Канинизированные мышиные антитела к человеческому pd-1



Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1
Канинизированные мышиные антитела к человеческому pd-1

Владельцы патента RU 2676158:

ИНТЕРВЕТ ИНТЕРНЭШНЛ Б.В. (NL)

Изобретение относится к биотехнологии. Описано выделенное канинизированное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с Рецептором 1 Программируемой Клеточной Смерти (PD-1), отличающееся тем, что указанное антитело содержит тяжелую цепь собачьего IgG и собачью легкую цепь каппа; отличающуюся тем, что собачья легкая цепь каппа содержит три области, определяющие комплементарность (CDR): CDR 1 легкой цепи (CDRL1), CDR 2 легкой цепи (CDRL2) и CDR 3 легкой цепи (CDRL3); и тяжелая цепь собачьего IgG содержит три CDR тяжелой цепи: CDR 1 тяжелой цепи (CDRH1), CDR 2 тяжелой цепи (CDRH2) и CDR 3 тяжелой цепи (CDRH3); где CDRL1 содержит аминокислотную последовательность SEQ ID NO:20; CDRL2 содержит аминокислотную последовательность SEQ ID NO:22; CDRL3 содержит аминокислотную последовательность SEQ ID NO:24; CDRH1 содержит аминокислотную последовательность SEQ ID NO:14; CDRH2 содержит аминокислотную последовательность SEQ ID NO:16 и CDRH3 содержит аминокислотную последовательность SEQ ID NO:18; где антитело и его антигенсвязывающий фрагмент связываются с собачьим PD-1 и блокируют связывание собачьего PD-1 с собачьим Лигандом 1 Программируемой Клеточной Смерти (PD-L1). Изобретение также относится к применению этих антител при лечении собак. Антитело по изобретению обладает высокой аффинностью связывания с собачьим PD-1. 12 н. и 6 з.п. ф-лы, 4 ил., 5 табл., 2 пр.

 

Перекрестные ссылки на родственные заявки

Настоящая заявка заявляет приоритет патентной заявки No. 61/918847 от 20 декабря 2013, содержание которой включено в данный документ ссылкой в полном объеме.

ОБЛАСТЬ ТЕХНИКИ

Настоящее изобретение относится к канинизированным мышиным антителам к человеческому PD-1, которые содержат специфические последовательности и обладают высокой аффинностью связывания с собачьим PD-1. Изобретение также относится к применению антител по настоящему изобретению при лечении злокачественного новообразования у собак.

УРОВЕНЬ ТЕХНИКИ

Иммуноингибирующий рецептор, который экспрессируется главным образом на активированных T- и B-клетках, Рецептор 1 Программируемой Клеточной Смерти, также обозначается как Рецептор Программируемой Смерти (PD-1), является членом суперсемейства иммуноглобулинов, связанных с CD28 и CTLA-4. PD-1 и типичные члены семейства представляют собой трансмембранные гликопротеины типа I, содержащие внеклеточный домен Ig вариабельного типа (V-типа), который связывается с их лигандами, и цитоплазматический хвост, который связывается с сигнальными молекулами. Цитоплазматический хвост PD-1 содержит два тирозин-содержащих сигнальных мотива, ITIM (ингибирующий тирозин-содержащий мотив иммунорецепторов) и ITSM (переключающий тирозин-содержащий мотив иммунорецепторов).

PD-1 ослабляет T-клеточные ответы при связывании с Лигандом 1 Программируемой Клеточной Смерти, который также обозначается как Лиганд 1 Программируемой Смерти (PD-L1), и/или с Лигандом 2 Программируемой Клеточной Смерти, который также обозначается как Лиганд 2 Программируемой Смерти (PD-L2). Связывание каждого из этих лигандов с PD-1 негативно регулирует сигнальную систему антигенного рецептора. Блокировка связывания PD-L1 с PD-1 усиливает опухолеспецифичный CD8+ T-клеточный иммунитет, способствуя при этом выведению опухолевых клеток иммунной системой. Опубликована трехмерная структура мышиного PD-1, а также кристаллическая структура мышиного PD-1 вместе с человеческим PD-L1 [Zhang et al., Immunity 20: 337-347 (2004); Lin et al, Proc. Natl. Acad. Sci. USA 105: 301 1-3016 (2008)].

PD-L1 и PD-L2 относятся к трансмембранным лигандам типа I, которые содержат оба IgV- и IgC-подобный домены во внеклеточной области наряду с короткими цитоплазматическим областями с неизвестными сигнальными мотивами. Оба PD-L1 и PD-L2 экспрессируются либо конститутивно, либо могут быть введены в различные типы клеток, включая негематопоэтические, а также различные типы опухолей. PD-L1 экспрессируется не только на B-клетках, T-клетках, миелоидных и дендритных клетках (DC), но также на периферических клетках, таких как капиллярные эндотелиальные клетки и клетки нелимфоидных органов, например, сердца или легкого. Напротив, PD-L2 обнаружен исключительно на макрофагах и на DC. Профиль экспрессии лигандов PD-1 предполагает, что PD-1 играет роль в поддержании периферической устойчивости и может дополнительно служить для регуляции самореактивного Т- и В-клеточного ответа на периферии.

В любом случае, сейчас совершенно ясно, что PD-1 играет критическую роль по меньшей мере в некоторых типах злокачественных новообразований человека, преимущественно путем опосредования ускользания от иммунологического надзора. Соответственно, было показано, что PD-L1 экспрессируется на ряде клеток мышиных и человеческих опухолей, и его может индуцировать IFN гамма в большинстве PD-L1-отрицательных опухолевых клеточных линий [Iwai et al, Proc. Natl. Acad. Sci. U.S.A. 99: 12293-12297 (2002); Strome et al, Cancer Res., 63: 6501-6505 (2003)]. Кроме того, идентифицировали экспрессию PD-1 на опухоль-инфильтрующих лимфоцитах и/или экспрессию PD-L1 на опухолевых клетках в ряде биопсий первичных человеческих опухолей. Такие опухолевые ткани включают злокачественные новообразования легкого, печени, яичников, шейки матки, кожи, толстой кишки, глиомы, мочевого пузыря, молочной железы, почки, пищевода, желудка, плоских клеток ротовой полости, уротелиальных клеток, и поджелудочной железы, а также опухоли головы и шеи [Brown et al., J. Immunol. 170: 1257-1266 (2003); Dong et al, Nat. Med. 8: 793-800 (2002); Wintterle et al, Cancer Res. 63: 7462-7467 (2003); Strome et al, Cancer Res., 63: 6501-6505 (2003); Thompson et al, Cancer Res 66: 3381-5 (2006); Thompson et al, Clin. Cancer Res. 13: 1757-1761 (2007); Nomi et al, Clin.Cancer Res. 13:2151-2157. (2007)]. Еще более поразительно, что экспрессия PD-лиганда на опухолевых клетках коррелировала с неблагоприятным прогнозом раковых пациентов-людей по многочисленным типам опухлей [обзор у Okazaki and Honjo, Int. Immunol. 19: 813-824 (2007)].

Кроме того, Nomi et al. [Clin. Cancer Res. 13: 2151-2157 (2007)] продемонстрировали терапевтическую эффективность блокировки связывания PD-L1 с PD-1 на мышиной модели агрессивного злокачественного новообразования поджелудочной железы посредством введения либо антитела к PD-1, либо к PD-L1. Эти антитела эффективно стимулировали опухоль-реактивную CD8+ T-клеточную инфильтрацию в опухоль, приводя к положительной регуляции противоопухолевых эффекторов, включающих IFN гамма, гранзим B и перфорин. Аналогично, применение антител для блокировки связывания PD-L1 и PD-1 значительно ингибировало опухолевый рост в мышиной модели плоскоклеточной карциномы [Tsushima et al, Oral Oncol. 42: 268-274 (2006)].

В других работах трансфекция PD-L1 в клетки мышиной линии мастоцитомы приводила к пониженному лизису опухолевых клеток при их совместном культивировании с клоном опухолеспецифичных CTL. Лизис восстанавливался при добавлении моноклонального антитела к PD-Ll [Iwai et al., Proc. Natl. Acad. Sci. U.S.A. 99: 12293-12297 (2002)]. Было показано in vivo на мышиной модели опухоли, что блокировка взаимодействия PD1/PD-L1 повышает эффективность терапии, восприимчивой к T-клеточному переносу, [Strome et al., Cancer Res. 63: 6501-6505 (2003)]. Кроме того, очевидность роли PD-1 в лечении злокачественного новообразования основана на экспериментах, осуществленных с PD-1-нокаутными мышами, в которых миеломные клетки, экспрессирующие PD-L1, росли только в животных дикого типа (приводя к опухолевому росту и ассоциированной с этим смерти животного), но не в мышах, дефицитных по PD-1 [Iwai Y. et al, Proc. Natl. Acad. Sci. U.S.A. 99: 12293-12297 (2002)]. Совсем недавно было показано, что антитела против PD-1 (включающие гуманизированные мышиные моноклональные антитела против человеческого PD-1) продемонстрировали по меньшей мере начальный успех в противоопухолевой терапии у людей [см., например, US 8354509 B2, US 8008449 B2 и US 7595048 B2].

Антитела к PD-1 также могут применять при хронической вирусной инфекции. CD8+ T-клетки памяти, генерированные после острой вирусной инфекции, являются высоко функциональными и составляют важный компонент защитного иммунитета. Напротив, хронические инфекции часто характеризуются вариацией степени функциональной недостаточности (истощения) вирусно-специфического T-клеточного ответа, и этот дефект является принципиальной причиной неспособности исключения существующего патогена. Хотя функциональные эффекторные T-клетки исходно получают на ранних стадиях инфекции, они постепенно теряют функцию во время протекания хронической инфекции. Barber et al. [Nature 439: 682-687 (2006)] продемонстрировали, что у мышей, инфицированных лабораторным штаммом LCMV, развивалась хроническая инфекция, приводящая к высокому уровню вируса в крови и в других тканях. У этих мышей изначально развивался сильный T-клеточный ответ, но, в конечном счете, он уступал инфекции при T-клеточном истощении. Barber et al. обнаружили, что уменьшение количества и функции эффекторных Т-клеток у хронически инфицированных мышей могло быть обращено вспять путем инъекции антитела, которое блокирует взаимодействие между PD-1 и PD-L1.

Цитирование любой ссылки в данном документе не следует рассматривать как допущение того, что такая ссылка доступна в качестве «предшествующего уровня техники» по отношению к настоящей заявке.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к канинизированным мышиным антителам к человеческому PD-1, которые обладают высокой аффинностью к собачьему PD-1, а также имеют способность блокировать связывание собачьего PD-1 с собачьим PD-L1. Настоящее изобретение также относится к применению таких антител при лечении заболевания, такого как злокачественное новообразование и/или таких заболеваний, которые обусловлены инфекциями.

Соответственно, в настоящем изобретении предлагается выделенное канинизированное антитело или его антиген-связывающий фрагмент, которые специфично связываются с Рецептором 1 Программируемой Смерти (PD-1), содержащее тяжелую цепь собачьего IgG и собачью легкую цепь каппа или лямбда. В конкретных воплощениях данного типа, собачью легкую цепь каппа или лямбда, которая включают три области, определяющие комплементарность, легкой цепи (CDR): CDR 1 легкой цепи (CDRLl), CDR 2 легкой цепи (CDRL2), и CDR 3 легкой цепи (CDRL3); и тяжелую цепь собачьего IgG, которая включает три CDR тяжелой цепи: CDR 1 тяжелой цепи (CDRH1), CDR 2 тяжелой цепи (CDRH2) и CDR 3 тяжелой цепи (CDRH3), получали из антитела к PD-1 млекопитающего. Конкретные воплощения канинизированных антител и их фрагментов по настоящему изобретению связываются с собачьими PD-1 и/или блокируют связывание собачьего PD-1 с собачьим Лигандом 1 Программируемой Смерти (PD-L1).

В некоторых воплощениях, собачья легкая цепь представляет собой цепь каппа. В конкретных воплощениях данного типа, CDRL1 содержит аминокислотную последовательность SEQ ID NO: 20. В родственных воплощениях, CDRL1 содержит консервативно модифицированный вариант SEQ ID NO: 20. В других воплощениях, CDRL2 содержит аминокислотную последовательность, включающую SEQ ID NO: 22. В родственных воплощениях, CDRL2 содержит консервативно модифицированный вариант SEQ ID NO: 22. Еще в других воплощениях, CDRL3 содержит аминокислотную последовательность SEQ ID NO: 24. В родственных воплощениях CDRL3 содержит консервативно модифицированный вариант SEQ ID NO: 24. Еще в других воплощениях, CDRH1 содержит аминокислотную последовательность SEQ ID NO: 14. В родственных воплощениях, CDRH1 содержит консервативно модифицированный вариант SEQ ID NO: 14. Еще в других воплощениях, CDRH2 содержит аминокислотную последовательность SEQ ID NO: 16. В родственных воплощениях CDRH2 содержит консервативно модифицированный вариант SEQ ID NO: 16. Еще в других воплощениях, CDRH3 содержит аминокислотную последовательность SEQ ID NO: 18. В родственных воплощениях CDRH3 содержит консервативно модифицированный вариант SEQ ID NO: 18.

В конкретных воплощениях, CDRL1 содержит аминокислотную последовательность SEQ ID NO: 20 или консервативно модифицированный вариант SEQ ID NO: 20, CDRL2 содержит аминокислотную последовательность, включающую SEQ ID NO: 22 или консервативно модифицированный вариант SEQ ID NO: 22, и CDRL3 содержит аминокислотную последовательность SEQ ID NO: 24 или консервативно модифицированный вариант SEQ ID NO: 24.

В других конкретных воплощениях, CDRH1 содержит аминокислотную последовательность SEQ ID NO: 14 или консервативно модифицированный вариант SEQ ID NO: 14, CDRH2 содержит аминокислотную последовательность, включающую SEQ ID NO: 16 или консервативно модифицированный вариант SEQ ID NO: 16, и CDRH3 содержит аминокислотную последовательность SEQ ID NO: 18 или консервативно модифицированный вариант SEQ ID NO: 18.

В более конкретных воплощениях, CDRL1 содержит аминокислотную последовательность SEQ ID NO: 20 или консервативно модифицированный вариант SEQ ID NO: 20, CDRL2 содержит аминокислотную последовательность, включающую SEQ ID NO: 22 или консервативно модифицированный вариант SEQ ID NO: 22, и CDRL3 содержит аминокислотную последовательность SEQ ID NO: 24 или консервативно модифицированный вариант SEQ ID NO: 24, и CDRH1 содержит аминокислотную последовательность SEQ ID NO: 14 или консервативно модифицированный вариант SEQ ID NO: 14, CDRH2 содержит аминокислотную последовательность, включающую SEQ ID NO: 16 или консервативно модифицированный вариант SEQ ID NO: 16, и CDRH3 содержит аминокислотную последовательность SEQ ID NO: 18 или консервативно модифицированный вариант SEQ ID NO: 18.

В еще более конкретных воплощениях, CDRL1 содержит аминокислотную последовательность SEQ ID NO: 20, CDRL2 содержит аминокислотную последовательность, включающую SEQ ID NO: 22, и CDRL3 содержит аминокислотную последовательность SEQ ID NO: 24, и CDRH1 содержит аминокислотную последовательность SEQ ID NO: 14, CDRH2 содержит аминокислотную последовательность, включающую SEQ ID NO: 16, и CDRH3 содержит аминокислотную последовательность SEQ ID NO: 18.

Для воплощений настоящего изобретения тяжелая цепь IgG содержит аминокислотную последовательность SEQ ID NO: 26. В родственных воплощениях тяжелая цепь IgG содержит консервативно модифицированный вариант SEQ ID NO: 26. В других воплощениях, тяжелая цепь IgG содержит аминокислотную последовательность SEQ ID NO: 28. В родственных воплощениях тяжелая цепь IgG содержит консервативно модифицированный вариант SEQ ID NO: 28. Еще в других воплощениях, тяжелая цепь IgG содержит аминокислотную последовательность SEQ ID NO: 30. В родственных воплощениях, тяжелая цепь IgG содержит консервативно модифицированный вариант SEQ ID NO: 30.

В некоторых воплощениях, легкая цепь каппа содержит аминокислотную последовательность SEQ ID NO: 32. В родственных воплощениях легкая цепь каппа содержит консервативно модифицированный вариант SEQ ID NO: 32. В конкретных воплощениях, легкая цепь каппа содержит аминокислотную последовательность SEQ ID NO: 34. В родственных воплощениях легкая цепь каппа содержит консервативно модифицированный вариант SEQ ID NO: 34.

В более предпочтительном воплощении, выделенное канинизированное антитело содержит аминокислотную последовательность SEQ ID NO: 28 и SEQ ID NO: 34. В родственных воплощениях, выделенное канинизированное антитело содержит консервативно модифицированный вариант SEQ ID NO: 28 и консервативно модифицированный вариант SEQ ID NO: 34. Еще в другом родственном воплощении, выделенное канинизированное антитело содержит аминокислотную последовательность SEQ ID NO: 28 и консервативно модифицированный вариант SEQ ID NO: 34. Еще в другом воплощении, выделенное канинизированное антитело содержит консервативно модифицированный вариант SEQ ID NO: 28 и аминокислотную последовательность SEQ ID NO: 34.

В настоящем изобретении дополнительно предлагаются выделенные нуклеиновые кислоты, которые кодируют любую из легких цепей канинизированного антитела по настоящему изобретению. Аналогично, в настоящем изобретении дополнительно предлагаются выделенные нуклеиновые кислоты, которые кодируют любую из тяжелых цепей канинизированного антитела по настоящему изобретению. В настоящем изобретении дополнительно предлагаются экспрессирующие векторы, которые содержат одну или более из выделенных нуклеиновых кислот по настоящему изобретению. В настоящем изобретении дополнительно предлагаются клетки-хозяева, которые содержат один или более экспрессирующих векторов по настоящему изобретению.

В конкретных воплощениях, антитело представляет собой рекомбинантное антитело или его антиген-связывающий фрагмент. В родственных воплощениях, вариабельный домен тяжелой цепи и вариабельный домен легкой цепи соединены с помощью гибкого линкера с образованием одноцепочечного антитела.

В конкретных воплощениях, антитело или антиген-связывающий фрагмент представляет собой Fab-фрагмент.

В других воплощениях, антитело или антиген-связывающий фрагмент представляет собой Fab'-фрагмент. В других воплощениях, антитело или антиген-связывающий фрагмент представляет собой (Fab')2-фрагмент. Еще в других воплощениях, антитело или антиген-связывающий фрагмент представляет собой диатело. В конкретном воплощении, антитело или антиген-связывающий фрагмент представляет собой домен-содержащее антитело. В конкретных воплощениях, антитело или антиген-связывающий фрагмент представляет собой камелизированное однодоменное антитело.

В конкретных воплощениях, канинизированное мышиное антитело к человеческому PD-1 или его антиген-связывающий фрагмент повышают иммунный ответ объекта-собаки, который подвергается лечению.

В настоящем изобретении дополнительно предлагаются нуклеиновые кислоты, которые кодируют канинизированные мышиные антитела к человеческому PD-1 или их антиген-связывающие фрагменты, как раскрыто в данном документе. В родственных воплощениях, такие антитела или антиген-связывающие фрагменты могут использоваться для получения лекарственного средства для лечения злокачественного новообразования у объекта-собаки. Альтернативно или совместно, в настоящем изобретении предлагается применение любого из антител или фрагментов антител по настоящему изобретению для диагностических целей. Еще в дополнительных воплощениях, предлагается набор, содержащий любое из канинизированных антител или антиген-связывающих фрагментов, раскрытых в данном документе.

Еще в дополнительных воплощениях, предлагается экспрессирующий вектор, включающий выделенную нуклеиновую кислоту, кодирующую любое из канинизированных мышиных антител к человеческому PD-1 или их антиген-связывающие фрагменты по изобретению. Изобретение также относится к клетке-хозяину, содержащей любой из экспрессирующих векторов, описанных в данном документе. В конкретных воплощениях, эти нуклеиновые кислоты, экспрессирующие векторы или полипептиды по изобретению применяют в способах получения антитела.

Настоящее изобретение дополнительно включает фармацевтические композиции, содержащие антитело или его антиген-связывающий фрагмент вместе с фармацевтически приемлемым носителем или разбавителем. Кроме того, в настоящем изобретении предлагаются способы повышения активности иммунной клетки, включающие введение терапевтически эффективного количества такой фармацевтической композиции объекту, нуждающемуся в этом. В некоторых воплощениях, способ применяют для лечения злокачественного новообразования. В других воплощениях, способ применяют при лечении инфекции или инфекционного заболевания. Еще в других воплощениях, канинизированное антитело по настоящему изобретению или его антиген-связывающий фрагмент применяют в качестве адъюванта вакцины.

Эти и другие аспекты настоящего изобретения будут лучше понятны при ссылке на следующее краткое описание чертежей и на подробное описание.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На Фигуре 1 представлена реактивность мышиного моноклонального антитела к человеческому PD-1, 08A [mAb 08A; как впервые описано в US 8354509 B2 касательно человеческого PD-1], против His-маркированного внеклеточного домена собачьего PD-1.

На Фигуре 2 представлена реактивность мышиного моноклонального антитела к человеческому PD-1, 08A (см. выше) против собачьих белков PD-1, экспрессированных на клетках CHO, с использованием тИФА на клетках (CELISA). Было обнаружено, что мышиное моноклональное антитело к человеческому PD-1, 08A, и его канинизированные варианты реагируют с собачьим PD-1 дозозависимым способом.

На Фигуре 3 изображена блокада лиганда мышиными и канинизированными моноклональными антителами. Мышиное моноклональное антитело к человеческому PD-1, 08A (см. выше), и его канинизированные варианты блокировали связывание собачьего PD-L1 с PD-1, экспрессированным на поверхности клеток CHO.

На Фигуре 4 представлено выравнивание константных областей (CH) тяжелых цепей собачьего IgGB, лишенного функции ADCC. Изображены собачий IgB дикого типа [clgGB wt], собачий IgGB(+)A-шарнир [cIgGB(+) A-шарнир], собачий IgGB(+) D-шарнир [dgGB(+) D-шарнир], и собачий IgGB (-)ADCC [clgGB(-) ADCC]. (+) A-шарнир представляет собой замену на IgG-A шарнир плюс показаны аминокислотные замены лизина и аспарагина; (+) D-шарнир представляет собой замену на IgG-D шарнир плюс показаны аминокислотные замены лизина и аспарагина. (-)ADCC представляет собой аминокислотную замену лизина и аспарагина.

ПОДРОБНОЕ ОПИСАНИЕ

Сокращения

ADCC Антитело-зависимая клеточная цитотоксичность
CDC Комплемент-зависимая цитотоксичность
CDR Области, определяющие комплементарность, в вариабельных областях иммуноглобулина, определяемые с использованием системы нумерации Kabat
CHO Яичники китайского хомяка
EC50 концентрация, приводящая к 50% эффективности или связывания
тИФА твердофазный Иммуноферментный Анализ
FR Каркасная область антитела: вариабельные области иммуноглобулина, за исключением CDR-областей.
HRP Пероксидаза хрена
IFN Интерферон
IC50 Концентрация, приводящая к 50% ингибирования
IgG Иммуноглобулин G
Kabat Выравнивание и система нумерации иммуноглобулинов, впервые предложенная Elvin A. Kabat [Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)]
mAb Моноклональное антитело (также Mab или MAb)
MES 2-(N-морфолин)этансульфокислота
MOA Механизм действия
NHS Сыворотка здорового человека
ПЦР Полимеразная цепная реакция
PK Фармакокинетика
SEB Энтеротоксин B стафилококка
TT Столбнячный анатоксин
V область Сегмент цепей IgG, который является вариабельным в последовательности между различными антителами. Он простирается до остатка 109 по Kabat в легкой цепи и 113 тяжелой цепи
VH Вариабельная область тяжелой цепи иммуноглобулина
VK Вариабельная область легкой цепи каппа иммуноглобулина

ОПРЕДЕЛЕНИЯ

Для того, чтобы легче понять изобретение, ниже специально приведены определения некоторых технических и научных терминов. До тех пор пока специально не определено иное где-либо в данном документе, все остальные технические и научные термины, используемые в данном документе, имеют общепринятые значения, понятные специалисту в области, к которой относится изобретение.

При использовании в данном документе, включая прилагаемую формулу изобретения, формы единственного числа «a», «an» и «the» включает их соответствующие множественные значения до тех пор, пока из контекста ясно не следует иное.

«Активация» при применении к клеткам или к рецепторам относится к активации или к обработке клетки или рецептора с помощью лиганда до тех пор, пока не указано иное по контексту или в прямой форме. «Лиганд» охватывает природные и синтетические лиганды, например, цитокины, варианты цитокинов, аналоги, мутантные белки и связывающие соединение, выделенные из антител. «Лиганд» также охватывает низкомолекулярные соединения, например, пептидомиметики цитокинов и пептидомиметики антител. «Активация» может относиться к клеточной активации, регулируемой внутренними механизмами, а также внешними факторами и факторами окружающей среды.

«Активность» молекулы может описывать или относиться к связыванию молекулы с лигандом или с рецептором, к каталитической активности; к способности стимулировать экспрессию генов и клеточную сигнальную систему, к дифференцировке или созреванию; к антигенной активности, к модулированию активностей других молекул и тому подобное. «Активность» молекулы также может относиться к активности при модулировании или поддержании межклеточных взаимодействий, например, адгезии, или активности при поддержании структуры клетки, например, клеточных мембран или цитоскелета. «Активность» также может означать удельную активность, например, [каталитическая активность]/[мг белка], или [иммунологическая активность]/[мг белка], концентрацию в биологическом компартменте и тому подобное. «Активность» может относиться к модулированию компонентов врожденного или приобретенного иммунитета.

«Введение» и «обработка» при применении к животному, например, к экспериментальному объекту-собаке, клетке, ткани, органу или к биологической жидкости, относится к контакту экзогенного фармацевтического средства, терапевтического средства, диагностического агента или композиции с животным, например, с объектом-собакой, с клеткой, тканью, органом или с биологической жидкостью. Обработка клетки охватывает контакт реагента с клеткой, а также контакт реагента с жидкостью, где жидкость находится в контакте с клеткой. «Введение» и «обработка» также означает in vitro и ex vivo обработки, например, клетки, реагентом, диагностическим, связывающим соединением или другой клеткой. Термин «объект» включает любой организм, предпочтительно, животное, более предпочтительно, млекопитающее (например, собаку, кошку или человека) и, наиболее предпочтительно, собаку.

«Лечить» или «лечение» означает введение терапевтического агента, такого как композиция, содержащая любое из антител или антиген-связывающих фрагментов по настоящему изобретению, внутренне или внешне объекту-собаке или пациенту, имеющему один или несколько симптомов заболевания или предрасположенного к заболеванию, на которое направлена терапевтическая активность агента. Как правило, агент вводят в количестве, эффективном для облегчения и/или улучшения одного или нескольких симптомов заболевания при лечении объекта или популяции, посредством чего индуцируют регрессию или ингибирование прогрессии таких симптомов до любой клинически измеряемой степени. Количество терапевтического агента, которое эффективно для облегчения любого конкретного симптома заболевания (также обозначаемого как «терапевтически эффективное количество»), может варьироваться согласно факторам, таким как стадия заболевания, возраст и масса пациента (например, собаки), и от способности фармацевтической композиции вызывать целевой ответ у объекта. Облегчение или улучшение симптома заболевания можно оценить с помощью любого клинического измерения, как правило, используемого ветеринарами или другими медицинскими работниками, для оценки состояния тяжести или прогрессии данного симптома. В то время как воплощение настоящего изобретения (например, способ лечения или готовое изделие) может быть неэффективным в облегчении симптомов целевого заболевания, оно должно облегчать симптомы целевого заболевания у статистически значимого количества объектов, как определено с помощью статистического теста, известного в данной области, такого как тест Стъюдента, критерий хиквадрат, U-тест Манна и Уитни, критерий Крускала-Уоллиса (H-тест), Критерий Джонкхиера-Терпстра и критерий Уилкоксона.

«Лечение» при применении к объекту-человеку, объекту ветеринарии (например, к собаке) или к объекту исследования, относится к терапевтическому лечению, а также к исследовательским и диагностическим применениям. «Лечение» при применении к объекту-человеку, объекту ветеринарии (например, к собаке), или к исследовательскому объекту, или к клетке, ткани или к органу охватывает контакт антител или антиген-связывающих фрагментов по настоящему изобретению с объектом-собакой или с другим животным объектом, клеткой, тканью, физиологическим компартментом или физиологической жидкостью.

Было обнаружено, что собачий PD-1 содержит аминокислотную последовательность SEQ ID NO: 2. В конкретном воплощении, собачий PD-1 кодируется нуклеиновой кислотой, которая содержит нуклеотидную последовательность SEQ ID NO: 1. Последовательности собачьего PD-1 могут отличаться наличием, например, консервативных вариаций в неконсервативных областях, но собачий PD-1 будет обладать по существу такой же физиологической функцией, что и собачий PD-1, содержащий аминокислотную последовательность SEQ ID NO: 2. Например, биологическая функция PD-1 состоит в ослаблении T-клеточных ответов при связывании с PD-L1 и/или PD-L2. То есть, PD-1 может рассматриваться как отрицательный регулятор. Следует заметить, что цитоплазматический хвост PD-1 содержит два тирозин-содержащих сигнальных мотива, ITIM (ингибирующий тирозин-содержащий мотив иммунорецепторов) и ITSM (переключающий тирозин-содержащий мотив иммунорецепторов). Кроме того, биологическая функция собачьего PD-1 может заключаться в наличии, например, эпитопа во внеклеточном домене, который специфично связывается с антителом по настоящему изобретению.

Было обнаружено, что собачий PD-L1 содержит аминокислотную последовательность SEQ ID NO: 8. В конкретном воплощении, собачий PD-L1 кодируется нуклеотидной последовательностью, содержащей SEQ ID NO: 7. Последовательности собачьего PD-L1 могут отличаться наличием, например, консервативных вариаций в неконсервативных областях, но собачий PD-L1 будет обладать по существу такой же физиологической функцией, что и собачий PD-L1, содержащий аминокислотную последовательность SEQ ID NO: 8. Например, одна биологическая функция PD-L1 заключается в ослаблении T-клеточных ответов при связывании с PD-1.

Конкретная аминокислотная последовательность собачьего PD-1 или PD-L1, соответственно, будет, как правило, по меньшей мере на 90% идентична собачьему PD-1, содержащему аминокислотную последовательность SEQ ID NO: 2, или собачьему PD-L1, содержащему аминокислотную последовательность SEQ ID NO: 8, соответственно. В некоторых случаях, собачий PD-1 или PD-L1, соответственно, может быть, по меньшей мере на 95%, или даже по меньшей мере на 96%, 97%, 98% или на 99% идентичен собачьему PD-1, содержащему аминокислотную последовательность SEQ ID NO: 2, или собачьему PD-L1, содержащему аминокислотную последовательность SEQ ID NO: 8, соответственно. В некоторых воплощениях, аминокислотная последовательность собачьего PD-1 или PD-L1 будет демонстрировать различие не более чем в 10 аминокислот от собачьего PD-1, содержащего аминокислотную последовательность SEQ ID NO: 2, или от собачьего PD-L1, содержащего аминокислотную последовательность SEQ ID NO: 8, соответственно. В некоторых воплощениях, аминокислотная последовательность собачьего PD-1 или PD-L1, соответственно, может демонстрировать не более чем 5, или даже не более чем 4, 3, 2, или 1 различие в аминокислотах от собачьего PD-1, содержащего аминокислотную последовательность SEQ ID NO: 2, или от собачьего PD-L1, содержащего аминокислотную последовательность SEQ ID NO: 8, соответственно. Процент идентичности может определяться, как описано в данном документе ниже.

Термин «иммунный ответ» относится к действию, например, лимфоцитов, антиген-презентирующих клеток, фагоцитарных клеток, гранулоцитов и растворимых макромолекул, продуцируемых вышеописанными клетками печени (включая антитела, цитокины и белки системы комплемента), что приводит в результате к селективному разрушению, деструкции или выведению из тела млекопитающего (например, тела собаки) злокачественных клеток, клеток или тканей, инфицированных патогенами, или инвазивных патогенов.

Канинизированные антитела к человеческому PD-1

В настоящем изобретении предлагаются выделенные канинизированные мышиные антитела к человеческому PD-1 или их антиген-связывающие фрагменты, которые связываются с собачьим PD-1, и применения таких антител или фрагментов.

При использовании в данном документе, канинизированное мышиное антитело к человеческому PD-1 относится к канинизированному антителу, которое специфично связывается с PD-1 млекопитающего. Антитело, которое специфично связывается с PD-1 млекопитающего, и конкретно, с собачьим PD-1, представляет собой антитело, которое демонстрирует предпочтительное связывание с PD-1 млекопитающего по сравнению с другими антигенами, но при этом данная специфичность не требует абсолютной специфичности связывания. Канинизированное мышиное антитело к человеческому PD-1 рассматривается как «специфичное» к собачьему PD-1, если это связывание является решающим фактором присутствия собачьего PD-1 в биологическом образце, полученном от собаки, или если это способно изменить активность собачьего PD-1 без чрезмерного препятствия активности других собачьих белков в образце тканей собаки, например, без получения нежелательных результатов, таких как ложные положительные результаты в контексте диагностики или побочные эффекты в терапевтическом контексте. Степень специфичности, необходимая для канинизированного мышиного антитела к человеческому PD-1 может зависеть от предназначенного применения антитела, и по крайней мере определяется его пригодностью для применения для назначенной цели. Антитело или связывающее соединение, выделенное из антиген-связывающего сайта антитела, рассматриваемым способом связывается со своим антигеном или его вариантом или его мутантом с аффинностью, которая по меньшей мере в два раза выше, предпочтительно по меньшей мере в десять раз выше, более предпочтительно, по меньшей мере в 20 раз выше и наиболее предпочтительно, по меньшей мере в 100 раз выше, чем аффинность связывания с другим собачьим антигеном.

При использовании в данном документе, говорят, что антитело специфично связывается с полипептидом, содержащим данную последовательность (в данном случае собачий PD-1), если оно связывается с полипептидами, содержащими последовательность собачьего PD-1, но не связывается с другими собачьими белками, лишенными аминокислотной последовательности собачьего PD-1. Например, антитело, которое специфично связывается с полипептидом, содержащим собачий PD-1, может связываться с FLAG®-маркированной формой собачьего PD-1, но не будет связываться с другими FLAG®-маркированными собачьими белками.

При использовании в данном документе, до тех пор, пока не указано иное, «фрагмент антитела» или «антиген-связывающий фрагмент» относится к антиген-связывающим фрагментам антител, т.е. к фрагментам антител, которые сохраняют способность специфично связываться с антигеном (например, с собачьим PD-1), связанным полноразмерным антителом, например, к фрагментам, которые сохраняют одну или несколько областей CDR. Примеры антиген-связывающих фрагментов включают в частности Fab-, Fab'-, F(ab')2-, и Fv-фрагменты; диатела; линейные антитела; молекулы одноцепочечных антител, например, sc-Fv; нанотела и мультиспецифичные антитела, образованные из фрагментов антител.

Как правило, канинизированное антитело или его антиген-связывающий фрагмент по изобретению сохраняет по меньшей мере 10% активности связывания собачьего PD-1 (по сравнению с соответствующим родительским антителом), когда эта активность выражена на молярной основе. Предпочтительно, антитело или антиген-связывающий фрагмент по изобретению сохраняет по меньшей мере 20%, 50%, 70%, 80%, 90%, 95% или 100% или более аффинности связывания с собачьим PD-1, по сравнению с родительским антителом. Также подразумевается, что антитело или антиген-связывающий фрагмент по изобретению может включать консервативные или неконсервативные аминокислотные замены (обозначаются как «консервативные варианты» или «функционально консервативные варианты» антитела), которые по существу не изменяют его биологической активности.

«Выделенное антитело» относится к статусу очистки и в таком контексте означает молекулу, которая по существу свободна от других биологических молекул, таких как нуклеиновые кислоты, белки, липиды, углеводы или другой материал, такой как клеточный дебрис и ростовая среда. Как правило, термин «выделенный» не предназначен для обозначения полного отсутствия такого материала или отсутствия воды, буферов или солей до тех пор, пока они присутствуют в количествах, которые по существу препятствуют экспериментальному или терапевтическому применению связывающего соединения, описанного в данном документе.

Вариабельные области каждой пары легкой/тяжелой цепи образуют антиген-связывающий сайт антитела. Таким образом, вообще, интактное антитело содержит два сайта связывания. За исключением бифункциональных или биспецифичных антител два сайта связывания, в основном, одинаковы.

Как правило, вариабельные домены обеих, тяжелой и легкой, цепей содержит три гипервариабельные области, также называемые областями, определяющими комплементарность, (CDR), локализованные внутри относительно консервативных каркасных областей (FR). CDR обычно фланкированы каркасными областями, что дает возможность связывания со специфичным эпитопом. Вообще, от N-конца к C-концу вариабельные домены обеих цепей, легкой и тяжелой, содержат FR1, CDR1, FR2 , CDR2, FR3, CDR3 и FR4. Распределение аминокислот в каждом домене, как правило, согласуется с определениями Sequences of Proteins of Immunological Interest, Kabat, et al; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No. 91-3242 (1991); Kabat, Adv. Prot. Chem. 32:1-75 (1978); Kabat, et al., J. Biol. Chem. 252:6609-6616 (1977); Chothia, et al, J.Mol. Biol. 196:901-917 (1987) или Chothia, et al, Nature 342:878-883 (1989)].

При использовании в данном документе, термин «гипервариабельная область» относится к аминокислотным остаткам антитела, которые отвечают за антигенное связывание. Гипервариабельная область содержит аминокислотные остатки из «области, определяющей комплементарность» или «CDR» (т.e. CDRL1, CDRL2 и CDRL3 в вариабельном домене легкой цепи и CDRH1, CDRH2 и CDRH3 в вариабельном домене тяжелой цепи). [См. Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), определение CDR-областей антитела по последовательности; см., также Chothia and Lesk, J. Mol. Biol. 196: 901-917 (1987), определение CDR-областей антитела по структуре]. При использовании в данном документе, термин «каркасные» или «FR» остатки относится к таким остаткам вариабельных доменов, которые отличаются от остатков гипервариабельных областей, определенных в данном документе как CDR-остатки.

При использовании в данном документе, термин «собака» включает всех домашних собак, семейство волчьих или семейство псовых до тех пор, пока не указано иное.

При использовании в данном документе термин «собачий каркас» относится к аминокислотной последовательности тяжелой цепи и легкой цепи собачьего антитела, отличной от остатков гипервариабельной области, определенных в данном документе как CDR-остатки. Что касается канинизированного антитела, то в большинстве воплощений аминокислотные последовательности нативных собачьих CDR заменяют на соответствующие чужеродные CDR (например, из мышиного антитела) в обеих цепях. Необязательно, тяжелая и/или легкая цепь собачьего антитела может содержать некоторые чужеродные остатки, отличные от CDR-остатков, например, для сохранения конформации чужеродных CDR внутри собачьего антитела и/или для модификации функции Fc, как обсуждается ниже.

Существует четыре известных подтипа тяжелой цепи IgG собачьего IgG, и они обозначаются как IgG-A, IgG-B, IgG-C, и IgG-D. Два известных подтипа легкой цепи обозначаются как лямбда и каппа.

Несмотря на связывание и активацию собачьих иммунных клеток, собачье или канинизированное антитело к PD-1 оптимально имеет два свойства:

1. оно лишено эффекторных функций, таких как антитело-зависимая цитотоксичность (ADCC) и комплемент-зависимая цитотоксичность (CDC), и

2. легко очищается в крупном масштабе с использованием стандартных технологий, таких как на основе хроматографии с протеином A.

Ни один из природных изотипов собачьего IgG не удовлетворяет обоим критериям. Например, IgG-B может очищаться с использованием протеина A, но при этом он имеет высокий уровень ADCC-активности. C другой стороны, IgG-A слабо связывается с протеином A, но демонстрирует нежелательную активность ADCC. Кроме того, ни IgG-C, ни IgG-D не может быть очищен на колонках с протеином A, хотя IgG-D демонстрирует отсутствие ADCC-активности. (IgG-C имеет значительную ADCC-активность). Настоящее изобретение преодолевает эти трудности путем предложения мутантных собачьих IgG-B антител, специфичных к PD-1; такие антитела лишены эффекторных функций, таких как ADCC, и могут быть легко очищены с использованием промышленной стандартной хроматографии с протеином A.

При использовании в данном документе, термин «канинизированное антитело» относится к антителу, которое содержит три CDR тяжелой цепи и три CDR легкой цепи из мышиного антитела к человеческому PD-1 вместе с собачьим каркасом или с модифицированным собачьим каркасом. Модифицированный собачий каркас содержит одну или несколько аминокислотных замен, приведенных в данном документе в качестве примера, которые дополнительно оптимизируют эффективность канинизированного антитела, например, для усиления его связывания с собачьим PD-1 и/или его способности блокировать связывание собачьего PD-1 с собачьим PD-L1.

«Гомология» относится к сходству между двумя полинуклеотидными последовательностями или между двумя полипептидными последовательностями, когда они оптимально выровнены. Когда положение в обеих из двух сравниваемых последовательностей занято тем же основанием или субъединицей аминокислотного мономера, например, если положение в каждой из двух ДНК-молекул занято аденином, то молекулы гомологичны в таком положении. Процент гомологии представляет собой количество гомологичных положений, общих для двух последовательностей, деленное на суммарное количество положений, сравнимых со 100. Например, если 6 из 10 положений в двух последовательностях согласуются или гомологичны, когда последовательности оптимально выровнены, то две последовательности гомологичны на 60%. Как правило, сравнение осуществляют, когда две последовательности выровнены с получением максимального процента гомологии.

«Выделенная молекула нуклеиновой кислоты» означает геномную ДНК или РНК, мРНК, кДНК или молекулы синтетического происхождения или некоторые их комбинации, которые не ассоциированы с полным полинуклеотидом или с его частью, где выделенные полинуклеотиды присутствуют в естественной среде или связаны с полинуклеотидом, с которым они не связаны в естественной среде. Для целей настоящего описания, следует понимать, что «молекула нуклеиновой кислоты, содержащая» конкретную нуклеотидную последовательность, не охватывает интактные хромосомы. Выделенные молекулы нуклеиновой кислоты, «содержащие» конкретные последовательности нуклеиновых кислот, могут включать дополнительно к конкретным последовательностям кодирующие последовательности до десяти или даже до двадцати или более других белков или их частей, или их фрагментов, или могут включать функционально связанные регуляторные последовательности, которые контролируют экспрессию кодирующей области упомянутых последовательностей нуклеиновых кислот, и/или могут включать векторные последовательности.

Выражение «контрольные последовательности» относится к ДНК-последовательностям, необходимым для экспрессии функционально связанной кодирующей области в конкретном организме-хозяине. Контрольные последовательности, которые подходят для прокариот, включают, например, промотор, необязательно операторную последовательность и сайт связывания рибосом. Известно, что эукариотические клетки используют промоторы, сигналы полиаденилирования и энхансеры.

Последовательность нуклеиновой кислоты является «функционально связанной», если она находится в функциональном взаимодействии с другой последовательностью нуклеиновой кислоты. Например, ДНК для последовательности-предшественника или секреторный лидер функционально связаны с ДНК для полипептида, если он экспрессируется в виде белка-предшественника, который участвует в секреции полипептида; промотор или энхансер функционально связан с кодирующей последовательностью, если он действует на транскрипцию последовательности; или сайт связывания рибосомы функционально связан с кодирующей последовательностью, если он присутствует для облегчения трансляции. Как правило, «функционально связанный» означает, что связанные ДНК-последовательности непрерывны и, в случае секреторного лидера, непрерывны и находятся в фазе чтения. Однако, энхансеры не должны быть непрерывными. Связывание осуществляется лигированием по подходящим сайтам рестрикции. Если таких сайтов не существует, синтетические олигонуклеотидные адапторы или линкеры используют в соответствии с обычной практикой. Также следует понимать, что когда в данном документе предлагается последовательность нуклеиновой кислоты, то она может включать стоп-кодон. Однако, поскольку стоп-кодоны взаимозаменяемы, то включение специфичного стоп-кодона в последовательность не должно рассматриваться как необходимая часть данной последовательности.

При использовании в данном документе, выражения «клетка», «клеточная линия» и «клеточная культура» используются взаимозаменяемо, и все такие обозначения включают потомство. Таким образом, слова «трансформанты» и «трансформированные клетки» включают первичную клетку-объект и культуры, выведенные из нее, не учитывая количества переносов. Также понятно, что не все потомство будет иметь точно идентичное содержание ДНК, что связано с преднамеренными или со спонтанными мутациями. Включено мутантное потомство, которое обладает такой же функцией или биологической активностью, которые выявляются при скрининге в исходно трансформированной клетке. В случае, где подразумеваются различные обозначения, это будет понятно из контекста.

При использовании в данном документе, «зародышевая последовательность» относится к нереаранжированным ДНК-последовательностям иммуноглобулинов. Может использоваться любой подходящий источник нереаранжированных последовательностей иммуноглобулинов. Человеческие зародышевые последовательности могут быть получены, например, из базы данных зародышевых последовательностей JOINSOLVER® на веб-сайте Национального института артрита и скелетно-мышечных и кожных заболеваний Национального института здравоохранения. Например, мышиные зародышевые последовательности могут быть получены, как описано в Giudicelli et al. [Nucleic Acids Res. 33:D256-D261 (2005)].

Свойства Типичных Канинизированных Мышиных Антител к Человеческому PD-1

В настоящем изобретении предлагаются выделенные канинизированные мышиные антитела к человеческому PD-1 и способы применения антител или их антиген-содержащих фрагментов при лечении заболевания, например, лечения злокачественного новообразования у собак. Примеры канинизированных мышиных антител к человеческому PD-1, которые связываются с PD-1, включают, в частности: антитела, которые содержат тяжелые цепи собачьих IgG-A, IgG-B и IgG-D и/или собачьи легкие цепи каппа вместе с CDR мышиного антитела к человеческому PD-1. Соответственно, в настоящем изобретении предлагаются выделенные канинизированные мышиные антитела к человеческому PD-1 или их антиген-содержащие фрагменты, которые связываются с собачьим PD-1 и блокируют связывание собачьего PD-1 с собачьим PD-L1.

Выделенное антитело или его антиген-связывающий фрагмент, который связывается с собачьим PD-1, может содержать одну, две, три, четыре, пять или шесть областей, определяющих комплементарность (CDR), мышиного антитела к человеческому белку, как описано в данном документе. Одна, две, три, четыре, пять или шесть CDR могут быть независимо выбраны из CDR-последовательностей, которые представлены в Таблице 2 в Примерах ниже. В некоторых воплощениях, одну, две или три CDR выбирают из VL CDR (аминокислотные последовательности SEQ ID NO: 20, 22 и/или 24) и/или одну, две или три CDR выбирают из VH CDR (SEQ ID NO: 14, 16 и/или 18), и/или консервативно модифицированных вариантов одной, двух или трех из этих VLCDR и/или консервативно модифицированных вариантов одной, двух или трех из VH CDR.

В дополнительном воплощении, выделенное антитело или его антиген-связывающий фрагмент, который связывается с собачьим PD-1, содержит легкую цепь каппа собачьего антитела, содержащую мышиные CDR-1, CDR-2 и/или CDR-3 легкой цепи, и тяжелую цепь собачьего антитела, содержащую мышиные CDR-1, CDR-2 и/или CDR-3 тяжелой цепи.

В других воплощениях, в изобретении предлагаются антитела или их антиген-связывающие фрагменты, которые специфично связываются с PD-1 и содержат легкие цепи каппа собачьего антитела, содержащие CDR, имеющие по меньшей мере 80%, 85%, 90%, 95%, 98% или 99% идентичности последовательности с SEQ ID NO: 20, 22 и/или 24, и тяжелую цепь собачьего антитела, содержащую CDR, имеющие по меньшей мере 80%, 85%, 90%, 95%, 98% или 99% идентичности последовательности с SEQ ID NO: 14, 16 и/или 18, демонстрируя при этом целевое связывание и функциональные свойства. В другом воплощении антитело или антиген-связывающий фрагмент по настоящему изобретению содержат собачий каркас, состоящий из комбинации последовательности тяжелой цепи IgG (содержащей аминокислотную последовательность SEQ ID NO: 26, 28 или 30 вместе с сигнальной последовательностью и без нее) вместе с легкой цепью каппа (содержащей аминокислотную последовательность SEQ ID NO: 32 или 34 вместе с сигнальной последовательностью и без нее), содержащий до 0, 1, 2, 3 , 4, 5 , 6, 7, 8, 9, 10 или более консервативных или неконсервативных аминокислотных замен, демонстрируя при этом целевое связывание и функциональные свойства. В конкретном воплощении данного типа, количество консервативных аминокислотных замен составляет от 0 до 5 для тяжелой цепи IgG и 0-5 для легкой цепи каппа.

«Консервативно модифицированные варианты» или «консервативная замена» относятся к заменам аминокислот в белке на другие аминокислоты, имеющие сходные характеристики (например, заряд, размер боковой цепи, гидрофобность/гидрофильность, конформация остова и устойчивость, и т.д.), так что замены могут часто осуществляться без изменения биологической активности белка. Специалистам в данной области понятно, что, как правило, замены единственной аминокислоты в несущественных областях полипептидов по существу не изменяют его биологической активности [см., например, Watson et al., Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.; 1987)]. Кроме того, замены структурно или функционально сходных аминокислот с меньшей вероятностью нарушают биологическую активность. Различные воплощения антитела или антиген-связывающего фрагмента по настоящему изобретению содержат полипептидные цепи, содержащие последовательности, раскрытые в данном документе, например, SEQ ID NO: 26, 28, 30, 32 и/или 34, или полипептидные цепи, содержащие до 1, 2, 3,4, 5, 6, 7, 8, 9, 10, 12, 15, 20 или более консервативных аминокислотных замен. Типичные консервативные замены представлены в Таблице 1.

ТАБЛИЦА 1.
Примерные консервативные аминокислотные замены
Исходный остаток Консервативная замена
Ala (A) Gly; Ser;
Arg (R) Lys; His
Asn (N) Gln; His
Asp (D) Glu; Asn
Cys (C) Ser; Ala
Gln (Q) Asn
Glu (E) Asp; Gln
Gly (G) Ala
His (H) Asn; Gln
Ile (I) Leu; Val
Leu (L) Ile; Val
Lys (K) Arg; His
Met (M) Leu; He; Tyr
Phe (F) Tyr; Met; Leu
Pro (P) Ala
Исходный остаток Консервативная замена
Ser(S) Thr
Thr (T) Ser
Trp(W) Tyr; Phe
Tyr(Y) Trp; Phe
Val (V) Ile; Leu

Функционально-консервативные варианты антител по изобретению также рассматриваются настоящим изобретением. При использовании в данном документе «функционально-консервативные варианты» относятся к антителам или фрагментам, в которых один или более из аминокислотных остатков заменен без изменения целевых свойств, таких как антигенная аффинность и/или специфичность. Такие варианты включают в частности замену аминокислоты на другую аминокислоту со сходными свойствами, как например консервативные аминокислотные замены Таблицы 1.

Нуклеиновые Кислоты

Настоящее изобретение дополнительно включает нуклеиновые кислоты, кодирующие иммуноглобулиновые цепи канинизированных мышиных антител к человеческому PD-1 и их антиген-связывающие фрагменты, раскрытые в данном документе. Например, настоящее изобретение включает нуклеиновые кислоты, перечисленные в Таблицах 2 и 3 и в Списке последовательностей ниже.

Также в настоящее изобретение включены нуклеиновые кислоты, которые кодируют иммуноглобулиновые полипептиды, содержащие аминокислотные последовательности, которые по меньшей мере примерно на 70% идентичны, предпочтительно по меньшей мере примерно на 80% идентичны, более предпочтительно, по меньшей мере на 90% идентичны и наиболее предпочтительно по меньшей мере примерно на 95% идентичны (например, на 95%, 96%, 97%, 98%, 99%, 100%) аминокислотным последовательностям антител, представленных в данном документе, когда сравнение осуществляют с помощью алгоритма BLAST, где параметры алгоритма выбирают так, чтобы получить наибольшее соответствие между соответствующими последовательностями по всей длине соответствующих эталонных последовательностей. В настоящем изобретении дополнительно предлагаются нуклеиновые кислоты, которые кодируют иммуноглобулиновые полипептиды, содержащие аминокислотные последовательности, которые по меньшей мере примерно на 70% сходны, предпочтительно, по меньшей мере примерно на 80% сходны, более предпочтительно по меньшей мере примерно на 90% сходны и, наиболее предпочтительно, по меньшей мере примерно на 95% сходны (например, на 95%, 96%, 97%, 98%, 99%, 100%) с любой из эталонных аминокислотных последовательностей, когда сравнение осуществляют с помощью алгоритма BLAST, где параметры алгоритма выбирают так, чтобы получить наибольшее соответствие между соответствующими последовательностями по всей длине соответствующих эталонных последовательностей.

Идентичность последовательности относится к степени, в которой аминокислоты двух полипептидов являются аналогичными в эквивалентных положениях при оптимальном выравнивании двух последовательностей. Сходство последовательностей включает идентичные остатки и неидентичные биохимически родственные аминокислоты. Биохимически родственные аминокислоты, которые имеют общие свойства и могут быть взаимозаменяемыми, обсуждались выше.

Следующие ссылки относятся к алгоритмам BLAST, которые часто используют для анализа последовательностей: АЛГОРИТМЫ BLAST: Altschul, S.F., et al, J.Mol. Biol. 215:403-410 (1990); Gish, W., et al, Nature Genet. 3:266-272 (1993); Madden, T.L., et al, Meth. Enzymol 266:131-141(1996); Altschul, S.F., et al, Nucleic Acids Res. 25:3389-3402 (1997); Zhang, J., et al, Genome Res. 7:649-656 (1997); Wootton, J.C., et al, Comput. Chem. 17:149-163 (1993); Hancock, J.M. et al, Comput. Appl. Biosci. 10:67-70 (1994); БАЛЛЬНАЯ СИСТЕМА ВЫРАВНИВАНИЯ: Dayhoff, M.O., et al, "A model of evolutionary change in proteins." in Atlas of Protein Sequence and Structure, vol. 5, suppl. 3. M.O. Dayhoff (ed.), pp. 345-352, (1978); Natl. Biomed. Res. Found., Washington, DC; Schwartz, R.M., et al, "Matrices for detecting distant relationships." in Atlas of Protein Sequence and Structure, vol. 5, suppl. 3." (1978), M.O. Dayhoff (ed.), pp. 353-358 (1978), Natl. Biomed. Res. Found., Washington, DC; Altschul, S.F., J. Mol. Biol. 219:555-565 (1991); States, D.J., et al, Methods 3:66-70(1991); Henikoff, S., et al, Proc. Natl. Acad. Sci. USA 89:10915-10919 (1992); Altschul, S.F., et al, J.Mol. Evol. 36:290-300 (1993); СТАТИСТИКА ВЫРАВНИВАНИЯ: Karlin, S., et al, Proc. Natl. Acad. Sci. USA 87:2264-2268 (1990); Karlin, S., et al, Proc. Natl. Acad. Sci. USA 90:5873-5877 (1993); Dembo, A., et al, Ann. Prob. 22:2022-2039 (1994); and Altschul, S.F. "Evaluating the statistical significance ofmultiple distinct local alignments." in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), pp. 1-14, Plenum, New York (1997).

В настоящем изобретении также предлагаются экспрессирующие векторы, содержащие выделенные нуклеиновые кислоты по изобретению, где нуклеиновая кислота функционально связана с контрольными последовательностями, которые распознаются клеткой-хозяином, когда она трансфецирована вектором. Также предлагаются клетки-хозяева, содержащие экспрессирующий вектор по настоящему изобретению, и способы получения антитела или его антиген-связывающего фрагмента, раскрытые в данном документе, включающие культивирование в культуральной среде клетки-хозяина, несущей экспрессирующий вектор, кодирующий антитело или антиген-связывающий фрагмент, и выделение антитела или антиген-связывающего фрагмента из клетки-хозяина или из культуральной среды.

Связывание эпитопа и аффинность связывания

В настоящем изобретении дополнительно предлагаются антитела или их антиген-связывающие фрагменты, которые связываются с тем же эпитопом на собачьем PD-1, что и канинизированное мышиное антитело к человеческому PD-1, содержащее аминокислотную последовательность SEQ ID NO: 28 и/или SEQ ID NO: 32, или канинизированное мышиное антитело к человеческому PD-1, содержащее аминокислотную последовательность SEQ ID NO: 28 и/или SEQ ID NO: 34. Канинизированные мышиные антитела к человеческому PD-1 или их антиген-связывающие фрагменты способны ингибировать связывание собачьего PD-1 с собачьим PD-L1.

Канинизированное мышиное антитело к человеческому PD-1 может быть получено рекомбинантным способом, как описано ниже в примерах. Клеточные линии млекопитающих, доступные в качестве хозяев для экспрессии антител или фрагментов, раскрытых в данном документе, хорошо известны в данной области и включают множество иммортализованных клеточных линий, доступных из Американской Типированной Коллекции Клеточных Культур (ATCC). Они включают, среди прочего, клетки яичника китайского хомяка (CHO), NSO, клетки SP2, клетки HeLa, клетки почки новорожденного хомяка (BHK), клетки почки обезьяны (COS), клетки гепатоклеточной карциномы человека (например, Hep G2), клетки A549, клетки 3T3, клетки HEK-293 и ряд других клеточных линий. Клетки-хозяева млекопитающих включают клетки человека, мыши, крысы, собаки, обезьяны, свиньи, козы, коровы, лошади и хомяка. Особенно предпочтительные клеточные линии выбирают посредством определения того, в какой клеточной линии будет высокий уровень экспрессии. Другие клеточные линии, которые могут использоваться, представляют собой клеточные линии насекомых, такие как клетки Sf9, клетки амфибий, бактериальные клетки, растительные клетки и грибные клетки. Когда рекомбинантные экспрессирующие векторы, кодирующие тяжелую цепь или антиген-связывающую часть или ее фрагмент, легкую цепь и/или ее антиген-связывающий фрагмент, вводят в клетки-хозяева млекопитающих, то антитела получают путем культивирования клеток-хозяев в течение периода времени, достаточного для того, чтобы дать возможность антителу экспрессироваться в клетках-хозяевах или, более предпочтительно, секретироваться в культуральную среду, в которой выращивают клетки-хозяева.

Антитела могут быть извлечены из культуральной среды с использованием стандартных методов очистки белка. Кроме того, экспрессия антител по изобретению (или других их компонентов) из продуцирующих клеточных линий может повышаться с использованием ряда известных методов. Например, система экспрессии гена глутаминсинтетазы (система GS) представляет собой распространенный способ повышения экспрессии при определенных условиях. Система GS обсуждается в целом или частично в связи с Европейскими патентами No. 0 216 846, 0 256 055 и 0 323 997 и Европейской патентной заявкой No. 89303964.4.

Как правило, гликопротеины, продуцируемые в конкретной клеточной линии или в трансгенном животном, будут иметь профиль гликозилирования, который является характерным для гликопротеинов, продуцируемых в клеточной линии или в трансгенном животном. Таким образом, конкретный профиль гликозилирования антитела будет зависеть от конкретной клеточной линии или трансгенного животного, используемых для продуцирования антитела. Однако настоящее изобретение включает все антитела, кодируемые молекулами нуклеиновых кислот, представленных в данном документе, независимо от профиля гликозилирования, который могут иметь антитела. Аналогично, в конкретных воплощениях, могут быть предпочтительными антитела с профилем гликозилирования, включающим только нефукозилированные N-гликаны, так как было показано, что эти антитела, как правило, демонстрируют более мощную эффективность, чем их фукозилированные аналоги как in vitro, так и in vivo [См., например, Shinkawa et al, J.Biol. Chem. 278: 3466-3473 (2003); патенты США No. 6946292 и 7214775].

Настоящее изобретение дополнительно включает фрагменты канинизированных мышиных антител к человеческому PD-1, раскрытых в данном документе. Фрагменты антител включает F(ab)2-фрагменты, которые могут быть получены ферментативным расщеплением IgG с помощью, например, пепсина. Fab-фрагменты могут быть получены, например, восстановлением F(ab)2 с помощью дитиотреитола или меркаптоэтиламина. Fab-фрагмент представляет собой цепь VL-CL, присоединенную к цепи VH-CH1 с помощью дисульфидного мостика. F(ab)2-фрагмент представляет собой два Fab-фрагмента, которые в свою очередь, соединены двумя дисульфидными мостиками. Fab-часть молекулы F(ab)2 включает часть Fc-области, между которыми располагается дисульфидный мостик. Fv-фрагмент представляет собой VL или VH область.

В одном воплощении, антитело иди антиген-связывающий фрагмент содержит константную область тяжелой цепи, например, собачью константную область, как например, константную область тяжелой цепи собачьего IgG-A, IgG-B, IgG-C и IgG-D или ее вариант. В другом воплощении, антитело или антиген-связывающий фрагмент содержит константную область легкой цепи, например, константную область собачьей легкой цепи, как например, константную область собачьей легкой цепи лямбда или каппа или ее вариант. В качестве примера, а не ограничения, константная область собачьей тяжелой цепи может быть из IgG-D, и константная область собачьей легкой цепи может быть из каппа.

Конструкция антитела

Канинизированные мышиные антитела к человеческому PD-1 по настоящему изобретению были сконструированы так, чтобы включать модификации в каркасных остатках внутри вариабельных доменов родительского (т.е., собачьего) моноклонального антитела, например, для улучшения свойств антитела.

Экспериментальные и диагностические применения

Канинизированные мышиные антитела к человеческому PD-1 или их антиген-связывающие фрагменты по настоящему изобретению также могут применяться в диагностических анализах для собачьего белка PD-1, например, для детектирования его экспрессии в конкретных опухолевых клетках, тканях или в сыворотке. Такие диагностические способы могут применяться в диагностике различных заболеваний, конкретно, некоторых злокачественных новообразований у собак.

Например, такой способ включает следующие стадии:

(a) покрытие субстрата (например, поверхности лунки микропланшета, например, пластикового планшета) канинизированным мышиным антителом к человеческому PD-1 или его антиген-связывающим фрагментом;

(b) нанесение на субстрат образца, тестируемого на предмет присутствия собачьего PD- 1;

(c) промывание планшета так, чтобы удалялся несвязанный материал в образце;

(d) нанесение антител, меченных детектируемой меткой (например, антитела, связанные с ферментами), которые также специфичны к антигену PD- 1;

(e) промывание субстрата так, чтобы удалить несвязанные, меченные антитела;

(f) если меченные антитела связаны с ферментом, то нанесение химического вещества, которое фермент превращает во флуоресцентный сигнал; и

(g) детектирование присутствия меченного антитела.

В следующем воплощении, меченное антитело метят с помощью пероксидазы, которая реагирует с ABTS [например, 2,2'-азино-бис(3-eэтилбензотиазолин-6-сульфоновая кислота)] или с 3,3',5,5'-тетраметилбензидином с изменением цвета, которое детектируют. Альтернативно, меченое антитело с помощью детектируемого радиоизотопа (например, H), который можно детектировать с помощью сцинцилляционного счетчика в присутствии сцинтиллятора. Канинизированные мышиные антитела к человеческому PD-1 по изобретению могут использовать в процедуре Вестерн-блотинга или иммуноблотинга.

Такая процедура образует часть настоящего изобретения и включает, например:

(i) контакт мембраны или другого твердого субстрата, тестируемого на присутствие связанного собачьего PD-1 или его фрагмента с канинизированным мышиным антителом к человеческому PD-1 или с его антиген-связывающим фрагментом по настоящему изобретению. Такая мембрана может принимать форму нитроцеллюлозной мембраны или мембраны на виниловой основе [например, поливинилиденфторидная (PVDF)], на которую переносили белки, тестируемые на присутствие собачьего PD-1 в неденатурирующих условиях в геле PAGE (электрофорез в полиакриламидном геле) или в SDS-PAGE (электрофорез в полиакриламидном геле с додецилсульфатом натрия (например, после электрофоретического разделения в геле). Перед контактом мембраны с канинизированным мышиным антителом к человеческому PD-1 или с его антиген-связывающим фрагментом, мембрану необязательно блокировали, например, с помощью обезжиренного сухого молока или ему подобного для связывания неспецифический сайтов связывания белка на мембране.

(ii) промывание мембраны один или два раза для удаления канинизированного мышиного антитела к человеческому PD-1 или его антиген-связывающего фрагмента и другого несвязанного вещества; и

(iii) детектирование связанного канинизированного мышиного антитела к человеческому PD-1 или его антиген-связывающего фрагмента.

Детектирование связанного антитела или антиген-связывающего фрагмента может осуществляться путем связывания антитела или антиген-связывающего фрагмента с вторичным антителом (антитело к иммуноглобулину), которое помечено с возможностью детектирования, и затем путем детектирования присутствия вторичного антитела.

Канинизированные мышиные антитела к человеческому PD-1 и их антиген-связывающие фрагменты, раскрытые в данном документе, также могут использоваться для иммуногистохимических анализов. Такой способ образует часть настоящего изобретения и включает, например, (1) контакт клетки, тестируемой на присутствие собачьего PD-1, с канинизированным мышиным антителом к человеческому PD-1 или с его антиген-связывающим фрагментом по настоящему изобретению; и (2) детектирование антитела или фрагмента на клетке или внутри нее. Если само антитело или антиген-связывающий фрагмент помечены детектируемой меткой, то они детектируются напрямую. Альтернативно, антитело или антиген-связывающий фрагмент могут связываться с вторичным антителом, меченным детектируемой меткой, которое детектируют.

Некоторые канинизированные мышиные антитела к человеческому PD-1 и их антиген-связывающие фрагменты, раскрытые в данном документе, также могут использоваться для in vivo визуализации опухоли. Такой способ может включать инъекцию радиоактивно меченных канинизированных мышиных антител к человеческому PD-1 или их антиген-связывающих фрагментов в тело собаки, тестируемой на присутствие опухоли, ассоциированной с экспрессией собачьего PD-1, с последующей радионуклидной визуализацией тела пациента для детектирования присутствия меченого антитела или антиген-связывающего фрагмента, например, в локусах, содержащих высокую концентрацию антитела или антиген-связывающего фрагмента, которые связаны с опухолью.

Методы визуализации включают визуализацию SPECT (однофотонная эмиссионная компьютерная томография) или PET (позитрон-эмиссионная томография). Метки включают, например, йод-123 (123I) и технеций-99m (99mTc), например, совместно с визуализацией SPECT или 11C, 13N, 15О или 18F, например, совместно с визуализацией PET, или Индий-111 [См., например, Gordon et al., International Rev. Neurobiol. 67:385-440 (2005)].

Фармацевтические Композиции и Введение

Для получения фармацевтических или стерильных композиций канинизированного мышиного антитела к человеческому PD-1 или его антиген-связывающего фрагмента, их предварительно смешивают с фармацевтически приемлемым носителем или вспомогательным веществом. [См., например, Remington's Pharmaceutical Sciences и U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, PA (1984)].

Композиции терапевтических или диагностических агентов могут быть получены путем смешивания с приемлемыми носителями, вспомогательными веществами или стабилизаторами в форме, например, лиофилизированных порошков, взвесей, водных растворов или суспензий [см., например, Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, NY; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, NY; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner и Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, NY]. В одном воплощении, антитела к PD-1 по настоящему изобретению разводят до подходящей концентрации в растворе ацетата натрия pH 5-6, и добавляют для тоничности NaCl или сахарозу. Дополнительные агенты, такие как полисорбат 20 или полисорбат 80, могут быть добавлены для повышения стабильности.

Токсичность и терапевтическая эффективность композиций антител, которые вводят индивидуально или в комбинации с другим агентом, могут определяться с помощью стандартных фармацевтических процедур в клеточных культурах или экспериментальных животных, например, для определения LD50 (дозы, летальной для 50% популяции) и ED50 (дозы, терапевтически эффективной в 50% популяции). Соотношение доз между токсическим и терапевтическим эффектами соответствует терапевтическому индексу (LD50/ED50). В конкретных аспектах, целевыми являются антитела, демонстрирующие высокие терапевтические индексы. Данные, поученные из таких анализов клеточных культур и исследований на животных, могут использоваться при составлении диапазона дозировки для применения у собак. Дозировка таких соединений предпочтительно находится в диапазоне циркулирующих концентраций, которые включают ED50 со слабой токсичностью или при ее отсутствии. Дозировка может варьироваться внутри данного диапазона в зависимости от применяемой дозировки и пути введения.

Способ введения может варьироваться. Подходящие пути введения включают пероральный, ректальный, чрезслизистый, интестинальный, парентеральный; внутримышечный, подкожный, внутрикожный, костномозговой, внутриоболочечный, прямой внутрижелудочковый, внутривенный, внутрибрюшинный, интраназальный, внутриглазной, ингаляционный, инсуфляционный, местный, кожный, чрескожный или внутриартериальный.

В конкретных воплощениях, канинизированное мышиное антитело к человеческому PD-1 или его антиген-связывающий фрагмент могут вводить с помощью инвазивного пути, такого как инъекция. В следующих воплощениях изобретения, канинизированное мышиное антитело к человеческому PD-1 или его антиген-связывающий фрагмент вводят с помощью внутривенной, подкожной, внутримышечной, внутриартериальной, внутриопухолевой, или с помощью ингаляционной, аэрозольной доставки. Введение с помощью неинвазивных путей (например, перорально; например в пилюлях, капсулах или в таблетках) также находится в рамках настоящего изобретения.

Композиции могут вводить с использованием медицинских устройств, известных в данной области. Например, фармацевтическую композицию по изобретению могут вводить с помощью инъекции с использованием гиподермальной иглы, включающей, например, предварительно наполненный шприц или автоинжектор. Фармацевтические композиции, раскрытые в данном документе, также могут вводить с использованием безыгольного гиподермического инъекционного устройства; такого как устройства, раскрытые в патентах США No. 6620135; 6096002; 5399163; 5383851; 5312335; 5064413; 4941880; 4790824 или 4596556.

Фармацевтические композиции, раскрытые в данном документе, также могут вводить с помощью инфузии. Примеры хорошо известных имплантатов и модульных форм введения фармацевтических композиций включают: патент США No. 4487603, который раскрывает имплантируемую микроинфузионную помпу для высвобождения лекарственного средства с контролируемой скоростью; патент США № 4447233, который раскрывает инфузионную помпу для доставки лекарственного средства с точной скоростью инфузии; патент США № 4447224, который раскрывает имплантируемое устройство для непрерывной доставки лекарственного средства; патент США No. 4439196, который раскрывает осмотическую систему доставки лекарственного средства, содержащую многокамерные компартменты. Специалисту в данной области хорошо известно множество таких имплантатов, систем доставки и модулей.

Альтернативно, специалист может вводить канинизированное мышиное антитело к человеческому PD-1 скорее локально, чем системно, например, посредством инъекции антитела непосредственно в артритический сустав или в область поражения, вызванного патогеном, характеризующуюся иммунопатологией, часто в депо-составах или в составах с замедленным высвобождением. Кроме того, специалист может вводить канинизированное мышиное антитело к человеческому PD-1 в системе направленной доставки лекарственного средства, например, в липосоме, покрытой тканеспецифичным антителом, направленной, например, в артритический сустав или в область поражения, вызванного патогеном, характеризующуюся иммунопатологией. Липосомы будут направляться к пораженной ткани и селективно там поглощаться.

Схема введения зависит от нескольких факторов, включающих скорость переключения терапевтического антитела в сыворотке или ткани, уровень симптомов, иммуногенность терапевтического антитела и доступность целевых клеток в биологическом матриксе. Предпочтительно, схема введения доставляет достаточное количество терапевтического антитела для воздействия на улучшения целевого болезненного состояния, при одновременной минимизации нежелательных побочных эффектов. Соответственно, количество доставленного биологического вещества зависит частично от конкретного терапевтического антитела и от тяжести состояния, которое подвергается лечению. Общедоступно руководство по выбору подходящих доз терапевтических антител [см., например, Wawrzynczak Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK (1996); Kresina (ed.) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, NY (1991); Bach (ed.) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, NY (1993); Baert, et al. New Engl. J.Med. 348:601-608 (2003); Milgrom et al. New Engl. J.Med. 341:1966-1973 (1999); Slamon et al. New Engl. J. Med. 344:783-792 (2001); Beniaminovitz et al. New Engl. J. Med. 342:613-619 (2000); Ghosh et al. New Engl. J.Med. 348:24-32 (2003); Lipsky et al. New Engl J.Med. 343:1594-1602 (2000)].

Определение подходящей дозы осуществляет ветеринар, например, с использованием параметров или факторов, известных или предполагаемых из уровня техники, для воздействия на лечение. Как правило, доза начинается с количества, чуть меньшего, чем оптимальная доза, и повышается маленькими шагами до тех пор, пока не будет достигнут целевой или оптимальный эффект относительно любого негативного побочного эффекта. Важные диагностические показатели включают показатели симптомов, например, воспаление или уровень продуцированных воспалительных цитокинов.

Антитела или их антиген-связывающие фрагменты, раскрытые в данном документе, могут обеспечиваться непрерывной инфузией или водимыми дозами, например, раз в день, 1-7 раз в неделю, раз в неделю, раз в две недели, раз в месяц, раз в два месяца, раз в квартал, раз в полгода, раз в год и т.д.. Дозы могут обеспечиваться, например, внутривенно, подкожно, местно, перорально, назально, ректально, внутримышечно, внутрицеребрально, интраназально или с помощью ингаляции. Суммарная недельная доза, как правило, составляет по меньшей мере 0,05 мг/кг массы тела, более часто по меньшей мере 0,2 мкг/кг, 0,5мкг/кг, 1мкг/кг, 10мкг/кг, 100мкг/кг, 0,25 мг/кг, 1 мг/кг, 2 мг/кг, 5 мг/мл, 10 мг/кг, 25 мг/кг, 50 мг/кг или более [см., например, Yang, et al. New Engl. J.Med. 349:427-434 (2003); Herald, et al. New Engl. J.Med. 346:1692-1698 (2002); Liu, et al. J.Neurol. Neurosurg. Psych. 67:451-456 (1999); Portielji, et al. Cancer Immunol. Immunother. 52:133-144 (2003)]. Также могут быть предложены дозы для достижения определенной целевой концентрации канинизированного мышиного антитела к человеческому PD-1 в сыворотке объекта, как например, 0,1, 0,3, 1, 3, 10, 30, 100, 300 мкг/мл или более. В других воплощениях, канинизированное мышиное антитело к человеческому PD-1 вводят подкожно или внутривенно раз в неделю, раз в две недели, «каждые 4 недели», раз в месяц, раз в два месяца или раз в квартал по 10, 20, 50, 80, 100, 200, 500, 1000 или 2500 мг/на объект.

При использовании в данном документе, термины «ингибировать» или «лечить», или «лечение» включают отсрочку развития симптомов, ассоциированных с расстройством, и/или уменьшение тяжести симптомов такого расстройства. Термины дополнительно включают улучшение существующих неконтролируемых или нежелательных симптомов, предотвращение дополнительных симптомов и улучшение или предотвращение причин, обуславливающих такие симптомы. Таким образом, термины обозначают, что полезный результат приобретает объект-позвоночное с расстройством, заболеванием или симптомом или с потенциальным развитием такого расстройства, заболевания или симптома.

При использовании в данном документе, термины «терапевтически эффективное количество», «терапевтически эффективная доза» и «эффективное количество» относятся к количеству канинизированного мышиного антитела к человеческому PD-1 или его антиген-связывающего фрагмента по настоящему изобретению, которое при добавлении к клетке, ткани или объекту индивидуально или в комбинации с дополнительным терапевтическим агентом является эффективным по части получения измеряемого улучшения одного или нескольких симптомов заболевания или патологического состояния или прогрессии такого заболевания или патологического состояния. Терапевтически эффективная доза дополнительно относится к такому количеству связывания соединения, которого достаточно для получения по меньшей мере частичного улучшения симптомов, например, для лечения, излечивания, предотвращения или улучшения соответствующего медицинского состояния или для повышения скорости лечения, излечивания, предотвращения или улучшения таких патологических состояний. При применении к индивидуальному активному ингредиенту, который вводят индивидуально, терапевтически эффективная доза относится только к такому ингредиенту. При применении к комбинации, терапевтически эффективная доза относится к объединенным количествам активных ингредиентов, которые приводят к получению терапевтического эффекта при введении либо в комбинации, последовательно, либо одновременно. Эффективное количество терапевтического средства будет приводить к улучшению диагностического показателя или параметра по меньшей мере на 10%; обычно по меньшей мере на 20%; предпочтительно по меньшей мере примерно на 30%; более предпочтительно по меньшей мере на 40%, и наиболее предпочтительно по меньшей мере на 50%. Эффективное количество также может приводить к улучшению объективного показателя в случаях, где объективные показатели используют для оценки тяжести заболевания.

Другие комбинированные терапии

Как описано ранее, канинизированное мышиное антитело к человеческому PD-1 или его антиген-связывающий фрагмент могут вводиться вместе с одним или несколькими другими терапевтическими агентами (такими как химиотерапевтический агент). Антитело может быть связано с агентом (в виде иммунокомплекса) или может вводиться отдельно от агента. В последнем случае (отдельное введение), антитело может вводиться до, после или одновременно с агентом или может вводиться совместно с другими известными терапиями.

Наборы

Кроме того, предлагаются наборы, содержащие один или несколько компонентов, которые включают, в частности, антитело или антиген-связывающий фрагмент, как обсуждалось в данном документе, которые специфично связываются с PD-1 (например, канинизированное мышиное антитело к человеческому PD-1 или его антиген-связывающий фрагмент по настоящему изобретению) вместе с одним или несколькими дополнительными компонентами, включающими, в частности, фармацевтически приемлемый носитель и/или химиотерапевтический агент, как обсуждалось выше. Связывающая композиция и/или химиотерапевтический агент могут быть составлены в виде чистой композиции или в комбинации с фармацевтически приемлемым носителем в фармацевтической композиции.

В одном воплощении, набор включает связывающую композицию по изобретению (канинизированное мышиное антитело к человеческому PD-1, содержащее аминокислотную последовательность SEQ ID NO: 28 и SEQ ID NO: 32 или 34, или его фармацевтическую композицию в одном контейнере (например, в стерильном стеклянном или пластиковом флаконе) и его фармацевтическую композицию и/или химиотерапевтический агент в другом контейнере (например, в стерильном стеклянном или пластиковом флаконе).

В другом воплощении набор содержит комбинацию по изобретению, включающую компонент связывающей композиции (например, канинизированное мышиное антитело к человеческому PD-1, содержащее аминокислотную последовательность SEQ ID NO: 28 и SEQ ID NO: 32 или 34) наряду с фармацевтически приемлемым носителем, необязательно в комбинации с одним или с несколькими компонентами терапевтических агентов, смешанных вместе в одном составе, необязательно в фармацевтической композиции в одном общем контейнере.

Если набор включает фармацевтическую композицию для парентерального введения объекту, то набор может включать устройство для осуществления такого введения. Например, набор может включать одну или несколько гиподермических игл или других устройств для инъекции, как обсуждалось выше. Набор также может включать лист-вкладыш, включающий информацию, касающуюся фармацевтических композиций и лекарственных форм в наборе. Как правило, такая информация помогает владельцам домашних питомцев и ветеринарам в эффективном и безопасном использовании прилагаемых фармацевтических композиций и лекарственных форм. Например, следующая информация касательно комбинации по изобретению может быть представлена во вкладыше: фармакокинетика, фармакодинамика, клинические исследования, параметры эффективности, показания к применению, противопоказания, предупреждения, предостережения, побочные реакции, передозировки, корректные дозировки и введение, как поставляется, корректные условия хранения, ссылки, информация производителя/поставщика и патентная информация.

Для удобства антитело или специфический связывающий агент, раскрытый в данном документе, может предлагаться в наборе, т.е., в виде упакованной комбинации реагентов в определенных количествах с инструкциями для осуществления диагностических анализов или детектирования. Если антитело является меченым с помощью фермента, то набор может включать субстраты и кофакторы, необходимые для фермента (например, субстратного предшественника, который обеспечивает детектируемый хромофор или флюорофор). Кроме того, могут быть включены другие добавки, такие как стабилизаторы, буферы (например, блокирующий буфер или лизирующий буфер) и т.п. Относительные количества различных реагентов могут широко варьироваться для обеспечения концентраций в растворе реагентов, которые по существу оптимизируют чувствительность анализа. Конкретно, реагенты могут предлагаться в виде сухих порошков, обычно лиофилизированных, включающих вспомогательные вещества, которые при растворении обеспечивают раствор реагентов, имеющих подходящую концентрацию.

ПРИМЕРЫ

ПРИМЕР 1

СОБАЧИЙ PD-1 И PD-L1

Идентификация и клонирование собачьего PD-1:

Нуклеиновую кислоту, кодирующую полноразмерный собачий PD-1 (cPD-1), идентифицировали посредством поиска по базе данных генов NCBI (регистрационный номер XM_543338.4, SEQ ID NO: 1). Транслированная аминокислотная последовательность SEQ ID NO: 2 (регистрационный номер XP-543338.3) соответствует предполагаемому собачьему белку PD-1, который дополнительно идентифицировали посредством поиска по белковой базе данных (NCBI) и сравнения идентифицированной аминокислотной последовательности с аминокислотными последовательностями мышиного, кошачьего и человеческого PD-1. Синтезировали ДНК-последовательность, соответствующую полноразмерному собачьему гену PD-1, которая была оптимизирована по кодонам для клеток CHO, и клонировали в плазмиду, обозначенную p96793. Сравнение ДНК- и белковых последовательностей предсказанного собачьего PD-1 с известными ДНК- и белковыми последовательностями PD-1 привело к идентификации ДНК-последовательностей, кодирующих внеклеточный домен (ECD) собачьего PD-1 (SEQ ID NO: 3), и аминокислотной последовательности ECD собачьего PD-1 (SEQ ID NO: 4).

ДНК-последовательность, кодирующая ECD собачьего PD-1 дополнительно к GT-линкеру и 8 остаткам гистидина синтезировали и клонировали в плазмиду, обозначенную LPD2726. Последовательность нуклеиновой кислоты (SEQ ID NO: 5), соответствующая собачьему PD-1 ECD вместе с GT-линкером и Fc-частью гена Fc человеческого IgG1, химически синтезировали и клонировали в плазмиду, обозначенную LPD2727. Собачий PD-1 ECD и Fc-часть человеческого IgG1 содержит аминокислотную последовательность SEQ ID NO: 6.

Идентификация и клонирование собачьего PD-L1:

Нуклеиновую кислоту, кодирующую полноразмерный собачий PD-L1, идентифицировали посредством поиска по базе данных NCBI (регистрационный номер XM_541302.4; SEQ ID NO: 7). Транслированную аминокислотную последовательность (регистрационный номер XP-541302.4; SEQ ID NO: 8), соответствующую предполагаемому собачьему белку PD-L1, идентифицировали с помощью поиска по белковой базе данных genebank (NCBI) и путем сравнения идентифицированной последовательности с известными последовательностями мышиного и человеческого PD-L1.

Путем сравнения ДНК, кодирующей собачий PD-L1, с известными последовательностями PD-L1, идентифицировали ДНК-последовательность, соответствующую домену ECD собачьего PD-Ll (SEQ ID NO: 9; который оптимизировали по кодонам для клеток CHO). Предсказанная аминокислотная последовательность ECD собачьего PD-L1 соответствует SEQ ID NO: 10. ДНК, кодирующую PD-L1 ECD, вместе с GT-линкером и 8 остатков гистидина синтезировали и клонировали в плазмиду, обозначенную LPD2695.

ДНК-последовательность, кодирующую аминокислотную последовательность собачьего PD-Ll ECD, вместе GT-линкером и Fc-частью человеческого IgG1 (SEQ ID NO: 11) химически синтезировали и клонировали в плазмиду, обозначенную LPD2697. Собачий PD-L1 ECD вместе с GT-линкером Fc-частью человеческого IgG1 содержит аминокислотную последовательность SEQ ID NO: 12. Таблица 1 содержит описание экспрессирующих плазмид, упомянутых выше.

Таблица 1
ПЛАЗМИДЫ, СОДЕРЖАЩИЕ ДНК, КОДИРУЮЩУЮ PD-1 или PD-L1
НАЗВАНИЕ ПЛАЗМИДЫ ЭКСПРЕССИРОВАННЫЙ ГЕН
P96793 Собачий PD-1
LPD2726 Собачий PD-1 ECD-8HIS
LPD2727 Собачий PD-1 ECD-/Человеческий IgGl Fc
LPD2695 Собачий PD-Ll ECD-8HIS
LPD2697 Собачий PD-Ll ECD-/Человеческий IgGl Fc

Экспрессия белков PD-1 и PD-L1:

Экспрессирующие плазмиды, кодирующие белки PD-1ECD-HIS, PD-1ECD-Fc, PDL-1 ECD-HIS, и PD-L1 ECD-Fc, трансфецировали в клетки HEK 293, и белки очищали из надосадочной жидкости трансфецированных клеток с использованием хроматографии с Протеином A для Fc-гибридных белков или с использованием колоночной хроматографии Nickel (Ni2+) для HIS-маркированных белков. Очищенные белки использовали для: тИФА или анализов связывания, как подробно описано ниже. Экспрессированные белки анализировали с помощью гелей SDS-PAGE.

ПРИМЕР 2

ИДЕНТИФИКАЦИЯ МЫШИНЫХ МОНОКЛОНАЛЬНЫХ АНТИТЕЛ К ЧЕЛОВЕЧЕСКОМУ БЕЛКУ,

КОТОРЫЕ СВЯЗЫВАЮТСЯ С СОБАЧЬИМ PD-1

Подтверждение реактивности моноклональных антител против собачьего PD-1

Также было обнаружено, что одно из мышиных моноклональных антител, которые ранее были получены против человеческого PD-1 [hPD-1.08A, идентифицированное в US 8354509 B2, который включен с помощью ссылки в полоном объеме] обладает существенной реактивностью по отношению к собачьему PD-1. Очищенное hPD-1.08A тестировали на реактивность к HIS-маркированному ECD-домену собачьего PD-1 с помощью тИФА следующим образом: HIS-маркированный собачий белок PD-1 ECD разводили до 10мкг/мл в покрывающем буфере (Карбонат/Бикарбонат pH 9) и наносили по 100мкл/на лунку в 96-луночном плоскодонном ИФА-планшете (NUNC). Планшеты инкубировали при 4°C в течение ночи. Затем планшеты промывали три раза с использованием фосфатно-солевого буферного раствора, содержащего 0,05% Tween-20 (PBST). Затем добавляли 200 мкл блокирующего буфера (5% обезжиренного молока в PBST) в каждую лунку, и планшеты инкубировали при 37°C в течение 60 минут.

Затем планшеты промывали три раза с помощью PBST. Затем добавляли 100мкл тестируемых моноклональных антител (mAb), разведенных в блокирующем буфере, в первые лунки соответствующих рядов. Тестируемые mAb затем разводили в два раза до соответствующего положения на планшете. После инкубирования планшетов при 37°C в течение 60 минут, планшеты промывали три раза с помощью PBST. Затем, в планшеты добавляли 100мкл на лунку разведенные 1:2000 козьи антитела к мышиному IgG, конъюгированные с пероксидазой хрена (KPL), и инкубировали их при 37°C в течение 60 минут. Затем планшеты промывали три раза с помощью PBST и добавляли в планшеты 100мкл/на лунку 3,3',5,5'-тетраметилбензидин, (TMB) субстрат (из KPL). Давали проявиться цветной реакции в течение 5-20 минут при 37°C перед измерением поглощения при 650нм.

Клетки CHO, экспрессирующие собачий белок PD-1

Полноразмерный собачий ген PD-1 клонировали в плазмиду p96793. В данной плазмиде экспрессия собачьего белка PD-1 управлялась промотором hCMV. Клетки CHO DXB1 1 (dhfr-) поддерживали в MEM-альфа (Gibco), дополненной 10% фетальной бычьей сыворотки.

Трансфекцию клеток CHO плазмидой p96793 проводили в 75см2 флаконах, содержащих приблизительно 6 x 106 клеток, с помощью доставки генов, опосредованной липосомами, с использованием липофектамина (Invitrogen). Через 48 часов клетки пассировали в среде MEM-альфа без нуклеозидов, дополненной 10% FBS и 400мкг/мл гигромицина B (селективная среда). Клонирование с лимитирующим разведением осуществляли на пуле dhfr+ гигромицин-устойчивых клеток. Клоны оценивали на предмет экспрессии собачьего PD-1 с помощью иммунофлуоресцентного анализа. Вкратце, монослои клеток фиксировали в 96-луночных планшетах с помощью 80% ацетона. Фиксированные и высушенные монослои клеток затем инкубировали в течение 1 часа вместе с поликлональными козьими антителами к человеческому PD-1 (R&D Systems). Планшеты промывали с помощью PBS, затем инкубировали в течение 1 часа вместе с меченным флуоресцеином кроличьим антителом к козьему IgG (KPL). Планшеты промывали с помощью PBS. Клоны нарабатывали и создавали банки клеточных стоков.

Реактивность мышиных mAb против собачьих белков PD-1, экспрессриованных на клетках CHO

Реактивность мышиных mAb к человеческому PD-1 с собачьим PD-1 на клетках CHO определяли с помощью клеточного анализа с использованием клеток CHO, которые экспрессируют PD-1. Вкратце, клетки CHO, экспрессирующие собачий PD-1, культивировали до конфлюентности 80-100% в 50 мкл среды (DMEM/HAM's F12, 10% FBS; «CHO среда»). Затем, добавляли 50 мкл среды, содержащей различные концентрации очищенных mAb на 1 час при 37°C. После трех промывок с помощью PBS-TWEEN, добавляли 100 мкл козьих антител к мышиному белку, конъюгированных с пероксидазой хрена (HRP), разведенных 1:1000 в культуральной среде, на один час при 37°C. После трех дополнительных промывок с помощью PBS-TWEEN, связанные mAb визуализировали с помощью субстрата пероксидазы (TMB). Увеличение поглощения, обусловленное активностью пероксидазы, измеряли при 450 нм на ридере для микропланшетов. Проявление цвета останавливали путем добавления 50 мкл на лунку 1 M фосфорной кислоты.

Блокада лиганда с помощью мышиных и канинизированных mAb к PD-1

Для мышиных mAb к человеческому PD-1, которые реагируют с собачьим PD-1, использовали клеточный тИФА (CELISA) на основе клеточной линии CHO, экспрессирующей собачий PD-1. Блокаду лиганда подтверждали с использованием данного анализа совместно с биотинилированным белком cPD-L1/Fc. Вкратце, высевали клетки cPD-1 CHO в 96-луночные планшеты с плотностью 4 x 104 клеток на лунку и инкубировали клетки при 37°C в течение 18-24 часов до тех пор, пока они не достигнут конфлюентности 95-100%. Культуральную среду отсасывали, промывали планшеты 3 раза с помощью PBS + 0,05% Tween20 и 1 x CHO среда. Делали 3-кратные последовательные разведения mAb к cPD1 в CHO-среде, начиная от 30 мкг/мл, и добавляли в планшет 50 мкл/на лунку антитела каждого разведения. Инкубировали при 37°C, 5% C0 2 со встряхиванием в течение 30 мин. Добавляли 50 мкл/на лунку cPD-L1-Fc-биотин (2 мкг/мл в стоке CHO-среды) и продолжали инкубировать при 37°C, 5% CО2 со встряхиванием в течение 45 мин. Промывали планшеты шесть раз с помощью PBS + 0,05% Tween 20. Добавляли 100 мкл/на лунку 1:2000 стрептавидин-пероксидаза хрена (Streptavidin-HRP) в CHO-среде и инкубировали 30-60 мин при 37°C/5% CО 2. Промывали планшеты пять раз с помощью PBS + 0,05% Tween20. Добавляли 100 мкл/на лунку субстрат TMB для проявления цвета. Останавливали проявку цвета путем добавления 50 мкл/на лунку 1M фосфорной кислоты. Измеряли оптическую плотность (O.D.) при A450 - A620 с использованием ридера для тИФА-планшетов.

Клонирование и идентификация ДНК-последовательностей, соответствующих мышиному mAb Hpd-.08A

ДНК-последовательность мышиных цепей VH и VL и ДНК-последовательности, кодирующие их CDR, идентифицировали, как описано в US 8354509 [см., Таблицу IV US 8354509; представленную в Таблице 2 непосредственно ниже].

Таблица 2
Мышиные CDR антител к человеческому PD-1 из
hPD- 1.08A US 8354509
CDR Тяжелая цепь
(SEQ ID NO:)
Легкая цепь(SEQ ID NO:)
N.A. A.A. N.A. A.A.
CDR-1 13 14 19 20
CDR-2 15 16 21 22
CDR-3 17 18 23 24

ПРИМЕР 3

КАНИНИЗАЦИЯ МЫШИНОГО МОНОКЛОНАЛЬНОГО АНТИТЕЛА К ЧЕЛОВЕЧЕСКОМУ PD-1

С целью осуществления способа канинизации, определяли ДНК-последовательность, которая кодирует тяжелую и легкую цепи собачьего IgG. ДНК- и белковая последовательность собачьей тяжелой и легкой цепи известны в данной области и могут быть получены путем поиска в генной и белковой базах данных NCBI. Существует четыре известных подтипа собачьих IgG, и они обозначаются как IgG-A, IgG-B, IgG-C и IgG-D. Существует два типа легких цепей в собачьих антителах, которые обозначаются как каппа и лямбда. В Таблице 3 приведены обе, аминокислотная последовательность и последовательность нуклеиновой кислоты тяжелой цепи (IgG-A, IgG-B, IgG-D) и легкой цепи (каппа) модифицированного собачьего антитела по настоящему изобретению, которое содержит мышиные CDR антитела к человеческому PD-1 Таблицы 2.

Таблица 3
МОДИФИЦИРОВАННЫЕ СОБАЧЬИ ПОСЛЕДОВАТЕЛЬНОСТИ ТЯЖЕЛОЙ И ЛЕГКОЙ ЦЕПИ#
Тип цепи Подтип Нуклеиновая кислота SEQ ID NO: Аминокислота SEQ ID NO:
H IgG-A 25 26
H IgG-B 27 28
H IgG-D 29 30
L Каппа (1011) 31 32
L Каппа (1022) 33 34
#Последовательности не включают сигнальную последовательность.

Конструкция канинизированных антител к PD-1

Не будучи связанными каким-либо конкретным способом, способ получения вариантов канинизированных mAb к PD-1 с различным содержанием собачьих и мышиных последовательностей включает в себя общую схему:

i) Определение ДНК-последовательностей VH- и VL-цепей мышиных mab

ii) Идентификация CDR H- и L-цепи мышиных mab

iii) Идентификация подходящей H- и L-цепи собачьего IgG

iv) Написание ДНК-последовательности H- и L-цепи собачьего IgG

v) Замена ДНК-последовательности, кодирующей эндогенные CDR собачьей H- и L-цепи на ДНК-последовательности, кодирующие соответствующие мышиные CDR. Кроме того, необязательная замена некоторых собачьих каркасных остатков на выбранные остатки из соответствующих мышиных каркасных областей.

vi) Синтез ДНК из стадии (v) и клонирование ее в подходящую экспрессирующую плазмиду

vii) Трансфекция плазмид в клетки HEK 293

viii) Очистка экспрессированного антитела из надосадочной жидкости клеток HEK 293

ix) Тестирование очищенного антитела на связывание с собачьим PD-1

Вышеописанные стадии привели к получению ряда вариантов антител с различным содержанием собачьих и мышиных последовательностей. Настоящее изобретение идентифицирует канинизированные мышиные антитела к человеческому PD-1, содержащие SEQ ID NO: 28 и SEQ ID NO: 32 или 34, как обладающие особенно прочным связыванием с собачьим PD-1.

ДНК-последовательность полноразмерного собачьего PD-1 подчеркнута и выделена жирным шрифтом

Нуклеотидная последовательность SEQ ID NO: 1 представлена без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 35 включает сигнальную последовательность.

atggggagccggcgggggccctggccgctcgtctgggccgtgctgcagctgggctggtggccaggatggctcctagactcccctgacaggccctggagcccgctcaccttctccccggcgcagctcacggtgcaggagggagagaacgccacgttcacctgcagcctggccgacatccccgacagcttcgtgctcaactggtaccgcctgagcccccgcaaccagacggacaagctggccgccttccaggaggaccgcatcgagccgggccgggacaggcgcttccgcgtcatgcggctgcccaacgggcgggacttccacatgagcatcgtcgctgcgcgcctcaacgacagcggcatctacctgtgcggggccatctacctgccccccaacacacagatcaacgagagtccccgcgcagagctctccgtgacggagagaaccctggagccccccacacagagccccagccccccacccagactcagcggccagttgcaggggctggtcatcggcgtcacgagcgtgctggtgggtgtcctgctactgctgctgctgacctgggtcctggccgctgtcttccccagggccacccgaggtgcctgtgtgtgcgggagcgaggacgagcctctgaaggagggccccgatgcagcgcccgtcttcaccctggactacggggagctggacttccagtggcgagagaagacgccggagcccccggcgccctgtgccccggagcagaccgagtatgccaccatcgtcttcccgggcaggccggcgtccccgggccgcagggcctcggccagcagcctgcagggagcccagcctccgagccccgaggacggacccggcctgtggcccctctga

Аминокислотная последовательность полноразмерного собачьего PD-1: сигнальная последовательность подчеркнута и выделена жирным шрифтом

Аминокислотная последовательность SEQ ID NO: 2 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 36 включает сигнальную последовательность.

MGSRRGPWPLVWAVLQLGWWPGWLLDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVMRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLVIGVTSVLVGVLLLLLLTWVLAAVFPRATRGACVCGSEDEPLKEGPDAAPVFTLDYGELDFQWREKTPEPPAPCAPEQTEYATIVFPGRPASPGRRASASSLQGAQPPSPEDGPGLWPL

ДНК-последовательность внеклеточного домена собачьего PD-1: SEQ ID NO: 3 (Оптимизированная по кодонам для экспрессии в клетках CHO)

Ctggattcccccgacagaccctggagccctctcaccttctcccctgcccagctgaccgtccaggaaggcgagaatgccaccttcacctgcagcctcgccgacatccccgacagcttcgtgctgaactggtacagactgagccccaggaaccagaccgacaagctggccgctttccaggaggacaggatcgaacccggcagggacaggaggtttagggtcatgaggctgcccaacggcagggacttccacatgtccatcgtggccgccagactgaacgactccggcatctacctgtgcggcgctatctacctgccccccaacacccagatcaacgagagccccagggccgaactgagcgtgacagagagaaccctggaacctcccacccagagcccttcccctcctcctagactgagcggacagctgcagggcctggtg

Внеклеточный домен собачьего PD-1: SEQ ID NO: 4:

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVMRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLV

ДНК последовательность, внеклеточный домен собачьего PD-1 - человеческий IgG1 Fc: SEQ ID NO: 5 (оптимизированная по кодонам для экспрессии в клетках HEK-293)

Ctggattcccccgacagaccctggagccctctcaccttctcccctgcccagctgaccgtccaggaaggcgagaatgccaccttcacctgcagcctcgccgacatccccgacagcttcgtgctgaactggtacagactgagccccaggaaccagaccgacaagctggccgctttccaggaggacaggatcgaacccggcagggacaggaggtttagggtcatgaggctgcccaacggcagggacttccacatgtccatcgtggccgccagactgaacgactccggcatctacctgtgcggcgctatctacctgccccccaacacccagatcaacgagagccccagggccgaactgagcgtgacagagagaaccctggaacctcccacccagagcccttcccctcctcctagactgagcggacagctgcagggcctggtgggtaccgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatga

Химерный белок, внеклеточный домен собачьего PD-1 - человеческий IgG1 Fc: сигнальная последовательность подчеркнута и выделена жирным шрифтом: SEQ ID NO: 6; SEQ ID NO: 53 включает сигнальную последовательность.

MNFLLSWVHWSLALLLYLHHAKWSQALDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVMRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLVGTDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

ДНК-последовательность полноразмерного собачьего PD-L1 подчеркнута и выделена жирным шрифтом Нуклеотидная последовательность SEQ ID NO: 7 без сигнальной последовательности; и Нуклеотидная последовательность SEQ ID NO: 37 включает сигнальную последовательность.

atgagaatgtttagtgtctttacattcatggcctactgccatttgctaaaagcatttacgatcacagtttctaaggacctgtatgtggtagagtatggtggcaatgtgacaatggaatgcaaattcccggtggaaaaacagttaaacttgtttgcactaatcgtctactgggaaatggaggataaaaaaattatacaatttgtgaatggaaaggaagacctgaaagttcagcacagcagctacagccagagggctcagctattgaaggaccagctcttcttggggaaggctgcgcttcagatcacagatgtgagattgcaggatgcaggggtttactgctgcttgatcggctatggcggtgctgactacaagcggattactttgaaagttcatgccccgtaccgcaacatcagccaaagaatttctgtggatcctgtcacctctgaacatgaactaatgtgtcaggctgagggttaccctgaggctgaagtcatctggacaagcagtgaccaccgagtcctgagtggcaaaaccaccatcactaattccaatagggaagagaagcttttcaatgtgaccagcacgctgaacatcaatgcaacagctaatgagattttctactgcacttttcaaagatcaggtcctgaggaaaacaatactgccgagttggtcatcccagaacgactgcccgttccagcaagtgagaggactcatttcatgattctgggacctttcctgttgcttcttggtgtagtcctggcagtcactttctgtctaaaaaaacatgggagaatgatggatgtggaaaaatgttgcacccgagataggaactcaaagaaacgaaatgatatacaatttgaagagacataa

Полноразмерная последовательность собачьего PD-L1: сигнальная последовательность подчеркнута и выделена жирным шрифтом

Аминокислотная последовательность SEQ ID NO: 8 без сигнальной последовательности; и Аминокислотная последовательность SEQ ID NO: 38 включает сигнальную последовательность.

MRMFSVFTFMAYCHLLKAFTITVSKDLYWEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHFMILGPFLLLLGWLAVTFCLKKHGRMMDVEKCCTRDRNSKKRNDIQFEET

ДНК-последовательность внеклеточного домена PD-L1: SEQ ID NO: 9 (оптимизированная по кодонам для экспрессии в клетках CHO)

tttaccatcaccgtgtccaaggacctgtacgtggtcgagtacggcggcaatgtgaccatggagtgcaagttccccgtggagaagcagctgaacctgttcgccctcatcgtgtactgggagatggaggacaagaagatcatccagttcgtgaacggcaaggaggacctgaaggtgcagcactccagctactcccagagagcccagctgctgaaggaccagctgttcctgggcaaggccgccctgcagatcaccgacgtgagactgcaggacgccggcgtgtattgctgcctgatcggctacggaggcgccgactacaagaggatcaccctgaaggtgcatgcaccctacaggaacatcagccagaggatcagcgtcgatcccgtgaccagcgagcacgagctgatgtgccaagccgagggctatcccgaggccgaagtgatctggaccagcagcgaccacagggtcctgagcggcaagaccaccatcaccaacagcaacagggaggagaagctgttcaacgtgaccagcaccctcaacatcaacgccaccgccaacgagatcttctactgcaccttccagaggagcggccccgaagagaacaacaccgccgagctggtgatccccgagagactgcctgtgcctgccagcgagaggacccac

Внеклеточный домен собачьего белка PD-L1: SEQ ID NO: 10

FTITVSKDLYWEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTH

ДНК-последовательность собачий внеклеточный домен PD-L1 - человеческий IgG1 Fc: SEQ ID NO: 11 (Оптимизированная по кодонам для экспрессии в клетках HEK-293)

tttaccatcaccgtgtccaaggacctgtacgtggtcgagtacggcggcaatgtgaccatggagtgcaagttccccgtggagaagcagctgaacctgttcgccctcatcgtgtactgggagatggaggacaagaagatcatccagttcgtgaacggcaaggaggacctgaaggtgcagcactccagctactcccagagagcccagctgctgaaggaccagctgttcctgggcaaggccgccctgcagatcaccgacgtgagactgcaggacgccggcgtgtattgctgcctgatcggctacggaggcgccgactacaagaggatcaccctgaaggtgcatgcaccctacaggaacatcagccagaggatcagcgtcgatcccgtgaccagcgagcacgagctgatgtgccaagccgagggctatcccgaggccgaagtgatctggaccagcagcgaccacagggtcctgagcggcaagaccaccatcaccaacagcaacagggaggagaagctgttcaacgtgaccagcaccctcaacatcaacgccaccgccaacgagatcttctactgcaccttccagaggagcggccccgaagagaacaacaccgccgagctggtgatccccgagagactgcctgtgcctgccagcgagaggacccacggtaccgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatga

Химерный белок внеклеточный домен собачьего PD-L1 - человеческий IgG1 Fc: SEQ ID NO: 12

FTITVSKDLYWEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGTDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

08A VH : CDR HI ДНК: SEQ ID NO: 13:

agttattatc tgtac

08A VH : CDR HI белок: SEQ ID NO: 14:

Ser Tyr Tyr Leu Tyr

08A VH : CDR H2 ДНК: SEQ ID NO: 15:

ggggttaatc ctagtaatgg tggtactaac ttcagtgaga agttcaag

08A VH : CDR H2 белок: SEQ ID NO: 16:

Gly Val Asn Pro Ser Asn Gly Gly Thr Asn Phe Ser Glu Lys Phe Lys

08A VH : CDR H3 ДНК: SEQ ID NO: 17:

agggattcta actacgacgg gggctttgac tac

08A VH : CDR H3 белок: SEQ ID NO: 18:

Arg Asp Ser Asn Tyr Asp Gly Gly Phe Asp Tyr

08A VL : CDR LI ДНК: SEQ ID NO: 19:

agggccagca aaagtgtcag tacatctggc tttagttatt tgcac

08A VL : CDR LI белок: SEQ ID NO: 20:

Arg Ala Ser Lys Ser Val Ser Thr Ser Gly Phe Ser Tyr Leu His

08A VL : CDR L2 ДНК: SEQ ID NO: 21:

cttgcatcca acctagagtc t

08A VL : CDR L2 белок: SEQ ID NO: 22:

Leu Ala Ser Asn Leu Glu Ser

08А VL : CDR L3 ДНК: SEQ ID NO: 23:

cagcacagtt gggagcttcc gctcacg

08A VL : CDR L3 белок: SEQ ID NO: 24:

Gin His s er Trp Glu Leu Pro Leu Thr

Канинизированное мышиное антитело 08A к человеческому PD-1

canVH-canlgGB-Fc (12G8 сигнальная последовательность подчеркнута и выделена жирным шрифтом): ТЯЖЕЛАЯ ЦЕПЬ

Нуклеотидная последовательность SEQ ID NO: 27 без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 41 включает сигнальную последовательность.

ATGGCCGTGCTGGGGCTGCTCTTCTGCCTGGTGACATTCCCAAGCTGTGTGCTAAGCGAGGTGCAGCTGGTGCAGTCCGGCGGCGATCTGGTGAAGCCTGGAGGCAGCGTGAGACTGAGCTGCGTGGCCAGCGGCTACACCTTCACCAGCTACTACCTGTACTGGGTGAGGCAGGCTCCTGGCAAAGGACTGCAGTGGATCGGCGGCGTGAATCCTAGCAACGGCGGCACCAACTTCAGCGAGAAGTTCAAGAGCAGGGCCACCCTGAGCGTGGACAAGGCCAAGAACACCGCCTACATGCAGCTGAACTCCCTGAGGGCCGAGGACACCGCCGTGTACTACTGCACCAGGAGGGACAGCAACTACGACGGCGGCTTCGACTACTGGGGACAGGGAACCCTGCTGACCGTGTCCAGCGCTTCCACAACCGCGCCATCAGTCTTTCCGTTGGCCCCATCATGCGGGTCGACGAGCGGATCGACTGTGGCCCTGGCGTGCTTGGTGTCGGGATACTTTCCCGAACCCGTCACGGTCAGCTGGAACTCCGGATCGCTTACGAGCGGTGTGCATACGTTCCCCTCGGTCTTGCAATCATCAGGGCTCTACTCGCTGTCGAGCATGGTAACGGTGCCCTCATCGAGGTGGCCCTCCGAAACGTTCACATGTAACGTAGCACATCCAGCCTCCAAAACCAAGGTGGATAAACCCGTGCCGAAAAGAGAGAATGGGCGGGTGCCTCGACCCCCTGATTGCCCCAAGTGTCCGGCTCCGGAAATGCTCGGTGGACCCTCAGTGTTTATCTTCCCTCCGAAGCCCAAGGACACTCTGCTGATCGCGCGCACTCCAGAAGTAACATGTGTAGTGGTGGACCTTGATCCCGAGGACCCCGAAGTCCAGATCTCCTGGTTTGTAGATGGGAAACAGATGCAGACCGCAAAAACTCAACCCAGAGAGGAGCAGTTCAACGGAACATACCGAGTGGTATCCGTCCTTCCGATTGGCCACCAGGACTGGTTGAAAGGGAAGCAGTTTACGTGTAAAGTCAACAATAAGGCGTTGCCTAGCCCTATTGAGCGGACGATTTCGAAAGCTAGGGGACAGGCCCACCAGCCATCGGTCTATGTCCTTCCGCCTTCCCGCGAGGAGCTCTCGAAGAATACAGTGAGCCTTACATGCCTCATTAAGGATTTCTTCCCGCCTGATATCGACGTAGAGTGGCAATCAAACGGTCAACAGGAGCCGGAATCCAAGTATAGAACCACTCCGCCCCAGCTTGACGAGGACGGATCATACTTTTTGTATTCAAAACTGTCGGTGGATAAGAGCCGGTGGCAGAGAGGTGACACCTTCATCTGTGCGGTGATGCACGAAGCACTCCATAATCACTACACCCAAGAGAGCCTCTCGCATTCCCCCGGAAAGTGA

Аминокислотная последовательность SEQ ID NO: 28 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 42 включает сигнальную последовательность.

MAVLGLLFCLVTFPSCVLSEVQLVQSGGDLVKPGGSVRLSCVASGYTFTSYYLYWVRQAPGKGLQWIGGVNPSNGGTNFSEKFKSRATLSVDKAKNTAYMQLNSLRAEDTAVYYCTRRDSNYDGGFDYWGQGTLLTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFNGTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSPGK

canVH-canlgGA-Fc (12G8 сигнальная последовательность подчеркнута и выделена жирным): ТЯЖЕЛАЯ ЦЕПЬ

Нуклеотидная последовательность SEQ ID NO: 25 без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 39 включает сигнальную последовательность.

ATGGCCGTGCTGGGGCTGCTCTTCTGCCTGGTGACATTCCCAAGCTGTGTGCTAAGCGAGGTGCAGCTGGTGCAGTCCGGCGGCGATCTGGTGAAGCCTGGAGGCAGCGTGAGACTGAGCTGCGTGGCCAGCGGCTACACCTTCACCAGCTACTACCTGTACTGGGTGAGGCAGGCTCCTGGCAAAGGACTGCAGTGGATCGGCGGCGTGAATCCTAGCAACGGCGGCACCAACTTCAGCGAGAAGTTCAAGAGCAGGGCCACCCTGAGCGTGGACAAGGCCAAGAACACCGCCTACATGCAGCTGAACTCCCTGAGGGCCGAGGACACCGCCGTGTACTACTGCACCAGGAGGGACAGCAACTACGACGGCGGCTTCGACTACTGGGGACAGGGAACCCTGCTGACCGTGTCCAGCGCTTCCACAACGGCTCCGTCGGTGTTTCCCCTGGCACCTAGCTGCGGGTCGACCTCGGGTAGCACAGTGGCGCTGGCGTGTTTGGTGTCGGGATACTTTCCCGAGCCGGTAACGGTGTCATGGAACTCAGGGTCACTTACATCAGGAGTCCATACTTTTCCGTCCGTGCTGCAGTCAAGCGGCTTGCATTCACTGTCCTCGATGGTGACGGTGCCTTCGTCGAGGTGGCCCAGCGAAACGTTCACTTGTAACGTAGTACACCCGGCCTCCAACACGAAAGTCGATAAACCGGTATTCAATGAGTGCAGATGTACAGACACCCCTCCCTGTCCGGTACCCGAACCCCTTGGAGGGCCGAGCGTCCTCATCTTCCCTCCCAAGCCAAAAGACATCTTGCGCATTACGAGGACACCAGAAGTCACGTGCGTAGTGCTTGATCTCGGTAGAGAAGATCCCGAGGTCCAGATCTCGTGGTTTGTGGATGGAAAGGAGGTCCACACCGCAAAGACTCAGTCGCGCGAGCAGCAGTTCAATGGCACGTATCGGGTCGTGAGCGTGCTTCCTATCGAGCATCAGGACTGGCTCACCGGGAAGGAGTTCAAATGCCGGGTCAATCATATCGACCTCCCGTCACCAATCGAGCGGACCATCTCGAAGGCTAGAGGAAGGGCGCACAAACCTTCGGTCTATGTGCTTCCCCCATCGCCCAAAGAGCTTTCCTCGTCGGATACGGTGTCCATTACATGCTTGATTAAGGACTTCTATCCTCCTGATATTGATGTGGAATGGCAATCAAACGGACAGCAGGAGCCGGAACGCAAGCACCGAATGACCCCACCGCAATTGGACGAAGATGGTAGCTACTTTCTCTACTCAAAGCTCTCAGTCGACAAATCCCGATGGCAGCAGGGAGATCCCTTCACTTGCGCCGTGATGCACGAGACACTCCAAAATCATTACACGGACCTTTCGTTGAGCCACTCGCCCGGAAAG

Аминокислотная последовательность SEQ ID NO: 26 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 40 включает сигнальную последовательность.

MAVLGLLFCLVTFPSCVLSEVQLVQSGGDLVKPGGSVRLSCVASGYTFTSYYLYWVRQAPGKGLQWIGGVNPSNGGTNFSEKFKSRATLSVDKAKNTAYMQLNSLRAEDTAVYYCTRRDSNYDGGFDYWGQGTLLTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLHSLSSMVTVPSSRWPSETFTCNWHPASNTKVDKPVFNECRCTDTPPCPVPEPLGGPSVLIFPPKPKDILRITRTPEVTCWLDLGREDPEVQISWFVDGKEVHTAKTQSREQQFNGTYRWSVLPIEHQDWLTGKEFKCRVNHIDLPSPIERTISKARGRAHKPSVYVLPPSPKELSSSDTVSITCLIKDFYPPDIDVEWQSNGQQEPERKHRMTPPQLDEDGSYFLYSKLSVDKSRWQQGDPFTCAVMHETLQNHYTDLSLSHSPGK

canVH-canlgGD-Fc (12G8 сигнальная последовательность подчеркнута и выделена жирным): ТЯЖЕЛАЯ ЦЕПЬ

Нуклеотидная последовательность SEQ ID NO: 29 без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 43 включает сигнальную последовательность.

ATGGCCGTGCTGGGGCTGCTCTTCTGCCTGGTGACATTCCCAAGCTGTGTGCTAAGCGAGGTGCAGCTGGTGCAGTCCGGCGGCGATCTGGTGAAGCCTGGAGGCAGCGTGAGACTGAGCTGCGTGGCCAGCGGCTACACCTTCACCAGCTACTACCTGTACTGGGTGAGGCAGGCTCCTGGCAAAGGACTGCAGTGGATCGGCGGCGTGAATCCTAGCAACGGCGGCACCAACTTCAGCGAGAAGTTCAAGAGCAGGGCCACCCTGAGCGTGGACAAGGCCAAGAACACCGCCTACATGCAGCTGAACTCCCTGAGGGCCGAGGACACCGCCGTGTACTACTGCACCAGGAGGGACAGCAACTACGACGGCGGCTTCGACTACTGGGGACAGGGAACCCTGCTGACCGTGTCCAGCGCTTCAACCACAGCGCCGAGCGTGTTCCCTCTGGCGCCGTCGTGCGGTTCCACCTCGGGATCAACAGTGGCCCTCGCCTGTCTCGTGAGCGGATACTTTCCGGAGCCTGTCACGGTGTCGTGGAATAGCGGATCACTCACGTCGGGCGTGCATACTTTTCCATCCGTCTTGCAATCGAGCGGATTGTACTCACTCTCCTCAACCGTCACTGTCCCCTCGTCGCGCTGGCCCTCGGAGACTTTTACGTGCAATGTAGTCCATCCGGCGAGCAACACGAAGGTCGACAAGCCCGTACCCAAGGAATCAACATGCAAGTGCATCTCGCCCTGTCCCGTCCCCGAATCCCTTGGTGGCCCCTCAGTGTTTATCTTCCCTCCGAAGCCTAAAGACATCTTGAGAATCACAAGAACACCGGAAATCACGTGTGTGGTCCTTGACTTGGGACGCGAGGACCCTGAGGTACAAATCTCGTGGTTTGTGGACGGGAAAGAGGTGCACACAGCAAAGACACAACCACGCGAGCAGCAGTTTAACTCAACGTACAGGGTAGTATCCGTACTTCCCATTGAACACCAGGATTGGCTCACCGGTAAAGAATTCAAATGCCGAGTGAATCACATCGGGCTTCCTAGCCCAATTGAGCGGACGATTTCCAAAGCTAGGGGTCAGGCCCACCAGCCGAGCGTATACGTGTTGCCGCCCTCCCCGAAGGAGCTGTCATCGTCAGATACGGTAACGTTGACGTGTCTGATCAAAGATTTCTTTCCTCCCGAAATTGATGTGGAATGGCAAAGCAATGGGCAGCCCGAGCCCGAGTCAAAGTACCATACTACTGCACCACAGCTGGACGAAGATGGATCGTATTTCCTCTACTCGAAACTGTCCGTGGATAAGTCCCGGTGGCAGCAAGGGGACACCTTCACTTGCGCGGTCATGCACGAGGCACTTCAGAACCACTATACGGACTTGAGCCTCTCGCATTCGCCAGGGAAG

Аминокислотная последовательность SEQ ID NO: 30 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 44 включает сигнальную последовательность.

MAVLGLLFCLVTFPSCVLSEVQLVQSGGDLVKPGGSVRLSCVASGYTFTSYYLYWVRQAPGKGLQWIGGVNPSNGGTNFSEKFKSRATLSVDKAKNTAYMQLNSLRAEDTAVYYCTRRDSNYDGGFDYWGQGTLLTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSTVTVPSSRWPSETFTCNWHPASNTKVDKPVPKESTCKCISPCPVPESLGGPSVFIFPPKPKDILRITRTPEITCWLDLGREDPEVQISWFVDGKEVHTAKTQPREQQFNSTYRWSVLPIEHQDWLTGKEFKCRVNHIGLPSPIERTISKARGQAHQPSVYVLPPSPKELSSSDTVTLTCLIKDFFPPEIDVEWQSNGQPEPESKYHTTAPQLDEDGSYFLYSKLSVDKSRWQQGDTFTCAVMHEALQNHYTDLSLSHSPGK

canVL-canKappa (1022)xHGF сигнальная последовательность подчеркнута и выделена жирным: ЛЕГКАЯ ЦЕПЬ

Нуклеотидная последовательность SEQ ID NO: 33 без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 47 включает сигнальную последовательность.

ATGGATATGAGAGTACCTGCACAACTTCTGGGATTGCTGCTTCTTTGGCTGAGAGGGGCCCGCTGCGATATCGTCCTGACCCAGACCCCTCCTAGCCTGTCCGTGAGCCCTGGAGAACCCGCCAGCATCAGCTGCAGGGCCTCCAAGAGCGTGAGCACCAGCGGCTTCAGCTACCTGCACTGGTACAGGCAGAAGCCCGGACAGCCTCCTCAGCTGCTGATCTTCCTGCCAGCAACCTGGAGAGCGGCGTGCCTGACAGGTTTAGCGGAAGCGGCAGCGGCACCGACTTCACACTGAGGATCTCCAGGGTGGAAGCCGACGACGCCGGAGTGTACTACTGCCAGCACAGCTGGGAACTGCCCCTGACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGAGGAACGACGCTCAGCCAGCCGTGTACCTCTTCCAGCCTTCGCCGGACCAGCTTCATACGGGGTCAGCGTCGGTGGTGTGCCTGTTGAACTCGTTTTACCCCAAGGACATTAACGTGAAGTGGAAGGTAGACGGGGTAATTCAAGACACTGGCATTCAAGAGTCCGTCACGGAACAAGACTCAAAAGACTCAACGTATTCACTGTCGTCAACCTTGACGATGTCAAGCACCGAGTATCTTAGCCATGAGCTGTATTCGTGCGAGATCACCCACAAGTCCCTCCCCTCCACTCTTATCAAATCCTTTCAGCGGTCGGAATGTCAGCGGGTCGAT

Аминокислотная последовательность SEQ ID NO: 34 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 48 включает сигнальную последовательность.

MDMRVPAQLLGLLLLWLRGARCDIVLTQTPPSLSVSPGEPASISCRASKSVSTSGFSYLHWYRQKPGQPPQLLIFLASNLESGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCQHSWELPLTFGQGTKVEIKRNDAQPAVYLFQPSPDQLHTGSASWCLLNSFYPKDINVKWKVDGVIQDTGIQESVTEQDSKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPSTLIKSFQRSECQRVD

canVL-canKappa (1011)(xHGF сигнальная последовательность подчеркнута и выделена жирным: ЛЕГКАЯ ЦЕПЬ

Нуклеотидная последовательность SEQ ID NO: 31 без сигнальной последовательности; и

Нуклеотидная последовательность SEQ ID NO: 45 включает сигнальную последовательность.

ATGGATATGAGAGTACCTGCACAACTTCTGGGATTGCTGCTTCTTTGGCTGAGAGGGGCCCGCTGCGATATCGTCCTGACCCAGACCCCTCTGAGCCTGTCCGTGAGCCCTGGAGAACCCGCCAGCATCAGCTGCAGGGCCTCCAAGAGCGTGAGCACCAGCGGCTTCAGCTACCTGCACTGGTACAGGCAGAAGCCCGGACAGAGCCCTCAGCTGCTGATCTTCCTGGCCAGCAACCTGGAGAGCGGCGTGCCTGACAGGTTTAGCGGAAGCGGCAGCGGCACCGACTTCACACTGAGGATCTCCAGGGTGGAAGCCGACGACGCCGGAGTGTACTACTGCCAGCACAGCTGGGAACTGCCCCTGACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGAGGAACGACGCTCAGCCAGCCGTGTACCTCTTCCAGCCTTCGCCGGACCAGCTTCATACGGGGTCAGCGTCGGTGGTGTGCCTGTTGAACTCGTTTTACCCCAAGGACATTAACGTGAAGTGGAAGGTAGACGGGGTAATTCAAGACACTGGCATTCAAGAGTCCGTCACGGAACAAGACTCAAAAGACTCAACGTATTCACTGTCGTCAACCTTGACGATGTCAAGCACCGAGTATCTTAGCCATGAGCTGTATTCGTGCGAGATCACCCACAAGTCCCTCCCCTCCACTCTTATCAAATCCTTTCAGCGGTCGGAATGTCAGCGGGTCGAT

Аминокислотная последовательность SEQ ID NO: 32 без сигнальной последовательности; и

Аминокислотная последовательность SEQ ID NO: 46 включает сигнальную последовательность.

MDMRVPAQLLGLLLLWLRGARCDIVLTQTPLSLSVSPGEPASISCRASKSVSTSGFSYLHWYRQKPGQSPQLLIFLASNLESGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCQHSWELPLTFGQGTKVEIKRNDAQPAVYLFQPSPDQLHTGSASWCLLNSFYPKDINVKWKVDGVIQDTGIQESVTEQDSKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPSTLIKSFQRSECQRVD

ПРИМЕР 4

МУТАНТНЫЕ СОБАЧЬИ АНТИТЕЛА IgG-B, СПЕЦИФИЧНЫЕ К PD-1

Существует четыре известных подтипа тяжелой цепи IgG собачьего IgG, и они обозначаются как IgG-A, IgG-B, IgG-C, и IgG-D. Два известных подтипа легкой цепи обозначаются как лямбда и каппа. Однако кроме связывания и активации собачьих иммунных клеток, собачье или канинизированное антитело к PD-1 оптимально имеет два свойства:

1. лишено эффекторных функций, таких как антитело-зависимая цитотоксичность (ADCC) и комплемент-зависимая цитотоксичность (CDC), и

2. легко очищается в крупном масштабе с использованием стандартных технологий, таких как на основе хроматографии с протеином A.

Ни один из природных изотипов собачьего IgG не удовлетворяет обоим критериям. Например, IgG-B может быть очищено с использованием протеина A, но при этом оно имеет высокий уровень ADCC-активности. IgG-C также имеет значительную ADCC-активность. C другой стороны, IgG-A слабо связывается с протеином A, но демонстрирует нежелательную активность ADCC. Кроме того, ни IgG-C, ни IgG-D не может быть очищен на колонках с протеином A, хотя IgG-D демонстрирует отсутствие ADCC-активности. Настоящее изобретение преодолевает эти трудности путем предложения мутантных собачьих IgG-B антител, специфичных к PD-1; такие антитела лишены эффекторных функций, таких как ADCC, и могут быть легко очищены с использованием промышленной стандартной хроматографии с протеином A. Точные модификации представлены на Фигуре 4.

Описанные варианты IgG-B с ослабленными эффекторными функциями охватывают первый вариант IgG-B, в котором каждый из остатков лизина (D 277) и аспарагина (N 325) подвергнут мутации с получением остатка аланина [clgGB(-) ADCC], второй вариант, в котором шарнирная область IgG-B заменена на шарнирную область IgG-D [cIgGB(+) D-шарнир], и третий вариант, в котором шарнирная область IgG-B заменена на шарнирную область IgG-A [cIgGB(+) A-шарнир]. Кроме того, второй и третий варианты также включают замену тех же остатков лизина и аспарагина первого варианта на остатки аланина. Нумерация остатков лизина и аспарагина, подвергнутых мутации, основана в данном изобретении на схеме нумерации, описанной для тяжелых цепей собачьего IgG у Tang et al., [VetImmunolandImmunopathol, 80:259-270 (2001)].

Собачий IgGB wt

SASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFNGTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK SEQ ID NO :49

Собачий IgGB ( + ) A-шарнир

SASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVFNECRCTDTPPCPAPEMLGGPSVFIFPPKPKATLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFAGTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRG DTFICAVMHEALHNHYTQESLSHSPGK SEQ ID NO: 50

Собачий IgGB ( + ) D-шарнир

SASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPKESTCKCISPCPAPEMLGGPSVFIFPPKPKATLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFAGTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSPGK SEQ ID NO: 51

Собачий IgGB(-)ADCC

SASTTAPSVFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKATLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFAGTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSPGK SEQ ID NO: 52

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ ТАБЛИЦА 1
ID N.A. A.A. Описание ID N.A. A.A. Описание
1 V Собачий PD-1 Полноразмерный 18 V hPD-1 CDR3 VH
2 V Собачий PD-1 Полноразмерный 19 V hPD-1 CDR1 VL
3 V Собачий PD-1 ECD 20 V hPD-1 CDR1 VL
4 V Собачий PD-1 ECD 21 V hPD-1 CDR2 VL
5 V Собачий PD-1 -Человеческий IgGl 22 V hPD-1 CDR2 VL
6 V Собачий PD-1 -Человеческий IgGl 23 V hPD-1 CDR3 VL
7 V Собачий PD-L1 Полноразмерный 24 V hPD-1 CDR3 VL
8 V Собачий PD-L1 Полноразмерный 25 V IgG-A Тяжелая цепь
9 V Собачий PD-L1 ECD 26 V IgG-A Тяжелая цепь
10 V Собачий PD-L1 ECD 27 V IgG-B Тяжелая цепь
11 V Собачий PD-L1 -Человеческий IgGl 28 V IgG-B Тяжелая цепь
12 V Собачий PD-L1 -Человеческий IgGl 29 V IgG-D Тяжелая цепь
13 V Hpd-1 CDR1 VH 30 V IgG-D Тяжелая цепь
14 V hPD-1 CDR1 VH 31 V Каппа (Легкая цепь) (1011)
15 V hPD-1 CDR2 VH 32 V Каппа (Легкая цепь) (1011)
16 V hPD-1 CDR2 VH 33 V Каппа (Легкая цепь) (1022)
17 V hPD-1 CDR3 VH 34 V Каппа (Легкая цепь) (1022)

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ ТАБЛИЦА 2 (вместе с ЛИДЕРНЫМИ ПОСЛЕДОВАТЕЛЬНОСТЯМИ)
ID N.A. A.A. Описание ID N.A. A.A. Описание
35 V Собачий PD-1 Полноразмерный 42 V IgG-B Тяжелая цепь
36 V Собачий PD-1 Полноразмерный 43 V IgG-D Тяжелая цепь
37 V Собачий PD-Ll Полноразмерный 44 V IgG-D Тяжелая цепь
38 V Собачий PD-Ll Полноразмерный 45 V Каппа (Легкая цепь) (1011)
39 V IgG-A Тяжелая цепь 46 V Каппа (Легкая цепь) (1011)
40 V IgG-A Тяжелая цепь 47 V Каппа (Легкая цепь) (1022)
41 V IgG-B Тяжелая цепь 48 V Каппа (Легкая цепь) (1022)
53 V Собачий PD-1 -Человеческий IgGl Полноразмерный

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ ТАБЛИЦА 3
ID NA AA Описание ID NA AA Описание
49 V clgGB wt 51 V cIgGB(+)D-шарнир
50 V dgGB(+)A-шарнир 52 V cIgGB(-)ADCC

Все ссылки, процитированные в данном документе, включены ссылкой в такой степени, как если бы каждая публикация, статья базы данных (например, последовательности Genbank или статьи GenelD), патентная заявка или патент были специально и индивидуально указаны, как включенные ссылкой. Это утверждение о включении ссылки подразумевается заявителем изобретения в силу 37 C.F.R. § 1.57(b)(1), для установления связи с каждой индивидуальной публикацией, статьей базы данных (например, последовательности Genbank или статьи GenelD), патентной заявкой, или патентом, каждый из которых ясно идентифицирован в соответствии с 37 C.F.R. § 1.57(b)(2), даже если такое цитирование не примыкает непосредственно к специальному указанию о включении с помощью ссылки. Включение специальных утверждений с помощью ссылки, если они есть, внутри описания никак не ослабляют это общее утверждение включения ссылкой. Цитирование ссылок данного документа не подразумевает в качестве допущения, что ссылка относится к предшествующему уровню техники, и не делает ее составляющей любого допущения о том, что касается содержания или даты этих публикаций или документов.

Настоящее изобретение не ограничивается рамками конкретных воплощений, описанных в данном документе. Фактически, различные модификации изобретения дополнительно к тем, что описаны в данном документе, будут очевидны специалистам в данной области на основе описания предшествующего описания и сопровождающих его фигур. Подразумевается, что такие модификации находятся в рамках прилагаемой формулы изобретения.

Предполагается, что предшествующего письменного описания достаточно, чтобы дать возможность специалисту в данной области осуществить практически изобретение. Специалисту в данной области на основе описания, изложенного выше, очевидны различные модификации изобретения дополнительно к тем, что были представлены, и они попадают в рамки прилагаемой формулы изобретения.

1. Выделенное канинизированное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с Рецептором 1 Программируемой Клеточной Смерти (PD-1), отличающееся тем, что указанное антитело содержит

тяжелую цепь собачьего IgG и собачью легкую цепь каппа;

отличающуюся тем, что собачья легкая цепь каппа содержит три области, определяющие комплементарность (CDR):

CDR 1 легкой цепи (CDRL1),

CDR 2 легкой цепи (CDRL2) и

CDR 3 легкой цепи (CDRL3); и

тяжелая цепь собачьего IgG содержит три CDR тяжелой цепи:

CDR 1 тяжелой цепи (CDRH1),

CDR 2 тяжелой цепи (CDRH2) и

CDR 3 тяжелой цепи (CDRH3); где

CDRL1 содержит аминокислотную последовательность SEQ ID NO:20;

CDRL2 содержит аминокислотную последовательность SEQ ID NO:22;

CDRL3 содержит аминокислотную последовательность SEQ ID NO:24;

CDRH1 содержит аминокислотную последовательность SEQ ID NO:14;

CDRH2 содержит аминокислотную последовательность SEQ ID NO:16 и

CDRH3 содержит аминокислотную последовательность SEQ ID NO:18;

где антитело и его антигенсвязывающий фрагмент связываются с собачьим PD-1 и блокируют связывание собачьего PD-1 с собачьим Лигандом 1 Программируемой Клеточной Смерти (PD-L1).

2. Выделенное канинизированное антитело по п. 1, где тяжелая цепь IgG содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:26, консервативно модифицированного варианта SEQ ID NO:26, SEQ ID NO:28, консервативно модифицированного варианта SEQ ID NO:28, SEQ ID NO:30 и консервативно модифицированного варианта SEQ ID NO:30.

3. Выделенное канинизированное антитело по п. 1 или 2, где легкая цепь каппа содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO:32, консервативно модифицированного варианта SEQ ID NO:32, SEQ ID NO:34 и консервативно модифицированного варианта SEQ ID NO:34.

4. Выделенное канинизированное антитело по пп. 1, 2 или 3, содержащее аминокислотную последовательность SEQ ID NO:28 и SEQ ID NO:34 или консервативно модифицированный вариант SEQ ID NO:28 и консервативно модифицированный вариант SEQ ID NO:34.

5. Выделенная нуклеиновая кислота, которая кодирует легкую цепь канинизированного антитела по п. 3 или 4.

6. Выделенная нуклеиновая кислота, которая кодирует тяжелую цепь канинизированного антитела по п. 2 или 4.

7. Выделенная нуклеиновая кислота по п. 5 или 6, которая содержит одну или несколько нуклеотидных последовательностей, выбранных из группы, состоящей из SEQ ID NO:13, 15, 17, 19, 21, 23, 25, 27, 29, 31 и 33.

8. Выделенная нуклеиновая кислота по п. 7, которая содержит нуклеотидную последовательность SEQ ID NO:27 или SEQ ID NO:33.

9. Вектор экспрессии, содержащий выделенную нуклеиновую кислоту по п. 5.

10. Вектор экспрессии, содержащий выделенную нуклеиновую кислоту по п. 6.

11. Вектор экспрессии, содержащий выделенную нуклеиновую кислоту по п. 7 или 8.

12. Клетка-хозяин, которая экспрессирует тяжелую цепь канинизированного антитела, которое специфично связывается с PD-1,

где указанная клетка-хозяин содержит один или несколько векторов экспрессии по п. 9.

13. Клетка-хозяин, которая экспрессирует легкую цепь канинизированного антитела, которое специфично связывается с PD-1,

где указанная клетка-хозяин содержит один или несколько экспрессирующих векторов по п. 10.

14. Клетка-хозяин, которая экспрессирует тяжелую цепь и легкую цепь канинизированного антитела, которое специфично связывается с PD-1,

где указанная клетка-хозяин содержит один или несколько экспрессирующих векторов по п. 11.

15. Фармацевтическая композиция для лечения злокачественного новообразования у собак, содержащая антитело или антигенсвязывающий фрагмент по пп. 1, 2, 3 4, или любую их комбинацию, и фармацевтически приемлемый носитель или разбавитель.

16. Способ повышения активности иммунной клетки, включающий введение нуждающемуся объекту терапевтически эффективного количества фармацевтической композиции по п. 15.

17. Способ по п. 16, где указанный способ используют для:

a. лечения злокачественного новообразования;

b. лечения инфекции или инфекционного заболевания или

c. в качестве вакцинного адъюванта.

18. Способ получения канинизированного антитела или его антигенсвязывающего фрагмента, которые специфично связываются с PD-1, включающий:

a. культивирование клетки-хозяина по пп. 12-14 в культуральной среде при условиях, в которых экспрессируется нуклеиновая кислота, продуцируя посредством этого полипептид, содержащий вариабельные области легкой цепи, полипептид, содержащий вариабельные области тяжелой цепи, или полипептид, содержащий вариабельные области легкой цепи, и полипептид, содержащий вариабельные области тяжелой цепи; и

b. выделение полипептидов из клетки-хозяина или из культуральной среды.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к антителу или его антигенсвязывающему фрагменту, специфически связывающемуся с IL-6, а также к фармацевтической композиции, его содержащей.

Изобретение относится к биотехнологии. Описано изолированное антитело или его антиген-связывающий фрагмент, которое связывается с рецептором хемокина 4 (CXCR4) и содержит:a) вариабельный участок тяжелой цепи (VH), содержащий (i) VH CDR1, выбранный из группы, состоящей из SEQ ID NO: 107, 113, 114; (ii) VH CDR2, выбранный из группы, состоящей из SEQ ID NO: 162, 128, 154, 123, 158, 124, 159, 125, 160, 126, 161, 127, 163, 164, 165, 166, 167, 168, 155, 129, 156 и 130, и (iii) VH CDR3, выбранный из группы, состоящей из SEQ ID NO: 112; и;b) вариабельный участок легкой цепи (VL), содержащий (i) VL CDR1, выбранный из группы, состоящей из SEQ ID NO: 144, 138, 141, 142, 143, 146, 147, 148, 149 и 150; (ii) VL CDR2, выбранный из группы, состоящей из SEQ ID NO: 145, 132; и (iii) VL CDR3, выбранный из группы, состоящей из SEQ ID NO: 139, 140 и 170.

Изобретение относится к области биохимии, в частности к мини-антителу для связывания с простата-специфичным мембранным агентом (PSMA), содержащему последовательность scFv, которая может связываться с PSMA, причем указанная scFv содержит вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) линкерной последовательностью; искусственную шарнирную область и последовательность СН3 IgG человека; и изолированному полинуклеотиду, который кодирует вышеуказанное мини-антитело.

Настоящее изобретение относится к иммунологии. Предложен иммуноконъюгат, включающий рекомбинантное антитело IgG1 к эпидермальному фактору роста человека (hEGFR), ковалентно присоединенное к цитотоксическому средству.

Изобретение относится к области биохимии, в частности к полипептиду, специфически связывающемуся с CD3, а также нуклеиновой кислоте, его кодирующей. Причем указанный полипептид содержит домен связывания с CD3 со сниженной изоэлектрической точкой.

Настоящее изобретение относится к области иммунологии. Предложена композиция для лечения IL-13 опосредованного расстройства, включающая анти-IL13 антитело и остаточное количество PLBL2 хомячка.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению человеческих белков в клетках СНО, и может быть использовано для получения человеческого антитела к гемагглютинину вируса гриппа А (ВГА) изотипа IgA2m1.

Настоящее изобретение относится к иммунологии. Предложен полипептид, способный связываться с поверхностным антигеном вируса гепатита B (HBV) и поверхностным антигеном, презентируемым иммунными эффекторными клетками.

Изобретение относится к области биохимии, в частности к выделенному антителу или его антигенсвязывающему фрагменту, которые специфически связываются с сайтом II ИЛ-6 человека, а также к композиции для лечения связанного с ИЛ-6 заболевания у субъекта, содержащей вышеуказанное антитело или его антигенсвязывающий фрагмент.

Группа изобретений относится к области биотехнологии. Предложен способ контроля паттерна гликозилирования рекомбинантного гликопротеина, включающий культивирование микроорганизма, содержащего полинуклеотид, кодирующий рекомбинантный гликопротеин, в культуральной среде, содержащей инсулин.

Изобретение относится к области биохимии, в частности к антителу для осуществления взаимодействия антиген-антитело с клаудином 6 (CLDN6), находящимся на поверхности клеток, экспрессирующих CLDN6, при этом по существу неспособному к взаимодействию антиген-антитело с другими высокогомологичными клаудинами, а также к иммуноконъюгату, фармацевтической композиции, содержащим вышеуказанное антитело.

Изобретение относится к биотехнологии. Описано изолированное антитело или его антиген-связывающий фрагмент, которое связывается с рецептором хемокина 4 (CXCR4) и содержит:a) вариабельный участок тяжелой цепи (VH), содержащий (i) VH CDR1, выбранный из группы, состоящей из SEQ ID NO: 107, 113, 114; (ii) VH CDR2, выбранный из группы, состоящей из SEQ ID NO: 162, 128, 154, 123, 158, 124, 159, 125, 160, 126, 161, 127, 163, 164, 165, 166, 167, 168, 155, 129, 156 и 130, и (iii) VH CDR3, выбранный из группы, состоящей из SEQ ID NO: 112; и;b) вариабельный участок легкой цепи (VL), содержащий (i) VL CDR1, выбранный из группы, состоящей из SEQ ID NO: 144, 138, 141, 142, 143, 146, 147, 148, 149 и 150; (ii) VL CDR2, выбранный из группы, состоящей из SEQ ID NO: 145, 132; и (iii) VL CDR3, выбранный из группы, состоящей из SEQ ID NO: 139, 140 и 170.

Изобретение относится к биотехнологии. Описано изолированное антитело или его антиген-связывающий фрагмент, которое связывается с рецептором хемокина 4 (CXCR4) и содержит:a) вариабельный участок тяжелой цепи (VH), содержащий (i) VH CDR1, выбранный из группы, состоящей из SEQ ID NO: 107, 113, 114; (ii) VH CDR2, выбранный из группы, состоящей из SEQ ID NO: 162, 128, 154, 123, 158, 124, 159, 125, 160, 126, 161, 127, 163, 164, 165, 166, 167, 168, 155, 129, 156 и 130, и (iii) VH CDR3, выбранный из группы, состоящей из SEQ ID NO: 112; и;b) вариабельный участок легкой цепи (VL), содержащий (i) VL CDR1, выбранный из группы, состоящей из SEQ ID NO: 144, 138, 141, 142, 143, 146, 147, 148, 149 и 150; (ii) VL CDR2, выбранный из группы, состоящей из SEQ ID NO: 145, 132; и (iii) VL CDR3, выбранный из группы, состоящей из SEQ ID NO: 139, 140 и 170.

Настоящее изобретение относится к иммунологии. Предложен иммуноконъюгат, включающий рекомбинантное антитело IgG1 к эпидермальному фактору роста человека (hEGFR), ковалентно присоединенное к цитотоксическому средству.

Настоящее изобретение относится к иммунологии. Предложен иммуноконъюгат, включающий рекомбинантное антитело IgG1 к эпидермальному фактору роста человека (hEGFR), ковалентно присоединенное к цитотоксическому средству.

Изобретение относится к области биохимии, в частности к полипептиду, специфически связывающемуся с CD3, а также нуклеиновой кислоте, его кодирующей. Причем указанный полипептид содержит домен связывания с CD3 со сниженной изоэлектрической точкой.

Изобретение относится к области биохимии, в частности к полипептиду, специфически связывающемуся с CD3, а также нуклеиновой кислоте, его кодирующей. Причем указанный полипептид содержит домен связывания с CD3 со сниженной изоэлектрической точкой.

Изобретение относится к области биохимии, в частности к бифункциональному антителу, соединенному с последовательностью фермента идуронат-2-сульфатазы посредством глицин-серинового мостика, обладающему высокой аффинностью к инсулиновому рецептору человека.

Настоящее изобретение относится к иммунологии. Предложен полипептид, способный связываться с поверхностным антигеном вируса гепатита B (HBV) и поверхностным антигеном, презентируемым иммунными эффекторными клетками.

Изобретение относится к медицине, а именно к онкологии, и может быть использовано для лечения неоплазии у субъекта. Для этого субъекту с неоплазией вводят антитело, связывающее рецептор колониестимулирующего фактора 1 (CSF1R) человека.

Изобретение относится к области биохимии, в частности к антителу для осуществления взаимодействия антиген-антитело с клаудином 6 (CLDN6), находящимся на поверхности клеток, экспрессирующих CLDN6, при этом по существу неспособному к взаимодействию антиген-антитело с другими высокогомологичными клаудинами, а также к иммуноконъюгату, фармацевтической композиции, содержащим вышеуказанное антитело.

Изобретение относится к биотехнологии. Описано выделенное канинизированное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с Рецептором 1 Программируемой Клеточной Смерти, отличающееся тем, что указанное антитело содержит тяжелую цепь собачьего IgG и собачью легкую цепь каппа; отличающуюся тем, что собачья легкая цепь каппа содержит три области, определяющие комплементарность : CDR 1 легкой цепи, CDR 2 легкой цепи и CDR 3 легкой цепи ; и тяжелая цепь собачьего IgG содержит три CDR тяжелой цепи: CDR 1 тяжелой цепи, CDR 2 тяжелой цепи и CDR 3 тяжелой цепи ; где CDRL1 содержит аминокислотную последовательность SEQ ID NO:20; CDRL2 содержит аминокислотную последовательность SEQ ID NO:22; CDRL3 содержит аминокислотную последовательность SEQ ID NO:24; CDRH1 содержит аминокислотную последовательность SEQ ID NO:14; CDRH2 содержит аминокислотную последовательность SEQ ID NO:16 и CDRH3 содержит аминокислотную последовательность SEQ ID NO:18; где антитело и его антигенсвязывающий фрагмент связываются с собачьим PD-1 и блокируют связывание собачьего PD-1 с собачьим Лигандом 1 Программируемой Клеточной Смерти. Изобретение также относится к применению этих антител при лечении собак. Антитело по изобретению обладает высокой аффинностью связывания с собачьим PD-1. 12 н. и 6 з.п. ф-лы, 4 ил., 5 табл., 2 пр.

Наверх