRLRHLYTSG (M21) (аминокислоты 1-27 SEQ ID NO:21);

RPLAFSDAGPHVHGWGDPIRLRHLYTSG (M22) (аминокислоты 1-27 SEQ ID NO:22);

RPLAFSDAGPHHGWGDPIRLRHLYTSG (M23) (аминокислоты 1-27 SEQ ID NO:23);

RPLAFSDAGPHHYWGDPIRLRHLYTSG (M24) (аминокислоты 1-27 SEQ ID NO:24);

RPLAFSDAGPHVYWGDPIRLRHLYTSG (M25) (аминокислоты 1-27 SEQ ID NO:25);

RPLAFSDSSPLVHWGDPIRLRHLYTSG (M26) (аминокислоты 1-27 SEQ ID NO:26);

RPLAFSDSSPHVHWGDPIRLRHLYTSG (M27) (аминокислоты 1-27 SEQ ID NO:27);

RPLAFSDAGPHVWGDPIRLRHLYTSG (M28) (аминокислоты 1-26 SEQ ID NO:28);

RPLAFSDAGPHVHYWGDPIRLRHLYTSG (M29) (аминокислоты 1-28 SEQ ID NO:29);

RPLAFSDAGPHVHYAWGDPIRLRHLYTSG (M30) (аминокислоты 1-29 SEQ ID NO:30);

RHPIPDSSPLLQFGAQVRLRHLYTSG (M31) (аминокислоты 1-26 SEQ ID NO:31);

RHPIPDSSPLLQFGDQVRLRHLYTSG (M32) (аминокислоты 1-26 SEQ ID NO:32);

RHPIPDSSPLLQFGPQVRLRHLYTSG (M33) (аминокислоты 1-26 SEQ ID NO:33);

RHPIPDSSPLLQFGGAVRLRHLYTSG (M34) (аминокислоты 1-26 SEQ ID NO:34);

RHPIPDSSPLLQFGGEVRLRHLYTSG (M35) (аминокислоты 1-26 SEQ ID NO:35);

RHPIPDSSPLLQFGGNVRLRHLYTSG (M36) (аминокислоты 1-26 SEQ ID NO:36);

RHPIPDSSPLLQFGGQARLRHLYTSG (M37) (аминокислоты 1-26 SEQ ID NO:37);

RHPIPDSSPLLQFGGQIRLRHLYTSG (M38) (аминокислоты 1-26 SEQ ID NO:38);

RHPIPDSSPLLQFGGQTRLRHLYTSG (M39) (аминокислоты 1-26 SEQ ID NO:39);

RHPIPDSSPLLQFGWGQPVRLRHLYTSG (M40) (аминокислоты 1-28 SEQ ID NO:40);

DAGPHVHYGWGDPIRLRHLYTSG (M74-R) (аминокислоты 2-24 SEQ ID NO:74);

VHYGWGDPIRLRHLYTSG (M75-R) (аминокислоты 2-19 SEQ ID NO:75);

RLRHLYTSG (M77-R) (аминокислоты 2-10 SEQ ID NO:77);

RHPIPDSSPLLQFGWGDPIRLRHLYTSG (M9) (аминокислоты 1-28 SEQ ID NO:9);

RHPIPDSSPLLQWGDPIRLRHLYTSG (M8) (аминокислоты 1-26 SEQ ID NO:8);

RPLAFSDAGPLLQFGWGDPIRLRHLYTSG (M12) (аминокислоты 1-29 SEQ ID NO:12);

RHPIPDSSPHVHYGWGDPIRLRHLYTSG (M10) (аминокислоты 1-28 SEQ ID NO:10);

RPLAFSDAGPLLQFGGQVRLRHLYTSG (M13) (аминокислоты 1-27 SEQ ID NO:13);

RHPIPDSSPHVHYGGQVRLRHLYTSG (M14) (аминокислоты 1-26 SEQ ID NO:14);

RPLAFSDAGPHVHYGGDIRLRHLYTSG (M43) аминокислоты 1-27 SEQ ID NO:43); или

RDSSPLLQFGGQVRLRHLYTSG (M6) (аминокислоты 1-22 SEQ ID NO:6)

и любые из вышеуказанных пептидных последовательностей, в которых амино-концевой остаток R может быть делетирован.

Пептидные последовательности согласно изобретению дополнительно включают последовательности, имеющие, в отличие от последовательности FGF19 или варианта последовательности FGF19, пониженную способность к образованию ГЦК или вообще не обладающие такой способностью, где, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184). Пептидные последовательности согласно изобретению также включают последовательности, имеющие, в отличие от последовательности FGF19 или варианта последовательности FGF19, повышенную активность, направленную на снижение уровня глюкозы, где, в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184). Кроме того, пептидные последовательности согласно изобретению включают последовательности, имеющие, в отличие от последовательности FGF19 или варианта последовательности FGF19, пониженную активность, направленную на увеличение уровня липидов (например, триглицеридов, холестерина, не-ЛВП или ЛВП), где в положениях аминокислот 16-20 FGF19, последовательность WGDPI (SEQ ID NO:170) заменена любой из последовательностей GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184).

Обычно, число аминокислот или аминокислотных остатков в пептидной последовательности согласно изобретению в целом составляет приблизительно менее, чем 250 (например, аминокислот или их миметиков). В различных конкретных вариантах осуществления изобретения, число остатков составляет приблизительно от 20 до 200 (например, аминокислот или их миметиков). В дополнительных вариантах осуществления изобретения, число остатков составляет приблизительно от 50 до 200 (например, аминокислот или их миметиков). В других вариантах осуществления изобретения, число остатков составляет приблизительно от 100 до 195 (например, аминокислот или их миметиков).

Аминокислоты или остатки могут быть связаны амидной или не-природной и не-амидной химической связью, включая, например, связи, образованные глутаральдегидом, N-гидроксисукцинимидоэфирами, бифункциональными малеимидами или N,N'-дициклогексилкарбодиимидом (DCC). Не-амидными связями являются, например, кетометилен, аминометилен, олефин, простой эфир, тиоэфир и т.п. (см, например, Spatola in Chemistry and Biochemistry of Amino Acids, Peptides and Proteins, Vol. 7, pp 267-357 (1983), «Peptide and Backbone Modifications» Marcel Decker, NY). Таким образом, если пептид согласно изобретению включает часть последовательности FGF19 и часть последовательности FGF21, то эти две части необязательно должны быть связаны друг с другом амидной связью, то есть, они могут быть связаны посредством любой другой химической группы или конъюгированы друг с другом посредством линкерной группы.

Настоящее изобретение также включает подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (включая варианты и подпоследовательности FGF19 и FGF21, перечисленные в таблицах 1-10 и в списке последовательностей), при условии, что вышеупомянутые последовательности будут сохранять по меньшей мере детектируемую или определяемую активность или функцию. Так, например, некоторые репрезентативные пептидные варианты имеют С-концевую последовательность FGF19,

PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188) в С-концевой части, например, за аминокислотными остатками «TSG» этого варианта.

Кроме того, некоторые репрезентативные пептидные варианты, например, варианты, имеющие полноразмерную последовательность FGF21 или ее часть у амино-конца, включают остаток «R», который расположен у N-конца, и который может быть делетирован. Аналогичным образом, некоторые репрезентативные пептидные варианты включают остаток «M», который расположен у N-конца, и который может быть добавлен или введен вместо делетированного остатка, такого как остаток «R». Более конкретно, в различных вариантах осуществления изобретения, пептидные последовательности у N-конца включают любую из последовательностей: RDSS (SEQ ID NO:115), DSS, MDSS (SEQ ID NO:116) или MRDSS (SEQ ID NO:117). Кроме того, в клетках, если остаток «M» является смежным с остатком «S», то этот остаток «M» может быть делетирован из пептидной последовательности, а если остаток «M» является смежным с остатком «D», то этот остаток «M» не может быть делетирован. Так, например, в различных вариантах осуществления изобретения, пептидые последовательности включают, у N-конца, нижеследующие остатки: MDSSPL (SEQ ID NO:l 19), MSDSSPL (SEQ ID NO:120) (усеченные до SDSSPL (SEQ ID NO:1 12)) и MSSPL (SEQ ID NO:1 13) (усеченные до SSPL (SEQ ID NO:114)).

В соответствии с этим, «пептидная», «полипептидная» и «белковая» последовательности согласно изобретению включают подпоследовательности, варианты и модифицированные формы вариантов и подпоследовательностей FGF19 и FGF21, перечисленных в таблицах 1-10 и в списке последовательностей, а также гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, при условии, что такие подпоследовательности, варианты или модифицированные формы (например, гибриды или химеры) будут сохранять по меньшей мере детектируемую активность или функцию, например, способность модулировать гомеостаз желчных кислот.

Используемые здесь термины «модифицировать» и его грамматические формы означают, что структура данной последовательности отличается от исходной последовательности, такой как пептидная последовательность. Такие модифицированные пептидные последовательности, нуклеиновые кислоты и другие структуры могут обладать более высокой или более низкой активностью или функцией, либо они могут иметь функцию или активность, отличающуюся от функции или активности исходной немодифицированной пептидной последовательности, нуклеиновой кислоты или другой структуры, либо они могут обладать свойством, желательным для применения белкового препарата в терапии (например, таким свойством, как время полужизни в сыворотке) в целях вырабатывания антитела, используемого в детектирующем анализе и/или в методе очистки белка. Так, например, пептидная последовательность согласно изобретению может быть модифицирована в целях увеличения времени полужизни в сыворотке, повышения стабильности белка in vitro и/или in vivo и т.п.

Конкретные примеры таких подпоследовательностей, вариантов и модифицированных форм пептидных последовательностей, описанных в настоящей заявке (например, пептидных последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), включают замены, делеции и/или инсерции/добавления одной или более аминокислот у амино-конца, у карбокси-конца или во внутренней области. Одним из примеров является замена одного аминокислотного остатка другим аминокислотным остатком в пептидной последовательности. Другим вариантом является делеция одного или более аминокислотных остатков из пептидной последовательности или инсерция или добавление одного или более аминокислотных остатков в пептидную последовательность.

Число замененных, делетированных или встроенных/добавленных аминокислотных остатков составляет 1 или более аминокислот (например, 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 или более) в пептидной последовательности. Таким образом, последовательность FGF19 или FGF21 может иметь несколько или много замен, делеций или инсерций/добавлений аминокислот (например, 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 или более). Кроме того, аминокислотная последовательность FGF19 может включать, или состоять из нее, аминокислотную последовательность, имеющую приблизительно 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 или более аминокислот FGF21; либо аминокислотная последовательность FGF21 может включать, или состоять из нее, аминокислотную последовательность, имеющую приблизительно 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 или более аминокислот FGF19.

Конкретными примерами замен являются замена L-остатка на D-остаток. В соответствии с этим, несмотря на то, что остатки перечислены в конфигурации L-изомера, в пептидные последовательности согласно изобретению могут быть включены D-аминокислоты в любом конкретном положении или во всех положениях пептидных последовательностей согласно изобретению, при условии, что D-изомер не будет образовывать последовательность, не обладающую детектируемой или определяемой функцией.

Дополнительными конкретными примерами являются неконсервативные или консервативные замены. «Консервативная замена» означает замену одной аминокислоты биологически, химически или структурно сходным аминокислотным остатком. Термин «биологически сходный» означает, что замененный остаток имеет соответствующую биологическую активность, например, активность, направленную на снижение уровня глюкозы. Термин «структурно сходный» означает, что данные аминокислоты имеют боковые цепи одинаковой длины, такие как аланин, глицин и серин, или аналогичный размер, либо они имеют такую же структуру, как первая, вторая или дополнительная пептидная последовательность. Термин «химическое сходство» означает, что остатки имеют один и тот же заряд, либо оба этих остатка являются гидрофильными и гидрофобными. Конкретные примеры включают замену одного гидрофобного остатка, такого как изолейцин, валин, лейцин или метионин, другим остатком, или замену одного полярного остатка другим остатком, например, замену лизина на аргинин, аспарагиновой кислоты на глутаминовую кислоту или аспарагина на глутамин, треонина на серин и т.п. Для того, чтобы определить, может ли подпоследовательность, вариант или модифицированая форма обладать активностью, например, активностью, направленной на снижение уровня глюкозы, могут быть проведены рутинные анализы.

Конкретные репрезентативные подпоследовательности, варианты и модифицированные формы описанных здесь пептидных последовательностей (например, пептидных последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей) на 50%-60%, 60%-70%, 70%-75%, 75%-80%, 80%-85%, 85%-90%, 90%-95%, или 96%, 97%, 98% или 99% идентичны исходной пептидной последовательности (например, пептидной последовательности, представленной в любой из таблиц 1-10 и в списке последовательностей). Термины «идентичность» и «гомология» и их грамматические формы означают, что два или более сравниваемых объектов являются одинаковыми. Таким образом, если две аминокислотных последовательности являются идентичными, то это означает, что они имеют идентичные аминокислоты. Выражение «идентичные площади, области или домены» означает, что части двух или более сравниваемых объектов являются одинаковыми. Таким образом, если две аминокислотных последовательности являются идентичными или гомологичными в одной или более областях последовательностей, то это означает, что они являются идентичными в этих областях.

Степень идентичности двух последовательностей может быть определена с помощью компьютерной программы и математического алгоритма, известных специалистам. Такие алгоритмы позволяют вычислять процент идентичности последовательностей (гомологию) обычно с введением пробелов и с учетом несоответствий в пределах сравниваемых областей последовательностей. Так, например, поисковый алгоритм BLAST (например, BLAST 2.0) (см, например, публикацию Altschul et al., J. Mol. Biol. 215:403 (1990), доступную в NCBI) имеет следующие стандартные параметры поиска: несоответствие -2; пробел-пропуск - 5; пробел-удлинение - 2. Для сравнения пептидных последовательностей, алгоритм BLASTP обычно используется в комбинации с оценочной матрицей, такой как PAM100, PAM 250, BLOSUM 62 или BLOSUM 50. Для оценки степени идентичности также используются программы FASTA (например, FASTA2 и FASTA3) и SSEARCH для сравнения последовательностей (Pearson et al, Proc. Natl. Acad. Sci. USA 85:2444 (1988); Pearson, Methods Mol Biol. 132: 185 (2000); и Smith et al., J. Mol. Biol. 147: 195 (1981)). Были также разработаны программы для количественной оценки структурного сходства белков с применением метода топологического картирования Делоне (Bostick et al., Biochem Biophys Res Commun. 304:320 (2003)).

В пептидных последовательностях согласно изобретению, включая подпоследовательности, варианты и модифицированные формы описанных здесь пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), «аминокислота» или «остаток» включают стандартные альфа-аминокислоты, а также бета-аминокислоты, альфа,альфа-дизамещенные аминокислоты и N-замещенные аминокислоты, где по меньшей мере одной боковой цепью является боковая цепь аминокислоты, определенная в настоящей заявке. Термин «аминокислота» также включает N-алкил-альфа-аминокислоты, где N-концевая аминогруппа имеет прямой или разветвленный С16-алкильный заместитель. Поэтому, термин «аминокислота» включает стереоизомеры и модификации природных аминокислот белка; небелковые аминокислоты; посттрансляционно модифицированные аминокислоты (например, модифицированные путем гликозилирования, фосфорилирования, отщепления сложного эфира или амида и т.п.); ферментативно модифицированные или синтезированные аминокислоты; дериватизированные аминокислоты; конструкции или структуры, полученные таким образом, чтобы они имитировали аминокислоты; аминокислоты с боковой цепью, которая является модифицированной или дериватизированной по сравнению с природными молекулами; либо синтетические или не-природные аминокислоты и т.п. В пептидные последовательности согласно изобретению входят модифицированные и редко встречающиеся аминокислоты (см., например, Synthetic Peptides: A User's Guide; Hruby et al, Biochem. J. 268:249 (1990); и Toniolo C, Int. J. Peptide Protein Res. 35:287 (1990)).

Кроме того, в пептидную последовательность могут быть включены аминокислоты с защитными и модифицирующими группами. Используемый здесь термин «молекула боковой цепи аминокислоты» включает любую боковую цепь любой аминокислоты, где термин «аминокислота» определен выше. Поэтому, этот термин включает молекулу боковой цепи природных аминокислот. Этот термин также включает молекулы боковой цепи в модифицированных природных аминокислотах, таких как аминокислоты, описанные в настоящей заявке и известные специалистам, где указанные молекулы боковой цепи присутствуют в стереоизомерах и модификациях природных аминокислот белка, в небелковых аминокислотах, в посттрансляционно модифицированных аминокислотах, в ферментативно модифицированных или синтезированных аминокислотах, в дериватизированных аминокислотах, в конструкциях или в структурах, полученных таким образом, чтобы они имитировали аминокислоты, и т.п. Так, например, в это определение входит молекула боковой цепи любой аминокислоты, описанной в настоящей заявке или известной специалистам.

В определение молекулы боковой цепи аминокислоты входит «производное молекулы боковой цепи аминокислоты». Неограничивающими примерами дериватизации молекулы боковой цепи аминокислоты являются, например: (a) добавление одного или более насыщенных или ненасыщенных атомов углерода к имеющейся алкильной, арильной или аралкильной цепи; (b) замена атомов углерода в боковой цепи другим атомом, предпочтительно, кислородом или азотом; (c) добавление концевой группы к атому углерода боковой цепи, включая метил (--CH3), метокси (--OCH3), нитро (--NO2), гидроксил (--OH) или циано (--C=N); (d) для молекул боковой цепи, включающих гидрокси-группу, тиоловую группу или аминогруппу, добавление подходящей гидрокси-, тиол- или амино-защитной группы; или (e) для молекул боковой цепи, имеющих циклическую структуру, добавление одного или более кольцевых заместителей, включая гидроксильные группы, галогеногруппы, алкильные группы или арильные группы, связанные друг с другом непосредственно или посредством эфирной связи. Подходящие защитные группы для аминогрупп известны специалистам. Такая дериватизация не должна негативно влиять на нужную активность конечной пептидной последовательности (например, активность, направленную на снижение уровня глюкозы; активность, направленную на улучшение метаболизма глюкозы или липидов; антидиабетическую активность; по существу, отсутствие способности образовывать ГЦК или онкогенной активности; по существу, отсутствие модулирующей активности, направленной на снижение или увеличение жировой массы и т.п.).

Термин «молекула боковой цепи аминокислоты» включает все указанные дериватизации, и их конкретными неограничивающими примерами являются: гамма-аминомасляная кислота, 12-аминододекановая кислота, альфа-аминоизомасляная кислота, 6-аминогексановая кислота, 4-(аминометил)-циклогексанкарбоновая кислота, 8-аминооктановая кислота, бифенилаланин, Boc-трет-бутоксикарбонил, бензил, бензоил, цитруллин, диаминомасляная кислота, пирроллизин, диаминопропионовая кислота, 3,3-дифенилаланин, ортонин, цитруллин, 1,3-дигидро-2H-изоиндолкарбоновая кислота, этил, Fmoc- флуоренилметоксикарбонил, гептаноил (CH3-(CH2)5--C(=О)--), гексаноил (CH3--(CH2)4--C(=О)--), гомоаргинин, гомоцистеин, гомолизин, гомофенилаланин, гомосерин, метил, сульфоксид метионина, метионинсульфон, норвалин (NVA), фенилглицин, пропил, изопропил, саркозин (SAR), трет-бутилаланин и бензилоксикарбонил.

Одна аминокислота, включая стереоизомеры и модификации природных аминокислот белка, небелковые аминокислоты, посттрансляционно модифицированные аминокислоты, ферментативно синтезированные аминокислоты, не-природные аминокислоты, включая дериватизированные аминокислоты, альфа,альфа-дизамещенные аминокислоты, происходящие от любой из вышеупомянутых аминокислот (то есть, альфа,альфа-дизамещенную аминокислоту, в которой по меньшей мере одна боковая цепь является такой же, как боковая цепь остатка, от которого он происходит), бета-аминокислоты, происходящие от любой из вышеупомянутых аминокислот (то есть, бета-аминокислоту, в которой бета-углерод отличается от бета-углерода остатка, от которого он происходит), и т.п., включая все вышеупомянутые аминокислоты, могут называться здесь «остатком». Подходящими заместителями, помимо молекулы боковой цепи альфа-аминокислоты, являются прямой или разветвленный С16-алкил. Примером альфа,альфа-дизамещенной аминокислоты является Aib. Хотя альфа,альфа-дизамещенные аминокислоты могут называться в соответствии с общеизвестной терминологией, принятой для L- и D-изомеров, однако, следует отметить, что такие названия приводятся для удобства, и что в случае, когда заместители в альфа-положении отличаются друг от друга, то такая аминокислота может в равной степени называться, если это необходимо, альфа,альфа-дизамещенной аминокислотой, происходящей от L- или D-изомера остатка, имеющего указанную молекулу боковой цепи аминокислоты. Таким образом, (S)-2-амино-2-метилгексановая кислота может называться либо альфа,альфа-дизамещенной аминокислотой, происходящей от L-Nle (норлейцина), либо альфа,альфа-дизамещенной аминокислотой, происходящей от D-Ala. Аналогичнным образом, Aib может называться альфа,альфа-дизамещенной аминокислотой, происходящей от Ala. В случае использования альфа,альфа-дизамещенной аминокислоты, предусматривается, что она включает все ее (R)- и (S)-конфигурации.

Термин «N-замещенная аминокислота» включает любую аминокислоту, где боковая цепь аминокислоты ковалентно связана с аминогруппой остова, и где, но необязательно, в положении альфа-углерода отсутствуют заместители, кроме Н. Примером N- замещенной аминокислоты является саркозин. Так, например, саркозин может называться N-замещенным производным аминокислоты Ala, в котором молекулы боковой цепи аминокислоты саркозина и Ala являются одинаковыми, то есть, метилом.

Настоящее изобретение относится к ковалентным модификациям пептидных последовательностей согласно изобретению, включая подпоследовательности, варианты и модифицированные формы описанных здесь пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей). Ковалентная модификация одного из типов включает реакцию взаимодействия целевых аминокислотных остатков с органическим дериватизирующим агентом, который обладает способностью взаимодействовать с выбранными боковыми цепями или с N- или C-концевыми остатками пептида. Дериватизация бифункциональными агентами может быть осуществлена, например, для перекрестного связывания пептида с нерастворимой в воде матрицей-носителем или поверхностью, и применяется в способе очистки антипептидных антител и наоборот. Наиболее распространенными перекрестно-связывающими агентами являются, например, 1,1-бис(диазоэтил)-2-фенилэтан, глутаральдегид, N-гидроксисукцинимидоэфиры, например, сложные эфиры 4-азидосалициловой кислоты, гомобифункциональные имидоэфиры, включая дисукцинимидиловые эфиры, такие как 3,3'-дитиобис(сукцинимидилпропионат), бифункциональные малеимиды, такие как бис-N-малеимидо-1,8-октан, и такие агенты, как метил-3-[(п-азидофенил)дитио]пропиоимидат.

Другие модификации включают дезамидирование глутаминильных и аспарагинильных остатков до соответствующих глутамильных и аспартильных остатков, соответственно; гидроксилирование пролина и лизина; фосфорилирование гидроксильных групп серильных или треонильных остатков; метилирование альфа-аминогрупп боковых цепей лизина, аргинина и гистидина (T. E. Creighton, Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86 (1983)); ацетилирование N-концевого амина; амидирование любой C-концевой карбоксильной группы и т.п.

Репрезентативные пептидные последовательности и подпоследовательности, варианты и модифицированные формы описанных здесь пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей) могут также включать модификации остова, введенные для повышения стабильности, а также производные и пептидомиметики. Термин «пептидомиметик» включает молекулу, которая имитирует остаток (называемую здесь «миметиком»), включая, но не ограничиваясь ими, молекулы пиперазинового ядра, молекулы кето-пиперазинового ядра и молекулы диазепинового ядра. Если это не оговорено особо, то аминокислотный миметик пептидной последовательности согласно изобретению включает карбоксильную группу и аминогруппу, и группу, соответствующую боковой цепи аминокислоты, а если такой молекулой является миметик глицина, то в ней отсутствуют все боковые цепи, кроме водорода.

Так, например, такими соединениями являются соединения, которые имитируют стерические затруднения, распределение поверхностного заряда, полярность и т.п. природной аминокислоты, которой необязательно является аминокислота, сообщающая стабильность биологической системе. Так, например, пролин может быть заменен другими лактамами или лактонами, имеющими подходящий размер и подходящее замещение; лейцин может быть заменен алкилкетоном, N-замещенным амидом, причем, специалистам также известны и другие модификации боковой цепи аминокислоты, осуществляемые с использованием алкильных, алкенильных или других заместителей и т.п. Основным элементом, используемым для осуществления таких замен, является молекула, которая имеет приблизительно такой же размер, такой же заряд и такую же конфигурацию как и остаток, используемый для конструирования этой молекулы. Уточнение этих модификаций может быть осуществлено путем функционального анализа соединений (например, анализа на снижение уровня глюкозы) или другого анализа, и путем сравнения их зависимости «структура - активность». Такие методы известны специалистам в области медицинской химии и разработки лекарственных средств.

Другим типом модификации пептидных последовательностей согласно изобретению, включая подпоследовательности, варианты и модифицированные формы описанных здесь пептидных последовательностей (включая пептиды, перечисленные в таблицах 1-10 и в списке последовательностей), является гликозилирование. Используемый здесь термин «гликозилирование» в широком смысле означает присутствие одной или более молекул сахара (например, углевода) в белках, липидах или других органических молекулах, или их добавление или присоединение к этим молекулам. Используемый здесь термин «дегликозилирование», в основном, означает удаление или делецию одной или более молекул сахара (например, углевода). Кроме того, этот термин включает качественные изменения уровня гликозилирования нативных белков, включая изменения типа и состава (количества) различных молекул сахара (например, углевода), присутствующих в этих белках.

Гликозилирование может быть достигнуто путем модификации аминокислотного остатка или добавления одного или более сайтов гликозилирования, которые могут присутствовать, а могут и не присутствовать, в нативной последовательности. Так, например, обычно, не-гликозилированный остаток может быть заменен остатком, который может быть гликозилированным. Добавление сайтов гликозилирования может быть осуществлено путем модификации аминокислотной последовательности. Модификация пептидной последовательности может быть осуществлена, например, путем добавления или замены одного или более сериновых или треониновых остатков (для сайтов O-связанного гликозилирования) или аспарагиновых остатков (для сайтов N-связанного гликозилирования). Структуры N-связанных и O-связанных олигосахаридов и сахарных остатков, присутствующих в молекуле каждого типа, могут отличаться друг от друга. Одним из типов сахаров, которые обычно присутствуют в обеих молекулах, является N-ацетилнейраминовая кислота (также называемая сиаловой кислотой). Сиаловая кислота обычно представляет собой концевой остаток N-связанных и O-связанных олигосахаридов, и благодаря отрицательному заряду, может сообщать гликопротеину кислотные свойства.

Пептидные последовательности согласно изобретению могут быть, но необязательно, модифицированы путем введения замен на нуклеотидном уровне (например, на уровне ДНК), а в частности, путем введения мутаций в ДНК, кодирующей пептид, в предварительно выбранных положениях оснований так, чтобы генерированные кодоны могли транслироваться в нужные аминокислоты. Другим способом увеличения числа углеводных молекул на пептиде является химическое или ферментативное присоединение гликозидов к полипептиду (см., например, WO 87/05330). Дегликозилирование может быть осуществлено путем удаления имеющегося сайта гликозилирования, делеции гликозильных групп химическими и/или ферментативными способами, или замены кодонов, кодирующих аминокислотные остатки, которые являются гликозилированными. Методы химического дегликозилирования известны специалистам, а методы ферментативного отщепления углеводных молекул от полипептидов могут быть осуществлены с использованием различных эндо- и экзогликозидаз.

Различные клеточные линии могут быть использованы для продуцирования белков, которые являются гликозилированными. Одним из неограничивающих примеров являются дефицитные по дигидрофолат-редуктазе (DHFR) клетки яичника китайского хомячка (CHO), которые представляют собой наиболее распространенные клетки-хозяева, используемые для продуцирования рекомбинантных гликопротеинов. Эти клетки не экспрессируют фермента бета-галактозид-альфа-2,6-сиалилтрансферазу, а поэтому, в них не происходит присоединения сиаловой кислоты по альфа-2,6-связи к N-связанным олигосахаридам гликопротеинов, продуцируемых этими клетками.

Другим типом модификации является конъюгирование (например, связывание) одного или более дополнительных компонентов или одной или более дополнительных молекул у N- и/или C-конца пептидной последовательности согласно изобретению, таких как другой белок (например, белок, имеющий аминокислотную последовательность, которая является гетерологичной по отношению к рассматриваемому белку) или молекула-носитель. Таким образом, репрезентативная пептидная последовательность может представлять собой конъюгат с другим компонентом или с другой молекулой.

В некоторых вариантах осуществления изобретения, амино- или карбокси-концы пептидной последовательности согласно изобретению могут быть присоединены к Fc-области иммуноглобулина (например, человеческого Fc) с образованием гибрида-конъюгата (или гибридной молекулы). Fc-гибридные конъюгаты могут повышать системное время полужизни биофармацевтических средств, и таким образом, биофармацевтический продукт может обладать более длительной активностью или не требует частого введения. Fc связывается с Fc-рецептором новорожденных (FcRn) в эндотелиальных клетках, присутствующих в кровеносных сосудах, и после такого связывания, Fc-гибридная молекула будет защищена от деградации и будет высвобождаться в кровоток и сохраняться в кровотоке в течение более длительного периода времени. Очевидно, что такое Fc-связывание осуществляется по механизму, благодаря которому сохраняется длительное время полужизни эндогенного IgG в плазме. Хорошо известные и апробированные Fc-гибридные лекарственные средства состоят из двух копий биофармацевтического средства, присоединенного к Fc-области антитела, что способствует улучшению фармакокинетических свойств, повышению растворимости и эффективности продуцирования. Недавно разработанная технология получения Fc-гибридов позволяет присоединять одну копию биофармацевтического средства к Fc-области антитела, что способствует оптимизации фармакокинетических и фармакодинамических свойств биофармацевтического средства по сравнению со свойствами традиционных Fc-гибридных конъюгатов.

Модификация конъюгата может быть применена для продуцирования пептидной последовательности, которая сохраняет свою активность наряду с дополнительной или комплементарной функцией или активностью второй молекулы. Так, например, пептидная последовательность может быть конъюгирована с молекулой, например, для повышения растворимости, повышения стабильности при хранении, увеличения срока хранения или повышения стабильности in vivo, снижения иммуногенности, обеспечения пролонгированного или регулируемого высвобождения in vivo и т.п. Другими функциями или активностями являются пониженная токсичность конъюгата по сравнению с не-конъюгированной пептидной последовательностью; более эффективное нацеливание конъюгата на клетки или органы конкретного типа по сравнению с не-конъюгированной пептидной последовательностью или более эффективное устранение причин или побочных эффектов, ассоциированных с описанным здесь расстройством или заболеванием (например, диабетом), с использованием лекарственного средства.

Клиническая эффективность терапевтических белков может ограничиваться коротким временем полужизни в плазме и чувствительностью к деградации. Исследования ряда терапевтических белков показали, что различные модификации, включая конъюгирование или присоединение пептидной последовательности к любым различным не-белковым полимерам, например, полиэтиленгликолю (ПЭГ), полипропиленгликолю или полиоксиалкиленам (см., например, конъюгирование, обычно осуществляемое путем ковалентного связывания линкерной молекулы с белком и не-белковым полимером (например, ПЭГ)), могут приводить к увеличению времени полужизни. Было показано, что такие ПЭГ-конъюгированные биомолекулы обладают клинически ценными свойствами, включая более высокую физическую стабильность и термостабильность, защиту от ферментативного разложения, повышенную растворимость, более длительное время полужизни в кровотоке in vivo и пониженный клиренс, а также пониженную иммуногенность и антигенность, и пониженную токсичность.

ПЭГ, которые являются подходящими для конъюгирования с пептидной последовательностью согласно изобретению, в основном, растворяются в воде при комнатной температуре и имеют общую формулу R(О-CH2-CH2)nO-R, где R представляет собой водород или защитную группу, такую как алкильная или алканоильная группа, и где n представляет собой целое число от 1 до 1000. Если R представляет собой защитную группу, то она обычно имеет от 1 до 8 атомов углерода. ПЭГ, конъюгированный с пептидной последовательностью, может быть прямым или разветвленным. В настоящее изобретение входят разветвленные производные ПЭГ, «звездообразные ПЭГ» и ПЭГ, имеющие множество ветвей. Молекулярная масса ПЭГ, используемого в настоящем изобретении, не ограничивается какими-либо конкретными интервалами, но в некоторых вариантах осуществления изобретения, молекулярная масса ПЭГ составляет от 500 до 20000, а в других вариантах осуществления изобретения, молекулярная масса ПЭГ составляет от 4000 до 10000.

Настоящее изобретение включает композиции конъюгатов, где ПЭГ имеют различные величины «n», а следовательно, другие различные ПЭГ имеют другой конкретный состав. Так, например, некоторые композиции содержат смесь конъюгатов, где n=1, 2, 3 и 4. В некоторых композициях, процент конъюгатов, если n=1, составляет 18-25%, процент конъюгатов, если n=2, составляет 50-66%, процент конъюгатов, если n=3, составляет 12-16%, а процент конъюгатов, если n=4, составляет до 5%. Такие композиции могут быть получены в условиях проведения реакции и с применением методов очистки, известных специалистам.

ПЭГ может связываться с пептидными последовательностями согласно изобретению прямо или опосредованно (например, посредством промежуточного соединения). Так, например, в одном из вариантов осуществления изобретения, ПЭГ связывается посредством концевой реакционноспособной группы («спейсера). Спейсером является, например, концевая реакционноспособная группа, которая опосредует связывание свободных аминогрупп или корбоксильных групп одной или более пептидных последовательностей с полиэтиленгликолем. ПЭГ, имеющие спейсер, который может быть связан со свободной аминогруппой, включает полиэтиленгликоль, содержащий N-гидроксисукцинимид, и такой ПЭГ может быть получен путем активации сложного эфира янтарной кислоты и полиэтиленгликоля N-гидроксисукцинимидом. Другой активированный полиэтиленгликоль, который может быть связан со свободной аминогруппой, представляет собой 2,4-бис(О-метоксиполиэтиленгликоль)-6-хлор-s-триазин, который может быть получен путем реакции взаимодействия монометилового эфира полиэтиленгликоля с ангидридом циануровой кислоты. Активированный полиэтиленгликоль, который может быть связан со свободной карбоксильной группой, включает полиоксиэтилендиамин.

Конъюгирование одной или более пептидных последовательностей согласно изобретению с ПЭГ, имеющим спейсер, может быть осуществлено различными стандартными методами. Так, например, реакция конъюгирования может быть осуществлена в растворе при pH от 5 до 10, при температуре в пределах от 4°C до комнатной температуры, в течение периода времени от 30 минут до 20 часов, с использованием молярного отношения реагента к белку, составляющего от 4:1 до 30:1. Условия проведения реакции могут быть выбраны так, чтобы данная реакция преимущественно способствовала достижению нужной степени замещения. Вообще говоря, низкая температура, низкий pH (например, pH=5) и короткое время прохождения реакции способствуют снижению числа присоединяемых ПЭГ, тогда как высокая температура, нейтральные или высокие значения pH (например, pH≥7) и более длительное время прохождения реакции способствует увеличению числа присоединяемых ПЭГ. Для прекращения реакции могут быть применены различные методы, известные специалистам. В некоторых вариантах осуществления изобретения, реакция может быть завершена путем подкисления реакционной смеси и ее замораживания, например, при -20°C.

Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты последовательностей и модифицированные формы репрезентативных пептидных последовательностей (включая пептиды, перечисленные в таблицах 1-10 и в списке последовательностей), могут быть также конъюгированы с крупными медленно метаболизирующимися макромолекулами, такими как белки; полисахариды, такие как сахароза, агароза, целлюлоза, целлюлозные сферы; полимерные аминокислоты, такие как полиглутаминовая кислота, полилизин; сополимеры аминокислот; инактивированные вирусные частицы; инактивированные бактериальные токсины, такие как дифтерийный токсоид, столбнячный токсоид, холерный токсоид, молекулы лейкотоксина; инактивированные бактерии и дендритные клетки. Такие конъюгированные формы, если это необходимо, могут быть использованы для продуцирования антител против пептидных последовательностей согласно изобретению.

Дополнительными подходящими компонентами и молекулами для конъюгирования являются, например, тироглобулин, альбумины, такие как альбумин человеческой сыворотки (HSA); столбнячный токсоид; дифтерийный токсоид; полиаминокислоты, такие как поли(D-лизин:D-глутаминова кислота); полипептиды VP6 ротавирусов; гемаглютинин вируса гриппа; нуклеопротеин вируса гриппа; гемоцианин лимфы улитки (KLH); и белок сердцевины и поверхностный антиген вируса гепатита В, или любые их комбинации.

Присоединение альбумина к пептидной последовательности согласно изобретению может быть, например, осуществлено, путем генетической манипуляции, в результате чего, ДНК, кодирующая HSA (альбумин человеческой сыворотки) или его фрагмент, может быть присоединена к ДНК, кодирующей пептидную последовательность. Затем, подходящий хозяин может быть трансформирован или трансфецирован гибридной нуклеотидной последовательностью с образованием, например, подходящей плазмиды, экспрессирующей гибридный полипептид. Экспрессия может быть осуществлена in vitro, например, в прокариотических или эукариотических клетках, или in vivo, например, в трансгенном организме. В некоторых вариантах осуществления изобретения, экспрессию гибридного белка осуществляют в клеточных линиях млекопитающего, например, в клеточных линиях CHO.

Другим способом генетического присоединения белков-мишеней или пептидов-мишеней к альбумину является технология, известная как Albufuse® (Novozymes Biopharma A/S; Denmark), причем, такие конъюгированные терапевтические пептидные последовательности в большинстве случаев являются гораздо более эффективными и лучше усваиваются организмом. Такая технология является коммерчески доступной и применяется для продуцирования альбуферона® (Human Genome Sciences), то есть, комбинации альбумина и интерферона α-2В, используемой для лечения инфекции, вызываемой вирусом гепатита C.

Другой вариант осуществления изобретения включает использование одного или более человеческих доменных антител (dAb). dAb представляют собой наименьшие функциональные связывающие единицы человеческих антител (IgG) и обладают хорошей стабильностью и растворимостью. Эта технология включает конъюгирование dAb с HSA (с образованием «AlbudAb»; см., например, EP1517921B, WO2005/118642 и WO2006/051288) и с представляющей интерес молекулой (например, с пептидной последовательностью согласно изобретению). AlbudAb часто имеют меньший размер и легче продуцируются микробными экспрессионными системами, такими как бактерии или дрожжи, чем конъюгаты, используемые в современных технологиях, применяемых для увеличения времени полужизни пептидов в сыворотке. Поскольку HSA имеет время полужизни приблизительно три недели, то полученная конъюгированная молекула будет иметь более длительное время полужизни. Применение технологии dAb может также повышать эффективность представляющей интерес молекулы.

Дополнительными подходящими компонентами и молекулами, используемыми для конъюгирования, являются компоненты и молекулы, подходящие для выделения или очистки. Конкретными неограничивающими примерами являются связывающие молекулы, такие как биотин (партнер по специфическому связыванию с авидином), антитело, рецептор, лиганд, лектин или молекулы, содержащиеся в твердом носителе, включая, например, пластиковые или полистироловые сферы, пластины или сферы, магнитиные сферы, тест-полоски и мембраны.

Методы очистки, такие как катионообменная хроматография, могут быть применены для разделения конъюгатов по разности зарядов, где указанные методы позволяют эффективно разделять конъюгаты по их различным молекулярным массам. Так, например, катионообменная колонка может быть загружена, а затем промыта ~20 мМ ацетата натрия, pH~4, после чего, она может быть элюирована линейным градиентом NaCl (0 M - 0,5 M), забуференного при pH от 3 до 5,5, а предпочтительно, при pH~4,5. Содержание фракций, полученных с помощью катионообменной хроматографии, может быть идентифицировано по молекулярной массе с применением стандартных методов, например, с помощью масс-спектроскопии, электрофореза в ДСН-ПААГ или с применением других известных методов разделения молекул по молекулярной массе. Затем, соответствующим образом идентифицируют фракцию, которая содержит конъюгат, имеющий нужное число присоединенных ПЭГ, и не содержит немодифицированных белковых последовательностей и конъюгатов, имеющих другое число присоединенных ПЭГ.

В других вариантах осуществления изобретения, пептидная последовательность согласно изобретению присоединена к химическому агенту (например, к иммунотоксину или химиотерапевтическому агенту), включая, но не ограничиваясь ими, цитотоксический агент, включая таксол, цитохалазин B, грамицидин D, митомицин, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин и их аналоги или гомологи. Другими химическими агентами являются, например, антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацил, декарбазин); алкилирующие агенты (например, мехлоретамин, кармустин и ломустин, циклофосфамид, бусульфан, дибромманнит, стрептозотоцин, митомицин C и цисплатин); антибиотики (например, блеомицин); и антимитотические агенты (например, винкристин и винбластин). Цитотоксины могут быть конъюгированы с пептидом согласно изобретению с применением линкерной технологии, известной специалистам и описанной в настоящей заявке.

Другими подходящими компонентами и молекулами, используемыми для конъюгирования, являются компоненты и молекулы, подходящие для детектирования в анализе. Конкретными неограничивающими примерами являются детектируемые метки, такие как радиоизотоп (например, 125I; 35S, 32P; 33P), фермент, который генерирует детектируемый продукт (например, люцифераза, β-галактозидаза, пероксидаза хрена и щелочная фосфатаза); флуоресцентный белок; хромогенный белок; краситель (например, флуоресцеин-изотиоцианат); металлы, испускающие флуоресцентное излучение (например, 152Eu); хемилюминесцентные соединения (например, соли люминола и акридиния); биолюминесцентные соединения (например, люциферин); и флуоресцентные белки. Непрямыми метками являются меченные или детектируемые антитела, которые связываются с пептидной последовательностью, где указанное антитело может быть детектировано.

В некоторых вариантах осуществления изобретения, пептидную последовательность согласно изобретению конъюгируют с радиоактивным изотопом с получением цитотоксического радиофармацевтического средства (радиоиммуноконъюгатов), которое может быть использовано в качестве диагностического или терапевтического средства. Примерами таких радиоактивных изотопов являются, но не ограничиваются ими, иод131, индий111, иттрий90 и лютеций177. Методы получения радиоиммуноконъюгатов известны специалистам. Примерами коммерчески доступных радиоиммуноконъюгатов являются ибритумомаб, тиуксетан и тозитумомаб.

Другими средствами и методами, применяемыми в настоящем изобретении для увеличения времени полужизни в кровотоке, повышения стабильности, снижения клиренса или изменения иммуногенности или аллергенности пептидной последовательности согласно изобретению, является модификация пептидной последовательности посредством гезилирования, где указанная модификация включает использование производных гидроксиэтилированного крахмала, связанных с другими молекулами, в целях изменения свойств молекулы. Различные аспекты гезилирования описаны, например, в заявках на патент США NN 2007/0134197 и 2006/0258607.

Любые из вышеуказанных компонентов и молекул, используемых для модификации пептидных последовательностей согласно изобретению, могут быть, но необязательно, конъюгированы посредством линкера. Подходящими линкерами являются «гибкие линкеры», которые имеют длину, в основном, достаточную для определенного перемещения модифицированных пептидных последовательностей по отношению к связанным компонентам и молекулам. Линкерные молекулы обычно имеют длину приблизительно 6-50 атомов. Линкерными молекулами могут быть также, например, арилацетилен, олигомеры этилегликоля, содержащие 2-10 мономерных звеньев, диамины, двухосновные кислоты, аминокислоты или их комбинации. Подходящие линкеры могут быть легко выбраны и могут иметь любую подходящую длину, такую как 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, 30-50 аминокислот (например, Gly).

Репрезентативными гибкими линкерами являются глициновые полимеры (G)n, полимеры глицин-серин (например, (GS)n, GSGGSn (SEQ ID NO:129) и GGGSn (SEQ ID NO:130), где n представляет собой целое число по меньшей мере 1), полимеры глицин-аланин, полимеры аланин-серин и другие гибкие линкеры. Полимеры глицина и полимеры глицин-серин являются относительно неструктурированными, а поэтому они могут служить в качестве нейтральной связи между компонентами. Репрезентативными гибкими линкерами являются, но не ограничиваются ими, GGSG (SEQ ID NO:131), GGSGG (SEQ ID NO:132), GSGSG (SEQ ID NO:133), GSGGG (SEQ ID NO:134), GGGSG (SEQ ID NO:189) и GSSSG (SEQ ID NO:135).

Пептидные последовательности согласно изобретению, включая варианты и подпоследовательности FGF19 и FGF21, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, а также подпоследовательности, варианты последовательностей и модифицированные формы последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей, обладают одной или более активностями, описанными в настоящей заявке. Одним из примеров такой активности является способность модулировать гомеостаз желчных кислот. Другим примером активности является пониженная стимуляция или пониженная способность образовывать ГЦК, например, по сравнению с FGF19. Дополнительным примером активности является пониженная активность в отношении увеличения уровня липидов (например, триглицерида, холестерина, не-ЛВП) или в отношении увеличения уровня ЛВП, например, по сравнению с FGF21. Другим примером активности является низкая активность в отношении снижения или уменьшения потери мышечной массы, например, по сравнению с FGF21. Еще одним примером активности является способность связываться с FGFR4 или активировать FGFR4, например, способность пептидных последовательностей связываться с FGFR4 с аффинностью, сравнимой или превышающей аффинность связывания FGF19 с FGFR4; и способность пептидных последовательностей активировать FGFR4 до уровня или количества, сравнимого или превышающего степень или уровень активации FGFR4 под действием FGF19. Другими примерами активностей является эффективность в лечении расстройства, связанного или ассоциированного с действием желчных кислот.

Более конкретно, пептидные последовательности согласно изобретению, включая варианты и подпоследовательности FGF19 и FGF21, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, а также подпоследовательности, варианты последовательностей и модифицированные формы последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей, обладают нижеследующими активностями, и такими последовательностями являются: пептидные последовательности, модулирующие гомеостаз желчных кислот или эффективные для лечения расстройства, связанного или ассоциированного с действием желчных кислот, и обладающие пониженной способностью образовывать ГЦК по сравнению с FGF19 или с вариантом последовательности FGF19, в которых WGDPI (SEQ ID NO:170) в положениях аминокислот 16-20 FGF19 заменена на любую из GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); пептидные последовательности, обладающие более высокой активностью, направленной на модуляцию желчных кислот, по сравнению с FGF19, или с вариантом последовательности FGF19, в которых WGDPI (SEQ ID NO:170) в положениях аминокислот 16-20 FGF19 заменена на любую из GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); пептидные последовательности, имеющие пониженную активность в отношении увеличения уровня липидов (например, триглицеридов, холестерина, не-ЛВП), или повышенную активность, направленную на увеличение уровня ЛВП по сравнению с FGF19 или с вариантами последовательности FGF19, в которых WGDPI (SEQ ID NO:170) в положениях аминокислот 16-20 FGF19 заменена на любую из GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) или FGDPI (SEQ ID NO:184); и пептидные последовательности, обладающие низкой активностью, направленной на снижение потери массы, по сравнению с FGF21.

Более конкретно, пептидные последовательности согласно изобретению, включая варианты и подпоследовательности FGF19 и FGF21, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, а также подпоследовательности, варианты последовательностей и модифицированные формы последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей, включают последовательности, имеющие нижеследующие активности, а именно: пептидные последовательности, которые модулируют гомеостаз желчных кислот; пептидные последовательности, которые являются эффективными для лечения расстройства, связанного или ассоциированного с действием желчных кислот; пептидные последовательности, которые связываются с FGFR4 или активируют FGFR4, такие как пептидные последовательности, которые связываются с FGFR4 с аффинностью, сравнимой или превышающей аффинность связывания FGF19 с FGFR4; пептидные последовательности, способные активировать FGFR4 до уровня или количества, сравнимого или превышающего степень или уровень активации FGFR4 под действием FGF19; пептидные последовательности, которые ингибируют или снижают уровень экспрессии гена альдо-кето-редуктазы, например, по сравнению с FGF19; и пептидные последовательности, которые стимулируют или повышают уровень экспрессии гена растворимого носителя семейства 1, уровень экспрессии гена члена 2 (Slc1a2), по сравнению с FGF21.

Описанными в настоящей заявке вариантами являются FGF19 с различными N-концевыми модификации и/или усечениями, включая варианты, в которых одна или несколько N-концевых аминокислот FGF19 были заменены аминокислотами FGF21. Такими вариантами являются варианты, обладающие активностью, направленной на снижение уровня глюкозы, а также имеющие нужный профиль липидов и не имеющие явного или детектируемого уровня онкогенности.

В различных конкретных аспектах изобретения рассматриваются модификации в области петли-8 FGF19 (остатки 127-129 определены как остатки, составляющие область петли-8), которые сообщают активность, направленную на снижение уровня глюкозы, а также сообщают благоприятные метаболические параметры без какой-либо явной онкогенности. В настоящей заявке, остатки 127-129 FGF19 определены как остатки, составляющие область петли-8, хотя в литературе, область петли-8 иногда определяется как область, включающая другие остатки или состоящая из других остатков (например, остатков 125-129). Как показано в примерах 8 и 9, некоторые комбинации замен R127L и P128E в каркасной области FGF19 дают неожиданный позитивный эффект в отношении снижения уровня образования ГЦК. Еще более неожиданным является то, что комбинация замен R127L и P128E и замена Leu (L) на Gln (Q) в центральной области FGF19 (см., например, последовательность центральной области, представленную в таблицах 1-4, 9 и 10) дает еще более значимый эффект в отношении предупреждения образования ГЦК. В соответствии с этим, варианты области петли-8 FGF19 были включены потому, что они могут снижать или, в основном, предотвращать или снижать на детектируемом уровне образование ГЦК. Кроме того, эффект, направленный на снижение уровня образования ГЦК, может быть усилен путем модификаций аминокислотных остатков, расположенных за пределами области петли-8 (например, замен аминокислотных остатков в центральной области).

Активности, такие как, например, модуляция гомеостаза желчных кислот; активность, направленная на снижение уровня глюкозы; способность вызывать расстройство, связанное или ассоциированное с действием желчных кислот, определяемая с помощью анализа; активность в образовании ГЦК или онкогенная активность; активность в отношении увеличения уровня липидов или активность, направленная на снижение потери массы, могут быть определены у животного, такого как мышь db/db. Измерение уровня связывания с FGFR4 или активации FGFR4 может быть осуществлено с помощью анализов, описанных в настоящей заявке или известных специалистам.

Термин «связывается» или «связывающий», если он употребляется при описании пептидной последовательности, означает, что данная пептидная последовательность взаимодействует на молекулярном уровне. Таким образом, пептидная последовательность, которая связывается с FGFR4, может связываться с полноразмерной последовательностью FGFR4 или с ее частью. Отличие специфического и селективного связывания от неспецифического связывания может быть установлено с помощью известных анализов (например, с помощью анализа на конкурентное связывание, иммунопреципитации, ELISA, проточной цитометрии, вестерн-блот-анализа).

Пептиды и пептидомиметики могут быть получены и выделены известными методами. Пептиды могут быть синтезированы, целиком или по частям, химическими методами (см., например, Caruthers (1980). Nucleic Acids Res. Symp. Ser. 215; Horn (1980); и Banga, A.K., Therapeutic Peptides and Proteins, Formulation, Processing and Delivery Systems (1995) Technomic Publishing Co., Lancaster, PA). Синтез пептидов может быть осуществлен различными твердофазными методами (см., например, Roberge Science 269:202 (1995); Merrifield, Methods Enzymol. 289:3 (1997)), а автоматический синтез может быть осуществлен, например, на синтезаторе пептидов ABI431A (Perkin Elmer) в соответствии с инструкциями производителей. Пептиды и пептидомиметики могут быть также синтезированы с применением комбинаторной технологии. Синтетические остатки и полипептиды, включая миметики, могут быть также синтезированы с применением ряда способов и методик, известных специалистам (см., например, Organic Syntheses Collective Volumes, Gilman, et al. (Eds) John Wiley & Sons, Inc., NY). Модифицированные пептиды могут быть продуцированы методами химической модификации (см., например, Belousov, Nucleic Acids Res. 25:3440 (1997); Frenkel, Free Radic. Biol. Med. 19:373 (1995); и Blommers, Biochemistry 33:7886 (1994)). Варианты, производные, последовательности с заменами и модификациями пептидных последовательностей могут быть также получены с применением таких методов, как олигонуклеотид-опосредованный мутагенез (сайт-направленный мутагенез), аланиновое сканирование и ПЦР-мутагенез. Сайт-направленный мутагенез (Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res. 10:6487 (1987)), кластерный мутагенез (Wells et al., Gene 34:315 (1985)), рестрикционный селективный мутагенез (Wells et al., Philos. Trans. R. Soc. London SerA 317:415 (1986)) и другие методы, которые могут быть осуществлены на основе клонированной ДНК в целях продуцирования пептидных последовательностей, вариантов, гибридов и химер согласно изобретению, а также их мутантов, производных, последовательностей с заменами и модификациями.

«Синтезированная» или «продуцированная» пептидная последовательность представляет собой пептид, полученный любым методом, включая обработку, проводимую вручную. Такими методами являются, но не ограничиваются ими, химический синтез, техника рекомбинантных ДНК, биохимическая или ферментативная фрагментация крупных молекул и их комбинации.

Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты последовательностей и модифицированные формы репрезентативных пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), могут быть также модифицированы с получением химерной молекулы. В соответствии с этим, настоящее изобретение относится к пептидным последовательностям, включающим гетерологичный домен. Такие домены могут быть присоединены к амино-концу или к карбокси-концу пептидной последовательности. Гетерологичные домены могут также находиться внутри пептидной последовательности, и/или альтернативно, они могут быть фланкированы аминокислотными последовательностями, происходящими от FGF19 и/или FGF21.

Термин «пептид» также включает димеры или мультимеры (олигомеры) пептидов. В соответствии с этим, настоящее изобретение также относится к димерам или мультимерам (олигомерам) репрезентативныых пептидных последовательностей, а также их подпоследовательностей, вариантов и модифицированных форм репрезентативных пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей).

Настоящее изобретение также относится к молекулам нуклеиновой кислоты, кодирующим пептидные последовательности согласно изобретению, включая подпоследовательности, варианты последовательностей и модифицированные формы репрезентативных пептидных последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей, и к векторам, включающим нуклеиновые кислоты, которые кодируют такой пептид. В соответствии с этим, «нуклеиновыми кислотами» являются нуклеиновые кислоты, кодирующие описанные здесь репрезентативные пептидные последовательности, а также нуклеиновые кислоты, кодирующие функциональные подпоследовательности, варианты последовательностей и модифицированные формы репрезентативных пептидных последовательностей, при условии, что все вышеуказанные последовательности будут сохранять по меньшей мере детектируемую или определяемую активность или функцию. Так, например, подпоследовательность, вариант или модифицированная форма репрезентативной описанной здесь пептидной последовательности (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), которые сохраняют некоторую способность снижать или уменьшать уровень глюкозы, будут обеспечивать нормальный гомеостаз глюкозы или ослабление симптомов гистопатологических состояний, ассоциированных с хронической или острой гипергликемией in vivo и т.п.

Нуклеиновая кислота, которая также может называться геном, полинуклеотидом, нуклеотидной последовательностью, праймером, олигонуклеотидом или зондом, означает природные или модифицированные полимеры любой длины, содержащие пурин и пиримидин, либо полирибонуклеотиды или полидезоксирибонуклеотиды, либо смешанные полирибо-полидезоксирибонуклеотиды и их α-аномерные формы. Два или более полимера, содержащих пурин и пиримидин, обычно связаны друг с другом фосфоэфирной связью или ее аналогом. Эти термины могут употребляться как синонимы и означают все формы нуклеиновой кислоты, включая дезоксирибонуклеотидную кислоту (ДНК) и рибонуклеиновую кислоту (РНК). Нуклеиновые кислоты могут быть одноцепочечными, двухцепочечными или трехцепочечными, а также линейными или кольцевыми. Нуклеиновые кислоты включают геномную ДНК и кДНК. Нуклеиновая кислота РНК может представлять собой сплайсированную или несплайсированную мРНК, рРНК, тРНК или антисмысловую РНК. Нуклеиновые кислоты включают природные и синтетические нуклеиновые кислоты, а также нуклеотидные аналоги и производные.

Из-за вырожденности генетического кода, молекулы нуклеиновой кислоты включают последовательности, которые являются вырожденными по сравнению с молекулами нуклеиновой кислоты, кодирующими пептидные последовательности согласно изобретению. Таким образом, настоящее изобретение относится к вырожденным последовательностям нуклеиновой кислоты, кодирующим пептидные последовательности, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (например, последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей). Термин «комплементарный», если он употребляется в отношении последовательности нуклеиновой кислоты, означает, что сравниваемые области являются на 100% комплементарными, то есть, имеют 100% спаривание оснований, и не имеют ошибочного спаривания оснований.

Нуклеиновые кислоты могут быть получены с применением любых различных стандартных методов клонирования и методов химического синтеза, и могут быть специально модифицированы посредством сайт-направленного мутагенеза или другими рекомбинантными методами, известными специалистам. Чистота полинуклеотидов может быть определена посредством секвенирования, гель-электрофореза или УФ-спектрометрии.

Нуклеиновые кислоты могут быть встроены в конструкцию нуклеиновой кислоты, в которой на экспрессию нуклеиновой кислоты влияет «элемент регуляции экспрессии», или в которой такая экспрессия регулируется этим элементом, называемым здесь «экспрессионным кластером». Термин «элемент регуляции экспрессии» означает один или более элементов последовательности нуклеиновой кислоты, которые регулируют экспрессию или влияют на экспрессию последовательности нуклеиновой кислоты, функционально присоединенной к этим элементам. Элемент регуляции экспрессии может включать, если это необходимо, промоторы, энхансеры, терминаторы транскрипции, сайленсеры генов или старт-кодон (например, ATG), находящиеся перед белок-кодирующим геном, и т.п.

Элемент регуляции экспрессии, функционально присоединенный к последовательности нуклеиновой кислоты, регулирует транскрипцию, и, если это необходимо, трансляцию последовательности нуклеиновой кислоты. Термин «функционально присоединенный» относится к юкстаположению, где сравниваемые компоненты находятся в функциональной зависимости друг от друга, что позволяет сообщать им нужную функцию. Обычно, элементы регуляции экспрессии находятся в юкстаположении у 5'- или 3'-концов генов, но они могут быть также интронами.

Элементами регуляции экспрессии являются элементы, конститутивно активирующие транскрипциию, индуцибельные элементы (то есть, элементы, которым для активации необходимы внешние сигналы или стимуляторы) или дерепрессорные элементы (то есть, элементы, которым требуется сигнал для отключения транскрипции, а если этот сигнал больше не передается, то транскрипция активируется или «дерепрессируется»). Настоящее изобретение также включает экспрессионные кластеры, которые представляют собой регуляторные элементы, достаточные для сообщения гену экспрессии, регулируемой в клетках или тканях конкретного типа (то есть, тканеспецифические регуляторные элементы). Обычно, такие элементы расположены выше или ниже (то есть, со стороны 5'-конца или 3'-конца) кодирующей последовательности. Промоторы обычно расположены со стороны 5'-конца кодирующей последовательности. Промоторы, продуцированные методами рекомбинантных ДНК или методами синтеза, могут быть использованы для осуществления транскрипции полинуклеотидов согласно изобретению. Термин «промотор» обычно означает минимальную последовательность, достаточную для инициации транскрипции.

Нуклеиновые кислоты могут быть встроены в плазмиду в целях ее переноса в клетку-хозяина для последующей экспрессии и/или генетической модификации. Плазмида представляет собой нуклеиновую кислоту, которая может стабильно и автономно репродуцироваться в клетке-хозяине; причем, плазмиды могут, но необязательно, содержать элемент регуляции экспрессии для запуска экспрессии нуклеиновой кислоты. В описании настоящего изобретения, термины «вектор» и «плазмида» являются синонимами. Плазмиды и векторы обычно содержат по меньшей мере ориджин репликации, для их репродуцирования в клетках, и промотор. Плазмиды и векторы могут также включать элемент регуляции экспрессии для экспрессии в клетке-хозяине, а поэтому, они могут быть использованы для экспрессии и/или генетической модификации нуклеиновых кислот, кодирующих пептидные последовательности, экспрессирующих пептидные последовательности в клетках-хозяевах и организмах (например, у индивидуума, нуждающегося в лечении), или, например, продуцирующих пептидные последовательности.

Используемый здесь термин «трансген» означает полинуклеотид, который был искусственно введен в клетку или в организм. Так, например, в клетке, содержащей трансген, такой трансген был введен путем генетической манипуляции или «трансформации» клетки. Клетка или ее потомство, в которые был введен трансген, называются «трансформированной клеткой» или «трансформантом». Обычно, трансген передается потомству трансформанта или становится частью организма, развивающегося из клетки. Трансгены могут быть встроены в хромосомную ДНК, либо они могут сохраняться в виде самореплицирующейся плазмиды, YAC, минихромосомы или т.п.

Промоторами бактериальных систем являются T7 и индуцибельные промоторы, такие как pL бактериофага λ, plac, ptrp, ptac (гибридный промотор ptrp-lac) и промоторы гена восприимчивости к тетрациклину. Промоторами системы клеток насекомых являются конститутивные или индуцибельные промоторы (например, экдизон). Промоторами клеток млекопитающих являются конститутивные промоторы, такие как промоторы вируса SV40, RSV, вируса бычьей папилломы (BPV) и других вирусов, или индуцибельные промоторы, происходящие от генома клеток млекопитающих (например, промотор металлотионеина IIA; промотор гена белка «теплового шока») или от вирусов млекопитающих (например, поздний промотор аденовируса; индуцибельный промотор вируса мышиной опухоли молочной железы, имеющего длинный концевой повтор). Альтернативно, ретровирусный геном может быть генетически модифицирован для введения пептидной последовательности в соответствующие клетки-хозяева и индуцирования экспрессии этой пептидной последовательности в указанных клетках.

Поскольку способы и применения настоящего изобретения включают доставку in vivo, то экспрессионные системы также включают векторы, используемые in vivo. Конкретными неограничивающими примерами являются аденовирусные векторы (патенты США NN 5700470 и 5731172), векторы на основе аденоассоциированных вирусов (патент США No. 5604090), векторы на основе вируса простого герпеса (патент США No. 5501979), ретровирусные векторы (патенты США NN 5624820, 5693508 и 5674703), векторы на основе BPV (патент США No. 5719054), векторы на основе CMV (патент США No. 5561063) и векторы на основе парвовируса, ротавируса, вируса Норуолк и лентивируса (см., например, патент США No. 6013516). Векторами также являются векторы, которые доставляют гены в клетки желудочно-кишечного тракта, включая стволовые клетки (Croyle et al., Gene Ther. 5:645 (1998); S.J. Henning, Adv. Drug Deliv. Rev. 17:341 (1997), патенты США NN 5821235 и 6110456). Многие из этих векторов были разрешены для их применения в исследованиях с участием человека.

Дрожжевые векторы включают конститутивные и индуцибельные промоторы (см., например, Ausubel et al., In: Current Protocols in Molecular Biology. Vol. 2, Ch. 13, ed., Greene Publish. Assoc. & Wiley Interscience, 1988; Grant et al. Methods in Enzymology, 153:516 (1987), eds. Wu & Grossman; Bitter Methods in Enzymology, 152:673 (1987), eds. Berger & Kimmel, Acad. Press, N.Y.; и Strathern et al., The Molecular Biology of the Yeast Saccharomyces (1982) eds. Cold Spring Harbor Press, Vols. I and II). Может быть также использован конститутивный дрожжевой промотор, такой как ADH или LEU2, или индуцибельный промотор, такой как GAL (R. Rothstein In: DNA Cloning. A Practical Approach. Vol.11, Ch. 3, ed. D.M. Glover, IRL Press, Wash., D.C., 1986). Векторы, которые облегчают интеграцию чужеродных последовательностей нуклеиновой кислоты в дрожжевой хромосоме, например, посредством гомологичной рекомбинации, известны специалистам. Если встроенные полинуклеотиды являются слишком крупными для их использования в более подходящих векторах (например, имеют размер приблизительно более, чем 12 т.п.н.), то в этом случае обычно используют искусственные дрожжевые хромосомы (YAC).

Экспрессионные векторы могут также содержать селективный маркер, сообщающий резистентность к давлению отбора, или идентифицируемый маркер (например, бета-галактозидазу), что позволяет клеткам, имеющим такой вектор, селективно расти и размножаться. Альтернативно, селективный маркер может присутствовать на втором векторе, который вводят в клетку-хозяина вместе с первым вектором, содержащим нуклеиновую кислоту, кодирующую пептидную последовательность. Селективными системами являются, но не ограничиваются ими, ген тимидин-киназы вируса простого герпеса (Wigler et al., Cell 11: 223 (1977)), ген гипоксантин-гуанин-фосфорибозилтрансферазы (Szybalska et al., Proc. Natl. Acad. Sci. USA 48:2026 (1962)) и гены аденин- фосфорибозилтрансферазы (Lowy et al., Cell 22:817 (1980)), которые могут быть использованы в tk--, hgprt-- или aprt--клетках, соответственно. Кроме того, в качестве основы для отбора на dhfr может быть использован ген резистентности к антиметаболиту, который сообщает резистентность к метотрексату (O'Hare et al, Proc. Natl. Acad. Sci. USA 78: 1527 (1981)); ген gpt, который сообщает резистентность к микофеноловой кислоте (Mulligan et al, Proc. Natl. Acad. Sci. USA 78:2072 (1981)); ген неомицина (neomycin), который сообщает резистентность к аминогликозиду G-418 (Colberre-Garapin et al, J. Mol. Biol. 150: 1(1981)); ген пуромицина и ген гигромицина, который сообщает резистентность к гигромицину (Santerre et al, Gene 30: 147 (1984)). Дополнительными селективными генами являются ген trpB, который сообщает клеткам способность утилизовать индол вместо триптофана; ген hisD, который сообщает клеткам способность утилизовать гистинол вместо гистидина (Hartman et al, Proc. Natl. Acad. Sci. USA 85:8047 (1988)); и ген ODC (ген орнитиндекарбоксилазы), который сообщает резистентность к ингибитору орнитиндекарбоксилазы, 2-(дифторметил)-DL-орнитину, ДФМО (McConlogue (1987) In: Current Communications in Molecular Biology, Cold Spring Harbor Laboratory).

В соответствии с этим, настоящее изобретение относится к трансформированной(ым) клетке(ам) (in vitro, ex vivo и in vivo) и к клеткам-хозяевам, которые продуцируют описанный здесь вариант или гибрид FGF19 и/или FGF21, где экспрессия варианта или гибрида FGF19 и/или FGF21 сообщается нуклеиновой кислотой, кодирующей вариант или гибрид FGF19 и/или FGF21. Трансформированные клетки и клетки-хозяева, которые экспрессируют пептидные последовательности согласно изобретению, обычно включают нуклеиновую кислоту, кодирующую пептидную последовательность согласно изобретению. В одном из вариантов осуществления изобретения, трансформированной клеткой или клеткой-хозяином является прокариотическая клетка. В другом варианте осуществления изобретения, трансформированной клеткой или клеткой-хозяином является эукариотическая клетка. В различных аспектах изобретения, эукариотической клеткой является дрожжевая клетка или клетка млекопитающего (например, клетка человека, примата и т.п.).

Используемый здесь термин «трансформированная клетка» или «клетка-хозяин» означает клетку, в которую была введена нуклеиновая кислота, способная амплифицироваться и/или транскрибироваться с последующей экспрессией кодируемой пептидной последовательности. Этот термин также включает любое потомство или субклоны клетки-хозяина.

Трансформированными клетками и клетками-хозяевами являются, но не ограничиваются ими, микроорганизмы, такие как бактерии и дрожжи, а также клетки растений, насекомых и млекопитающих. Так, например, такими клетками являются бактерии, трансформированные рекомбинантной нуклеиновой кислотой бактериофага, экспрессионными векторами плазмидной нуклеиновой кислоты или космидной нуклеиновой кислоты; дрожжи, трансформированные дрожжевыми рекомбинантными экспрессионными векторами; системы клеток растений, инфицированные рекомбинантными вирусными экспрессионными векторами (например, вирусом мозаики цветной капусты, CaMV; вирусом мозаики табака, TMV) или трансформированные рекомбинантными плазмидными экспрессионными векторами (например, плазмидой Ti); системы клеток насекомых, инфицированные рекомбинантными вирусными экспрессионными векторами (например, бакуловирусом); и системы клеток животных, инфицированные рекомбинантными вирусными экспрессионными векторами (например, ретровирусами, аденовирусом, вирусом коровьей оспы); или трансформированные системы клеток животных, сконструированные для их транзиентного или стабильного размножения или для транзиентной или стабильной экспрессии.

В случае применений в генотерапии и способов проведения генотерапии, трансформированная клетка может присутствовать у индивидуума. Клетка индивидуума может быть трансформирована in vivo нуклеиновой кислотой, кодирующей пептидную последовательность согласно изобретению. Альтернативно, клетка может быть трансформирована in vitro трансгеном или полинуклеотидом, а затем она может быть трансплантирована в ткань индивидуума для его эффективного лечения. Альтернативно, первичный клеточный изолят или созданная клеточная линия могут быть трансформированы трансгеном или полинуклеотидом, кодирующим вариант FGF19 и/или FGF21 или его гибридную/химерную последовательность (или вариант), так, чтобы химерная пептидная последовательность включала полноразмерную последовательность FGF19 или ее часть или полноразмерную последовательность FGF21 или ее часть, а затем, но необязательно, они могут быть трансплантированы в ткань индивидуума.

Неограничивающими примерами клеток-мишеней для экспрессии пептидных последовательностей, а в частности, для экспрессии in vivo, являются клетки поджелудочной железы (островковые клетки), мышечные клетки, клетки слизистой и эндокринные клетки. Такие эндокринные клетки могут обеспечивать индуцибельное продуцирование (секрецию) варианта FGF19 и/или FGF21 или его гибридной/химерной последовательности (или варианта), такой как химерная пептидная последовательность, включающая полноразмерную последовательность FGF19 или ее часть, или полноразмерную последовательность FGF21 или ее часть. Другими клетками, используемыми для трансформации, являются стволовые клетки или другие мультипотентные или плюрипотентные клетки, например, клетки-предшественники, которые дифференцируются в различные клетки поджелудочной железы (островковые клетки), мышечные клетки, клетки слизистой и эндокринные клетки. Доставка стволовых клеток обеспечивает более длительную экспрессию пептидных последовательностей согласно изобретению.

Используемый здесь термин «культивированный», если он относится к клетке, означает, что указанная клетка была культивирована in vitro. Конкретным примером такой клетки является клетка, выделенная у индивидуума и культивированная или адаптированная для культивирования в тканевой культуре. Другим примером является клетка, генетически модифицированная in vitro и снова трансплантированная тому же самому или другому индивидууму.

Используемый здесь термин «выделенный», если он относится к клетке, означает, что данная клетка была отделена от ее природного окружения in vivo. «Культивированные» и «выделенные» клетки могут быть модифицированы вручную, например, путем генетической трансформации. Эти термины охватывают любое потомство клеток, включая потомство клеток, которое может не быть идентичным родительской клетке, что обусловлено мутациями, происходящими в процессе деления клеток. Эти термины не относятся ко всему организму человека.

Нуклеиновые кислоты, кодирующие пептидные последовательности согласно изобретению, могут быть введены в клетки всего организма для их стабильной экспрессии в этих клетках. Такие организмы, включая организмы трансгенных животных, не являющихся человеком, могут быть использованы в исследованиях на влияние экспрессии пептида во всем организме животного и на терапевтический эффект. Так, например, как описано в настоящей заявке, продуцирование варианта FGF19 и/или FGF21 или его гибридной/химерной последовательности (или варианта), таких как химерная пептидная последовательность, включающая описанную здесь полноразмерную последовательность FGF19 или ее часть, или полноразмерную последовательность FGF21 или ее часть, приводит к модуляции гомеостаза желчных кислот у мышей.

Линии мышей, которые были выведены, или которые являются восприимчивыми к развитию конкретного заболевания (например, диабета, дегенеративных расстройств, рака и т.п.), могут быть также использованы в описанных здесь способах введения терапевтических белков для исследования эффекта экспрессии терапевтического белка у мышей, восприимчивых к данному заболеванию. Трансгенные и геномодифицированные животные-модели, которые являются восприимчивыми к конкретному заболеванию или к физиологическим условиям, такие как мыши с диабетом (STZ), индуцированным стрептозотоцином, являются подходящими мишенями для экспрессии у них вариантов FGF19 и/или FGF21 или их гибридных/химерных последовательностей (или вариантов), таких как химерная пептидная последовательность, включающая описанную здесь полноразмерную последовательность FGF19 или ее часть, или полноразмерную последовательность FGF21 или ее часть. Таким образом, настоящее изобретение относится к трансгенным животным, не являющимся человеком, у которых продуцируется вариант FGF19 и/или FGF21 или его гибридная/химерная последовательность (или вариант), такие как химерная пептидная последовательность, включающая описанную здесь полноразмерную последовательность FGF19 или ее часть, или полноразмерную последовательность FGF21 или ее часть, где указанное продуцирование не происходит в природе, а сообщается животному трансгеном, присутствующим в соматических или зародышевых клетках указанного животного.

Термин «трансгенное животное» означает животное, у которого соматические или зародышевые клеточные линии несут генетическую информацию, сообщаемую, прямо или опосредовано, путем искусственной генетической модификации на субклеточном уровне, например, путем микроинъекции рекомбинантного вируса или инфицирования этим вирусом. Термин «трансгенный» также относится к клеткам или тканям (то есть, к «трансгенной клетке», к «трансгенныой ткани»), полученным от трансгенного животного, подвергнутого описанной здесь генетической модификации. В контексте настоящего описания, термин «трансгенное животное» не охватывает животных, полученных путем классического перекрестного скрещивания или оплодотворения in vitro, а охватывает животных, у которых в одну или более клеток была введена молекула нуклеиновой кислоты. Трансгенные животные согласно изобретению могут быть либо гетерозиготными, либо гомозиготными по указанному трансгену. Методы получения трансгенных животных, включая мышей, овец, свиней и лягушек, хорошо известны специалистам (см., например, патенты США NN. 5721367, 5695977, 5650298 и 5614396) и рассматриваются в настоящем изобретении.

Пептидные последовательности, нуклеиновые кислоты, кодирующие пептидные последовательности, векторы и трансформированные клетки-хозяева, экспрессирующие пептидные последовательности, включают их выделенные и очищенные формы. Термин «выделенный», если он относится к композиции согласно изобретению, означает, что указанная композиция была отделена, в основном, полностью или по меньшей мере частично, от одного или более компонентов его природного окружения. Вообще говоря, композиции, существующие в природе, после их выделения, по существу, не содержат одного или более компонентов, с которыми они обычно ассоциируются в природе, например, одного или более компонентов, таких как белок, нуклеиновая кислота, липид, углевод или клеточная мембрана. Термин «выделенный» не исключает альтернативные физические формы указанной композиции, такие как варианты, модификации или дериватизированные формы, гибриды и химеры, мультимеры/олигомеры и т.п., или формы, экспрессирующиеся в клетках-хозяевах. Термин «выделенный» также не исключает формы (например, фармацевтические композиции, комбинированные композиции и т.п.), содержащие комбинации, одна из которых была продуцирована искусственно.

«Выделенная» композиция может также называться «очищенной», если она не содержит некоторых компонентов, значительного числа, большого числа или всех других компонентов, таких как одно или более других веществ, например, примесей или нежелательных веществ или соединений. Пептидные последовательности согласно изобретению, по существу, неизвестны, или, очевидно, не существуют в природе. Однако, что касается композиции, существующей в природе, то выделенная композиция не содержит некоторых компонентов, значительного числа или большого числа или всех других компонентов, таких как одно или более других веществ, с которыми она обычно ассоциируется в природе. Таким образом, выделенная пептидная последовательность, которая также существует в природе, не включает полипептиды или полинуклеотиды, присутствующие среди миллионов других последовательностей, таких как белки, входящие в библиотеку белков, или нуклеиновые кислоты, входящие, например, в библиотеку геномных ДНК или кДНК. «Очищенная» композиция включает комбинации с одной или более другими неактивными или активными молекулами. Так, например, пептидную последовательность согласно изобретению объединяют с другим лекарственным средством или с другим агентом, таким как, например, лекарственное средство, снижающее уровень глюкозы, или терапевтический агент.

Используемый здесь термин «рекомбинантный», если он относится к пептидным последовательностям, к нуклеиновым кислотам, кодирующим пептидные последовательности, и т.п., означает, что указанные композиции являются модифицированными (то есть, сконструированными) (например, in vitro) таким образом, чтобы они, по существу, отличались от композиций, существующих в природе. Конкретным примером рекомбинантного пептида является пептидная последовательность согласно изобретению, экспрессирующаяся в клетке, трансфецированной нуклеиновой кислотой, кодирующей пептидную последовательность. Конкретным примером рекомбинантной нуклеиновой кислоты является нуклеиновая кислота (например, геномная ДНК или кДНК), кодирующая пептидную последовательность и клонированная в плазмиду с 5'-, 3'- или интронными областями или без этих областей, где гены указанной последовательности обычно являются смежными в геноме данного организма. Другим примером рекомбинантного пептида или рекомбинантной нуклеиновой кислоты является гибридная или слитая последовательность, такая как химерная пептидная последовательность, содержащая часть FGF19 и часть FGF21.

В соответствии с этим, настоящее изобретение относится к композициям и смесям пептидных последовательностей согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (включая варианты и последовательности FGF19 и FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей). В одном из вариантов осуществления изобретения, смесь включает одну или более пептидных последовательностей и фармацевтически приемлемый носитель или наполнитель. В другом варианте осуществления изобретения, смесь включает одну или более пептидных последовательностей и вспомогательное лекарственное средство или терапевтическое средство, такое как лекарственное средство или терапевтическое средство, модулирующее гомеостаз желчных кислот, или антидиабетическое средство, или средство, снижающее уровень глюкозы. Настоящее изобретение также относится к комбинациям, таким как одна или более пептидных последовательностей в фармацевтически приемлемом носителе или наполнителе вместе с одним или более лекарственными средствами или терапевтическими средствами, модулирующими гомеостаз желчных кислот, или предназначенными для лечения расстройства, связанного или ассоциированного с действием желчных кислот, или антидиабетическими средствами, или средствами, снижающими уровень глюкозы. Такие комбинации пептидной последовательности согласно изобретению с другим лекарственным средством или агентом, таким как лекарственное средство или терапевтическое средство, модулирующее гомеостаз желчных кислот, или предназначенное для лечения расстройства, связанного или ассоциированного с действием желчных кислот, или средство, снижающее уровень глюкозы, могут быть, например, использованы в описанных здесь способах и применениях настоящего изобретения, например, для лечения индивидуума.

Получение комбинаций также включает введение пептидных последовательностей или нуклеиновых кислот согласно изобретению в частицы или полимерные соединения, такие как полиэфиры, углеводы, полиаминокислоты, гидрогель, поливинилпирролидон, этиленвинилацетат, метилцеллюлоза, карбоксиметилцеллюлоза, сульфат протамина или сополимеры лактида/гликолида, сополимеры полилактида/гликолида или сополимеры этиленвинилацетата; включение в микрокапсулы, полученные методами коацервации или межфазной полимеризации, например, с использованием гидроксиметилцеллюлозы или желатиновых микрокапсул, или полиметилметакрилатных микрокапсул, соответственно; включение в коллоидные системы доставки лекарственного средства и в дисперсионные системы, такие как макромолекулярные комплексы, нанокапсулы, микросферы, сферы и липидные системы (например, N-ацильные жирные группы, такие как N-лауроил, N-олеоил, жирные амины, такие как додециламин, олеоиламин и т.п. (см., например, патент США No. 6638513), включая, например, эмульсии типа «масло в воде», мицеллы, смешанные мицеллы и липосомы.

Пептиды согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (включая варианты и подпоследовательности FGF19 и FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей), описанные в настоящей заявке, могут быть использованы для модуляции метаболизма глюкозы и облегчения транспорта глюкозы из крови в главные органы метаболизма, такие как мышцы, печень и жировая ткань. Такие пептидные последовательности могут быть продуцированы в количествах, достаточных или эффективных для восстановления переносимости глюкозы и/или для улучшения гомеостаза глюкозы или обеспечения нормального гомеостаза глюкозы.

Как описано в настоящей заявке, введение различных вариантов и гибридных пептидных последовательностей FGF19 и FGF21 мышам позволяет успешно модулировать гомеостаз желчных кислот. Кроме того, в отличие от FGF19, некоторые пептидные последовательности не стимулируют или не индуцируют образование ГЦК или онкогенез у мышей. Таким образом, введение пептидов согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (включая варианты и подпоследовательности FGF19 и FGF21, перечисленные в таблицах 1-10 и в списке последовательностей, и гибриды и химеры FGF19/FGF21, перечисленные в таблицах 1-10 и в списке последовательностей) животному прямыми или опосредованными методами in vivo или ex vivo (например, введение варианта или гибридного пептида, нуклеиновой кислоты, кодирующей такой вариант или гибридный пептид, или трансформированной клетки или вектора для генотерапии, экспрессирующих указанный вариант или гибридный пептид), может быть осуществлено для лечения различных расстройств, таких как расстройства, связанные или ассоциированные с действием желчных кислот.

В соответствии с этим, настоящее изобретение включает способы и применения in vitro, ex vivo и in vivo (осуществляемые, например, на материале, взятом от индивидуума или в самом организме индивидуума). Такие способы и применения могут быть осуществлены с использованием любых описанных здесь пептидных последовательностей согласно изобретению.

В соответствии с этим, настоящее изобретение относится к способам лечения индивидуума, страдающего определенным расстройством или имеющего риск развития у него данного расстройства. В различных вариантах осуществления изобретения, способ включает введение пептидной последовательности, такой как описанные здесь вариант, гибрид или химера FGF19 или FGF21 (см., например, таблицы 1-10), или подпоследовательность, вариант или модифицированная форма варианта, гибрида или химеры FGF19 или FGF21, описанные в настоящей заявке (см., например, таблицы 1-10 и список последовательностей), индивидууму в количестве, эффективном для лечения указанного расстройства.

Репрезентативными расстройствами, подвергаемыми лечению, предупреждению и т.п. с применением пептидов и способов согласно изобретению, являются расстройства, связанные или ассоциированные с действием желчных кислот. Неограничивающими примерами указанных заболеваний и расстройств являются метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены. Так, например, пептидные последовательности согласно изобретению могут быть введены индивидууму, нуждающемуся в модулиции гомеостаза желчных кислот или страдающему расстройством, связанным или ассоциированным с действием желчных кислот. Пептидные последовательности согласно изобретению могут быть также использованы для лечения других расстройств, ассоциированных с гипергликемией, включая поражение почек (например, поражение почечных канальцев или нефропатию), дегенерацию печени, поражение глаз (например, диабетическую ретинопатию или катаракту) и диабетические поражения стопы; дислипидемии и их осложнения, такие как, например, аторосклероз, ишемической болезни сердца, цереброваскулярные расстройства и т.п.

Другими состояниями, которые могут быть ассоциированы с метаболическим синдромом, являются такие заболевания, как ожирение и увеличение массы тела (включая их сопутствующие состояния, такие как, но не ограничивающиеся ими, неалкогольная жирная печень (НАЖП), неалкогольный стеатогепатит (НАСГ) и поликистозный синдром яичника (ПКСЯ)), а также тромбозы, гиперкоагуляция и протромбоз (артериальный и венозный), гипертензия (включая гипертензию воротной вены (определяемую по градиенту венозного давления печени (ГВДП), превышающему 5 мм рт.ст.), сердечно-сосудистые заболевания, инсульт и сердечная недостаточность; расстройства или состояния, в развитии которых участвуют воспалительные реакции, включая атеросклероз, хронические воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит), астму, системную красную волчанку, артрит или другие воспалительные ревматические расстройства; нарушения клеточного цикла или дифференцировки клеток, такие как опухоли жировых клеток, липоматозные карциномы, включая, например, липосаркомы, солидные опухоли и новообразования; нейродегенеративные заболевания и/или демиелинизирующие расстройства центральной и периферической нервной системы и/или и/или нервные заболевания, в развитии которых участвуют нейровоспалительные процессы, и/или другие периферические невропатии, включая болезнь Альцгеймера, рассеянный склероз, болезнь Паркинсона, прогрессирующую мультифокальную лейкоэнцефалопатию и синдром Гийена-Барре; кожные болезни и дерматологические расстройства и/или расстройства, ассоциированные с заживлением ран, включая эритематозно-сквамозные дерматозы; и другие расстройства, такие как синдром X, остеоартрит и острый респираторный дистресс-синдром.

Используемый здесь термин «расстройство, связанное или ассоциированное с действием желчных кислот», если он относится к состоянию индивидуума, означает преходящее или хроническое изменение уровня желчной кислоты (одной или более желчных кислот) у индивидуума. Такое состояние может быть вызвано ингибированием, снижением или замедлением синтеза, метаболизма или абсорбции желчных кислот, в результате чего уровень желчных кислот у индивидуума изменяется по сравнению с уровнем желчных кислот, обычно присутствующих у здоровых индивидуумов.

Как описано в настоящей заявке, настоящее изобретение включает способы предупреждения (например, у индивидуумов с предрасположенностью к развитию конкретного(ых) расстройства (расстройств)), отсрочки, замедления или ингибирования прогрессирования заболевания или начала его развития, или способы лечения (например, ослабления симптомов) расстройства, связанного или ассоциированного с действием желчных кислот, по сравнению с расстройством у соответствующего индивидуума такого же возраста и пола, такой же расы и т.п. Таким образом, в некоторых вариантах осуществления изобретения, способ согласно изобретению, например, способ модуляции гомеостаза желчных кислот или способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, включает контактирование пептида согласно изобретению, описанного в настоящей заявке (например, варианта или гибрида FGF19 и/или FGF21, описанных в таблицах 1-10 или в списке последовательностей), или введение указанного пептида согласно изобретению в количестве, эффективном для модуляции гомеостаза желчных кислот или для лечения расстройства, связанного или ассоциированного с действием желчных кислот.

Кроме того, настоящее изобретение включает способы предупреждения (например, у индивидуумов с предрасположенностью к развитию конкретного(ых) расстройства (расстройств)), замедления или ингибирования прогрессирования или отсрочки начала развития заболеваний или лечения заболеваний, ассоциированных с нежелательными уровнями или аномально низкими уровнями желчных кислот, где все указанные нарушения, как отдельно, так и в комбинации, могут приводить, например, к развитию расстройства, связанного или ассоциированного с действием желчных кислот. Такие расстройства могут быть следствием, например, генетической предрасположенности или нарушения режима питания.

Термин «индивидуум» означает животное. Обычно, таким животным является млекопитающее, у которого наблюдается благоприятный эффект от лечения с использованием пептидной последовательности согласно изобретению. Конкретными примерами являются приматы (например, человек), собаки, кошки, лошади, коровы, свиньи и овцы.

Индивидуумами являются индивидуумы, страдающие расстройством, например, связанным или ассоциированным с действием желчных кислот, таким как метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены; или индивидуумы, у которых отсутствует такое расстройство, но у которых имеется риск развития этого расстройства. Индивидуумами с риском развития расстройства, связанного или ассоциированного с действием желчных кислот, являются, например, индивидуумы, у которых нарушение режима питания может приводить к развитию острого или метаболического синдрома; расстройства, ассоциированного с метаболизмом липидов или глюкозы; расстройства, ассоциированного с метаболизмом холестерина или триглицеридов; диабета типа 2; холестаза, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевания, ассоциированного с внепеченочным холестазом (например, прерывания поступления желчи, ассоциированное со сдавливанием опухолью, блокады желчных протоков желчными камнями); малабсорбции желчных кислот и других расстройств, поражающих дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительных заболеваний кишечника (например, болезни Крона и язвенного колита); расстройств, связанных с нарушением абсорбции желчных кислот неясной этиологии (идиопатических) и вызывающих диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)), и симптомов заболеваний ЖКТ и рака ЖКТ, печени, и/или желчного пузыря (например, рака толстой кишки и гепатоцеллюлярного рака); и/или патологий, связанных с нарушением синтеза желчных кислот, таких как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены; а также индивидуумы, у которых в анамнезе имеются такие заболевания, или у которых наблюдается генетическая предрасположенность к развитию расстройства, связанного или ассоциированного с действием желчных кислот, такого как метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены.

Описанные способы лечения включают контактирование пептида согласно изобретению, описанного в настоящей заявке (например, варианта или гибрида FGF19 и/или FGF21, описанных в таблицах 1-10 или в списке последовательностей), или введение указанного пептида согласно изобретению в количестве, эффективном для достижения желаемого результата лечения у индивидуума. Лечение, которое дает нужный результат, приводит к снижению тяжести, ослаблению или предупреждению одного или более симптомов заболевания, или к снижению тяжести или частоты появления симптомов у индивидуума, например, к улучшению состояния у индивидуума или к достижению «благоприятного эффекта» или «терапевтического эффекта». Поэтому, такое лечение может приводить к снижению тяжести, ослаблению или предупреждению одного или более симптомов заболевания или к снижению частоты появления симптомов указанного заболевания у индивидуума; к стабилизации или ингибированию прогрессирования или обострения такого заболевания, а в некоторых случаях, к кратковременной ремиссии заболевания (например, на 1-6, 6-12 или 12-24 часа), к ремиссии средней продолжительности (например, на 1-6, 6-12, 12-24 или 24-48 дней) или к длительной ремиссии (например, на 1-6, 6-12, 12-24, 24-48 недель или более, чем на 24-48 недель). Таким образом, в случае расстройства, связанного или ассоциированного с действием желчных кислот, такого как метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены, указанное лечение, например, может приводить к снижению или ослаблению одного или более симптомов или побочных эффектов расстройства, связанного или ассоциированного с действием желчных кислот.

Термины «эффективное количество» или «достаточное количество», относящиеся к введению индивидууму и/или к лечению индивидуума, означают количество, которое, при введении в разовой дозе или в дробных дозах, отдельно или в комбинации с одной или более другими композициями (терапевтическими агентами, такими как лекарственное средство для лечения гипергликемии), способами лечения, схемами лечения или терапевтическими агентами, обеспечивают детектируемый ответ в течение любого периода времени (кратковременного, средней продолжительности или длительного), и дают нужный результат или объективный или субъективный благоприятный эффект у индивидуума на любом определяемом или детектируемом уровне или в течение любого периода времени (например, в течение нескольких часов, дней, месяцев, лет или до полного излечения). Такие количества обычно являются эффективными с точки зрения улучшения состояния индивидуума или устранения одного, многих или всех побочных симптомов, последствий или осложнений заболевания до определенной степени, хотя снижение или ингибирование прогрессирования или обострения заболевания также рассматривается как удовлетворительный результат.

Используемый здесь термин «улучшение состояния» означает положительную динамику течения заболевания у индивидуума, ослабление тяжести заболевания или ингибирование прогрессирования или обострения заболевания (например, стабилизацию заболевания). В случае расстройства, связанного или ассоциированного с действием желчных кислот, такого как, например, метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены, например, улучшение состояния может означать снижение или ослабление одного или более симптомов или побочных эффектов данного заболевания.

Поэтому, терапевтический эффект или улучшение состояния необязательно означает полное устранение любого одного, большого числа или всех симптомов, осложнений, последствий данного расстройства или заболевания, или причин, вызывающих такое расстройство или заболевание. Таким образом, удовлетворительная конечная точка может достигнута в том случае, если наблюдается улучшение состояния индивидуума в течение короткого, среднего или длительного периода времени, или если наблюдается частичное ослабление заболевания, частичное уменьшение частоты рецидивов, частичное снижение тяжести, прогрессирования или продолжительности заболевания; или ингибирование или устранение одного или более побочных эффектов, осложнений или последствий данного расстройства или заболевания или причин их развития; и частичное снижение обострения или прогрессирования (например, стабилизация одного или более симптомов или осложнений данного состояния, расстройства или заболевания) расстройства или заболевания в течение определенного периода времени (например, в течение нескольких часов, дней, недель, месяцев и т.п.).

Таким образом, в случае расстройства, подвергаемого лечению с использованием пептидной последовательности согласно изобретению, количество пептида, достаточное для ослабления симптомов расстройства, зависит от типа, тяжести, стадии или продолжительности течения заболевания и от терапевтического эффекта или желаемого результата, и такое количество может быть легко определено специалистом. Соответствующее количество пептида также зависит от индивидуальных особенностей пациента (например, биологической доступности лекарственного средства, пола и возраста пациента и т.п.). Так, например, кратковременное или частичное восстановление нормального гомеостаза желчных кислот у индивидуума позволяет снизить дозу, количество или частоту введения лекарственного средства, используемого для лечения метаболического синдрома; расстройства, ассоциированного с метаболизмом липидов или глюкозы; расстройства, ассоциированного с метаболизмом холестерина или триглицеридов; диабета типа 2; холестаза, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевания, ассоциированного с внепеченочным холестазом (например, прерывания поступления желчи, ассоциированного со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбции желчных кислот и других расстройств, поражающих дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительного заболевания кишечника (например, болезни Крона и язвенного колита); расстройств, связанных с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающих диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)), и симптомов заболеваний ЖКТ и рака ЖКТ, печени, и/или желчного пузыря (например, рака толстой кишки и гепатоцеллюлярного рака); и/или патологий, связанных с нарушением синтеза желчных кислот, таких как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены, даже если не будет достигнуто полное излечение. Эффективное количество может быть определено, например, путем оценки одного или более релевантных физиологических эффектов.

Способы и применения согласно изобретению для лечения индивидуума могут быть также осуществлены в целях профилактики для предупреждения или снижения вероятности развития расстройства у индивидуума, такого как расстройство, связанное или ассоциированное с действием желчных кислот. Альтернативно, указанные способы и применения могут быть осуществлены во время или после лечения индивидуума. Так, например, способы и применения согласно изобретению, осуществляемые, например, с использованием пептидной последовательности согласно изобретению, которая может быть введена индивидууму, могут быть осуществлены до, во время или после лечения индивидуума в целях улучшения гомеостаза желчных кислот с использованием другого лекарственного средства или терапевтического агента. Кроме того, композиция, такая как пептидная последовательность согласно изобретению, может быть объединена с другим лекарственным средством или агентом, таким как, например, лекарственное средство или терапевтический агент, стабилизирующие гомеостаз желчных кислот.

В соответствии с этим, способы и применения согласно изобретению для лечения индивидуума могут быть осуществлены до, в основном, во время, или после другого лечения, и в дополнение к другим формам терапии. Дополнительная терапия включает другие способы лечения, направленные на снижение уровня глюкозы, такие как лечение путем введения инсулина, усилителей чувствительности к инсулину и других лекарственных средств; изменение режима питания (прием пищи с низким содержанием сахара, жира и т.п.); хирургическая операция по снижению массы тела (уменьшение объема желудка путем гастрошунтирования, гастроэктомии); бандажирование желудка, баллонирование желудка, циркурлярная резекция желудка и т.п. Так, например, способы и применения согласно изобретению, осуществляемые в целях лечения гипергликемии или инсулинорезистентности могут быть проведены в комбинации с использованием лекарственных средств или других фармацевтических композиций, которые снижают уровень глюкозы или повышают чувствительность к инсулину у индивидуума.

В настоящем изобретении рассматривается комбинированная терапия, проводимая с использованием множества агентов (и агентов различных классов), включая 1) инсулин (например, в виде болюса и базальных аналогов), миметики инсулина и агенты, которые стимулируют секрецию инсулина, включая сульфонилмочевины (например, хлорпропамид, толазамид, ацетогексамид, толбутамид, глибурид, глимепирид, глипизид) и меглитиниды (например, репаглинид (PRANDIN) и натеглинид (STARLIX)); 2) бигуаниды (например, метформин (GLUCOPHAGE)) и другие агенты, которые стимулируют утилизацию глюкозы, снижают уровень продуцирования глюкозы в печени и/или снижают выход глюкозы из тонкого кишечника; 3) ингибиторы альфа-глюкозидазы (например, акарбоза и миглитол) и другие агенты, которые замедляют гидролиз углеводов и их последующую абсорбцию из кишечника и снижают уровень глюкозы в крови после приема пищи; 4) тиазолидиндионы (например, розиглитазон (AVANDIA), троглитазон (REZULIN), пиоглитазон (ACTOS), глипизид, балаглитазон, ривоглитазон, нетоглитазон, троглитазон, энглитазон, циглитазон, адаглитазон, дарглитазон, которые усиливают действие инсулина (например, повышают чувствительность к инсулину), что приводит к повышению степени утилизации глюкозы в периферических тканях; 5) глюкагон-подобные пептиды, включая ингибиторы DPP-IV (например, вилдаглиптин (GALVUS) и ситаглиптин (JANUVIA)) и глюкагон-подобный пептид 1 (GLP-1) и агонисты и аналоги GLP-1 (например, экзенатид (BYETTA и ITCA 650 (осмотический насос, вставляемый подкожно для доставки аналога экзенатида в течение 12 месяцев; Intarcia, Boston, MA)); и 6) DPP-IV-резистентные аналоги (миметики инкретина), агонисты PPAR-гамма, агонисты PPAR двойного действия, агонисты PPAR универсального действия, ингибиторы PTP1B, ингибиторы SGLT, средства, повышающие секрецию инсулина, агонисты RXR, ингибиторы киназы-3 гликоген-синтазы, иммуномодуляторы, агонисты адренергического рецептора бета-3, ингибиторы 11-бета-HSD1 и аналоги амилина.

В некоторых вариантах осуществления изобретения, другими репрезентативными агентами, которые могут быть использованы в комбинации с химерными пептидами и способами согласно изобретению, являются ингибиторы дипептидил-пептидазы-4 (DPP-4), препараты бромокриптина (например, секвестранты желчных кислот (например, колесевелам)) и ингибиторы SGLT-2. Лекарственные средства, снижающие аппетит, также хорошо известны специалистам и могут быть использованы в комбинации с рассматриваемыми здесь композициями и способами. Дополнительная терапия может быть осуществлена до, во время или после проведения терапии способами согласно изобретению.

Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты последовательности и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), могут быть получены в унифицированной дозе или в унифицированной лекарственной форме. В конкретном варианте осуществления изобретения, пептидную последовательность вводят в количестве, эффективном для лечения индивидуума, нуждающегося в лечении, например, заболевания, ассоциированного с нарушением гомеостаза желчных кислот или с аномальным гомеостазом желчных кислот, такого как метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени и гипертензии воротной вены. Репрезентативные унифицированные дозы составляют в пределах приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 нг; приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 мкг; и приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 мг.

Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты последовательности и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), могут быть введены в виде разовой дозы или дробных доз, например, в эффективном или достаточном количестве для достижения нужного результата. Репрезентативные дозы составляют в пределах приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 пг/кг; приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 нг/кг; и приблизительно 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 25000-50000 мкг/кг. Разовая доза или дробные дозы могут быть введены, например, несколько раз в день, каждый день, через день, раз в неделю или через определенные промежутки времени (например, два раза в неделю, через 1 неделю, 2 недели, 3, 4, 5, 6, 7 или 8 недель, или через один месяц, 2, 3, 4, 5 или 6 месяцев).

Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), могут быть введены любым способом, и такие способы могут быть осуществлены посредством системного введения, введения в периферические органы или местного введения. Так, например, пептидная последовательность может быть введена парентерально (например, подкожно, внутривенно, внутримышечно или внутрибрюшинно), перорально (например, путем проглатывания, подщечно или подъязычно), путем ингаляции, внутрикожно, вовнутрь полости, интракраниально, трансдермально (местно), через слизистую или ректально. Пептидные последовательности согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), и фармацевтические композиции, используемые в способах согласно изобретению, могут быть введены посредством (микро)инкапсулированной системы для доставки или в виде имплантата.

Конкретный неограничивающий пример парентерального (например, подкожного) введения предусматривает использование системы для подкожной доставки Intarcia (Intarcia Therapeutics, Inc.; Hayward, CA). Эта система включает осмотический мининасос, который позволяет осуществлять доставку соответствующего количества терапевтического агента в течение нужного периода времени. Помимо сохранения лекарственного средства на соответствующем терапевтическом уровне, эта система позволяет использовать препараты, обеспечивающие сохранение стабильности белковых терапевтических агентов при температуре человеческого тела в течение длительного периода времени.

Настоящее изобретение также относится к «фармацевтическим композициям», которые включают пептидную последовательность (или последовательности) согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), и один или более фармацевтически приемлемых или физиологически приемлемых разбавителей, носителей или наполнителей. В конкретных вариантах осуществления изобретения, пептидная последовательность или пептидные последовательности присутствуют в терапевтически приемлемом количестве. Фармацевтические композиции могут быть использованы в соответствии со способами и применениями настоящего изобретения. Так, например, фармацевтические композиции могут быть введены ex vivo или in vivo индивидууму для лечения в соответствии с указанными способами и применениями настоящего изобретения.

Фармацевтические композиции согласно изобретению могут быть приготовлены так, чтобы они были совместимы с нужным способом введения или с нужной схемой введения, где репрезентативные схемы введения описаны в настоящей заявке. Кроме того, фармацевтические композиции могут также содержать другие терапевтически активные агенты или соединения, описанные в настоящей заявке (например, агенты или лекарственные средства, стабилизирующие желчные кислоты) или известные специалистам, и такие фармацевтические композиции могут быть использованы для лечения или предупреждения различных описанных здесь заболеваний и расстройств, ассоциированных с действием желчных кислот.

Фармацевтические композиции обычно включают терапевтически эффективное количество по меньшей мере одной из пептидных последовательностей согласно изобретению, включая подпоследовательности, варианты и модифицированные формы репрезентативных пептидных последовательностей (последовательностей, перечисленных в таблицах 1-10 и в списке последовательностей), и одного или более фармацевтически и физиологически приемлемых вспомогательных агентов. Подходящими фармацевтически приемлемыми или физиологически приемлемыми разбавителями, носителями или наполнителями являются, но не ограничиваются ими, антиоксиданты (например, аскорбиновая кислота и бисульфат натрия), консерванты (например, бензиловый спирт, метилпарабены, этил или н-пропил, п-гидроксибензоат), эмульгаторы, суспендирующие агенты, диспергирующие агенты, растворители, наполнители, агенты, придающие объем, буферы, носители, разбавители и/или адъюванты. Так, например, подходящим носителем может быть физиологический раствор или забуференный цитратом физиологический раствор, который может быть добавлен вместе с другими компонентами, обычно содержащимися в фармацевтических композициях для парентерального введения. Репрезентативными носителями также являются нейтрально забуференный физиологический раствор или физиологический раствор, смешанный с сывороточным альбумином. Специалист в данной области может легко выбрать буферы из ряда буферов, которые могут быть использованы в фармацевтических композициях и лекарственных формах согласно изобретению. Типичными буферами являются, но не ограничиваются ими, фармацевтически приемлемые слабые кислоты, слабые основания или их смеси. Буферными компонентами также являются водорастворимые соединения, такие как фосфорная кислота, винные кислоты, молочная кислота, янтарная кислота, лимонная кислота, уксусная кислота, аскорбиновая кислота, аспарагиновая кислота, глутаминовая кислота и их соли.

В качестве первичного растворителя может быть использован растворитель как компонент носителя, и такой растворитель может быть водным или безводным. Кроме того, носитель может содержать другие фармацевтически приемлемые наполнители для модификации или сохранения pH, осмомолярности, вязкости, стерильности или стабильности фармацевтической композиции. В некоторых вариантах осуществления изобретения, фармацевтически приемлемым носителем является водный буфер. В других вариантах осуществления изобретения, носитель содержит, например, хлорид натрия и/или цитрат натрия.

Фармацевтические композиции согласно изобретению могут содержать другие фармацевтически приемлемые вспомогательные агенты для модификации или сохранения скорости высвобождения пептида согласно изобретению. Такими вспомогательными агентами являются вещества, известные специалистам в области приготовления препаратов пролонгированного высвобождения. Описание фармацевтически и физиологически приемлемых вспомогательных агентов можно найти, например, в руководствах Remington's Pharmaceutical Sciences. 18th Ed. (1990, Mack Publishing Co., Easton, Pa. 18042) pages 1435-1712, The Merck Index, 12th Ed. (1996, Merck Publishing Group, Whitehouse, NJ); и Pharmaceutical Principles of Solid Dosage Forms (1993, Technonic Publishing Co., Inc., Lancaster, Pa.). Другие фармацевтические композиции, подходящие для введения, известны специалистам, и могут быть использованы в способах и композициях согласно изобретению.

Фармацевтическая композиция может храниться в стерильном сосуде в виде раствора, суспензии, геля, эмульсии, твердого вещества или дегидратированного или лиофилизованного порошка. Такие композиции может храниться в готовой форме, в лиофилизованной форме, которая должна быть разведена перед ее введением, в жидкой форме, которая должна быть разведена перед ее введением, или в другой приемлемой форме. В некоторых вариантах осуществления изобретения, фармацевтическая композиция содержится в контейнере для одноразового приема (например, во флаконе, в ампуле, в шприце или в автоматическом инжекторе (например, подобном инжектору EpiPen®)), или, в соответствии с другими вариантами, в контейнере для многоразового приема (например, во флаконе для многоразового приема). Для доставки пептидов согласно изобретению может быть применено любое устройство для доставки лекарственного средства, включая имплантаты (например, имплантируемые насосы) и системы катетеров, известные специалистам. Депо-инъекции, которые обычно вводят подкожно или внутримышечно, могут быть также применены для высвобождения пептидов согласно изобретению в течение определенного периода времени. Депо-инъекции обычно имеют твердую или масляную основу, и, в основном, содержат по меньшей мере один из вспомогательных компонентов, описанных в настоящей заявке. Специалисту в данной области известны препараты, которые могут быть использованы для приготовления депо-инъекций.

Фармацевтическая композиция может быть приготовлена так, чтобы она была совместима с нужным способом введения. Таким образом, фармацевтические композиции включают носители, разбавители или наполнители, подходящие для введения различными способами, включая парентеральное введение (например, подкожное (s.c.), внутривенное, внутримышечное или внутрибрюшинное введение), внутрикожное введение, пероральное введение (например, путем проглатывания), введение путем ингаляции, введение вовнутрь полости, интракраниальное введение и трансдермальное (местное) введение.

Фармацевтические композиции могут быть приготовлены в форме стерильной водной или масляной суспензии для инъекций. Эта суспензия может быть приготовлена с использованием подходящих диспергирующих, смачивающих и суспендирующих агентов, описанных в настоящей заявке или известных специалистам. Стерильный препарат для инъекций может также представлять собой стерильный раствор или стерильную суспензию для инъекций, приготовленную в нетоксичном парентарально приемлемом разбавителе или растворителе, например, раствор в 1,3-бутандиоле. Приемлемыми разбавителями, растворителями и дисперсионными средами, которые могут быть использованы, являются вода, раствор Рингера, изотонический раствор хлорида натрия, Cremophor EL™ (BASF, Parsippany, NJ) или забуференный фосфатом физиологический раствор (PBS), этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль) и их подходящие смеси. Кроме того, в качестве растворителя или суспендирующей среды обычно используются стерильные жирные масла. Для этой цели может быть использовано любое легкое жирное масло, включая синтетические моно- или диглицериды. Кроме того, для приготовления инъекций могут быть использованы жирные кислоты, такие как олеиновая кислота. Пролонгированная абсорбция конкретных препаратов для инъекций может быть достигнута путем включения агентов, замедляющих абсорбцию (например, моностеарата алюминия или желатина).

Фармацевтические композиции могут быть приготовлены в форме, подходящей для перорального введения, например, в виде таблеток, капсул, пастилок, леденцов, водных или масляных суспензий, диспергируемых порошков или гранул, эмульсий, жестких или мягких капсул, сиропов, растворов, микросфер или эликсиров. Фармацевтические композиции для перорального введения могут быть получены любым способом, известным специалистам в области приготовления фармацевтических композиций. Такие композиции могут содержать один или более агентов, таких как подсластители, ароматизаторы, красители и консерванты, обеспечивающие фармацевтическим препаратам эстетический вид и приятный вкус. Таблетки, содержащие пептид согласно изобретению, могут быть смешаны с нетоксичными фармацевтически приемлемыми наполнителями, используемыми для получения таблеток. Такими наполнителями являются, например, разбавители, такие как карбонат кальция, карбонат натрия, лактоза, фосфат кальция или фосфат натрия; гранулирующие и дезинтегрирующие агенты, например, кукурузный крахмал или альгиновая кислота; связывающие агенты, например, крахмал, желатин или аравийская камедь; и замасливатели, например, стеарат магния, стеариновая кислота или тальк.

Таблетки, капсулы и т.п., подходящие для перорального введения, могут не иметь покрытий, либо на них могут быть нанесены покрытия известными методами для замедления дезинтергации и абсорбции в желудочно-кишечном тракте и для обеспечения пролонгированного высвобождения в течение длительного периода времени. Так, например, может быть использовано соединение, замедляющее высвобождение, такое как глицерилмоностеарат или глицерилдистеарат. Таблетки, капсулы и т.п. могут также иметь покрытие, нанесенное известными методами, в целях получения осмотических терапевтических таблеток для регулируемого высвобождения. Другими агентами являются биологически разлагаемые или биологически совместимые частицы или полимерные соединения, такие как полиэфиры, полиаминокислоты, гидрогель, поливинилпирролидон, полиангидриды, полигликолевая кислота, этиленвинимлацетат, метилцеллюлоза, карбоксиметилцеллюлоза, сульфат протамина или сополимеры лактида/гликолида, сополимеры полилактида/гликолида или сополимеры этиленвинилацетата, обеспечивающие регулируемое высвобождение вводимой композиции. Так, например, агент для перорального введения может быть заключен в микрокапсулы, приготовленные методами коацервации или межфазной полимеризации, то есть, в микрокапсулы, содержащие гидроксиметилцеллюлозу или желатин, или микрокапсулы, содержащие полиметилметакрилат, соответственно, либо он может быть включен в коллоидную систему для доставки лекарственных средств. Коллоидными дисперсионными системами являются макромолекулярные комплексы, нанокапсулы, микросферы, микрогранулы и липидные системы, включая эмульсии типа «масло в воде», мицеллы, смешанные мицеллы и липосомы. Методы приготовления таких препаратов известны специалистам и применяются в промышленности.

Препараты для перарального введения могут быть также приготовлены в виде твердых желатиновых капсул, в которых активный ингредиент смешан с инертным твердым разбавителем, например, карбонатом кальция, фосфатом кальция, каолином или микрокристаллической целлюлозой, или в виде мягких желатиновых капсул, в которых активный ингредиент смешан с водной или масляной средой, например, с арахисовым маслом, с жидким вазелиновым маслом или с оливковым маслом.

Водные суспензии содержат активные вещества в смеси с наполнителями, подходящими для приготовления таких суспензий. Указанными наполнителями являются суспендирующие агенты, например, натрий-содержащая карбоксиметилцеллюлоза, метилцеллюлоза, гидроксипропилметилцеллюлоза, альганат натрия, поливинилпирролидон, трагакантовая камедь и аравийская камедь, а диспергирующими или смачивающими агентами могут быть природный фосфатид, например, лецитин, или продукты реакции конденсации алкиленоксида с жирными кислотами, например, полиоксиэтиленстеарат, или продукты реакции конденсации этиленоксида с длинноцепочечными алифатическими спиртами, например, гептадекаэтиленоксицетанол, или продукты реакции конденсации этиленоксида с неполными сложными эфирами, происходящими от жирных кислот, и с гекситом, такие как полиоксиэтиленсорбитолмоноолеат, или продукты реакции конденсации этиленоксида с неполными сложными эфирами, происходящими от жирных кислот, и с ангидридами гексита, например, полиэтиленсорбитанмоноолеат. Водные суспензии могут также содержать один или более консервантов.

Масляные суспензии могут быть приготовлены путем суспендирования активного ингредиента в растительном масле, например, в арахисовом масле, в оливковом масле, в кунжутном масле или в кокосовом масле, или в минеральном масле, таком как жидкое вазелиновое масло. Масляные суспензии могут содержать загуститель, например, пчелиный воск, твердый парафин или цетиловый спирт. Для придания пероральному препарату органолептических свойств могут быть добавлены подсластители, описанные выше, и ароматизаторы.

Диспергируемые порошки и гранулы, подходящие для получения водной суспензии путем добавления воды, содержат активный ингредиент в смеси с диспергирующим или смачивающим агентом, суспендирующим агентом или с одним или более консервантами. Подходящие диспергирующие или смачивающие агенты и суспендирующие агенты описаны в настоящей заявке.

Фармацевтические композиции согласно изобретению могут быть также приготовлены в форме эмульсий типа «масло в воде». Масляная фаза может представлять собой растительное масло, например, оливковое масло или арахисовое масло, или минеральное масло, например, жидкое вазелиновое масло или их смеси. Подходящими эмульгаторами могут быть природные камеди, например, аравийская камедь или трагакантовая камедь; природные фосфатиды, например, соевые бобы, лецитин и сложные эфиры или неполные сложные эфиры, происходящие от жирных кислот; ангидриды гексита, например, сорбитанмоноолеат; и продукты конденсации неполных сложных эфиров с этиленоксидом, например, полиоксиэтиленсорбитанмоноолеат.

Фармацевтические композиции, такие как препараты с регулируемым высвобождением, включая имплантаты, липосомы, гидрогели, пролекарства и микроинкапсулированные системы доставки, могут также включать носители для защиты композиции от быстрого разложения или быстрого выведения из организма. Так, например, может быть использовано соединение для замедления высвобождения, такое как глицерилмоностеарат или глицерилстеарат, присутствующие отдельно или в комбинации с воском. Пролонгированная абсорбция фармацевтических композиций для инъекций может быть достигнута путем включения агента, замедляющего абсорбцию, например, моностеарата алюминия или желатина. Предотвращение заражения микроорганизмами может быть достигнуто с использованием различных антибактериальных и противогрибковых агентов, например, парабена, хлорбутанола, фенола, аскорбиновой кислоты, тимерозала и т.п.

Настоящее изобретение также относится к пептидам согласно изобретению, приготовленным в форме суппозиториев для ректального введения. Суппозитории могут быть получены путем смешивания пептида согласно изобретению с подходящим нераздражающим наполнителем, который является твердым при обычных температурах, но жидким при температуре прямой кишки, то есть, он расплавляется в прямой кишке с последующим высвобождением лекарственного средства. Такими соединениями являются, но не ограничиваются ими, масло какао и полиэтиленгликоли.

В соответствии с этим, настоящее изобретение относится к способам идентификации пептида (или его подпоследовательности, варианта и модифицированной формы, описанных в настоящей заявке), который модулирует гомеостаза желчных кислот без какой-либо значимой активности в образовании ГЦК. В одном из вариантов осуществления изобретения, указанный способ включает получение пептидной последовательности-кандидата; введение пептидной последовательности-кандидата тестируемому животному; измерение уровней желчных кислот у животного после введения пептидной последовательности-кандидата для того, чтобы определить, модулирует ли такая пептидная последовательность-кандидат гомеостаз желчных кислот; и анализ пептидной последовательности-кандидата на индуцирование ГЦК у животного или на экспрессию маркера, коррелирующего с активностью в образовании ГЦК. Пептид-кандидат, который модулирует гомеостаз желчных кислот, но не обладает какой-либо значимой активностью в образовании ГЦК, указывает на то, что данная пептидная последовательность модулирует гомеостаз желчных кислот, но не обладает какой-либо значимой активностью в образовании ГЦК.

Используемые здесь термины «анализ» и «измерение» и их грамматические формы являются синонимами и означают качественную или количественную оценку или качественную и количественную оценку. Если эти термины относятся к детектированию, то под этим подразумевается оценка относительного количества любым методом, включая различные методы, описанные в настоящей заявке и известные специалистам. Так, например, желчные кислоты и их предшественники, такие как 7-альфа-гидрокси-4-холестен-3-он, могут быть проанализированы или оценены в образце (например, в сыворотке), взятом у индивидуума. Другим неограничивающим примером является метод, проводимый посредством двух реакций (Randox Laboratories, Ltd.) с использованием сыворотки или гепаринизированной плазмы. В первой реакции, желчные кислоты окисляют 3-α-гидроксистероид-дегидрогеназой с последующим восстановлением тио-NAD до тио-NADH. Во второй реакции, окисленные желчные кислоты восстанавливают тем же ферментом с последующим окислением NADH до NAD. Скорость образования тио-NADH определяют путем оценки изменения удельной оптической плотности на 405 нм.

Факторами риска развития ГЦК, то есть, наиболее распространенного типа рака печени, являются диабет типа 2 (который, вероятно, обостряется при ожирении). Риск развития ГЦК при диабете типа 2 возрастает (приблизительно в 2,5-7 раз по сравнению с риском в отсутствии диабета) в зависимости от длительности заболевания диабетом и схемы его лечения.

Для скрининга и диагностики ГЦК могут быть применены различные методики, хорошо известные специалистам. Индикаторами ГЦК является детектирование опухолевого маркера, такого как повышенные уровни альфа-фетопротеина (AFP) или дес-гамма-карбоксипротромбина (DCP). Могут быть также применены различные другие методы сканирования и визуализации, включая ультразвуковое исследование, КТ-сканирование и МРТ. В соответствии с настоящим изобретением, анализ пептида (например, пептида-кандидата) на индуцирование ГЦК может быть осуществлен in vivo, например, путем количественной оценки образования узелков ГЦК у животного-модели, такого как мышь db/db, которой был введен указанный пептид, по сравнению с образованием узелков ГЦК у животного-модели, которому был введен FGF19 дикого типа. На макроскопическом уровне, рак печени может быть узелковым, где узелки опухоли (которые имеют круглую или овальную форму, серый или зеленый цвет и хорошо очерченные границы, но при этом не являются инкапсулированными) обнаруживаются либо в виде одной крупной опухоли, либо в виде нескольких мелких опухолей. Альтернативно, ГЦК может присутствовать в виде инфильтрирующейся опухоли, которая является диффузной и имеет размытые очертания, а в большинстве случаев, инфильтрируется в воротные вены.

Оценку образцов ткани печени на патологию обычно осуществляют после получения результатов одного или более из вышеупомянутых анализов, указывающих на возможное наличие ГЦК. Таким образом, способы согласно изобретению могут также включать оценку образца ткани печени, взятого у животного-модели in vivo (например, у мыши db/db), используемого в анализах на ГЦК для того, чтобы определить, может ли пептидная последовательность индуцировать ГЦК. При исследованиях под микроскопом, патолог может определить принадлежность присутствующей ГЦК к одному из четырех общих структурных и цитологических типов (паттернов) (то есть, к типу фиброламеллярных клеток, псевдогландулярных (аденоидных) клеток, плейоморфных клеток (гигантских клеток) и «прозрачных клеток»).

Настоящее изобретение также включает продуцирование и использование антител и их фрагментов, которые связываются с пептидными последовательностями согласно изобретению, включая подпоследовательности, варианты последовательностей и модифицированные формы репрезентативных пептидных последовательностей (включая пептиды, перечисленные в таблицах 1-10 и в списке последовательностей).

Используемые здесь термины «антитела» (Abs) и «иммуноглобулины» (Igs) означают гликопротеины, обладающие одинаковыми структурными свойствами. Антитела обладают специфичностью связывания с антигеном, а иммуноглобулины включают антитела и другие антитело-подобные молекулы, которые могут не обладать специфичностью к антигену.

Термин «антитело» включает интактные моноклональные антитела, поликлональные антитела, мультиспецифические антитела (например, биспецифические антитела), образованные по меньшей мере двумя интактными антителами, и связывающие фрагменты антитела, включая Fab и F(ab')2, при условии, что они обладают нужной биологической активностью. Основная структурная единица антитела содержит тетрамер, и каждый тетрамер состоит из двух идентичных пар полипептидных цепей, где каждая пара имеет одну «легкую» цепь (приблизительно 25 кДа) и одну «тяжелую» цепь (приблизительно 50-70 кДа). Амино-концевая часть каждой цепи включает вариабельную область, состоящую приблизительно из 100-110 или более аминокислот, ответственных, главным образом, за распознавание антигена. В противоположность этому, карбокси-концевая часть каждой цепи определяет константную область, ответственную, главным образом, за эффекторную функцию. Человеческие легкие цепи подразделяются на легкие цепи каппа и лямбда, а человеческие тяжелые цепи подразделяются на цепи мю, дельта, гамма, альфа или эпсилон и определяют изотип антитела, такой как IgM, IgD, IgA и IgE, соответственно. Связывающие фрагменты получают методами рекомбинантных ДНК или путем ферментативного или химического расщепления интактных антител. Связывающими фрагментами являются Fab, Fab', F(ab')2, Fv и одноцепочечные антитела.

Каждая тяжелая цепь имеет у одного своего конца вариабельный домен (VH), за которым следует ряд константных доменов. Каждая легкая цепь имеет вариабельный домен у одного конца (VL) и константный домен у другого конца; причем, константный домен легкой цепи находится параллельно первому константному домену тяжелой цепи, а вариабельный домен легкой цепи находится параллельно вариабельному домену тяжелой цепи. В легких и тяжелых цепях, вариабельные и константные области соединены областью «J», состоящей приблизительно из 12 или более аминокислот, при этом, тяжелая цепь также включат область «D», состоящую приблизительно из более, чем 10 аминокислот. Все цепи антитела содержат относительно консервативные каркасные области (FR), имеющие одинаковую общую структуру и соединенные тремя гипервариабельными областями, также называемыми «комплементарность-определяющими областями» или CDR. CDR двух цепей каждой пары находятся на одной линии с каркасными областями, что обеспечивает связывание со специфическим эпитопом. Легкие и тяжелые цепи, от N-конца до C-конца, содержат домены FR1, CDR1, FR2, CDR2, FR3, CDR3 и FR4.

Интактное антитело имеет два сайта связывания, и эти два сайта, за исключением бифункциональных или биспецифических антител, являются одинаковыми. Биспецифическим или бифункциональным антителом является искусственное гибридное антитело, имеющее две различных пары тяжелой/легкой цепи и два различных сайта связывания. Биспецифические антитела могут быть получены различными методами, включая слияние гибридом или присоединение Fab'-фрагментов.

Используемый здесь термин «моноклональное антитело» означает антитело, полученное от популяции, в основном, гомогенных антител, то есть, отдельные антитела, входящие в эту популяцию, являются идентичными, за исключением возможных природных мутаций, которые могут присутствовать в небольших количествах. Моноклональные антитела являются в высокой степени специфичными и направлены против одного антигенного сайта. В противоположность препаратам поликлональных антител, которые включают различные антитела, направленные против различных детерминат (эпитопов), каждое моноклональное антитело направлено против одной детерминанты на антигене.

«Нейтрализующее антитело» представляет собой молекулу антитела, способную блокировать или значительно снижать эффекторую функцию антигена-мишени, с которым связывается это антитело.

Связывающие фрагменты антитела могут быть получены путем ферментативного или химического расщепления интактных антител. Гидролиз антител ферментом папаином приводит к образованию двух идентичных антигенсвязывающих фрагментов, также известных как «Fab»-фрагменты и «Fc»-фрагмент, который не обладает активностью связывания с антигеном. Гидролиз антител ферментом пепсином приводит к образованию F(ab')2-фрагмента, в котором две ветви молекулы антитела остаются связанными и содержат два антигенсвязывающих сайта. F(ab')2-фрагмент обладает способностью перекрестно связываться с антигеном.

Термин «Fab» означает фрагмент антитела, содержащий константный домен легкой цепи и домен CH1 тяжелой цепи. Используемый здесь термин «Fv» означает минимальный фрагмент антитела, который сохраняет антиген-распознающие и антигенсвязывающие сайты. В двухцепочечных Fv, эта область состоит из димера, включающего один вариабельный домен тяжелой цепи и один вариабельный домен легкой цепи, связанные нековалентной связью. В одноцепочечных Fv, один вариабельный домен тяжелой цепи и один вариабельный домен легкой цепи могут быть ковалентно связаны гибким пептидным линкером, в результате чего, легкая и тяжелая цепи могут образовывать «димерную структуру», аналогичную структуре двухцепочечных Fv. Такая структура имеет конфигурацию, при которой три CDR каждого вариабельного домена взаимодействуют друг с другом и определяют антигенсвязывающий сайт на поверхности димера VH-VL. Хотя все шесть CDR, в целом, сообщают антителу специфичность связывания с антигеном, однако, даже один вариабельный домен (или половина Fv, содержащая только три CDR, специфичных к антигену) обладает способностью распознавать антиген и связываться с ним.

Термин «комплементарность-определяющие области» или «CDR» означает части иммунологических рецепторов, которые контактируют со специфическим лигандом и определяют его специфичность. Термин «гипервариабельная область» означает аминокислотные остатки антитела, ответственные за связывание с антигеном. Гипервариабельная область обычно содержит аминокислотные остатки, происходящие от «комплементарность-определяющей области» или «CDR», и/или остатки, происходящие от «гипервариабельной петли».

Используемый здесь термин «эпитоп» означает сайты связывания с антителами на белковых антигенах. Детерминанты, то есть, эпитопы, обычно состоят из химически активных групп, расположенных на поверхности молекул, таких как аминокислоты или сахарные боковые цепи, а также обладают специфическими трехмерными структурными и зарядовыми свойствами. Считается, что антитело связывается с антигеном, если константа диссоциации этого антитела составляет ≤1 мкΜ, предпочтительно, ≤100 нМ, а наиболее предпочтительно, ≤10 нМ. Повышенная константа равновесия («KD») означает пониженную аффинность связывания эпитопа и антитела, а пониженная константа равновесия означает повышенную аффинность связывания эпитопа и антитела. Антитело с константой KD, имеющей величину «не выше, чем» указанная величина, означает, что данное антитело связывается с эпитопом при данном KD или при более высоком KD. KD является характеристикой связывания эпитопа и антитела, а «активность» является характеристикой эффективности антитела, то есть, функции антитела. При этом не следует проводить корреляцию между константой равновесия и активностью, то есть, например, относительно низкий KD автоматически не означает высокую активность.

Термин «селективно связывается», если он относится к антителу, не означает, что антитело связывается только с одним веществом, скорее всего, это следует понимать, что KD связывания антитела с первым веществом ниже, чем KD связывания антитела со вторым веществом. Антитело, которое исключительно связывается с эпитопом, связывается только с одним этим эпитопом.

При введении человеку антител, которые содержат вариабельные и/или константные области грызунов (мышей или крыс), эти антитела, например, иногда быстро выводятся из организма или вырабатывают в организме иммунный ответ против этого антитела. Во избежание необходимости использования антител, происходящих от грызунов, могут быть получены полностью человеческие антитела путем введения человеческого антитела грызунам так, чтобы у этих грызунов продуцировались полностью человеческие антитела. Термины «человеческие» и «полностью человеческие» антитела, если это не оговорено особо, являются синонимами. Термин «полностью человеческие» может быть использован в том случае, когда необходимо дифференцировать частично человеческие антитела от полностью человеческих антител. Различные методы продуцирования полностью человеческих антител известны специалистам.

Для предотвращения возможных ответов, вырабатываемых человеческим антимышиным антителом, могут быть использованы химерные антитела или как-либо иначе гуманизованные антитела. Химерные антитела имеют человеческую константную область и мышиную вариабельную область, и у некоторых пациентов могут наблюдаться ответы, вырабатываемые человеческим антихимерным антителом. Поэтому, во избежание вырабатывания возможных ответов, продуцируемых человеческим антимышиным антителом или человеческим антихимерным антителом, предпочтительнее использовать полностью человеческие антитела против мультимерных ферментов.

Полностью человеческие моноклональные антитела могут быть получены, например, путем генерирования гибридомных клеточных линий методами, известными специалистам. Другие методы получения антител включают использование последовательностей, кодирующих конкретные антитела, в целях трансформации подходящей клетки-хозяина млекопитающего, такой как клетка CHO. Трансформация может быть осуществлена любым известным методом введения полинуклеотидов в клетку-хозяина, включая, например, упаковку полинуклеотидов в вирус (или в вирусный вектор) и перенос этого вируса (или вектора) в клетку-хозяина или трансфекцию клетки-хозяина этим вирусом известными методами. Методы введения гетерологичных полинуклеотидов в клетки млекопитающих хорошо известны специалистам, и такими методами являются трансфекция, опосредуемая декстраном, преципитация фосфатом кальция, трансфекция, опосредуемая полибреном, слияние протопластов, электропорация, инкапсуляция полинуклеотида(ов) в липосомы и прямая микроинжекция ДНК в ядро. Клеточные линии млекопитающих, используемые в качестве хозяев для экспрессии, хорошо известны специалистам, и такими клеточными линиями являются, но не ограничиваются ими, клетки CHO, клетки HeLa и клетки человеческой гепатоцеллюлярной карциномы.

Антитела могут быть использованы в диагностике и/или в терапии. Так, например, антитела могут быть использованы для диагностики путем детектирования уровня одного или более пептидов согласно изобретению у индивидуума и последующего сравнения детектированного уровня со стандартным контрольным уровнем или с базовым уровнем, ранее определенным у этого индивидуума (например, до развития какого-либо заболевания). Эти антитела могут быть использованы в качестве терапевтического средства для модуляции активности одного или более пептидов согласно изобретению, и таким образом, для воздействия на данное состояние или расстройство.

Настоящее изобретение относится к наборам, включающим, без какого-либо ограничения, пептидные последовательности согласно изобретению, необязательно в комбинации с одним или более терапевтическими агентами, композициями и фармацевтическими композициями, упакованными в подходящий упаковочный материал. Набор включает, но необязательно, этикетку или вкладыш в упаковку, в котором имеются описание компонентов или инструкции по применению этих компонентов in vitro, in vivo или ex vivo. Репрезентативными инструкциями являются инструкции по лечению расстройства, связанного или ассоциированного с действием желчных кислот, такого как метаболический синдром; расстройство, ассоциированное с метаболизмом липидов или глюкозы; расстройство, ассоциированное с метаболизмом холестерина или триглицеридов; диабет типа 2; холестаз, включая, например, внутрипеченочный холестаз (например, первичный ПБЦ, ПНВХ, ПСХ, ВХБ, холестаз новорожденных и холестаз, индуцированный лекарственными средствами (например, эстрогеном)); и заболевание, ассоциированное с внепеченочным холестазом (например, прерывание поступления желчи, ассоциированное со сдавливанием опухолью, блокада желчных протоков желчными камнями); малабсорбция желчных кислот и другие расстройства, поражающие дистальный отдел тонкой кишки, включая поражения, связанные с резекцией подвздошной кишки; воспалительные заболевания кишечника (например, болезнь Крона и язвенный колит); расстройства, связанные с нарушением абсорбции желчных кислот неясной этиологии (идиопатические) и вызывающие диарею (например, диарею, ассоциированную с действием желчных кислот (ДЖК)) и симптомы заболеваний ЖКТ и рак ЖКТ, печени, и/или желчного пузыря (например, рак толстой кишки и гепатоцеллюлярный рак); и/или патологии, связанные с нарушением синтеза желчных кислот, такие как патологии, приводящие к развитию не-алкогольного стеатогепатита (НАСГ), цирроза печени, гипертензии воротной вены и т.п.

Набор может содержать группу таких компонентов, например, две или более отдельных пептидных последовательностей, или комбинацию пептидной последовательности с другой терапевтически приемлемой композицией (например, с лекарственным средством для модуляции гомеостаза желчных кислот).

Термин «упаковочный материал» означает физическую структуру, содержащую компоненты набора. Упаковочный материал может сохранять стерильность компонентов и может быть изготовлен из материала, обычно используемого для этих целей (таким материалом могут быть, например, бумага, гофрированное волокно, стекло, пластик, фольга, ампулы, флаконы, пробирки и т.п.).

Наборы согласно изобретению могут включать этикетки или вкладыши. Этикетки или вкладыши представляют собой «печатную продукцию», например, бумагу или картон, вложенные отдельно или прикрепленные к компоненту, набору или упаковочному материалу (например, к коробке), или наклеенные, например, на ампулу, пробирку или сосуд, содержащие компонент набора. Этикетки или вкладыши могут также включать компьютерный носитель информации, такой как диск (например, жесткий диск, плата, запоминающее устройство, такое как диск), оптический диск, такой как CD- или DVD-ROM/RAM, DVD, MP3, магнитная лента или электронные носители данных, такие как RAM и ROM или комбинированные системы, такие как магнитные/оптические носители данных, носитель FLASH или карта памяти.

Этикетки или вкладыши могут включать информацию об одном или более компонентах, дозах, клинической фармакологии активного(ых) ингредиента(ов), включая его (их) механизм действия, фармакокинетику и фармакодинамику. Этикетки или вкладыши могут включать информацию о производителе, номера партий, местонахождение фирмы-производителя и дату выпуска.

Этикетки или вкладыши могут включать информацию о состоянии, расстройстве, заболевании или симптомах, для лечения которых может быть использован компонент набора. Этикетки или вкладыши могут включать инструкции для врача-клинициста или для индивидуума по применению одного или более компонентов набора в способах лечения, протоколах лечения и схемах терапевтического лечения. Инструкции могут включать указания о дозах, частоте или продолжительности введения доз, и информацию по осуществлению любых способов лечения, протоколов лечения или схем терапевтического лечения, описанных в настоящей заявке. Репрезентативными инструкциями являются инструкции по лечению с использованием пептидной последовательности или по применению пептидной последовательности, описанной в настоящей заявке. Следовательно, наборы согласно изобретению могут также включать этикетки или инструкции по осуществлению любых способов и применений согласно изобретению, включая способы лечения и их применение.

Этикетки или вкладыши могут включать информацию о каком-либо благоприятном эффекте, который дает данный компонент, то есть, о профилактическом или терапевтическом эффекте. Этикетки или вкладыши могут включать информацию о возможных негативных побочных эффектах, такую как предупреждение индивидуума или противопоказания по приему конкретной композиции при определенных клинических ситуациях. Негативные побочные эффекты могут наблюдаться в том случае, если индивидуум принимает или собирается принимать один или более других лекарственных препаратов, которые могут быть несовместимыми с данной композицией, или если индивидуум проходит или планирует пройти другой курс лечения или лечение по другой схеме терапии, которые могут быть несовместимыми с приемом данной композиции, а поэтому инструкции могут включать информацию о такой несовместимости.

Наборы согласно изобретению могут также включать и другие компоненты. Каждый компонент набора может находиться в отдельном контейнере, а все контейнеры могут находиться в одной упаковке. Наборы согласно изобретению могут быть изготовлены так, чтобы они могли храниться на холоде. Наборы согласно изобретению могут быть составлены так, чтобы они содержали пептидные последовательности согласно изобретению или нуклеиновые кислоты, кодирующие пептидные последовательности. Клетки, присутствующие в наборе, могут храниться в соответствующих условиях до их применения.

Если это не оговорено особо, то все используемые здесь технические и научные термины имеют общепринятые значения, известные специалистам в области, к которой относится настоящее изобретение. Хотя для практического осуществления настоящего изобретения или для проведения тестов согласно изобретению могут быть применены методы и материалы, аналогичные или эквивалентные методам и материалам, описанным в настоящей заявке, однако, предпочтение следует отдать методам и материалам, описанным в настоящей заявке.

Все патентные заявки, публикации, патенты и другие упомянутые здесь документы, а также приводимые здесь ссылки на GenBank и ATCC во всей своей полноте вводятся в настоящее описание посредством ссылки. В случае возникновения разночтений в употреблении и определении данного термина в настоящем описании, следует отдать предпочтение определению, приведенному в данном разделе. Используемые здесь артикли «a», «an» и «the», употребляемые с существительными в единственном числе, могут относиться и к существительным во множественном числе, если это не противоречит контексту описания. Так, например, термины «пептидная последовательность» или «лечение» могут означать множество таких последовательностей, схем лечения и т.п.

Используемые во всем документе численные величины часто представлены в виде интервалов их значений. Указание этих интервалов приводится лишь для удобства и краткости, и такие интервалы не должны рассматриваться как жесткие ограничения объема изобретения, если это не противоречит контексту описания. В соответствии с этим, точно указанный интервал величин включает все возможные субинтервалы значений, все отдельные численные величины, входящие в этот интервал, и все численные величины или численные интервалы, включая целые и дробные числа, входящие в эти интервалы, если это конкретно не противоречит контексту описания. Такое представление численных величин употребляется независимо от размера интервала их значений во всем описании настоящей заявки. Так, например, интервал 90-100% включает 91-99%, 92-98%, 93-95%, 91-98%, 91-97%, 91-96%, 91-95%, 91-94%, 91-93% и т.п. Интервал 90-100% также включает 91%, 92%, 93%, 94%, 95%, 95%, 97%, и т.п., и 91,1%, 91,2%, 91,3%, 91,4%, 91,5%, и т.п., 92,1%, 92,2%, 92,3%, 92,4%, 92,5% и т.п.

Кроме того, интервал значений 1-3, 3-5, 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, 160-170, 170-180, 180-190, 190-200, 200-225, 225-250 включает 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 и т.п. В другом примере, интервал значений 25-250, 250-500, 500-1000, 1000-2500 или 2500-5000, 5000-25000, 5000-50000 включает любую численную величину или интервал, в который входят или который охватывает такие значения, например, 25, 26, 27, 28, 29...250, 251, 252, 253, 254....500, 501, 502, 503, 504... и т.п.

Кроме того, во всем документе используется ряд интервалов значений. Такой ряд значений включает комбинации верхних и нижних предельных значений, входящих в предельные значения другого ряда. Такое представление численных величин употребляется независимо от размера интервала их значений во всем описании данного патентного документа. Так, например, ряд интервалов значений, таких как 5-10, 10-20, 20-30, 30-40, 40-50, 50-75, 75-100, 100-150, включает такие интервалы, как 5-20, 5-30, 5-40, 5-50, 5-75, 5-100, 5-150, и 10-30, 10-40, 10-50, 10-75, 10-100, 10-150, и 20-40, 20-50, 20-75, 20-100, 20-150 и т.п.

Для ясности, в настоящем описании приводятся некоторые аббревиатуры. Одним из примеров являются однобуквенные обозначения аминокислотных остатков. Аминокислоты и их соответствующие трехбуквенные и однобуквенные коды приводятся ниже:

аланин Ala (A)
аргинин Arg (R)
аспарагин Asn (N)
аспарагиновая кислота Asp (D)
цистеин Cys (C)
глутаминовая кислота Glu (E)
глутамин Gln (Q)
глицин Gly (G)
гистидин His (H)
изолейцин Ile (I)

лейцин Leu (L)
лизин Lys (К)
метионин Met (M)
фенилаланин Phe (F)
пролин Pro (P)
серин Ser (S)
треонин Thr (T)
триптофан Trp (W)
тирозин Tyr (Y)
валин Val (V)

В общих чертах, представленное здесь настоящее изобретение раскрывается с использованием аффирмативной (утвердительной) формы изложения для описания различных вариантов его осуществления. Кроме того, настоящее изобретение включает, в частности, варианты, в которых полностью или частично отсутствует предмет изобретения, например, вещества или материалы, стадии и условия проведения способов, протоколов, процедур, тестов или анализов. Таким образом, даже если настоящее изобретение описано в терминах, относящихся к объектам, не включенным в настоящее описание, тем не менее, аспекты, которые конкретно не включены в данное описание, могут входить в объем настоящего изобретения.

Настоящее изобретение описано на примерах ряда вариантов его осуществления. Тем не менее, следует отметить, что в настоящее изобретение могут быть внесены различные модификации, не выходящие за рамки существа и объема изобретения. В соответствии с этим, нижеследующие примеры приводятся лишь в иллюстративных целях, и не ограничивают объема изобретения, представленного в формуле изобретения.

Примеры

Пример 1

Ниже приводится описание различных методов и материалов, применяемых в рассматриваемых здесь исследованиях.

Животные. Мыши db/db были закуплены в лаборатории The Jackson Laboratory (Bar Harbor, ME). Мыши содержались в обычных условиях их обитания с регулируемым чередованием дня и ночи (12-часов - день и 12-часов - ночь, а именно, ночь продолжается от 6:30 p.m (вечера) до 6:30 a.m (утра)), при температуре 22±4°C и влажности 50%±20%. Мыши имели свободный доступ (ad libitum) к воде (автоклавировванной дистиллированной воде) и к коммерчески доступному корму (Harlan Laboratories, Indianapolis, IN, Irradiated 2018 Teklad Global 18% Protein Rodent Diet), содержащему 17 ккал % жира, 23 ккал % белка и 60 ккал % углеводов. Все исследования на животных были разрешены Научным комитетом по уходу и содержанию животных (NGM Institutional Animal Care and Use Committee).

ДНК и аминокислотные последовательности. кДНК ОРС кодирует варианты человеческого FGF19 (FGF19 Homo sapiens, GenBank Accession No. NM_005117.2). Последовательность белка кодируется кДНК (GenBank Accession No. NP_005108.1).

ПЦР. ОРС FGF19 амплифицировали с помощью полимеразной цепной реакции (ПЦР) с использованием рекомбинантной ДНК (кДНК), полученной из человеческой ткани тонкого кишечника. Наборы реагентов для ПЦР вместе с ДНК-полимеразой Phusion® High-Fidelity были закуплены у компании New England BioLabs (F-530L, Ipswich, MA). Были использованы нижеследующие праймеры:

прямой ПЦР-праймер:

5' CCGACTAGTCACCatgcggagcgggtgtgtgg (SEQ ID NO:136) и

обратный ПЦР-праймер:

5' ATAAGAATGCGGCCGCTTACTTCTCAAAGCTGGGACTCCTC (SEQ ID NO:137).

Амплифицированный ДНК-фрагмент гидролизовали рестриктирующими ферментами Spe I и Not I (рестрикционные сайты были включены в 5'- или 3'-ПЦР-праймеры, соответственно), а затем лигировали с трансгенными AAV-векторами, которые были гидролизованы теми же самыми рестриктирующими ферментами. Вектор, используемый для экспрессии, содержал селективный маркер и экспрессионный кластер, состоящий из сильного эукариотического промотора, расположенного со стороны 5'-конца от сайта инсерции клонированной кодирующей последовательности, а за этим кластером находились 3'-нетранслируемая область и хвост полиаденилирования бычьего гормона роста. Эта экспрессионная конструкция также фланкируется внутренними концевыми повторами у 5'- и 3'-концов.

Анализ на ингибирование Cyp7a1 в первичных человеческих гепатоцитах. Первичные человеческие гепатоциты высевали на покрытые коллагеном планшеты (Becton Dickinson Biosciences) в среду Уильямса E (Invitrogen), в которую были добавлены 100 нМ дексаметазона (Sigma) и 0,25 мг/мл MatriGel™ (Becton Dickinson Biosciences). Клетки обрабатывали FGF19 или его вариантами при 37°C в течение 6 часов. Экспрессию Cyp7a1 оценивали с тремя повторностями путем проведения количественной ОТ-ПЦР (TaqMan® ABI PRISM 7700, Applied Biosystems) и нормализовали на экспрессию GAPDH.

Анализ на ингибирование Cyp7a1 in vivo. 9-недельным самцам мышей db/db (Jackson Laboratories) внутрибрюшинно инъецировали рекомбинантные белки FGF19 или FGF21 в количестве 0,1 мг/кг, 1 мг/кг и 10 мг/кг. Через 5 часов после инъекции, животных подвергали эвтаназии. Затем извлекали печень, и эту печень гомогенизировали в реагенте TRIzol® (Invitrogen). Всю РНК экстрагировали и обрабатывали ДНКазой (Ambion), а затем проводили количественный ОТ-ПЦР-анализ и нормализовали на экспрессию GAPDH.

Получение и очистка AAV. Клетки AAV293 (полученные от Agilent Technologies, Santa Clara, CA) культивировали в модифицированной по способу Дульбекко среде Игла (DMEM, Mediatech, Inc. Manassas, VA), в которую были добавлены 10% фетальная бычья сыворотка и 1× раствор антибиотика-противогрибкового средства (Mediatech, Inc. Manassas, VA). Клетки высевали с 50% плотностью на день 1 в 150 мм-планшетах для культивирования клеток, а затем, на день 2, трансфецировали методом преципитации фосфатом кальция с использованием 3 плазмид (20 мкг/планшет каждой): трансгенной AAV-плазмиды, плазмиды pHelper™ (Agilent Technologies) и AAV2/9-плазмиды (Gao et al., J. Virol. 78:6381 (2004)). Через сорок восемь (48) часов после трансфекции, клетки соскабливали с планшетов, осаждали путем центрифугирования при 3000×g и ресуспендировали в буфере, содержащем 20 мМ трис pH 8,5, 100 мМ NaCl и 1 мМ MgCl2. Суспензию замораживали на бане с сухим льдом и спиртом, а затем оттаивали на водяной бане при 37°C. Циклы замораживания и оттаивания повторяли три раза, а затем добавляли бензоназу (Benzonase®, Sigma-aldrich, St. Louis, MO) до концентрации 50 единиц/мл; после чего добавляли дезоксихолат до конечной концентрации 0,25%. После инкубирования при 37°C в течение 30 минут, клеточный дебрис осаждали путем центрифугирования при 5000×g в течение 20 минут. Вирусные частицы в супернатанте очищали в прерывистом градиенте иодиксанала (Sigma-aldrich, St. Louis, MO) как описано ранее (Zolotukhin S. et al (1999) Gene Ther. 6:973). Вирусный штамм концентрировали с использованием Vivaspin® 20 (с отсечкой молекулярной массы (MW) 100000 дальтоне, Sartorius Stedim Biotech, Aubagne, France) и ресуспендировали в забуференном фосфатом физиологическом растворе (PBS), содержащем 10% глицерин, а затем хранили при -80°C. Для определения числа копий вирусного генома, 2 мкл вирусного штамма инкубировали в 6 мкл раствора, содержащего 50 единиц/мл Benzonase®, 50 мМ трис-HCl, pH 7,5, 10 мМ MgCl2 и 10 мМ CaCl2, при 37°C в течение 30 минут.

Затем добавляли 15 мкл раствора, содержащего 2 мг/мл протеиназы K, 0,5% ДСН и 25 мМ EDTA, и полученную смесь инкубировали еще 20 минут при 55°C для высвобождения вирусной ДНК. Вирусную ДНК очищали с использованием мининабора DNeasy® Kit (Qiagen, Valencia, CA) и элюировали 40 мкл воды. Копию вирусного генома (GC) определяли с помощью количественной ПЦР.

Вирусный штамм разводили PBS до нужной концентрации GC/мл. Вирусный рабочий раствор (200 мкл) вводили мышам путем инъекции в хвостовую вену.

Анализ на гепатоцеллюлярную карциному (ГЦК). Образцы печени брали у мышей db/db через 24 недели после инъекции AAV. Оценку ГЦК регистрировали как число узелков ГЦК на поверхности всей печени мышей, которым вводили инъекции вариантов пептида, деленное на число узелков ГЦК у мышей, которым вводили инъекции FGF19 дикого типа.

Анализ на уровни FGF19/FGF21/вариантов в сыворотке. Цельную кровь (приблизительно 50 мкл/мышь), взятую из кончика хвоста мыши, собирали в обыкновенные капиллярные пробирки (BD Clay Adams SurePrep™, Becton Dickenson and Co. Sparks, MD). Сыворотку и клетки крови отделяли путем центрифугирования пробирок в центрифуге Autocrit™ Ultra 3 (Becton Dickinson and Co. Sparks, MD). Уровни FGF19, FGF21 и варианта в сыворотке определяли с использованием наборов EIA (Biovendor) в соответствии с инструкциями производителей.

Анализы на связывание и активность FGFR4. Твердофазный ELISA (анализ на связывание) и анализ на фосфорилирование ERK могут быть осуществлены с использованием очищенных рекомбинантных белков. Анализ на связывание с FGFR может быть осуществлен с помощью твердофазного ELISA. Вкратце, 96-луночный планшет может быть покрыт 2 мкг/мл анти-hFc антитела и может быть инкубирован с 1 мкг/мл FGFRl-hFc или FGFR4-hFc. Связывание с вариантами FGF19 в присутствии 1 мкг/мл растворимого β-klotho и 20 мкг/мл гепарина может быть детектировано с использованием биотинилированных анти-FGF19 антител (0,2 мкг/мл) с последующим инкубированием со стрептавидином-ПХ (100 нг/мл). Для анализа на активацию FGFR4, клетки Hep3B могут быть стимулированы вариантами FGF19 в течение 10 минут при 37°C, а затем они могут быть сразу подвергнуты лизису и проанализированы на фосфорилирование ERK с использованием коммерчески доступного набора, поставляемого фирмой Cis-Bio.

Пример 2

Для подтверждения ингибирования экспрессии cyp7a1 вариантами FGF19, например, описанными здесь вариантами, ингибирование экспрессии cyp7a1 под действием FGF19 дикого типа определяли после введения различных концентраций. Воздействие FGF21 оценивали путем сравнения.

Вкратце, на время 0, мышам db/db внутрибрюшинно вводили дозу рекомбинантного FGF19 (0,1 мг/кг; 1 мг/кг; 10 мг/кг) или рекомбинантного FGF21 (0,1 мг/кг; 1 мг/кг; 10 мг/кг). Через пять часов после введения дозы извлекали печень, экстрагировали РНК и определяли уровень экспрессии cyp7a1 с помощью ПЦР в реальном времени (кол.ПЦР), при этом, в качестве нормализованного контроля использовали GADPH. У мышей каждой группы, n=3, величины уровней экспрессии cyp7a1 для различных концентраций FGF19 и FGF21 сравнивали с величинами уровней экспрессии у мышей, которым вводили дозу PBS-носителя, используемого в качестве контроля.

Как показано на фиг. 1, введение FGF19 приводило к резкому снижению уровня экспрессии cyp7a1 в зависимости от концентрации. Хотя введение FGF21 также приводило к снижению уровня экспрессии cyp7a1, однако, этот эффект был менее заметным, чем это наблюдалось в случае FGF19.

Влияние варианта M70 на уровень экспрессии cyp7a1 в человеческих первичных гепатоцитах было сравнимым с влиянием FGF19. Как показано на фиг. 2, вариант M70 ингибировал экспрессию cyp7a1 на уровне, сравнимом с уровнем ингибирования под действием FGF19.

Пример 3

С помощью анализов, описанных выше, ингибирование cyp7a1 в первичных человеческих гепатоцитах определяли для ряда вариантов FGF19. Как показано на фиг. 3 - фиг. 5, несколько вариантов (например, M1, M2 и т.п.) продемонстрировали высокий уровень ингибирования cyp7a1.

Для оценки влияния некоторых дополнительных вариантов FGF19 на ингибирование Cyp7a1 были проведены клеточный анализ in vitro (в первичных человеческих гепатоцитах) и анализ in vivo (путем введения доз белка мышам db/db), где указанные варианты сравнивали с контролем, то есть, с физиологическим раствором. На фиг. 5 представлены результаты (IC50 и % Cyp7a1) в виде таблицы. Хотя большинство оцениваемых вариантов FGF19 обладали Cyp7a1-ингибирующей активностью, однако, несколько вариантов (например, M90, M96, M98, M5 и M32) уже не ингибировали Cyp7a1.

Варианты FGF19, которые сохраняли Cyp7a1-ингибирующую активность, могут быть также оценены в анализе на ГЦК (или в другом релевантном анализе или с использованием другой модели) как описано выше для идентификации вариантов, которые могут быть использованы для модуляции метаболизма желчных кислот и/или для лечения заболеваний, ассоциированных с действием желчных кислот (например, диареи, вызываемой желчными кислотами, и первичного билиарного цирроза), но не вызывающих развитие ГЦК. В графическом материале представлены данные для вариантов, которые были оценены в анализа на ГЦК.

Пример 4

Ниже представлены систематизированные данные для 25 дополнительных вариантов пептидов, проанализированных на активность в повышении уровня липидов и онкогенную активность. Эти данные явно указывают на положительную корреляцию между активностью в повышении уровня липидов и онкогенезом, как было определено в анализе на образование ГЦК у мышей db/db.

В таблицах систематизированы различные пептидные варианты. Такие репрезентативные пептидные варианты имеют С-концевую последовательность FGF19:

PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188) в C-концевой части, например, за аминокислотными остатками «TSG». Интересно отметить, что пептидные варианты (всего 7, включая M5), которые не вызывают статистически значимого увеличения уровня липидов, не индуцируют образования ГЦК. В противоположность этому, все пептидные варианты (всего 17), которые вызывают статистически значимое увеличение уровня липидов, также индуцируют образование ГЦК у мышей. Полученные данные указывают на строгую положительную корреляцию между активностью в повышении уровня липидов и образованием ГЦК. В соответствии с этим, активность в повышении уровня липидов может быть использована в качестве индикатора и/или прогностического фактора образования ГЦК у животных.

M88 (H31A/S141A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPAGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLAHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:88);

M89 (H31A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPAGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:89);

M90 (K127A/R129A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQAQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:90);

M91 (K127A/S141A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQRQLYKNRGFLPLAHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:91);

M92 (K127A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQRQLYKNRGFLPLSAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:92).

M93 (R129A/S141A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQAQLYKNRGFLPLAHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:93);

M94 (S141A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLAAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:94);

M95 (K127A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQRQLYKNRGFLPLSAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:95);

M96 (K127A/R129A/S141A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQAQLYKNRGFLPLAHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:96);

M97 (K127A/R129A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQAQLYKNRGFLPLSAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:97);

M98 (K127A/R129A/S141A/H142A):

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAAQAQLYKNRGFLPLAAFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:98).

Пример 5

Ниже представлены систематизированные данные для дополнительных пептидных вариантов FGF19, проанализированных на активность в снижении уровня глюкозы и активность в повышении уровня липидов.

В таблице 4 проиллюстрированы пептидные «внутренние последовательности» 35 дополнительных вариантов FGF19, обозначенных M5-M40. Такие репрезентативные пептидные варианты имеют С-концевую последовательность FGF19:

PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188) у С-концевой части, например, за аминокислотными остатками «TSG» внутренней последовательности. Эти данные явно указывают на то, что варианты M6, M7, M8, mM38 и M39 обладают нужными свойствами, такими как активность в снижении уровня глюкозы, но не обладают какой-либо статистически значимой активностью в повышении уровня липидов у мышей db/db.

В таблице 5 проиллюстрированы пептидные последовательности дополнительных вариантов.

Таблица 5

Дополнительные варианты (SEQ ID NN:41, 42 и 44-46)

M41: RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (SEQ ID NO:41);

M42: HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (SEQ ID NO:42);

M44: RPLAFSDAGPHVHYGWGDPIRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS (SEQ ID NO:44);

M45: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:45);

M46: RPLAFSDAGPHVHYGWGDPIRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:46).

В таблице 6 представлены пептидные последовательности 3 вариантов FGF19, обозначенные M1, M2 и M69. Полученные данные явно указывают на то, что эти три варианта обладают нужными свойствами, такими как активность в снижении уровня глюкозы у мышей db/db. Указанные три варианта, очевидно, способствуют повышению уровня липидов у мышей db/db.

Таблица 6

Дополнительные варианты (SEQ ID NN: 1, 2 и 69)

M1:

RPLAFSDASPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:1 или 139);

M2:

RPLAFSDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:2 или 140);

M69:

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:69);

Пример 6

Ниже представлены систематизированные данные, указывающие на то, что FGF19 снижает массу тела у мышей с ожирением, вызываемым избыточным кормлением, и у мышей ob/ob, а также снижает активность в образовании опухоли печени и массу тела у мышей db/db.

Мышам инъецировали FGF19 или FGF21 в AAV-векторе. Массу тела регистрировали через 4 недели после инъекции.

Таблица 7
FGF19 снижает массу тела у мышей с ожирением, вызываемым избыточным кормлением, и у мышей ob/ob (последовательности соответствуют аминокислотам 1-29 SEQ ID NO:99 и аминокислотам 1-25 SEQ ID NO:100, соответственно)

N-концевой домен Внутренняя последовательность Снижение массы тела у мышей с ожирением, вызываемым избыточным кормлением Снижение массы тела у мышей ob/ob
FGF19 RPLAFSDAGPHVHYGWGDPI RLRHLYTSG + +
FGF21 HPIPDSSPLLQ--FGGQV RQRYLYTDD + +

Таблица 8
Корреляция массы тела и образования опухоли печени под действием FGF19, FGF21 и выбранных вариантов у мышей db/db (см., например, SEQ ID NN:99, 100, 5, 6, 32, 52 и 69)
N-концевой домен Внутренняя последовательность SEQ ID NO Узелки опухоли печени Масса тела
FGF19 RPLAFSDAGPHVHYGWGDPI RLRHLYTSG 99 (а.к. 1-29) + Увеличение
FGF21 HPIPDSSPLLQ--FGGQV RQRYLYTDD 100 (а.к. 1-25) - Снижение
M5 R-HPIPDSSPLLQ--FGGQV RLRHLYTSG 5 (а.к. 1-26) - Увеличение
M6 R-----DSSPLLQ--FGGQV RLRHLYTSG 6 (а.к. 1-22) - Снижение
M32 R-HPIPDSSPLLQ--FGDQV RLRHLYTSG 32 (а.к. 1-26) - Снижение
M52 R-----DSSPLLQ--WGDPI RLRHLYTSG 52 (а.к. 1-22) - Снижение
M69 R-----DSSPLVHYGWGDPI RLRHLYTSG 69 (а.к. 1-24) - Увеличение

Пример 7

Ниже описано исследование, которое показало, что вариант пептида M5 и вариант пептида M69 снижают уровень глюкозы в крови.

Мышам (ob/ob) инъецировали (подкожно) вариант M5 (0,1 и 1 мг/кг, s.c.) или FGF19 (1 мг/кг, s.c), или вариант M69 (0,1 и 1 мг/кг, s.c.) или FGF19 (1 мг/кг, s.c). Уровни глюкозы в плазме измеряли через 2, 4, 7 и 24 часа после инъекции. Результаты, полученные с использованием варианта M5 и варианта M69, показали, что эффекты снижения уровней глюкозы, достигаемые с использованием этих вариантов и FGF19 дикого типа, были аналогичными (данные не приводятся).

Пример 8

В этом примере описано несколько вариантов полипептидов и их конкретные свойства, включая влияние этих вариантов на снижение уровня глюкозы, параметры липидного профиля и образование ГЦК.

В частности, в таблице 9 приводится сравнение данных, полученных для вариантов M5 (SEQ ID NO:5), M6 (SEQ ID NO:6) и M50 (SEQ ID NO:50), с данными, полученными для соответствующих вариантов полипептидов (обозначенных M144, M145 и M146, соответственно), имеющих N-концевые делеции Arg (R). В таблице перечислены только некоторые домены последовательностей для каждого варианта: N-концевой домен, внутренняя последовательность и область «складка-8/петля-8/складка-9».

Таблица 9
N-концевой домен n Внутренняя последовательность Область «складка-8/петля-8/складка-9» Снижение уровня глюкозы Снижение массы тела Повышение уровня ЛВП Повышение уровня триглицеридов Образование ГЦК
FGF19 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:99)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:99)
//EEIRPDGYNVY//(а.к. 102-112 SEQ ID NO:99) + - + + +
FGF21 HPIPDSSPLLQ--FGGQV
(а.к. 1-20 SEQ ID NO:100)
RQRYLYTDD
(а.к. 21-29 SEQ ID NO:100)
//ELLLEDGYNVY//(а.к. 97-107 SEQ ID NO:100) + + - - -
M5 R-HPIPDSSPLLQ--FGGQV
(а.к. 1-17 SEQ ID NO:5)
RLRHLYTSG (а.к. 18-26 SEQ ID NO:5) //EEIRPDGYNVY//(а.к. 99-109 SEQ ID NO:5) + - - - -
M6 R-------DSSPLLQ--FGGQV
(а.к. 1-14 SEQ ID NO:6)
RLRHLYTSG (а.к. 15-23 SEQ ID NO:6) //EEIRPDGYNVY//(а.к. 95-105 SEQ ID NO:6) + - - - -
M50 R-HPIPDSSPLLQ--FGDQV
(а.к. 1-17 SEQ ID NO:50)
RLRHLYTSG (а.к. 18-26 SEQ ID NO:50) //EEIRPDGYNVY//(а.к. 99-109 SEQ ID NO:50) + + - - -
M144 --HPIPDSSPLLQ--FGGQV
(а.к. 2-17 SEQ ID NO:5)
RLRHLYTSG (а.к. 18-26 SEQ ID NO:5) //EEIRPDGYNVY//(а.к. 99-109 SEQ ID NO:5) + - - - -
M145 ------DSSPLLQ—FGGQV
(а.к. 2-14 SEQ ID NO:6)
RLRHLYTSG(а.к. 15-23 SEQ ID NO:6) //EEIRPDGYNVY//(а.к. 95-105 SEQ ID NO:6) + - - - -
M146 --HPIPDSSPLLQ--FGDQV
(а.к. 2-17 SEQ ID NO:50)
RLRHLYTSG(а.к. 18-26 SEQ ID NO:50) //EEIRPDGYNVY//(а.к. 99-109 SEQ ID NO:50) + + - - -

Как показали данные, представленные в таблице 9, делеция N-концевого Arg (R) не вызывает значительного снижения уровня глюкозы, снижения массы тела, повышения уровня ЛВП и триглицеридов и образования ГЦК.

Пример 9

В этом примере описано несколько вариантов пептидов, имеющих аминокислотные замены в области петли-8 FGF19, а также описано влияние этих вариантов на массу тела, некоторые метаболические параметры и образование ГЦК.

В таблице 10 представлены данные для вариантов полипептидов, обозначенных M3, M139, M140, M141 и M160. Аминокислотная последовательность для M3 представлена в настоящем описании, а аминокислотные последовательности для M139, M140, M141 и M160 представлены ниже:

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M139) (SEQ ID NO:193);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIREDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M140) (SEQ ID NO:194);

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGWDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILCDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M141) (SEQ ID NO:195); и

RPLAFSDAGPHVHYGWGDPIRQRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (M160) (SEQ ID NO:196).

В таблице 10 перечислены только домены последовательностей для каждого из вышеупомянутых вариантов, а именно: N-концевой домен, внутренняя последовательность и область «складка-8/петля-8/складка-9». Хотя конкретные аминокислотные остатки, составляющие область петли-8, широко не описаны в литературе, однако, остатки 127-129 FGF19 определены здесь как остатки, составляющие область петли-8.

Таблица 10
N-концевой домен n Внутренняя последовательность Область «складка-8/петля-8/складка-9» Снижение уровня глюкозы Снижение массы тела Повышение уровня ЛВП Повышение уровня триглицеридов Образование ГЦК
FGF19 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:99)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:99
//EEIRPDGYNVY//
(а.к. 102-112 SEQ ID NO:99)
+ - + + +
FGF21 HPIPDSSPLLQ--FGGQV
(а.к. 1-20 SEQ ID NO:100)
RQRYLYTDD
(а.к. 21-29 SEQ ID NO:100)
//ELLLEDGYNVY//
(а.к. 97-107 SEQ ID NO:100)
+ + - - -
M3 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:3)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:3)
//EEILEDGYNVY//
(а.к. 102-112 SEQ ID NO:3)
+ + + + +/-
M139 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO193)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:193)
//EEILPDGYNVY//
(а.к. 102-112 SEQ ID NO:193)
+ - + + +
M140 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:194)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:194)
//EEIREDGYNVY//
(а.к. 102-112 SEQ ID NO:194)
+ + + + +/-
M141 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:195)
RLRHLYTSG
(а.к. 21-29 SEQ ID NO:195)
//EEILCDGYNVY// (а.к. 102-112 SEQ ID NO:195) + - + + +
M160 RPLAFSDAGPHVHYGWGDPI
(а.к. 1-20 SEQ ID NO:196)
RQRHLYTSG
(а.к. 21-29 SEQ ID NO:196)
//EEILEDGYNVY//
(а.к. 102-112 SEQ ID NO:196)
+ + + + -

Как показано в таблице 10, замена P128E, очевидно, крайне необходима для предупреждения образования ГЦК, но этой замены, как таковой, недостаточно для предупреждения образования ГЦК. В частности, более надежное предупреждение образования ГЦК может быть достигнуто в случае замены P128E в M140. И наоборот, одна замена R127L не предотвращает образование ГЦК (см. M139). Как показало сравнение с M3, комбинация замен R127L и P128E приводит к снижению образования ГЦК, но не к полному ее предотвращению. Однако, неожиданно было обнаружено, что комбинация замен R127L и P128E вместе с заменой Leu (L) на Gln (Q) во внутренней области FGF19 с высокой степенью надежности предупреждает образование ГЦК (см. M160).

Эти данные показали, что область петли-8 FGF19 играет определенную роль в образовании ГЦК. Аминокислотные остатки, расположенные за пределами области петли-8 (например, замены во внутренней области), могут обеспечивать более надежное предупреждение образования ГЦК.

M1 (SEQ ID NO:1)

RPLAFSDASPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M2 (SEQ ID NO:2)

RPLAFSDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M3 (SEQ ID NO:3)

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M5 (SEQ ID NO:5)

RHPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M5-R (SEQ ID NO:160)

HPIPDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M48 (SEQ ID NO:48)

RDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M49 (SEQ ID NO:49)

RPLAFSDSSPLLQFGGQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M50 (SEQ ID NO:50)

RHPIPDSSPLLQFGDQVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEILEDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M51 (SEQ ID NO:51)

RHPIPDSSPLLQFGGNVRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M52 (SEQ ID NO:52)

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M53 (SEQ ID NO:192)

MDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M69 (SEQ ID NO:69)

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M70 (SEQ ID NO:70)

MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M71 (SEQ ID NO:71)

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHSLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS;

M72 (SEQ ID NO:72)

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS;

M73 (SEQ ID NO:73)

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVVQDELQGVGGEGCHMHPENCKTLLTDIDRTHTEKPVWDGITGE;

M75 (SEQ ID NO:75)

RVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

M76 (SEQ ID NO:76)

RGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK;

FGF19 (SEQ ID NO:99)

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK.

Пример 10

В этом примере показано, что введение M70 человеку приводит к ингибированию 7a-гидрокси-4-холестен-3-она (C4), то есть, маркера синтеза желчных кислот.

Индивидуумы, участвующие в исследовании: В исследованиях участвовали здоровые взрослые люди в возрасте 18-65 лет с нормальной массой тела (индекс массы тела, BMI=20-35). Протокол исследования был одобрен Австралийским Комитетом по Этике исследований с участием человека, и у каждого участника брали письменное согласие. Критериями включения каждого индивидуума в исследование являются: хорошее здоровье, определяемое по отсутствию клинически значимых симптомов заболеваний в анамнезе, по оценке физического состояния, по ЭКГ с 12 отведениями, по данным клинических лабораторных анализов и скринингу параметров жизненно важных функций. Из эксперимента были исключены индивидуумы, у которых в анамнезе имелись клинические манифестации каких-либо серьезных метаболических, аллергических, кожных, печеночных, почечных, гематологических, легочных, сердечно-сосудистых, желудочно-кишечных, нервных или психических расстройств.

Протокол исследования. Данное исследование представляет собой рандомизированное плацебо-контролируемое испытание, проводимое двойным слепым методом. Предварительный скрининг индивидуумов осуществляли за 7-30 дней до их включения в исследование, и перед лечением проводили базовую оценку. Каждому индивидууму ежедневно подкожно инъецировали одну ударную дозу M70 в количестве 3 мг/день в течение 7 дней. Пробы крови собирали в гепаринизированные пробирки посредством введенного катетера. Затем проводили анализ проб крови, взятых на день 1 и день 7 через 4,5 часа или 24 часа после введения M70 или плацебо. Для мониторинга ферментативной активности CYP7A1 (активности в отношении синтеза желчных кислот) использовали уровни 7a-гидрокси-4-холестен-3-она (C4) в сыворотке. Анализы отдельных проб сыворотки проводили после экстракции образца, а затем эти пробы анализировали с помощью жидкостной хроматографии высокого давления (ЖХВД) как описано в литературе (Galman et al. (2003) J. Lipid Res. 2003;44(4):859-66).

Результаты. Данные, представленные на фиг. 6, показали, что уровни С4 в сыворотке, на дни 1 и 7, через 4,5 часа или 24 часа после введения дозы, значительно снижались у этих пациентов по сравнению с пациентами, принимавшими плацебо.

Пример 11

В этом примере показана активация передачи сигнала мышиного FGFR4-β-klotho под действием FGF19, M3 и M70 в клеточной линии крысиных миобластов.

Методы: ELK-люциферазный анализ проводили с использованием клеток L6, временно трансфецированных мышиным FGFR4, β-klotho и репортерными конструкциями, содержащими 5 × UAS-люциферазу и GAL4-ДНК-связывающий домен (DBD), присоединенный к ELK1. В этой системе, люциферазная активность регулируется киназой, регулируемой эндогенным фосфорилированным внеклеточным сигналом (ERK). Клетки инкубировали с лигандами в течение 6 часов, а затем подвергали лизису и оценивали на люциферазную активность.

Анализ на активацию клеточного рецептора проводили для оценки способности мышиного FGFR4 опосредовать лиганд-зависимую передачу сигнала в присутствии β-klotho. Для этой цели, клеточную линию крысиных миобластов L6, в которых не наблюдалась эндогенная экспрессия этих белков, трансфецировали ДНК, кодирующими мышиные FGFR4 и β-klotho, а также плазмидами, содержащими репортерную систему на основе Elk1-зависимого химерного фактора транскрипции.

После трансфекции, зависимость экспрессии люциферазы от концентрации лиганда анализировали в лизатах целых клеток в присутствии субстрата люциферина.

Результаты: Было обнаружено, что ко-экспрессия FGFR4 и β-klotho в клетках L6 усиливает активацию путей передачи внутриклеточных сигналов под действием M3, M70 и FGF19 (EC50=20, 38 и 53 пМ, соответственно (см. таблицу 11 и фиг. 7).

Таблица 11
Ко-экспрессия мышиного комплекса FGFR4/β-klotho в клетках L6 усиливает активацию путей передачи внутриклеточных сигналов под действием FGF19, M3 и M70
Лиганд FGFR4/β-klotho
EC50 (нМ) Emax (кратность усиления)
FGF19 52,5±0,01 1,82±0,09
M3 19,8+0,04 1,68+0,04
M70 38,3±0,12 1,85±0,14
EC50 = полумаксимальная эффективная концентрация; Emax = максимальная эффективность. Данные представлены как среднее ± ср. кв. откл.

Полученные данные дают основание предположить, что образование третичного комплекса между корецепторами FGFR4-β-klotho и когнатными лигандами играет важную роль в повышении активации передачи внутриклеточного сигнала.

Список последовательностей

Описание настоящего изобретения подано вместе с копией Списка последовательностей, сохраненной на считываемом компьютером носителе (CRF) данных. Этот файл CRF под названием 13370-007_SEQLIST.txt, который был создан 26 декабря 2013 г. и имеет размер 241577 байтов, идентичен представленной бумажной копии Списка последовательностей и во всей своей полноте вводится в настоящее описание посредством ссылки.

1. Способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, у субъекта, включающий введение пептида указанному субъекту, где указанный пептид содержит:

a) N-концевую область, включающую по меньшей мере семь аминокислотных остатков; где N-концевая область содержит DSSPL (SEQ ID NO:121) или DASPH (SEQ ID NO:122); и

b) C-концевую область, содержащую

(i) первую последовательность С-концевой области, содержащую WGDPIRLRHLYTSG (аминокислотные остатки 16-29 последовательности SEQ ID NO:99 [FGF19]), где остаток W соответствует положению первой аминокислоты указанной С-концевой области, и

(ii) вторую последовательность С-концевой области, содержащую PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (аминокислотные остатки 30-194 последовательности SEQ ID NO: 99 [FGF19]), или последовательность, содержащую от 1 до 5 аминокислотных замен, делеций или инсерций;

где пептид

(i) связывается с рецептором фактора роста фибробластов 4 (FGFR4) c аффинностью, равной или большей, чем аффинность связывания FGF19 с FGFR4;

(ii) активирует FGFR4 в степени или количестве, равном или большем, чем FGF19;

(iii) обладает одним из пониженного образования гепатоцеллюлярной карциномы (ГЦК), повышенной активности в отношении снижения уровня глюкозы, пониженной активности в отношении увеличения уровня липидов, пониженной активности в отношении увеличения уровня триглицеридов, пониженной активности в отношении увеличения уровня холестерина, пониженной активности в отношении увеличения уровня не-ЛВП или ЛВП по сравнению с FGF19 или по сравнению с последовательностью варианта FGF19, где последовательность WGDPI в положениях аминокислот 16-20 FGF19 (SEQ ID NO:99) заменена любыми из GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP, WGDPI; и/или

(iv) имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21;

посредством чего осуществляется лечение расстройства, связанного или ассоциированного с действием желчных кислот, у субъекта.

2. Способ по п. 1, где вторая последовательность С-концевой области пептида содержит 1-5 аминокислотных замен, делеций или инсерций.

3. Способ по п. 1, где пептид составляет менее чем около 250 аминокислот в длину.

4. Способ по п. 1, где N-концевая область содержит аминокислотные остатки VHYG (SEQ ID NO:101), DASPHVHYG (SEQ ID NO:102) или DSSPLVHYG (SEQ ID NO:103).

5. Способ по п. 4, где G соответствует последнему положению N-концевой области.

6. Способ по п. 1, где N-концевая область содержит аминокислотные остатки DSSPLLQ (SEQ ID NO:104) и где остаток Q представляет собой аминокислоту в последнем положении N-концевой области.

7. Способ по п. 5, где N-концевая область дополнительно включает:

RHPIP (SEQ ID NO:106), где R представляет собой аминокислоту в первом положении N-концевой области;

HPIP (SEQ ID NO:107), где H представляет собой аминокислоту в первом положении N-концевой области;

RPLAF (SEQ ID NO:108), где R представляет собой аминокислоту в первом положении N-концевой области;

PLAF (SEQ ID NO:109), где P представляет собой аминокислоту в первом положении N-концевой области; или

R, где R представляет собой аминокислоту в первом положении N-концевой области.

8. Способ по п. 6, где N-концевая область дополнительно включает:

RHPIP (SEQ ID NO:106), где R представляет собой аминокислоту в первом положении N-концевой области;

HPIP (SEQ ID NO:107), где H представляет собой аминокислоту в первом положении N-концевой области;

RPLAF (SEQ ID NO:108), где R представляет собой аминокислоту в первом положении N-концевой области;

PLAF (SEQ ID NO:109), где P представляет собой аминокислоту в первом положении N-концевой области; или

R, где R представляет собой аминокислоту в первом положении N-концевой области.

9. Способ по п. 1, где N-концевая область содержит аминокислотные остатки DSSPLLQFGGQV (SEQ ID NO:105) и где остаток V соответствует последнему положению N-концевой области.

10. Способ по п. 1, где аминокислотные остатки HPIP (SEQ ID NO:107) представляют собой первые 4 аминокислотных остатка N-концевой области.

11. Способ по п. 1, где

в первом положении N-концевой области присутствует остаток R или М;

в первом и втором положениях N-концевой области присутствует последовательность MR, RM, RD, DS, MD или MS;

в 1-3 положениях N-концевой области присутствует последовательность MDS, RDS, MSD, MSS или DSS;

в 1-4 положениях N-концевой области присутствует последовательность RDSS (SEQ ID NO:115) или MDSS (SEQ ID NO:116);

в 1-5 положениях N-концевой области присутствует последовательность MRDSS (SEQ ID NO:117);

в 1-6 положениях N-концевой области присутствует последовательность MDSSPL (SEQ ID NO:119), или

в 1-7 положениях N-концевой области присутствует последовательность MSDSSPL (SEQ ID NO:120).

12. Способ по п. 1, где пептид содержит N-концевую область и первую C-концевую область, имеющую аминокислотную последовательность, содержащую или состоящую из:

RPLAFSDASPHVHYGWGDPIRLRHLYTSG (аминокислоты 1-29 SEQ ID NO:1);

PLAFSDASPHVHYGWGDPIRLRHLYTSG (аминокислоты 2-29 SEQ ID NO:1);

RPLAFSDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-29 SEQ ID NO:2);

PLAFSDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 2-29 SEQ ID NO:2);

RHPIPDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-26 SEQ ID NO:8);

RHPIPDSSPLLQFGWGDPIRLRHLYTSG (аминокислоты 1-28 SEQ ID NO:9);

RPLAFSDSSPLVHWGDPIRLRHLYTSG (аминокислоты 1-27 SEQ ID NO:26);

PLAFSDSSPLVHWGDPIRLRHLYTSG (аминокислоты 2-27 SEQ ID NO:26);

HPIPDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-25 SEQ ID NO:47);

RDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-22 SEQ ID NO:52);

DSSPLLQWGDPIRLRHLYTSG (аминокислоты 2-22 SEQ ID NO:52);

MDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-24 SEQ ID NO:53);

RDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-24 SEQ ID NO:69);

DSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 2-24 SEQ ID NO:69);

MRDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-25 SEQ ID NO:70);

DSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-23 SEQ ID NO:141);

HPIPDSSPLLQFGWGDPIRLRHLYTSG (аминокислоты 1-27 SEQ ID NO:163); или

MDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-22 SEQ ID NO:192).

13. Способ по п. 1, где в первом положении аминокислоты N-концевой области находится остаток метионина (M), остаток аргинина (R), остаток серина (S), остаток гистидина (H), остаток пролина (P), остаток лейцина (L) или остаток аспарагиновой кислоты (D).

14. Способ по п. 1, где N-концевая область не имеет остаток метионина (М) или остаток аргинина (R) в первом положении аминокислоты N-концевой области.

15. Способ по п. 1, где N-концевая область включает любую одну из следующих аминокислотных последовательностей: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120) или SDSSPL (SEQ ID NO:112).

16. Способ по п. 1, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:26, SEQ ID NO:47, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:69, SEQ ID NO:70; SEQ ID NO:141, SEQ ID NO:163 или SEQ ID NO:192.

17. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1, 2, 8, 9, 26, 52 или 69, где остаток аргинина (R) в первом положении аминокислоты N-концевой области последовательности является делетированным.

18. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1.

19. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:2.

20. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:8.

21. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:9.

22. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:26.

23. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:47.

24. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:52.

25. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:53.

26. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:141.

27. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:163.

28. Способ по п. 16, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:192.

29. Способ по п. 1, где вторая последовательность С-концевой области содержит по меньшей мере одну аминокислотную замену в последовательности EIRPD SEQ ID NO:99.

30. Способ по п. 29, где по меньшей мере одна аминокислотная замена сделана в последовательности IRP последовательности EIRPD SEQ ID NO:99.

31. Способ по п. 29, где по меньшей мере одна аминокислотная замена сделана в последовательности RP последовательности EIRPD SEQ ID NO:99.

32. Способ по п. 31, где последовательность RP заменена последовательностью LE.

33. Способ по п. 1, где указанный пептид слит с Fc-областью иммуноглобулина.

34. Способ по п. 1, где пептид обладает по меньшей мере одним из пониженной способности к образованию ГЦК, повышенной активности в отношении снижения уровня глюкозы или пониженной активности в отношении увеличения уровня липидов по сравнению с FGF19 или с вариантом последовательности FGF19, в которой в положениях аминокислот 16-20 FGF19 (SEQ ID NO:99) последовательность WGDPI заменена любой из последовательностей GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP или FGDPI.

35. Способ по п. 34, где образование ГЦК, активность в отношении снижения уровня глюкозы или активность в отношении увеличения уровня липидов определяют у мышей db/db.

36. Способ по п. 34, где пептид имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21.

37. Способ по п. 36, где активность в отношении снижения мышечной массы определяют у мышей db/db.

38. Способ по п. 1, где пептид составляют в виде фармацевтической композиции, дополнительно содержащей фармацевтически приемлемый носитель.

39. Способ по п. 1, дополнительно включающий проведение дополнительной терапии у указанного субъекта.

40. Способ по п. 1, где указанный способ снижает синтез желчных кислот у субъекта.

41. Способ по п. 1, где указанный способ снижает уровень CYP7a1 у субъекта.

42. Способ по любому из пп. 1-41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой первичный билиарный цирроз (ПБЦ).

43. Способ по любому из пп. 1-41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой холестаз.

44. Способ по любому из пп. 1-41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой первичный склерозирующий холангит.

45. Способ по любому из пп. 1–41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой диарею, ассоциированную с действием желчных кислот (ДЖК).

46. Способ по любому из пп. 1–41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой внутрипеченочный холестаз беременных (ВХБ).

47. Способ по любому из пп. 1–41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой нарушение синтеза желчных кислот.

48. Способ по любому из пп. 1–41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой малабсорбцию желчных кислот.

49. Способ по любому из пп. 1–41, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой неалкогольный стеатогепатит (НАСГ).

50. Способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, у субъекта, включающий введение пептида указанному субъекту, где указанный пептид имеет аминокислотную последовательность, содержащую или состоящую из MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:70);

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:69);
RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:52); или
MDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:192); посредством чего осуществляется лечение расстройства, связанного или ассоциированного с действием желчных кислот у субъекта.

51. Способ по п. 50, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:70.

52. Способ по п. 50, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:70.

53. Способ по п. 50, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:69.

54. Способ по п. 50, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:69.

55. Способ по п. 50, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:52.

56. Способ по п. 50, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:52.

57. Способ по п. 50, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:192.

58. Способ по п. 50, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:192.

59. Способ по п. 50, где аминокислотная последовательность содержит по меньшей мере одну аминокислотную замену в последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

60. Способ по п. 59, где по меньшей мере одна аминокислотная замена сделана в последовательности IRP последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

61. Способ по п. 59, где по меньшей мере одна аминокислотная замена сделана в последовательности RP последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

62. Способ по п. 61, где последовательность RP заменена последовательностью LE.

63. Способ по п. 50, где указанный пептид слит с Fc-областью иммуноглобулина.

64. Способ по п. 50, где пептид составляют в виде фармацевтической композиции, дополнительно содержащей фармацевтически приемлемый носитель.

65. Способ по п. 50, дополнительно включающий проведение дополнительной терапии у указанного субъекта.

66. Способ по п. 50, где указанный способ снижает синтез желчных кислот у субъекта.

67. Способ по п. 50, где указанный способ снижает уровень CYP7a1 у субъекта.

68. Способ по любому из пп. 50-67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой ПБЦ.

69. Способ по любому из пп. 50-67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой холестаз.

70. Способ по любому из пп. 50-67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой первичный склерозирующий холангит.

71. Способ по любому из пп. 50–67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой ДЖК.

72. Способ по любому из пп. 50–67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой ВХБ.

73. Способ по любому из пп. 50–67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой нарушение синтеза желчных кислот.

74. Способ по любому из пп. 50–67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой малабсорбцию желчных кислот.

75. Способ по любому из пп. 50–67, где расстройство, связанное или ассоциированное с действием желчных кислот, представляет собой НАСГ.

76. Способ модуляции гомеостаза желчных кислот у субъекта, включающий введение пептида указанному субъекту, где указанный пептид содержит:

a) N-концевую область, включающую по меньшей мере семь аминокислотных остатков; где N-концевая область содержит DSSPL (SEQ ID NO:121) или DASPH (SEQ ID NO:122); и

b) C-концевую область, содержащую

(i) первую последовательность С-концевой области, содержащую WGDPIRLRHLYTSG (аминокислотные остатки 16-29 последовательности SEQ ID NO:99 [FGF19]), где остаток W соответствует положению первой аминокислоты указанной С-концевой области, или

(ii) вторую последовательность С-концевой области, содержащую PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (аминокислотные остатки 30-194 последовательности SEQ ID NO:99 [FGF19]), или последовательность, содержащую от 1 до 5 аминокислотных замен, делеций или инсерций;

где пептид

(v) связывается с рецептором фактора роста фибробластов 4 (FGFR4) c аффинностью, равной или большей, чем аффинность связывания FGF19 с FGFR4;

(vi) активирует FGFR4 в степени или количестве, равном или большем, чем FGF19;

(vii) обладает одним из пониженного образования гепатоцеллюлярной карциномы (ГЦК), повышенной активности в отношении снижения уровня глюкозы, пониженной активности в отношении увеличения уровня липидов, пониженной активности в отношении увеличения уровня триглицеридов, пониженной активности в отношении увеличения уровня холестерина, пониженной активности в отношении увеличения уровня не-ЛВП или ЛВП по сравнению с FGF19 или по сравнению с последовательностью варианта FGF19, где последовательность WGDPI в положениях аминокислот 16-20 FGF19 (SEQ ID NO:99) заменена любыми из GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP; и/или

(viii) имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21;

посредством чего осуществляется модуляция гомеостаза желчных кислот у субъекта.

77. Способ по п. 76, где вторая последовательность С-концевой области пептида содержит 1-5 аминокислотных замен, делеций или инсерций.

78. Способ по п. 76, где пептид составляет менее чем около 250 аминокислот в длину.

79. Способ по п. 76, где N-концевая область содержит аминокислотные остатки VHYG (SEQ ID NO:101), DASPHVHYG (SEQ ID NO:102) или DSSPLVHYG (SEQ ID NO:103).

80. Способ по п. 79, где G соответствует последнему положению N-концевой области.

81. Способ по п. 76, где N-концевая область содержит аминокислотные остатки DSSPLLQ (SEQ ID NO:104) и где остаток Q представляет собой аминокислоту в последнем положении N-концевой области.

82. Способ по п. 80, где N-концевая область дополнительно включает:

RHPIP (SEQ ID NO:106), где R представляет собой аминокислоту в первом положении N-концевой области;

HPIP (SEQ ID NO:107), где H представляет собой аминокислоту в первом положении N-концевой области;

RPLAF (SEQ ID NO:108), где R представляет собой аминокислоту в первом положении N-концевой области;

PLAF (SEQ ID NO:109), где P представляет собой аминокислоту в первом положении N-концевой области; или

R, где R представляет собой аминокислоту в первом положении N-концевой области.

83. Способ по п. 81, где N-концевая область дополнительно включает:

RHPIP (SEQ ID NO:106), где R представляет собой аминокислоту в первом положении N-концевой области;

HPIP (SEQ ID NO:107), где H представляет собой аминокислоту в первом положении N-концевой области;

RPLAF (SEQ ID NO:108), где R представляет собой аминокислоту в первом положении N-концевой области;

PLAF (SEQ ID NO:109), где P представляет собой аминокислоту в первом положении N-концевой области; или

R, где R представляет собой аминокислоту в первом положении N-концевой области.

84. Способ по п. 76, где N-концевая область содержит аминокислотные остатки DSSPLLQFGGQV (SEQ ID NO:105) и где остаток V соответствует последнему положению N-концевой области.

85. Способ по п. 76, где аминокислотные остатки HPIP (SEQ ID NO:107) представляют собой первые 4 аминокислотных остатка N-концевой области.

86. Способ по п. 76, где

в первом положении N-концевой области присутствует остаток R или М;

в первом и втором положениях N-концевой области присутствует последовательность MR, RM, RD, DS, MD или MS;

в 1-3 положениях N-концевой области присутствует последовательность MDS, RDS, MSD, MSS или DSS;

в 1-4 положениях N-концевой области присутствует последовательность RDSS (SEQ ID NO:115) или MDSS (SEQ ID NO:116);

в 1-5 положениях N-концевой области присутствует последовательность MRDSS (SEQ ID NO:117);

в 1-6 положениях N-концевой области присутствует последовательность MDSSPL (SEQ ID NO:119), или

в 1-7 положениях N-концевой области присутствует последовательность MSDSSPL (SEQ ID NO:120).

87. Способ по п. 76, где пептид содержит N-концевую область и первую C-концевую область, имеющую аминокислотную последовательность, содержащую или состоящую из:

RPLAFSDASPHVHYGWGDPIRLRHLYTSG (аминокислоты 1-29 SEQ ID NO:1);

PLAFSDASPHVHYGWGDPIRLRHLYTSG (аминокислоты 2-29 SEQ ID NO:1);

RPLAFSDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-29 SEQ ID NO:2);

PLAFSDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 2-29 SEQ ID NO:2);

RHPIPDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-26 SEQ ID NO:8);

RHPIPDSSPLLQFGWGDPIRLRHLYTSG (аминокислоты 1-28 SEQ ID NO:9);

RPLAFSDSSPLVHWGDPIRLRHLYTSG (аминокислоты 1-27 SEQ ID NO:26);

PLAFSDSSPLVHWGDPIRLRHLYTSG (аминокислоты 2-27 SEQ ID NO:26);

HPIPDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-25 SEQ ID NO:47);

RDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-22 SEQ ID NO:52);

DSSPLLQWGDPIRLRHLYTSG (аминокислоты 2-22 SEQ ID NO:52);

MDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-24 SEQ ID NO:53);

RDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-24 SEQ ID NO:69);

DSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 2-24 SEQ ID NO:69);

MRDSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-25 SEQ ID NO:70);

DSSPLVHYGWGDPIRLRHLYTSG (аминокислоты 1-23 SEQ ID NO:141);

HPIPDSSPLLQFGWGDPIRLRHLYTSG (аминокислоты 1-27 SEQ ID NO:163); или

MDSSPLLQWGDPIRLRHLYTSG (аминокислоты 1-22 SEQ ID NO:192).

88. Способ по п. 76, где в первом положении аминокислоты N-концевой области находится остаток метионина (M), остаток аргинина (R), остаток серина (S), остаток гистидина (H), остаток пролина (P), остаток лейцина (L) или остаток аспарагиновой кислоты (D).

89. Способ по п. 76, где N-концевая область не имеет остаток метионина (М) или остаток аргинина (R) в первом положении аминокислоты N-концевой области.

90. Способ по п. 76, где N-концевая область включает любую одну из следующих аминокислотных последовательностей: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120) или SDSSPL (SEQ ID NO:112).

91. Способ по п. 76, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:26, SEQ ID NO:47, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:69, SEQ ID NO:70; SEQ ID NO:141, SEQ ID NO:163 или SEQ ID NO:192.

92. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1, 2, 8, 9, 26, 52 или 69, где остаток аргинина (R) в первом положении аминокислоты N-концевой области последовательности является делетированным.

93. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:1.

94. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:2.

95. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:8.

96. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:9.

97. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:26.

98. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:47.

99. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:52.

100. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:53.

101. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:141.

102. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:163.

103. Способ по п. 91, где пептид имеет аминокислотную последовательность, содержащую или состоящую из SEQ ID NO:192.

104. Способ по п. 76, где вторая последовательность С-концевой области содержит по меньшей мере одну аминокислотную замену в последовательности EIRPD SEQ ID NO:99.

105. Способ по п. 103, где по меньшей мере одна аминокислотная замена сделана в последовательности IRP последовательности EIRPD SEQ ID NO:99.

106. Способ по п. 103, где по меньшей мере одна аминокислотная замена сделана в последовательности RP последовательности EIRPD SEQ ID NO:99.

107. Способ по п. 106, где последовательность RP заменена последовательностью LE.

108. Способ по п. 76, где указанный пептид слит с Fc-областью иммуноглобулина.

109. Способ по п. 76, где пептид обладает по меньшей мере одним из пониженной способности к образованию ГЦК, повышенной активности в отношении снижения уровня глюкозы или пониженной активности в отношении увеличения уровня липидов по сравнению с FGF19 или с вариантом последовательности FGF19, в которой в положениях аминокислот 16-20 FGF19 (SEQ ID NO:99) последовательность WGDPI заменена любой из последовательностей GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP или FGDPI.

110. Способ по п. 109, где образование ГЦК, активность в отношении снижения уровня глюкозы или активность в отношении увеличения уровня липидов определяют у мышей db/db.

111. Способ по п. 109, где пептид имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21.

112. Способ по п. 111, где активность в отношении снижения мышечной массы оценивают определяют у мышей db/db.

113. Способ по п. 76, где пептид составляют в виде фармацевтической композиции, дополнительно содержащей фармацевтически приемлемый носитель.

114. Способ по п. 76, дополнительно включающий проведение дополнительной терапии у указанного субъекта.

115. Способ по п. 76, где указанный способ снижает синтез желчных кислот у субъекта.

116. Способ по п. 76, где указанный способ снижает уровень CYP7a1 у субъекта.

117. Способ по любому из пп. 76-116, где субъект имеет ПБЦ.

118. Способ по любому из пп. 76-116, где субъект имеет холестаз.

119. Способ по любому из пп. 76-116, где субъект имеет первичный склерозирующий холангит.

120. Способ по любому из пп. 76-116, где субъект имеет ДЖК.

121. Способ по любому из пп. 76-116, где субъект имеет ВХБ.

122. Способ по любому из пп. 76-116, где субъект имеет нарушение синтеза желчных кислот.

123. Способ по любому из пп. 76-116, где субъект имеет малабсорбцию желчных кислот.

124. Способ по любому из пп. 76-116, где субъект имеет НАСГ.

125. Способ модуляции гомеостаза желчных кислот у субъекта, включающий введение пептида указанному субъекту, где указанный пептид имеет аминокислотную последовательность, содержащую или состоящую из

MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:70);

RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:69);

RDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:52); или
MDSSPLLQWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO: 192;

таким образом обеспечивая модуляцию гомеостаза желчных кислот у субъекта.

126. Способ по п. 125, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:70.

127. Способ по п. 125, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:70.

128. Способ по п. 125, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:69.

129. Способ по п. 125, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:69.

130. Способ по п. 125, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:52.

131. Способ по п. 125, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:52.

132. Способ по п. 125, где пептид имеет аминокислотную последовательность, содержащую SEQ ID NO:192.

133. Способ по п. 125, где пептид имеет аминокислотную последовательность, состоящую из SEQ ID NO:192.

134. Способ по п. 125, где аминокислотная последовательность содержит по меньшей мере одну аминокислотную замену в последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

135. Способ по п. 134, где по меньшей мере одна аминокислотная замена сделана в последовательности IRP последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

136. Способ по п. 134, где по меньшей мере одна аминокислотная замена сделана в последовательности RP последовательности EIRPD SEQ ID NO:70, 69, 52 или 192.

137. Способ по п. 136, где последовательность RP заменена последовательностью LE.

138. Способ по п. 125, где указанный пептид слит с Fc-областью иммуноглобулина.

139. Способ по п. 125, где пептид составляют в виде фармацевтической композиции, дополнительно содержащей фармацевтически приемлемый носитель.

140. Способ по п. 125, дополнительно включающий проведение дополнительной терапии у указанного субъекта.

141. Способ по п. 125, где указанный способ снижает синтез желчных кислот у субъекта.

142. Способ по п. 125, где указанный способ снижает уровень CYP7a1 у субъекта.

143. Способ по любому из пп. 125-142, где субъект имеет ПБЦ.

144. Способ по любому из пп. 125-142, где субъект имеет холестаз.

145. Способ по любому из пп. 125-142, где субъект имеет первичный склерозирующий холангит.

146. Способ по любому из пп. 125-142, где субъект имеет ДЖК.

147. Способ по любому из пп. 125-142, где субъект имеет ВХБ.

148. Способ по любому из пп. 125-142, где субъект имеет нарушение синтеза желчных кислот.

149. Способ по любому из пп. 125-142, где субъект имеет малабсорбцию желчных кислот.

150. Способ по любому из пп. 125-142, где субъект имеет НАСГ.



 

Похожие патенты:

Группа изобретений относится к in vitro диагностике и определению эффективности лечения болезни Гоше. Способ in vitro для диагностики болезни Гоше у индивидуума включает выявление биомаркера в образце от индивидуума, определение уровня биомаркера, присутствующего в образце, и сравнение уровня биомаркера с пороговым уровнем.

Изобретение относится к биотехнологии. Предложен способ in vitro определения наличия в образце рыбьего жира активности n-3 полиненасыщенной жирной кислоты (PUFA).

Настоящее изобретение относится к способу стабилизации жирных кислот, присутствующих в образце, таком как биологические жидкости (например, кровь, слюна, грудное молоко, моча, сперма, плазма и сыворотка крови), причем способ предусматривает нанесение жирных кислот или образца, содержащего жирные кислоты, на твердый носитель, который содержит твердую подложку, по меньшей мере одно хелатообразующее средство и по меньшей мере один антиоксидант, где твердая подложка содержит менее 2 мкг/см2 примесей, где примеси представляют собой одно или более соединений, выбранных из группы, состоящей из насыщенных жирных кислот, сложных эфиров насыщенных жирных кислот, смоляных кислот и сложных эфиров смоляных кислот.

Изобретение относится к медицине и предназначено для выделения и исследования иммунных комплексов, содержащих множественно модифицированные липопротеины низкой плотности (ИК-ммЛНП), из сыворотки крови человека.

Изобретение относится к области медицины, а именно к исследованию физических и химических свойств биологической жидкости, и может быть использовано в терапевтической стоматологии для оценки эффективности лечения хронического генерализованного пародонтита (ХГП) у пациентов с метаболическим синдромом (МС).

Изобретение относится к медицине, а именно к реаниматологии и хирургии, и касается способа прогнозирования полиорганной недостаточности у пациентов после абдоминальных хирургических вмешательств.

Способ относится к области медицины, а именно к интенсивной терапии критических состояний, и представляет собой способ лабораторной диагностики синдрома жировой эмболии, включающий забор крови из вены и артерии.

Изобретение относится к области биотехнологии. Способ обнаружения вещества, которое опосредует положительную регуляцию транскрипции гена биологического маркера, или определения, опосредует ли вещество положительную регуляцию транскрипции гена биологического маркера, состоит из следующих этапов: обеспечение первой системы анализа, включающей последовательность мРНК, которая содержит область, кодирующую первый репортерный белок, функционально связанную с промотором первого биологического маркера; обеспечение второй системы анализа, включающей вторую последовательность мРНК, которая содержит область, кодирующую второй репортерный белок, функционально связанную с промотором второго биологического маркера; осуществление контакта указанной второй системы анализа с веществом; осуществления контакта указанной первой системы анализа со стандартным веществом или контрольным веществом и определение уровней транскрипции указанных первой и второй последовательностей мРНК.

Изобретение относится к области медицины, а именно к способу диагностики болезни Альцгеймера или умеренного когнитивного расстройства. Сущность способа состоит в том, что способ включает измерение в крови десмостерола, бета-амилоида, гельсолина.
Изобретение относится к клинической иммунологии и может быть использовано для определения атерогенности иммунных комплексов, содержащих множественно модифицированные липопротеины низкой плотности (ИК-ммЛПНП).

Группа изобретений относится к области биотехнологии. Предложено устройство и способ оптического контроля химической реакции.

Изобретение относится к области биотехнологии, а именно к способу детекции последовательности нуклеотидов при проведении полимеразной цепной реакции. Раскрыт способ детекции специфических нуклеотидных последовательностей с помощью ПЦР в реальном времени, включающий приготовление реакционной смеси, при этом прямой праймер имеет в своем составе с 3' конца участок, комплементарный детектируемой нуклеотидной последовательности, следующий за ним участок, имеющий идентичную флуоресцентному зонду последовательность, участок в области 5' конца, представляющий собой две комплементарные друг другу последовательности, разделенные некомплементарным участком и гибридизующиеся во время реакции, за счет чего ампликон, полученный с помощью обратного праймера с матрицы, содержащей в своем составе прямой праймер, получает участок для отжига флуоресцентного зонда, а также две комплементарные друг другу последовательности уже на 3' конце, одна из которых после гибридизации выступает в роли праймера и запускает амплификацию с гидролизом зонда, достраивая последовательность на ампликоне с образованием на его 3' конце участка для отжига обратного праймера, что позволяет уже этому праймеру в последующих циклах запускать амплификацию с гидролизом отжигающихся на ампликоне флуоресцентных зондов, что сопровождается нарастанием флуоресценции, путем оценки которой выполняется детекция наличия специфических нуклеотидных последовательностей.

Изобретение относится к области медицины. Предложен способ определения маркеров наличия опухолевых Т-лимфобластов.

Предложенная группа изобретений относится к области медицины, в частности акушерству и медицинской генетике. Предложены способы определения источника анеуплоидных клеток по крови беременной женщины.

Изобретение относится к области генетики, молекулярной биологии и медицины. Предложен способ выявления соматических мутаций Q209P (с.

Изобретение относится к области генетики, молекулярной биологии и медицины. Предложен способ выявления соматических мутаций в генах BRAF, NRAS и KIT.

Настоящее изобретение относится к области биотехнологии, конкретно к полипептидному биомаркеру эффективности применения ингибитора FGFR при лечении рака мочевого пузыря и рака легких, что может быть использовано в медицине.

Изобретение относится к области медицины, в частности к дерматологии. Предложен способ выявления мутаций 2282del4, R501X и R2447X в гене филаггрина (FLG) при вульгарном ихтиозе и атопическом дерматите.

Изобретение относится к области биотехнологии. Описан способ диагностики полиморфизма гена CARD15, включающий однопробирочную полимеразную цепную реакцию (ПЦР) и две пары праймеров (CARD15_Rev_A_NEW-5’-GGC CAG GGT ACA AGG GAA AG, CARD15_For_A_NEW-5’ -GGA AAT TGA GAA ACT CAG CCA GCA, CARD15_Rev_T_NEW-5’ -CAG AGC AAG AGT CTG GTA TGC A, CARD15_For_T_NEW-5’ -GCA CGG TGA TTC ATG AGC TG) для амплификации двух разных аллелей однонуклеотидного полиморфизма: фрагмент гена с аллелем А (562 п.о) ассоциирован с пониженным содержанием соматических клеток, а участок аллеля Т (282 п.о.) ассоциирован с повышенным содержанием соматических клеток в молоке коров.

Изобретение относится к биотехнологии. Предложен способ обнаружения токсикогенной Clostridium difficile (C.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению человеческих белков в клетках СНО, и может быть использовано для получения человеческого антитела к гемагглютинину вируса гриппа А (ВГА) изотипа IgA2m1.

Изобретение относится к биотехнологии. Описан способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, включающий введение пептида. При этом пептид содержит: a) N-концевую область, включающую по меньшей мере семь аминокислотных остатков, и b) C-концевую область. При этом N-концевая область содержит DSSPL или DASPH. C-концевая область содержит: первую последовательность С-концевой области, содержащую WGDPIRLRHLYTSG, где остаток W соответствует положению первой аминокислоты указанной С-концевой области, или вторую последовательность С-концевой области, содержащую PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK, или последовательность, содержащую от 1 до 5 аминокислотных замен, делеций или инсерций. Пептид связывается с рецептором фактора роста фибробластов 4 c аффинностью, равной или большей, чем аффинность связывания FGF19 с FGFR4; активирует FGFR4 в степени или количестве, равном или большем, чем FGF19; обладает одним из пониженного образования гепатоцеллюлярной карциномы, повышенной активности в отношении снижения уровня глюкозы, пониженной активности в отношении увеличения уровня липидов, пониженной активности в отношении увеличения уровня триглицеридов, пониженной активности в отношении увеличения уровня холестерина, пониженной активности в отношении увеличения уровня не-ЛВП или ЛВП по сравнению с FGF19 или по сравнению с последовательностью варианта FGF19, где последовательность WGDPI в положениях аминокислот 16-20 FGF19 заменена любыми из GQV, GDI, WGPI, WGDPV, WGDI, GDPI, GPI, WGQPI, WGAPI, AGDPI, WADPI, WGDAI, WGDPA, WDPI, WGDI, WGDP; иили имеет низкую активность в отношении снижения мышечной массы по сравнению с FGF21. Также представлен способ модуляции гомеостаза желчных кислот. 4 н. и 146 з.п. ф-лы, 7 ил., 14 табл., 12 пр.

Наверх