Применение антагониста vegf при лечении хориоретинальных неоваскулярных нарушений и нарушений проницаемости у педиатрических пациентов

Изобретение относится к применению ранибизумаба в лечении хориоретинальных неоваскулярных нарушений или нарушений проницаемости у детей. Применение ранибизумаба для лечения ребенка включает введение в глаз указанного ребенка ранибизумаба в дозе 0,2 мг для детей в возрасте 2-4 лет и в дозе 0,3 мг для детей в возрасте 5-11 лет. Изобретение обеспечивает безопасное и эффективное лечение детей с хориоретинальными неоваскулярными нарушениями или нарушениями проницаемости за счет оптимально подобранных доз ранибизумаба. 12 з.п. ф-лы, 2 ил., 9 пр.

 

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Данное изобретение относится к области лечения поражений сетчатки у детей.

УРОВЕНЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

Рост новых кровеносных сосудов, которые берут начало в сосудистой оболочке (сосудистый слой глаза между сетчаткой и склерой) и проникают в субретинальный пигментный эпителий или субретинальное пространство, называется «хориоидальная неоваскуляризация» (CNV). CNV у детей может иметь различную этиологию. Например, CNV может быть обусловлена воспалительными процессами, которые могут инициироваться инфекционным агентом. Примерами являются CNV на фоне (предполагаемого) гистоплазмоза глаз или токсоплазмоза, краснушной ретинопатии, саркоидоза, токсокароза собак, синдрома Фогта-Коянаги-Харада и хронического увеита. Другие причины CNV включают травматический разрыв хориоидеи. CNV также наблюдается с дистрофиями сетчатки, которые часто связаны с врожденным генетическим дефектом. Примерами являются CNV на фоне желточной дегенерации желтого пятна Беста, макулярной дистрофии Северной Каролины, болезни Штаргардта и хороидеремии. Как и у взрослых, но более редко, CNV у детей также наблюдается на фоне тяжелой миопии, ангиоидных полос сетчатки и хориоидальной остеомы. CNV у детей дополнительно может быть связана с друзами диска зрительного нерва, колобомой зрительного нерва и ямки зрительного нерва и синдромом утреннего сияния. В некоторых случаях основная причина CNV у детей неизвестна и, вследствие этого, называется идиопатической CNV.

Стандартные методы лечения CNV у взрослых включают терапию лазерной фотокоагуляцией (LPT), вертепорфин (Visudyne®) фотодинамическую терапию (vPDT) и субмакулярную хирургию. Также доступны варианты фармакологического лечения. Например, для лечения CNV у взрослых применяют антагонисты VEGF, такие как пегаптаниб (Macugen®), ранибизумаб (Lucentis®) и бевацизумаб (Avastin®).

Сообщения о применении вне зарегистрированных показаний пегаптаниба, ранибизумаба или бевацизумаба у детей по большей части единичны (Kohly et al. (2011) Can J Ophthalmol 46(1):46-50). Например, две дозы пегаптаниба приводят к почти полному повторному присоединению сетчатки у 2-хлетнего мальчика с 4 стадией ретинита Коутса в пределах трех недель после лечения (Ciulla et al. (2009) Curr Opin Ophthalmol 20(3):166-74). Ранибизумаб вводят детям, страдающим CNV на фоне кератоконуса, папилломакулярного разрыва оболочки Бруха, токсокароза глаз и желточной дегенерации желтого пятна Беста. Бевацизумаб применяют для лечения детей, страдающих CNV на фоне ретинита Коутса, миопии, хориоидальной остеомы, отслойки сенсорной сетчатки вследствие травмы глаз от удара тупым предметом, желточной дегенерации желтого пятна Беста, поражения фовеолярной желточной дегенерации желтого пятна, разрыва хориоидеи, токсоплазмоза и кистозного макулярного отека. В некоторых случаях применяют комбинированное лечение бевацизумабом с триамцинолона ацетонидом и/или LPT или vPDT.

Зачастую трудно спрогнозировать, как лекарственный препарат, успешно применяемый у взрослых, будет вести себя в педиатрической популяции, особенно у более младших детей (0-12 лет). В случаях, о которых сообщалось до настоящего времени, не наблюдалось побочных эффектов при применении антител-антагонистов VEGF для лечения CNV у детей. Однако, поскольку ранибизумаб и бевацизумаб обычно вводят интравитреально, высказаны некоторые опасения, что малое количество антитела-антагониста VEGF может попадать в головной мозг, где он может препятствовать нормальному развитию головного мозга ребенка (Sivaprasad et al. (2008) Br J Ophthalmol. 92:451-54). Возможные опасения также возникают в отношении системного действия антитела-антагониста VEGF при лечении детей (Lyall et al. (2010) Eye 24: 1730-31).

В дополнение, у более маленьких детей (возраст менее 6 лет) введение в стекловидное тело является затруднительным, поскольку это обычно требует общей анестезии, которая сопровождается дополнительным набором факторов риска.

Когда CNV возникает на фоне медленно прогрессирующего заболевания, такого как желточная дегенерация желтого пятна Беста, ретинит Коутса или тяжелая миопия, рано начатое лечение может быть предпочтительным для профилактики и отсрочки стойкого повреждения сетчатки и, вследствие этого, может предотвращать или по меньшей мере значительно отсрочить потерю зрения. Подобные заключения распространяются на CNV иной этиологии, поскольку даже транзиторное снижение остроты зрения может влиять на нормальное развитие ребенка.

Пропотевание жидкости через сосуды, вызывающее отек желтого пятна (ME), может приводить к необратимому структурному повреждению и постоянной потере зрения. ME наблюдается при патологических состояниях, таких как псевдофакичный кистозный макулярный отек (CME), увеит-индуцированный CME, травма, серповидно-клеточная ретинопатия и т.д. Врожденные заболевания глаз, такие как ретинит Коутса, также могут повышать риск развития ME в раннем возрасте. Сообщалось о применении вне зарегистрированных показаний интравитреальных антагонистов VEGF, включая бевацизумаб, в качестве вспомогательного средства в лечении ретинита Коутса у детей (Kaul et al. (2010) Indian J Ophthalmol. 58(1):76-78, Cakir et al. (2008) J AAPOS 12(3):309-11).

Не существует установленного стандарта ведения при лечении ME у детей. Типичные варианты лечения ME включают местно применяемые нестероидные противовоспалительные препараты (NSAID), местно применяемые стероиды, субсклеральное или интравитреальное лечение стероидами, лазерную фотокоагуляцию и комбинацию лазерной терапии и противовоспалительных методов лечения.

Таким образом, целью изобретения является предоставление дополнительных и улучшенных методов лечения поражений сетчатки у детей, которые решают по меньшей мере некоторые из существующих проблем, касающихся лечения детей антителами-антагонистами VEGF. В частности, настоящее изобретение относится к новым методам лечения и схемам лечения, которые являются более подходящими для педиатрических пациентов, например, посредством инъекции меньшей дозы и/или требующие меньшее количество инъекций антагониста VEGF.

РАСКРЫТИЕ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к применению антагониста VEGF в лечении хориоретинальных неоваскулярных нарушений, или нарушений проницаемости, у детей. В частности, изобретение предоставляет антагонист VEGF для применения в способе лечения ребенка, имеющего CNV или ME, при этом указанный способ включает введение в глаз ребенка антагониста VEGF, который либо не поступает, либо быстро выводится из системного кровотока. Антагонист VEGF может быть введен интравитреально, например, посредством инъекции, или местно, например, в виде глазных капель. Изобретение дополнительно предоставляет применение антагониста VEGF в производстве лекарственного препарата для лечения ребенка, имеющего хориоретинальное неоваскулярное нарушение, или нарушение проницаемости.

Антагонисты VEGF

VEGF представляет собой хорошо описанный сигнальный белок, который стимулирует ангиогенез. Для медицинского применения разрешены два антитела-антагониста VEGF под названиями ранибизумаб (Lucentis®) и бевацизумаб (Avastin®). Ранибизумаб и бевацизумаб подают большие надежды в лечении заболеваний глаз, включая CNV различной этиологии у взрослых. Ранее сообщалось о применении вне зарегистрированных показаний ранибизумаба или бевацизумаба у детей (см., например, Kohly et al. (2011) Can J Ophthalmol 46(1):46-50).

При том, что ранибизумаб и бевацизумаб имеют одинаковую скорость клиренса из глаза в кровоток, ранибизумаб быстро выводится из системного кровотока, тогда как бевацизумаб сохраняется и может подавлять уровни системного VEGF в течение нескольких недель. Более конкретно, ранибизумаб имеет короткий системный период полувыведения, составляющий приблизительно 2 часа, тогда какбевацизумаб имеет системный период полувыведения, составляющий приблизительно 20 дней. В развивающемся организме, например у ребенка, данное пролонгированное подавление системного VEGF может иметь нежелательные побочные действия на нормальное развитие.

Вследствие этого, в одном аспекте изобретение относится к применению антагониста VEGF в лечении хориоретинального неоваскулярного нарушения, или нарушения проницаемости, у ребенка, при этом антагонист VEGF либо не поступает, либо быстро выводится из системного кровотока ребенка. В соответствии с изобретением, клиренс антагониста VEGF может быть достаточно быстрым, когда системный период полувыведения антагониста VEGF составляет между 7 дней и приблизительно 1 часом. Предпочтительно, системный период полувыведения антагониста VEGF изобретения составляет менее чем 7 дней, более предпочтительно менее чем 1 день, наиболее предпочтительно менее 3 часов. Предпочтительным антитело-антагонистом VEGF является ранибизумаб.

В качестве альтернативы, антагонист VEGF не является антителом-антагонистом VEGF. Не антитела-антагонисты включают, например, иммуноадгезины. Одним таким иммуноадгезином с действием антагониста VEGF является афлиберцепт (Eylea®), который недавно был одобрен для медицинского применения и также известен как VEGF-ловушка (Holash et al. (2002) PNAS USA 99:11393-98; Riely & Miller (2007) Clin Cancer Res 13:4623-7s). Афлиберцепт имеет системный период полувыведения, составляющий приблизительно 5-6 дней, и представляет собой предпочтительный не антитело-антагонист VEGF для применения с изобретением. Афлиберцепт представляет собой рекомбинантный человеческий растворимый VEGF рецепторный белок слияния, состоящий из фрагментов внеклеточных доменов человеческих рецепторов VEGF 1 и 2, соединенных с Fc-фрагментом человеческого IgG1. Он представляет собой димерный гликопротеин с молекулярной массой белка, составляющей 97 килодальтон (кДа), и содержит гликозилирование, составляющее дополнительные 15% общей молекулярной массы, приводящее к общей молекулярной массе, составляющей 115 кДа. Его удобно получать в виде гликопротеина посредством экспрессии в рекомбинантных клетках CHO-K1. Каждый мономер может иметь следующую аминокислотную последовательность (SEQ ID NO: 1):

SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG,

а дисульфидные мостики могут быть сформированы между остатками 30-79, 124-185, 246-306 и 352-410 в пределах каждого мономера, и между остатками 211-211 и 214-214 между мономерами.

Другой, не антитело-антагонист VEGF иммуноадгезин, в настоящее время в преклинической разработке представляет собой рекомбинантный человеческий растворимый VEGF рецепторный белок слияния, аналогичный VEGF-ловушке, содержащий внеклеточные лиганд-связывающие домены 3 и 4 из VEGFR2/KDR, соответственно, и домен 2 из VEGFR1/Flt-1; данные домены соединены с белковым фрагментом Fc человеческого IgG (Li et al. (2011) Molecular Vision 17:797-803). Данный антагонист связывается с изоформами VEGF-A, VEGF-B и VEGF-C. Молекулу получают с применением двух различных технологических процессов, приводящих к различным профилям гликозилирования в итоговых белках. Две гликоформы называются KH902 (конберцепт) и KH906. Белок слияния может иметь следующую аминокислотную последовательность (SEQ ID NO:2):

MVSYWDTGVLLCALLSCLLLTGSSSGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRLPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPGPGDKTHTCPLCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKATPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

и, подобно VEGF-ловушке, может быть представлен в виде димера. Данный белок слияния и родственные молекулы дополнительно охарактеризованы в EP1767546.

Другие, не антитела-антагонисты VEGF, включают миметики антител (например, Affibody® молекулы, аффилины, аффитины, антикалины, авимеры, пептиды домена Куница и монотела) с активностью антагониста VEGF. Благодаря своему малому размеру миметики антител обычно выводится из кровотока быстро (в пределах от минут до часов). Одним из путей, применяемых для продлевания локального и системного периода полувыведения, является пегилирование.

Вследствие этого термин “не антитела-антагонисты VEGF” включает рекомбинантные связывающие белки, включающие в себя белок с анкириновым повтором, который связывает VEGF-A и предотвращает его связывание с VEGFR-2. Одним примером данной молекулы является DARPin® MP0112. Белок с анкириновым повтором может иметь следующую аминокислотную последовательность (SEQ ID NO: 3):

GSDLGKKLLEAARAGQDDEVRILMANGADVNTADSTGWTPLHLAVPWGHLEIVEVLLKYGADVNAKDFQGWTPLHLAAAIGHQEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQKAA.

Рекомбинантные связывающие белки, включающие белок с анкириновым повтором, который связывает VEGF-A и предотвращает его связывание с VEGFR-2, более подробно описаны в WO2010/060748 и WO2011/135067. Пегилирование продлевает системный период полувыведения DARPins® до 1-3 дней.

Дополнительными особыми миметиками антител с активностью антагонистов VEGF являются 40 кД пегилированный Anticalin® PRS-050 (Mross et al. (2011) Molecular Cancer Therapeutics 10: Supplement 1, Abstract A212) и монотело пегдинетаниб (также называется Ангиосепт или CT-322, см. Dineen et al. (2008) BMC Cancer 8:352).

Упомянутый выше не антитело-антагонист VEGF может быть модифицирован для дополнительного улучшения его фармакокинетических свойств. Например, не антитело-антагонист VEGF может быть химически модифицирован, смешан с биодеградируемым полимером или инкапсулирован в микрочастицы для повышения задержки в стекловидном теле и уменьшения системного действия на не антитело-антагонист VEGF.

Варианты перечисленных выше антагонистов VEGF, которые имеют улучшенные характеристики для требуемого применения, могут быть получены посредством добавления или делеции аминокислот. Как правило, данные варианты аминокислотных последовательностей будут иметь аминокислотную последовательность, обладающую по меньшей мере 60% идентичностью аминокислотных последовательностей с аминокислотными последовательностями SEQ ID NO: 1, SEQ ID NO: 2 или SEQ ID NO: 3, предпочтительно по меньшей мере 80%, более предпочтительно по меньшей мере 85%, более предпочтительно по меньшей мере 90%, и наиболее предпочтительно по меньшей мере 95%, включая, например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% и 100%. Идентичность или гомология в отношении данной последовательности определяется в данном документе, как процентная величина аминокислотных остатков в кандидатной последовательности, которые являются идентичными SEQ ID NO: 1, SEQ ID NO: 2 или SEQ ID NO: 3, после выравнивания последовательностей и введения делеций, при необходимости, с целью достижения максимального процента идентичности последовательностей, и не подразумевая каких-либо консервативных замещений в качестве части идентичности последовательностей.

Идентичность последовательностей можно определить стандартными способами, которые широко используются для сравнения сходства в положении аминокислот двух полипептидов. Применяя компьютерную программу, такую как BLAST или FASTA, два полипептида выравнивают для оптимального сопоставления их соответствующих аминокислот (либо по всей длине одной или обоих последовательностей, либо вдоль заранее определенного участка одной или обоих последовательностей). Программы обеспечивают штраф за открытие делеции по умолчанию и штраф за делецию по умолчанию, и в совокупности с компьютерной программой можно применять стандартную матрицу замен, такую как PAM 250 (см. Dayhoff et al. (1978) Atlas of Protein Sequence and Structure, vol. 5, supp. 3). Например, процентная идентичность тогда может быть вычислена как: общее количество идентичных совпадений, умноженное на 100, а затем разделенное на сумму длины более длинной последовательности в пределах совпавшего перекрывания и количества делеций, введенных в более короткие последовательности с целью выравнивания двух последовательностей.

Если не антитело-антагонист VEGF применяют при использовании изобретения, не антитело-антагонист VEGF связывается с VEGF через один или более белковых доменов, которые не являются производными антиген-связывающего домена антитела. Не антитело-антагонист VEGF является предпочтительно белковоподобным, но может включать модификации, которые не являются белковоподобными (например, пегилирование, гликозилирование). В некоторых вариантах осуществления изобретения антагонист VEGF изобретения предпочтительно не включает Fc-участок антитела, поскольку присутствие Fc-участка в некоторых случаях увеличивает период полувыведения антагониста VEGF и продлевает время присутствия антагониста VEGF в кровотоке.

Пегилирование

Благодаря своему малому размеру миметики антител обычно быстро выводятся из кровотока (в пределах от минут до часов). Таким образом, в некоторых вариантах осуществления изобретения, в частности когда антагонист VEGF представляет собой миметик-антитело, в молекуле антагониста VEGF в различных положениях могут быть присоединены одна или более молекул полиэтиленгликоля.

Данное присоединение может быть достигнуто посредством реакции с аминами, тиолами или другими подходящими функциональными группами. Тиольная группа может быть представлена в цистеиновом остатке; и аминогруппа может представлять собой, например, первичный амин, обнаруженный в N-конце полипептида, или аминогруппы, присутствующие в боковой цепи аминокислоты, такой как лизин или аргинин.

Присоединение молекул полиэтиленгликоля (PEG) (пегилирование) может быть сайт-направленным. Например, подходящая функциональная группа может быть введена в антагонист VEGF для создания сайта, где преимущественно может происходить пегилирование. Например, антагонист VEGF, такой как миметик-антитело (например, DARPin® MP0112), может быть модифицирован, чтобы он содержал цистеиновый остаток в требуемом положении, делая возможным сайт-направленное пегилирование на цистеине, например, посредством реакции с производным PEG, выполняющим функцию малеимида. Альтернативно, подходящая функциональная группа может уже исходно присутствовать в антагонисте VEGF.

Молекула PEG может широко варьировать с молекулярной массой (т.е. от приблизительно 1 кДа до приблизительно 100 кДа) и может быть разветвленной или линейной. Предпочтительно, молекула PEG имеет молекулярную массу, составляющую приблизительно от 1 до приблизительно 50 кДа, предпочтительно приблизительно от 10 до приблизительно 40 кДа, даже более предпочтительно приблизительно от 15 до приблизительно 30 кДа, и наиболее предпочтительно приблизительно 20 кДа. Например, было показано, что добавление 20 кДа молекулы PEG продлевает период полувыведения DARPin® в кровотоке до 20 часов, тогда как более крупные молекулы PEG от 40 до 60 кДа в размерах увеличивали период полувыведения из кровтотока до приблизительно 50 часов.

Пациент

Настоящее изобретение относится к применению антагониста VEGF в лечении хориоретинальных неоваскулярных нарушений, или нарушений проницаемости, у детей. Пациентом считается ребенок, когда у него или у нее еще не завершился его или ее 18-ый год жизни. В одном варианте осуществления ребенок, согласно изобретению, является старше 1 года, но менее чем 18 лет.

В возрасте 12 лет человеческий глаз фактически полностью развит. Вследствие этого не ожидается, что введение в стекловидное тело антагониста VEGF детям в возрасте 12 лет или больше будет препятствовать нормальному развитию глаза. Вследствие недостаточности данных и теоретических рисков при введении ингибитора VEGF, который задействован во множестве путей, необходимых для роста и развития (ангиогенез, дифференцировка эндотелия и развитие гематоэнцефалитического барьева), большим риском считается введение антагониста VEGF детям младше 12 лет.

В конкретном варианте осуществления ребенок находится в возрасте менее 12 лет. Ребенок может быть 5 лет или старше, но в возрасте менее 12 лет. В другом варианте осуществления ребенок является старше 1 года (например, 2 года или старше), но в возрасте менее 5 лет. Введение антагониста VEGF нуждающемуся в этом более юному ребенку может превысить риски системного действия на антагонист, когда стойкое снижение остроты зрения или полная потеря зрения является практически неизбежной при отсутствии лечения.

Показания

Настоящее изобретение относится к лечению хориоретинального неоваскулярного нарушения, или нарушения проницаемости, у ребенка. Хориоретинальные неоваскулярные нарушения, или нарушения проницаемости, наблюдаемые у детей, включают CNV и ME.

CNV, поддающееся лечению посредством настоящего изобретения, может быть вторичным по отношению к ряду заболеваний и болезненных процессов, которые возникают у детей. Например, к CNV могут приводить заболевания, которые вызывают воспаление в глазу. Данные заболевания включают гистоплазмоз глаз или токсоплазмоз, краснушную ретинопатию, саркоидоз, токсокароз собак, синдром Фогта-Коянаги-Харада и хронический увеит. У педиатрических пациентов с вышеуказанными инфекционными заболеваниями, связанными с последующим развитием CNV, в частности, с (предполагаемым) гистоплазмозом глаз, токсоплазмозом и токсокарозом собак в анамнезе, лечение антагонистом VEGF согласно изобретению следует начинать при первом признаке CNV, чтобы предотвратить или отсрочить стойкое повреждение сетчатки.

Дополнительной причиной CNV является дистрофия сетчатки. Дистрофии сетчатки с ранним началом связаны с одним или более генетическим дефектом (дефектами). Примерами являются желточная дегенерация желтого пятна Беста, макулярная дистрофия Северной Каролины, болезнь Штаргардта и хороидеремия. Ретинит Коутса также может иметь наследственный компонент и аналогичным образом является связанным с CNV. В соответствии с изобретением лечение CNV антагонистом VEGF может быть особенно предпочтительным у детей с желточной дегенерацией желтого пятна Беста и/или ретинитом Коутса. У педиатрических пациентов, имеющих семейный анамнез и, вследствие этого, повышенный риск развития дистрофии сетчатки, лечение антагонистом VEGF согласно изобретению следует начинать при первом признаке CNV, чтобы предотвратить или отсрочить стойкое повреждение сетчатки. У детей с желточной дегенерацией желтого пятна Беста лечение может быть начато перед тем, как ребенок достигнет возраста 10 лет, предпочтительно до 6 лет. У детей с ретинитом Коутса лечение может быть начато на ранних стадиях, предпочтительно в I стадии ретинита Коутса, которая характеризуется только телеангиэктазией.

CNV может возникать вторично после повреждения сосудистой оболочки после физического повреждающего воздействия. Например, разрыв сосудистой оболочки может возникнуть вследствие травмы глаза.

Опухоли сосудистой оболочки также могут быть связаны с CNV. Опухолевый рост может приводить к острому снижению остроты зрения вследствие серьезной макулярной отслойки или субретинального кровоизлияния и может включать CNV. Редкой и доброкачественной опухолью сосудистой оболочки является хориоидальная остеома.

CNV, поддающаяся лечению посредством настоящего изобретения, вследствие этого включает CNV, ассоциированную или вторичную по отношению к ряду патологических состояний, включая посттравматическую хориопатию, ангиоидные полосы сетчатки/эластическую псевдоксантому, желточную дегенерацию желтого пятна Беста, центральную серозную хориопатию, точечную внутреннюю хориопатию, мультифокальный хориоидит, синдром гистоплазмоза, хориоидальную остеому, токсоплазмоз, увеит, доброкачественную внутричерепную гипертензию, перипапиллярный, идиопатический хориоидит, патологическую миопию, полипообразную хориоидальную васкулопатию и центральную серозную хориопатию.

Ретинальная неоваскуляризация, поддающаяся лечению посредством настоящего изобретения, включает ретинальную неоваскуляризацию по отношению к серповидно-клеточной ретинопатии, ретинальную ангиоматозную пролиферацию, ROP и ретинит Коутса.

ME, поддающаяся лечению посредством настоящего изобретения, может быть ассоциированной или вторичной по отношению к псевдофакии, увеиту, окклюзивному васкулиту, пигментному ретиниту, окклюзии ветки вены сетчатки (BRVO), окклюзии центральной вены сетчатки (CRVO), глазному ишемическому синдрому, лучевой нейропатии зрительного нерва/ретинопатии, поствоспалительной хориоидальной неоваскуляризации, пролиферативной диабетической ретинопатии (PDR), серповидно-клеточная ретинопатии, перифлебита сетчатки или передней неартериитной ишемической невропатии зрительного нерва.

Другие хориоретинальные неоваскулярные нарушения, или нарушения проницаемости, которые могут поддаваться лечению посредством настоящего изобретения, дополнительно включают метастатические процессы в сосудистой оболочке глаза, неоваскуляризацию, ассоциированную с меланомой, макроаневризму, вазопролиферативную опухоль, юкстапапиллярную капиллярную гемангиому, идиопатические макулярные телеангиэктазии, герпетическую неоваскуляризацию роговицы, неоваскуляризацию роговицы вследствие рубцующегося пемфигоида, неоваскуляризацию задней капсулы, неоваскуляризацию роговицы, ассоциированную с синдромом сухого глаза, ревизией фильтрационной подушки, вспомогательной фильтрующей хирургией глаукомы, неоваскулярной глаукомы и идиопатической CNV.

Дозирование

Ранибизумаб обычно вводят взрослым интравитреально в дозе 0,5 мг в объеме 50 мкл. Афлиберцепт также вводят посредством интравитреальной инъекции. Типичная доза для взрослых составляет 2 мг (суспендированная в 0,05 мл буфера, включающего 40 мг/мл в 10 мМ фосфата натрия, 40 мМ хлорида натрия, 0,03% полисорбата-20 и 5% сахарозы, pH 6,2).

Дети в возрасте по меньшей мере 12 лет обычно получают такую же дозу антагониста VEGF, какую вводят взрослому. При том, что рост и развитие глаза продолжается и после 12 лет, размер глаза у детей данной возрастной группы сопоставим со средним размером глаза у взрослых и, вследствие этого, не ожидается, что воздействие на сыворотку интравитреально введенного антагониста VEGF будет гораздо более сильным, чем наблюдается у взрослых. В дополнение, организм достигает стадии развития, в которой он более походит на организм среднего взрослого.

Однако, обычная доза и/или объем могут быть уменьшены для лечения детей более младшего возраста (в возрасте до 12 лет, в частности в возрасте до 5 лет) вследствие уменьшенного интравитреального объема их глаз, меньшей массы тела и повышенных рисков для нормального развития организма, связанного с системным воздействием антагониста VEGF.

В одном варианте осуществления уменьшена только доза антагониста VEGF (например, для уменьшения системного воздействия антагониста VEGF), тогда как вводимый объем остается таким же. Уменьшение дозы может быть достигнуто посредством разбавления взрослой лекарственной формы за счет добавления стерильного буферного раствора (в идеале такого же буфера, в котором антагонист VEGF предоставлен во взрослой лекарственной форме). Меньшими объемами иногда труднее управлять, и это может приводить к более выраженным колебаниям количества антагониста VEGF, действительно вводимого пациенту. Вследствие этого, в некоторых вариантах осуществления дозу антагониста VEGF уменьшают без уменьшения объема, который используют для введения антагониста VEGF. Например, доза может быть уменьшена, но объем может быть оставлен таким же, как обычный объем для взрослого (например, давая дозу 0,24 мг ранибизумаба в 40 мкл объема с использованием лекарственной формы 6 мг/мл).

В других вариантах осуществления вводят такую же дозу, но в уменьшенном объеме (с учетом меньшего размера глаза у детей в возрасте до 12 лет).

Предпочтительно, и доза, и объем являются уменьшенными. Обычно и доза, и объем, вводимые детям в возрасте до 12 лет и в возрасте более 1 года, составляют 60% или менее обычной дозы и объема антагониста VEGF, вводимого взрослому. Доза и объем могут быть уменьшены пропорционально уменьшенному интравитреальному объему глаза в соответствии с возрастом ребенка с целью поддержания такой же концентрации в глазу, которая, как обнаружено, является эффективной у взрослых.

Однако, в некоторых случаях снижение дозы пропорционально уменьшенному интравитреальному объему глаза ребенка может быть недостаточной для предотвращения системного воздействия уровней антагониста VEGF, которые превышают уровни, которые как было обнаружено являются безопасными для взрослой популяции. Системное действие коррелирует с массой тела больного. Вследствие этого, при выборе конкретных доз для введения детям, возможность недостаточного воздействия по отношению к стандартному воздействию на стекловидное тело взрослого (сниженная эффективность) необходимо уравновешивать с повышенным воздействием на сыворотку (повышенный риск). Следовательно, в некоторых вариантах осуществления изобретения вводимую ребенку дозу дополнительно уменьшают по сравнению с целесообразным пропорциональным уменьшением относительно уменьшенного интравитреального объема глаза ребенка с целью поддержания безопасных уровней системного воздействия антагониста VEGF.

Существующие лекарственные формы антагониста VEGF могут применяться для достижения уменьшенных доз и объемов. Лекарственная форма ранибизумаба 10 мг/мл является особенно подходящей для предоставления доз и объемов, приспособленных для различных возрастных групп и групп пациентов (например, 0,5 мг, 0,4 мг, 0,3 мг, 0,25 мг, 0,2 мг, 0,15 мг 0,1 мг или 0,05 мг в 50 мкл, 40 мкл, 30 мкл, 25 мкл, 20 мкл, 15 мкл, 10 мкл и 5 мкл, соответственно). Аналогичным образом, лекарственную форму ранибизумаба 6 мг/мл можно применять для введения 0,06 мг, 0,12 мг, 0,18 мг и 0,24 мг в 10 мкл, 20 мкл, 30 мкл и 40 мкл, соответственно.

В соответствии с изобретением дети возрастной группы от 5 до 12 лет могут получать приблизительно 60% обычной дозы для взрослых в приблизительно 60% обычного объема для взрослых (например, 0,3 мг ранибизумаба в 30 мкл объема). В качестве альтернативы, доза может быть уменьшена наполовину, но объем может быть уменьшен лишь незначительно (например, посредством введения 0,24 мг ранибизумаба в объеме 40 мкл).

Дети в возрасте до 5 лет, но старше 1 года, могут получать приблизительно 40% обычной дозы для взрослых в приблизительно 40% обычного объема для взрослых. Например, 0,2 мг ранибизумаба может быть введено в объеме 20 мкл.

В некоторых случаях дозу можно повысить для достижения эффекта. Например, дозу у детей старше 1 года и младше 5 лет можно повысить до половины или немного более половины дозы для взрослых (например, для 0,25 мг ранибизумаба в 25 мкл или 0,3 мг в 30 мкл). Однако для детей данной возрастной группы доза обычно не должна превышать 60% обычной дозы для взрослых, чтобы избежать воздействия уровней антагониста VEGF в сыворотке намного более высоких, чем уровни, которые, как обнаружено, являются безопасными у взрослых. Предпочтительно, доза, вводимая детям данной возрастной группы, не должна превышать 50% обычной дозы для взрослых.

Аналогичным образом, доза у детей старше 5 лет и младше 12 лет может быть повышена до приблизительно трех четвертых дозы для взрослых (например, для ранибизумаба 0,4 мг в 40 мкл). Однако, для детей в данной возрастной группе доза обычно не должна превышать 80% обычной дозы для взрослых, чтобы избежать воздействия уровней антагониста VEGF в сыворотке намного более высоких, чем уровни, которые, как обнаружено, являются безопасными у взрослых. Предпочтительно, доза, вводимая детям данной возрастной группы, не должна превышать 70% обычной дозы для взрослых.

Введение

Антагонист VEGF изобретения обычно необходимо вводить пациенту через интравитреальную инъекцию, хотя можно применять другие пути введения, такие как депо медленного высвобождения, глазную пробку/резервуар или глазные капли. Обычным является введение водной формы, с типичным объемом 5-50 мкл, например, 7,5 мкл, 10 мкл, 15 мкл, 20 мкл, 25 мкл или 40 мкл. Инъекцию можно выполнять через иглу 30-го калибра x ½-дюйма (12,7 мм).

В некоторых случаях можно применять интравитреальное устройство для непрерывной доставки антагониста VEGF в глаз в течение периода нескольких месяцев перед необходимостью пополнения за счет инъекции. Когда антагонист VEGF вводят непрерывно, дозу и скорость высвобождения препарата можно отрегулировать, применяя глазные модели и модели системного действия, описанные в данном документе. Предпочтительно, интравитреальное устройство разработано для высвобождения антагониста VEGF с первоначальной скоростью, которая является более высокой в первый месяц. Скорость высвобождения препарата медленно снижается, например, в течение первого месяца после имплантации до скорости, которая приблизительно на 50% меньше, чем первоначальная скорость. Контейнер может иметь размер, который является достаточным, чтобы поддерживать поступление антагониста VEGF, которое длится в течение приблизительно от четырех до шести месяцев. Поскольку уменьшенная доза антагониста VEGF может быть достаточной для эффективного лечения, когда введение является продолжительным, поступление из контейнера может длиться в течение одного года или дольше, предпочтительно приблизительно два года, более предпочтительно приблизительно три года.

Непрерывная доставка антагониста VEGF может быть более пригодна для детей в возрасте 12 лет или старше, поскольку глаз фактически достиг своих взрослых размеров. Если имплантация интравитреального устройства препятствует нормальному развитию глаза ребенка, непрерывная доставка может быть непригодной. Например, непрерывная доставка антагониста VEGF может быть непригодной у детей в возрасте младше 12 лет, конкретно у детей в восрасте младше 5 лет, более конкретно у детей в возрасте младше 2 лет.

В данной области техники известны различные интравитреальные системы доставки. Данные системы доставки могут быть активными или пассивными. Например, WO2010/088548 описывает систему доставки, имеющую жесткий корпус, использующий пассивную диффузию для доставки терапевтического агента. WO2002/100318 раскрывает систему доставки, имеющую эластичный корпус, который делает возможным активное введение посредством градиента давления. В качестве альтернативы, активная доставка может быть достигнута посредством имплантируемых миниатюрных помп. Примером интравитреальной системы доставки с применением миниатюрной помпы для доставки терапевтического агента является Ophthalmic MicroPump System™, продаваемая Replenish, Inc., которую можно запрограммировать на доставку установленного количества терапевтического агента в течение заранее определенного числа раз.

Для непрерывной доставки, антагонист VEGF обычно заключают в небольшой капсулообразный контейнер (например, чашечку из силиконового эластомера). Контейнер обычно имплантируют в глаз выше радужной оболочки. Контейнер включает высвобождающее отверстие. Высвобождение антагониста VEGF может регулироваться мембраной, расположенной между антагонистом VEGF и отверстием, или посредством миниатюрного насоса, соединенного с контейнером. В качестве альтернативы, антагонист VEGF может быть размещен в матрице с медленным высвобождением, что предотвращает быструю диффузию антагониста из контейнера.

Непрерывное введение посредством интравитреального устройства может особенно подходить для пациентов с хронической CNV на фоне, например, ангиоидных полос сетчатки, центральной серозной хориопатии, синдрома Фогта-Коянаги-Харада или эластической псевдоксантомой. Пациенты с CNV, рефрактерной к традиционному лечению противовоспалительной терапией, могут также выигрывать от непрерывного введения. Поскольку для имплантации системы доставки требуется лишь небольшое хирургическое вмешательство, и можно избежать интравитреальных инъекций, можно избежать проблем соблюдения больным режима лечения с повторными интравитреальными инъекциями. Интравитреальные концентрации антагониста VEGF снижены, и вследствие этого уменьшается потенциальный риск побочных эффектов от антагониста VEGF, попадающего в кровоток. Уход от интравитреальных инъекций может быть особенно перспективным у детей, которым может потребоваться общая анестезия для интравитреальных инъекций. Повышенные уровни антагониста VEGF в организме в целом могут препятствовать нормальному росту и развитию детей, которые вследствие этого могут выигрывать от более низких интравитреальных концентраций антагониста VEGF.

В одном аспекте изобретения антагонист VEGF предоставлен в предварительно заполненном стерильном шприце, готовом к введению. Предпочтительно, шприц имеет низкое содержание силикона. Более предпочтительно, шприц не содержит силикона. Шприц может быть сделан из стекла. Применение предварительно заполненного шприца для доставки имеет преимущество, что можно избежать любой контаминации стерильного раствора антагониста VEGF перед введением. Предварительно заполненные шприцы также обеспечивают более легкое обращение для введения офтальмологом.

В соответствии с изобретением, предварительно заполненный шприц будет содержать подходящую дозу и объем антагониста VEGF изобретения. Обычно и доза, и объем в предварительно заполненном шприце составляют 60% или менее обычной дозы и объема антагониста VEGF, вводимого взрослому. Обычный объем антагониста VEGF в предварительно заполненном шприце составляет 5-50 мкл, например, 7,5 мкл, 10 мкл, 15 мкл, 20 мкл, 25 мкл или 40 мкл. Например, предварительно заполненный шприц может содержать лекарственную форму ранибизумаба 10 мг/мл (например, содержащую 0,4 мг, 0,3 мг, 0,2 мг или 0,1 мг в 40 мкл, 30 мкл, 20 мкл и 10 мкл, соответственно). В качестве альтернативы предварительно заполненный шприц может содержать лекарственную форму ранибизумаба 6 мг/мл (например, содержащую 0,06 мг, 0,12 мг, 0,18 мг и 0,24 мг в 10 мкл, 20 мкл, 30 мкл и 40 мкл, соответственно).

В предпочтительном варианте осуществления предварительно заполненный шприц с малой дозой в соответствии с изобретением имеет номинальный максимальный объем содержимого, составляющий 0,2 мл, и специально выполнен с возможностью точного дозирования объемов ниже 50 мкл.

В другом аспекте изобретения антагонист VEGF предоставлен в качестве части набора. В дополнение к контейнеру, включающему антагонист VEGF, набор будет дополнительно содержать шприц. Шприц применяют для введения в стекловидное тело антагониста VEGF. Предпочтительно, шприц представляет собой шприц с малой дозой, т.е. шприц, который отмеряет малые объемы с высокой точностью. В некоторых вариантах осуществления контейнер будет содержать более чем одну дозу антагониста VEGF и более чем один шприц, делающие возможным применение набора для множественных введений антагониста VEGF.

Лекарственные формы с медленным высвобождением

VEGF антагонист может быть предоставлен в виде лекарственных форм с медленным высвобождением. Лекарственные формы с медленным высвобождением обычно получают посредством смешивания терапевтического агента с биодеградируемым полимером или инкапсулирования его в микрочастицы. Изменяя условия изготовления композиций для доставки на полимерной основе, можно модулировать свойства кинетического высвобождения итоговых композиций. Добавление полимерных носителей также снижает вероятность, что любой интравитреально введенный антагонист VEGF попадет в кровоток или проникнет в развивающийся мозг ребенка.

В соответствии с изобретением лекарственная форма с медленным высвобождением обычно включает антагонист VEGF, полимерные носители и модификатор высвобождения для модифицирования скорости высвобождения антагониста VEGF из полимерных носителей. Полимерные носители обычно включают один или более биодеградируемых полимеров или сополимеров или их комбинации. Например, полимерные носители могут быть выбраны из полимолочной кислоты (PLA), полигликолевой кислоты (PGA), сополимера лактида с гликолидом (PLGA), полиэфиров, поли(ортоэфира), поли(фосфазида), поли(фосфатного эфира), поликапролактонов или их комбинации. Предпочтительным полимерным носителем является PLGA. Модификатор высвобождения обычно представляет собой длинноцепочечный жирный спирт, предпочтительно включающий от 10 до 40 атомов углерода. Широко используемые модификаторы высвобождения включают каприловый спирт, пеларгоновый спирт, каприновый спирт, лауриловый спирт, миристиловый спирт, цетиловый спирт, пальмитолеиловый спирт, стеариловый спирт, изостеариловый спирт, элаидиловый спирт, олеиловый спирт, линолеиловый спирт, полиненасыщенный элаидолинолеиловый спирт, полиненасыщенный линолеиловый спирт, элаидолинолениловый спирт, полиненасыщенный рицинолеиловый спирт, арахидиловый спирт, бегениловый спирт, эруциловый спирт, лигноцериловый спирт, цериловый спирт, монтаниловый спирт, клуитиловый спирт, мирициловый спирт, мелиссиловый спирт и геддиловый спирт.

В конкретном варианте осуществления антагонист VEGF заключен в композицию с замедленным высвобождением на основе микросфер. Микросферы предпочтительно приготовлены из PLGA. Количество антагониста VEGF, заключенного в микросферы, и скорость высвобождения препарата антагониста VEGF можно регулировать, изменяя условия, применяемые для приготовления микросфер. Процессы изготовления данных лекарственные формы с медленным высвобождением описаны в US 2005/0281861 и US 2008/0107694.

Необходимость и объем дозы и регулирование скорости высвобождения для лекарственной формы с медленным высвобождением, подходящей для введения детям, можно оценить, применяя глазные модели и модели системного действия, описанные в данном документе.

Схемы лечения

В соответствии с изобретением антагонист VEGF вводят один или более раз первоначально, а затем повторно вводят «по мере необходимости» в зависимости от эффективности начального курса лечения. В некоторых вариантах осуществления первичное лечение ограничено единичной интравитреальной инъекцией антагониста VEGF.

Посредством выполнения дополнительных инъекций на основе «по мере необходимости», интервал между введениями антагониста VEGF после первичного лечения может быть увеличен, поскольку вторую или дополнительную дозу антагониста VEGF вводят, только когда лечащий врач может наблюдать признаки активности заболевания. Воздействие высоких уровней антагониста VEGF в сыворотке, вследствие этого, дополнительно уменьшается. В дополнение, уменьшение общего количества требуемых инъекций снижает риск других потенциальных побочных эффектов, например, вследствие общей анестезии, которая может потребоваться для безопасного введения антагонист детям более младшего возраста. Менее частое выполнение интравитреальных инъекций также может повысить соблюдение больным лечебного режима, приводя в целом к более эффективному лечению. Это является особенно перспективным у пациентов, страдающих CNV на фоне медленно прогрессирующего дегенеративного заболевания сетчатки, такого как болезнь Штаргардта или желточная дегенерация желтого пятна Беста, которым может потребоваться множественные инъекции в течение продолжительного периода времени для улучшения остроты зрения или предотвращения потери зрения. Уменьшение общего количества введении также приводит к более экономически эффективной терапии.

В некоторых случаях единичная инъекция антагониста VEGF согласно изобретению может быть достаточной для улучшения заболевания или предотвращения прогрессирования заболевания в течение многих лет. В некоторых случаях пациенту вводят одну, две или три инъекции, каждую по меньшей мере с иинтервалом в один месяц, тогда как любые последующие инъекции выполняют менее часто, предпочтительно на основе «по мере необходимости». В некоторых вариантах осуществления инъекции выполняют с интервалом по меньшей мере 6 недель, предпочтительно 8 недель, более предпочтительно 10 недель.

Лечение может быть прервано, когда достигнута максимальная острота зрения. Например, лечение может быть прервано, когда острота зрения является стабильной в течение по меньшей мере трех месяцев (т.е., в течение данного периода не наблюдается увеличения или уменьшения остроты зрения).

Введение по индивидуальной схеме «по мере необходимости» основано на оценке лечащим врачом активности заболевания. Активность заболевания можно оценить посредством наблюдения за изменением наилучшей корригированной остроты зрения (BCVA) от исходного уровня (т.е. от первоначальной дозы антагониста VEGF) с течением времени, начиная с 1 месяца и вплоть до 12 месяца после первого введения антагониста VEGF. В дополнение или в качестве альтернативы, изменения в активности заболевания оценивают посредством наблюдения за изменениями клинических и анатомических признаков ответа на лечение.

Например, первый раз антагонист VEGF вводят пациенту после того, как был установлен первичный диагноз хориоретинального неоваскулярного нарушения, или нарушения проницаемости, (например, CNV или ME) (обычно в результате того, что пациент становится слабовидящим или во время стандартного обследования у пациентов, предрасположенных к развитию данного нарушения). Диагноз может быть установлен при исследовании глаза с помощью комбинации осмотра с помощью щелевой лампы, биомикроскопического осмотра дна, офтальмоскопии, оптической когерентной томографии (OCT), флуоресцентной ангиографии дна (FFA) и/или цветной фотосъемки глазного дна (CFP).

Интервал контрольных обследований обычно устанавливается по усмотрению лечащего врача. Например, контрольные обследования могут иметь место каждые четыре недели или более после первичного введения антагониста VEGF (например, ежемесячно или раз в два месяца). Например, контрольные обследования могут иметь место каждые 4-6 недель, каждые 6-8 недель, каждые 8-10 недель и т.д.

Второе, третье или дополнительное введение антагониста VEGF выполняют, только если обследование глаза выявляет признаки стойкого или рецидивирующего хориоретинального неоваскулярного нарушения, или нарушения проницаемости, во время контрольного обследования. Интервал между инъекциями не должен быть короче одного месяца. Во время контрольных обследований параметры активности поражения CNV и ME (такие как активный ангиогенез, экссудация и характеристики пропотевания жидкости через сосуды) можно оценить на основании изображений в результате проведения OCT, FFA, CFP и т.д. и/или клинической оценки (включая BCVA). Изменения данных параметров регистрируют на протяжение времени, обычно начиная с месяца 1, и вплоть до 12 месяца, после того как была введена первоначальная доза антагониста VEGF.

Изменения ключевых анатомиических параметров поражений CNV и ME (например, уменьшенная толщина сетчатки или истечение жидкости) указывают на снижение активности заболевания. Положительная динамика в BCVA, составляющая ≥5, ≥10 или ≥15 знаков в месяце 6 и месяце 12 по сравнению с исходным уровнем, также является показателем успешности лечения. В данных случаях дополнительных введений антагониста VEGF может не потребоваться. Потеря в BCVA, составляющая ≥5, ≥10 или ≥15 знаков от исходного уровня или сохраняющаяся активность заболевания (например, отсутствие уменьшения толщины сетчатки, продолжающееся истечение, на которое указывает наличие жидкости) указывает на необходимость одной или более дополнительных инъекций антагониста VEGF.

Комбинированная терапия

Соединения изобретения можно вводить в комбинации с одним или более дополнительным видом лечением (видами лечения).

В одном аспекте изобретения лечение антагонистом VEGF изобретения можно применять в комбинации с LPT или vPDT.

LPT применяет лазерный свет, чтобы вызвать регулируемое повреждение сетчатки для оказания благотворного терапевтического действия. Маленькие вспышки лазерного света способны заварить протекающие кровеносные сосуды, разрушить патологические кровеносные сосуды, заварить разрывы сетчатки или разрушить патологическую ткань в задней части глаза. Это является быстрым и обычно не требует другой анестезии, кроме анестезирующих глазных капель. Методики и аппараты LPT являются легко доступными офтальмологам. См. Lock et al. (2010) Med J Malaysia 65:88-94.

Методики LPT в соответствии с их применением можно классифицировать на фокальный, панретинальный (или рассеяный) или секторальный. Фокальный LPT наносит ожоги малых размеров на конкретные точки фокального истечения (т.е. микроаневризмы). Панретинальный LPT рассеивает ожоги на всем протяжении периферической сетчатки. Секторальный LPT наносит схему ожогов на области сетчатки с диффузным капиллярным истечением или неперфузией, при этом каждый ожог обычно отделен интервалом в две видимые ширины ожога. Пациенты могут получать более одного типа LPT (например, комбинацию фокального и панретинального LPT), и они могут применяться один непосредственно после другого или после отсрочки. Обычный терапевтический панретинальный LPT задействует нанесение 1200-1600 ожогов.

Размеры лазерных пятен (диаметры пятен), составляющие 50-500 мкм, являются обычными (меньшие размеры пятен являются более обычными для фокального LPT, более крупные для панретинального), нанесенные в течение 50-200 мс (непрерывно, или посредством микроимпульсов), с применением длины волны от зеленого до желтого, например, с применением аргонового газового (514,5 нм) лазера, криптонового желтого лазера (568,2 нм) или перестраиваемого лазера на красителе (переменная длина волны). В некоторых случаях может применяться красный лазер, если зеленый или желтый лазер исключен (например, при наличии кровоизлияния в стекловидное тело).

Микроимпульсная лазерная терапия (MLP) применяет 810 нм или 577 нм лазеры для направления прерывистого луча лазерного света на пораженную ткань (Kiire et al. (2011) Retina Today, 67-70). Это приводит к большей степени контроля над фототермическими эффектами при лазерной фотокоагуляции. Устоявшаяся непрерывная эмиссия традиционного LPT доставляется в виде коротких лазерных импульсов. Каждый импульс обычно составляет 100-300 мкс в длину с интервалом от 1700 до 1900 мкс между каждым импульсом. «Ширина» (время «включения») каждого импульса и интервала между импульсами время «выключения») регулируются хирургом. «Ширина» более короткого микроимпульса ограничивает время нагревания, индуцированного лазером, для распространения в примыкающую ткань. Более длинный интервал между импульсами позволяет происходить охлаждению перед доставкой следующего импульса. Таким образом, может быть минимизировано внутрисетчаточное повреждение. В связи с этим MLP также называется “подпороговая лазерная обработка” или “тканесберегающая лазерная обработка”. 10-25% микроимпульсной энергии являются достаточным, чтобы продемонстрировать устойчивый фототермический эффект, который ограничивается пигментным эпителием сетчатки и не влияет на нейросенсорную часть сетчатки.

Согласно изобретению пациенты могут получать и LPT, и антагонист VEGF. Введение LPT и антагониста VEGF не должно происходить одновременно, так что одно будет предшествовать другому. Инициирование введения LPT и антагониста VEGF происходит в пределах 6 месяца друг от друга, и в идеале происходит в пределах 1 месяца друг от друга (например, в пределах 10 дней).

Обычно терапию антагонистом VEGF назначают перед LPT. LPT может происходить непосредственно после введения антагониста VEGF (например, в пределах 2-20 дней, обычно в пределах 10-14 дней), или может происходить после более длинной отсрочки (например, после по меньшей мере 4 недель, после по меньшей мере 8 недель, после по меньшей мере 12 недель или после по меньшей мере 24 недель). Ожидается, что инъецируемые антагонисты VEGF поддерживают значительную интравитреальную VEGF-связывающую активность в течение 10-12 недель (Stewart & Rosenfeld (2008) Br J Ophthalmol 92:667-8). В альтернативном варианте осуществления терапию антагонистом VEGF назначают после LPT.

Некоторые варианты осуществления задействуют более чем одно введение LPT и/или антагониста VEGF. Например, в одном используемом варианте осуществления пациент последовательно получает (i) антагонист VEGF, (ii) по меньшей мере одно введение LPT, (iii) антагонист VEGF. Например, пациент может получить первоначальную интравитреальную инъекцию антагониста VEGF; затем, в пределах 10-14 дней после получения антагониста VEGF, он или она получает фокальные LPT с последующей второй инъекцией антагониста VEGF по меньшей мере через 4 недели или месяца первоначальной инъекции. В качестве альтернативы, в пределах 10-14 дней после получения антагониста VEGF, пациент может получить по меньшей мере один сеанс (например, вплоть до трех) панретинального LPT; и затем, через 4 недели или месяц после первоначальной инъекции, пациент получает вторую инъекцию антагониста VEGF. Данная схема может быть продолжена дополнительными дозами антагониста VEGF, например, с частотой каждый 1 или 2 месяца или по мере необходимости. С обеспечением того, что LPT инициируют в пределах 14 дней после первоначальной инъекции, антагонист все еще будет присутствовать в глазу.

Комбинирование терапии антагонистом VEGF с LPT является особенно полезным для лечения экстрафовеальной и юкстафовеальной CNV у подростков и более старших контактных детей (например, 6 лет и старше), поскольку можно применять такие же методики, как методики, применяемые у взрослых. Юкстафовеальное лечение CNV посредством LPT не рекомендуется у детей более младшего возраста (в возрасте менее 6 лет) вследствие высокого риска случайного ожога центральной ямки сетчатки.

vPDT применяет фотоактивируемую молекулу, чтобы вызвать локальное повреждение неоваскулярного эндотелия, приводя к окклюзии сосудов. Свет попадает на сетчатку в виде единичного круглого пятна через оптиковолоконный кабель и щелевую лампу, используя пригодную офтальмологическую увеличивающую линзу (применение «холодного» лазерного света). Фотоактивируемое соединение - вертепорфин (Visudyne®) - посредством инъекции вводят в кровоток перед применением лазерного света, и наносят повреждение посредством фотоактивации соединения в зоне, пораженной CNV. Вертепорфин переносится в плазму прежде всего посредством липопротеинов. Как только вертепорфин активируется светом в присутствии кислорода, вырабатывается высокоактивный, короткоживущий атомарный кислород и активные кислородные радикалы, что повреждает эндотелий, окружающий кровеносные сосуды. Известно, что поврежденный эндотелий высвобождает прокоагулянт и вазоактивные факторы через липооксигеназный (лейкотриеновый) и циклооксигеназный (эйкосаноиды, такие как тромбоксан) пути, приводя к агрегации тромбоцитов, формированию фибринового тромба и вазоконстрикции. По-видимому, вертепорфин в какой-то степени преимущественно накапливается в новообразованных сосудах. Длина волны лазера, применяемая для фотоактивации фотоактивируемого соединения, может ваьировать в зависимости от конкретного используемого фотоактивируемого соединения. Например, доставку пациенту лазерного света с длиной волны 689 нм можно применять через 15 минут после начала 10-минутной инфузии вертепорфина. Фотоактивация регулируется общей доставленной плотностью энергии. При применении vPDT в лечении CNV, рекомендованная плотность энергии составляет 50 Дж/см2 неоваскулярного повреждения, нанесенного с интенсивностью 600 мВ/см2 в течение 83 секунд. Плотность энергии, интенсивность света, коэффициент усиления глазной линзы и установка фокусировки объектива являются важными параметрами для надлежащей доставки света в предварительно заданную точку лечения во время vPDT и могут нуждаться в настройке в зависимости от лазерной системы, применяемой для лечения.

Введение антагониста VEGF выполняют перед или после vPDT. Обычно введение антагониста VEGF и vPDT будет выполняться в тот же день. Обычно интравитреальную инъекцию антагониста VEGF выполняют последней для минимизации обработки глаза после инъекции. В качестве альтернативы, лечение антагонистом VEGF инициируют по меньшей мере за 1 неделю, 2 недели, 3 недели, 4 недели, 2 месяца, 3 месяца, 4 месяца, 5 месяцев или 6 месяцев перед vPDT. Антагонист VEGF может вводиться каждые 4 недели, каждые 6 недель или каждые 8 недель. Лечение может быть продолжено с таким же интервалом или с увеличенными интервалами после vPDT. Если интервал увеличенный, период между введением антагониста VEGF может увеличиваться на 50% или 100%. Например, если первоначальный интервал составлял 4 недели, интервал может быть увеличен до 6 или 8 недель. В качестве альтернативы, введение антагонист VEGF может быть продолжительным, например, если используется интравитреальная система доставки. Интравитреальное устройство может быть имплантировано перед vPDT. В качестве альтернативы, однократное введение не антитела-антагониста VEGF тотчас до или после vPDT может быть достаточным для достижения желаемого эффекта. Например, единичная доза антагониста VEGF может быть дана в день vPDT.

vPDT предпочтительно вводят только один раз, но может быть повторено по мере необходимости. В основном, vPDT дают не чаще, чем каждые 3 месяца. vPDT можно повторять каждые 3 месяца. В качестве альтернативы, vPDT можно повторять менее часто, в частности, если лечение антагонистом VEGF продолжают после vPDT. Обычно, vPDT вводят на основе «по мере необходимости». В идеале, продолженное лечение антагонистом VEGF после vPDT предотвращает рецидив CNV.

vPDT применяют в виде монотерапии или в комбинации с противовоспалительным агентом у детей и для улучшения остроты зрения обычно требуется только одна сессия. Однако в ряде случаев сообщалось о явно выраженных изменениях пигментного эпителия сетчатки. В одном варианте осуществления vPDT является менее предпочтительным в качестве части комбинированной терапии антагонистом VEGF для лечения CNV у детей. Комбинация vPDT с триамцинолоном может приводить к повышенному внутриглазному давлению. Вследствие этого, комбинации терапии VEGF с vPDT и триамцинолоном следовало бы избежать.

В дополнительном аспекте изобретения время лечения и соблюдение больным лечебного режима улучшаются за счет применения антагониста VEGF в комбинации с противовоспалительным агентом. Введение антагониста VEGF в комбинации с противовоспалительным агентом может иметь синергетические эффекты в зависимости от основной причины CNV. Добавление противовоспалительного агента является особенно перспективным при CNV на фоне воспалительного заболевания или патологического состояния. Противовоспалительные агенты включают стероиды и НПВС. НПВС, применяемые в лечении болезней глаз, включают кетолорак, непафенак и диклофенак. В некоторых случаях применение диклофенака является предпочтительным. Кортикостероиды, применяемые в лечении болезней глаз, включают дексаметазон, преднизолон, флуорометолон и флюоцинолон. Другие стероиды или их производные, которые можно применять в комбинации с лечением антагонистом VEGF, включают анекортав, который обладает ангиостатическим действием, но действует посредством иного механизма, чем антагонисты VEGF согласно изобретению. Предпочтительным противовоспалительным агентом является триамцинолон. Противовоспалительный агент также может представлять собой антагонист TNF-α. Например, антитело TNF-α может быть введено в комбинации с не антителом-антагонистом VEGF. Антитела TNF-α, например, те, что продаются под торговыми наименованиями Humira®, Remicade®, Simponi® и Cimzia®, являются хорошо известными в данной области. В качестве альтернативы, в комбинации с антагонистом VEGF может быть введен не антитело-антагонист TNF-α, такой как Enbrel®.

Одновременно с антагонистом VEGF может быть введен противовоспалительный агент. Противовоспалительный агент можно вводить либо системно, либо локально. Например, противовоспалительный агент может быть введен перорально, местно либо, предпочтительно, интравитреально. В конкретном варианте осуществления триамцинолон вводят интравитреально одновременно с антагонистом VEGF изобретения.

В другом аспекте изобретения антагонист VEGF вводят после введения антимикробного агента. Например, антимикробный агент может быть выбран из гатифлоксацина, ципрофлоксацина, офлоксацина, норфлоксацина, полимиксина B + хлорамфеникол, хлорамфеникола, гентамицина, флуконазола, сульфацетамида, тобрамицина, неомицина + полмиксина B и нетилмицина. В качестве альтернативы антимикробный агент может быть выбран из пириметамина, сульфадиазина и фолиновой кислоты или их комбинации. Комбинация с пириметамином может быть особенно перспективной в лечении пациента CNV, ассоциированной с токсоплазмозом.

Общее

Термин «включающий» охватывает «содержащий», а также «состоящий», например, композиция, «включающая» X, может состоять исключительно из X или может включать что-либо дополнительно, например, X+Y.

Термин «приблизительно» в отношении к числовому значению x является произвольным и обозначает, например, x+10%.

ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг.1: Прогнозируемые соотношения воздействия максимальной концентрации (Cmax) ранибизумаба в сыворотке у детей, получающих разовые билатеральные интравитреальные дозы ранибизумаба, составляющие 0,1-0,5 мг относительно ссылки in vitro IC50=11 нг/мл. Прогнозируемые диапазоны воздействия представляют неопределенность в модельных предположениях.

Фиг.2: Прогнозируемые соотношения воздействия для площади под фармакокинетической кривой (AUC) ранибизумаба в сыворотке (черное) и стекловидном теле (серое) детей, получающих разовые билатеральные интравитреальные дозы ранибизумаба, составляющие 0,1-0,5 мг относительно ссылки AUC ранибизумаба в сыворотке взрослых, получающих разовую одностороннюю интравитреальную дозу ранибизумаба, составляющую 0,5 мг. Прогнозируемые диапазоны воздействия представляют неопределенность в модельных предположениях.

СПОСОБЫ ОСУЩЕСТВЛЕНИЯ ИЗОБРЕТЕНИЯ

Сравнительный пример 1

13-летний мальчик, обратившийся с «мушками» в 4-недельном анамнезе в его правом глазу, связанным с 5 днем нечеткого зрения в анамнезе. Острота зрения была подсчитана пальцами. Исследование глаза показало легкую реакцию передней камеры и витреит. Исследование дна показало бледную зону нижневисочного хориоретинита к диску с окружающей серьезной элевацией, затрагивающей центральную ямку и перипапиллярную область. Исследование левого глаза было нормальным. Дополнительное исследование выявило, что 4 неделями ранее пациент играл со своей домашней собакой перед тем, как поел сладостей, не помыв руки. Был установлен диагноз токсокарозный хориоретинит. Пациента лечили 60 мг преднизолона. Зрение сначала улучшилось до 0,0 (LogMAR). Однако, после постепенного снижения дозы, зрение ухудшилось до 0,5. Исследование дна показало юкстафовеальное субретинальное кровоизлияние. CNV диагностировали с помощью флюоресцентной ангиографии.

Пациенту вводили интравитреальную инъекцию ранибизумаба. За 1 месяц его зрение улучшилось до 0,0. Остающуюся небольшую зону истечения наблюдали во время последующего посещения. После двух дополнительных инъекций с интервалом в 1 месяц с помощью флюоресцентной ангиографии и окулярной когерентной томографии не наблюдалось дополнительного истечения из мембраны и рассасывания субретинальной жидкости. Острота зрения пациента оставалась стабильной на -0,2 за 12 месяцев наблюдения.

Сравнительный пример 2

Данную нерандомизированную, ретроспективную серию случаев разработали для исследования долговременной безопасности и эффективности интравитреального бевацизумаба (IVB) вне зарегистрированных показаний при лечении педиатрических заболеваний сетчатки и сосудистой оболочки, не являющихся ретинопатией недоношенных (ROP). В исследование включили пациентов в возрасте младше 18 лет, лечившихся IVB между 1 января 2005 года и 1 января 2013 года. Критерии исключения включали наблюдение менее чем 6 месяцев, ROP в анамнезе и глаза, демонстрирующие светочувствительность или плохое зрение.

Из ста четырех глаз, пролеченных IVB по поводу педиатрических заболеваний сетчатки и сосудистой оболочки, 81 глаз 77 пациентов был включен в настоящее исследование. Средний возраст составил 9,1 лет (диапазон от 8 месяцев до 17 лет) и 45/77 (58%) пациентов были мужского пола. Пациенты получали среднее количество инъекций, составляющее 4,1 (диапазон 1-17), и средняя продолжительность наблюдения составила 788 дней. Первичные диагнозы пациентов, лечившихся IVB, включали ретинит Коутса (n=30), хориоидальную неоваскулярную мембрану (n=27), семейную эксудативную форму витреоретинопатии (FEVR, n=13), кистозный отек желтого пятна (n=5) и другие (n=6). Средний эквивалент Снеллена остроты зрения на момент первичного осмотра составил 20/228 и улучшился до 20/123 на 6 месяце (p=0,017) и до 20/108 на 12 месяце наблюдения (p=0,002). Средняя толщина сетчатки в области центральной ямки улучшилась от 439 микрон на момент первичного осмотра до 351 микрон на 6 месяце (p=0,005) и 340 микрон на 12 месяце (p<0,001). Статистически значимое улучшение остроты зрения на 12 месяц наблюдали у пациентов с хориоидальной неоваскулярной мембраной (p=0,013), но улучшение остроты зрения не достигало статистического уровня значимости при кистозном отеке желтого пятна (p=0,06), ретините Коутса (p=0,14) или FEVR (p=0,54). Единственным системным побочным эффектом, идентифицированным в настоящем исследовании, было развитие идиопатической внутричерепной гипертензии у 16-летней страдающей ожирением женщины с FEVR. Глазные побочные эффекты включали повышение внутриглазного давления (IOP>30), требующее местно применяемой терапии в 8 глазах 7 пациентов, из которых 5 глаз были на сопутствующей локальной или местной терапии кортикостероидами. Ухудшение тракционной отслойки сетчатки наблюдали в 2 глазах с FEVR.

Пациенты, получающие IVB для лечения педиатрических заболеваний сетчатки и сосудистой оболочки, не являющихся (ROP), испытывали значительное улучшение остроты зрения и редукцию толщины сетчатки в области центральной ямки. IVB хорошо переносился с минимальными побочными действиями, отмеченными при наблюдении в среднем 788 дней.

Пример 1

Фармакокинетическая модель для прогнозирования внутриглазного и системного действия интравитреально вводимого ранибизумаба у детей

Чтобы смоделировать внутриглазное и системное действие ранибизумаба у детей, на основании опубликованных данных было установлено два ключевых взаимоотношения:

1. Связь между возрастом ребенка и глубиной стекловидной камеры и плотностью стекловидного геля, чтобы спрогнозировать скорость глазного клиренса и концентрацию в стекловидном теле;

2. Связь между возрастом и массой тела ребенка и ФК параметрами системного распределения (аллометрического измерения масштабов), чтобы спрогнозировать системную концентрацию.

Концентрацию в стекловидном теле ранибизумаба вычисляли, используя объем стекловидного тела. Его вычисляли как объем части сферы, высота которой равна глубине стекловидной камеры (VCD) и диаметр которой равен осевой длине глаза (AL) глаза. VCD детей и взрослых коррелировала с возрастом при использовании кусочно-линейной регрессионной модели и опубликованных данных для детей в возрасте до 3 лет (Fledelius & Christensen (1996) Br J Ophthalmol 80(10):918-921); более старших детей (Twelker et al. (2009) Optom Vis Sci 86(8):918-935); и взрослых (Neelam et al. (2006) Vision Res 46(13):2149-2156). AL глаза в каждой возрастной группе вычисляли, применяя аспектное отношение, равное отношению средней AL и значений VCD, полученных из публикаций, приведенных выше.

Скорость глазного клиренса ранибизумаба в человеческом глазу вычисляли, применяя одномерную модель диффузии и конвекции в пористых средах (Zhao & Nehorai (2006) IEEE Trans Signal Process 54(6):2213-2225; Dechadilok & Deen (2006) Ind Eng Chem Res 45(21):6953-6959). В данной модели глаз представлен в виде цилиндра, ось симметрии которого совпадает с передне-задней осью глаза. Передняя сторона цилиндра представляет собой гиалиновую мембрану, граничащую с передней камерой, а задняя сторона цилиндра представляет собой сетчатку. Длина цилиндра равна VCD. В дополнение к VCD, скорость глазного клиренса в данной модели определяют посредством плотности стекловидного геля. Взаимоотношение между плотностью стекловидного тела и скоростью глазного клиренса установили, используя опубликованные данные (Tan et al. (2011) Invest Ophthalmol Vis Sci, 52(2):1111-1118). Связь между возрастом и плотностью стекловидного тела основывалась на опубликованной информации (Oyster (1999) The Human Eye, Sinauer Associates Incorporated, pp. 530-544). Модель дополнительно калибровали для соответствия глазной кинетики, установленной у взрослых для интравитреально вводимого ранибизумаба (ФК популяционная модель Novartis ранибизумаба).

Системное распределение ранибизумаба было описано с применением популяционной фармакокинетической модели (ФК популяционная модель Novartis ранибизумаба). Взаимосвязь между массой тела и системным клиренсом смоделировали, применяя стандартные принципы аллометрического измерения масштабов (Anderson, & Holford (2008) Annu Rev Pharmacol Toxicol 48(1):303-332). Массу тела детей и взрослых вычисляли, применяя установленные взаимосвязи между возрастом и параметрами распределения массы тела (Portier et al (2007) Risk Anal 27(1):11-26).

Модельные расчеты были выполнены для обычных пациентов и предоставлен ожидаемый средний срок воздействия. Были смоделированы типичные дети в возрасте 2, 5, 12 или 18 лет. Был смоделирован типичный взрослый в возрасте 70 лет.

Воздействие моделировали для диапазона тех ключевых модельных параметров, которые, как ожидается, оказывают наибольшее влияние на предполагаемое воздействие. Экспонены взаимосвязей аллометрического измерения масштабов между системным клиренсом и объемом распрделения и массой тела варьировали между 0,37-0,75 (клиренс) и 0,41-1 (объем). Была зафиксирована теоретически бόльшая проницаемость незрелых оболочек глаза у детей младшего возраста вследствие увеличенной скорости глазного клиренса на 50% относительно значения у взрослого.

Пример 2

Определение дозы ранибизумаба для лечения детей с хориоретинальными неоваскулярными нарушениями и нарушениями проницаемости

Применяя фармакокинетическую модель, описанную в Примере 1, прогнозируемое глазное и системное действие у детей, получающих интравитреально вводимый ранибизумаб, сравнивали с воздействием у взрослых вслед за интравитреальной инъекцией 0,5 мг ранибизумаба, поскольку известны профили эффективности и безопасности у взрослых при данном уровне дозы и способе введения.

Соотношения воздействия для ранибизумаба вычисляли для трех различных параметров: (i) максимальная концентрация (Cmax) в сыворотке, которая предоставляет критерий острой токсичности, (ii) площадь под фармакокинетической кривой (AUC) в сыворотке, которая предоставляет критерий потенциальной долгосрочной токсичности, связанной с продолжительным ингибированием системного VEGF, и (iii) AUC в стекловидном теле, которая предоставляет критерий эффективности, связанной с продолжительным ингибированием VEGF в глазу.

Соотношение прогнозируемого воздействия у детей к воздействию у взрослых представляет критерий вероятности глазной и системной токсичности и может применяться для определения соотношения между относительной пользой и риском периатрических доз. Считается, что дозы с соотношением системного воздействия, составляющим менее 1, обладают приемлемым профилем безопасности. Концентрация в сыворотке также должна быть менее чем IC50 для ранибизумаба in vitro, который находится в диапазоне 11-27 нг/мл. Считается, что дозы с соотношением воздействия в стекловидном теле, близким к 1, обладают приемлемым профилем эффективности.

Было определено, что соотношение воздействия Cmax в сыворотке относительно IC50 in vitro составляет менее 1 при всех дозах интравитреально вводимого ранибизумаба во всех возрастных группах (см. Фиг.1). При выборе конкретных доз для введения детям, возможность недостаточного воздействия относительно справочного воздействия на стекловидное тело у взрослого (пониженная эффективность) необходимо сбалансировать повышенным воздействием в сыворотке (повышенный риск). Адаптированные к возрасту дозы, составляющие 0,2 мг для детей в возрасте 2-4 лет, 0,3 мг детей в возрасте 5-11 лет и 0,5 мг детей в возрасте 12-17 лет, достигают одинакового чрезмерного воздействия в сыворотке (соотношения AUC >1) и одинакового недостаточного воздействия в стекловидном теле (соотношения AUC <1) при использовании модели, описанной в Примере 1 (см. Фиг. 2). Это предполагает, что данные дозы могут иметь допустимый профиль пользы и риска, исходя из клинической интерпретации соотношений прогнозируемого воздействия.

Корректировку дозы антагонистов VEGF, не являющихся ранибизумабом, для лечения детей можно определить, применяя данные о прогнозируемом глазном и системном действии ранибизумаба, описанном в данном документе.

Пример 3

Сорок пять глаз тридцати трех педиатрических пациентов с хориоидальной неоваскуляризацией (CNV) лечили интравитреальной инъекцией антиангиогенных агентов (1,25 мг/0,05 мл бевацизумаба [40 глаз] или 0,5 мг/0,05 мл ранибизумаба [5 глаз]). Хориоидальную неоваскуляризацию вследствие различных причин клинически диагностировали и подтвердили визуализирующими методами исследования.

Было 24 лица женского пола и 15 лиц мужского пола со средним возрастным групповым показателем 13 лет (диапазон 3-17 лет). Средний период наблюдения составил 12,8 месяца (диапазон 3-60 месяцев). Этиология CNV включала идиопатическую, увеитную, миопическую CNV и CNV, ассоциированную с различными макулярными дистрофиями. Медиана logMAR остроты зрения на момент первичного осмотра и последнего наблюдения составила 0,87 (эквивалент Снеллена 20/150) и 0,7 (эквивалент Снеллена 20/100), что соответственно было статистически значимым (p=0,0003). Среднее и медианное число инъекций, полученное в течение периода наблюдения, составило 2,2 и 1, соответственно. При последнем наблюдении у 22 глаз данной группы (48%) прибавилось более 3 зрительных осей, и 27 глаз (60%) имели итоговую остроту зрения 20/50 или лучше. Девять глаз (20%) не улучшились и имели серьезную потерю зрения (20/200 или хуже).

Интравитреальная антиангиогенная терапия CNV у педиатрических пациентов выглядит временно безопасной и эффективной у большинства пораженных глаз.

Пример 5

13-летняя девочка обратилась со сниженной остротой зрения ее левого глаза и друзами зрительного нерва, подтвержденными ультрасонографическим исследованием в В-режиме в обоих глазах. Флюоресцентная ангиография и оптическая когерентная томография выявили наличие хориоидальной неоваскуляризации в левом глазу. Ее наилучшая корригированная острота зрения составила 20/50 в левом глазу и 20/25 в правом глазу. Она демонстрировала гиперметропию +8,5 Dsph и астигматизм обеих глаз +0,5 Dcyl.

Пациента лечили единичной инъекцией ранибизумаба (под общей анестезией) и контролировали посредством клинического обследования, оптической когерентной томографии и флюоресцентной ангиографии.

Через один месяц после инъекции острота зрения улучшилась от 20/50 до 20/25, толщина сетчатки в области центральной ямки уменьшилась, и суб- и интраретинальная жидкость частично резорбировалась, что было подтверждено с помощью OCT. Через два месяца после инъекции острота зрения улучшилась до 20/20. Офтальмоскопия и OCT показали полное рассасывание субретинальной жидкости и отека желтого пятна. Фиброзная ткань, расположенная между диском зрительного нерва и желтым пятном, визуализировалась при флюоресцентной ангиографии без признаков активности и рецидива CNV. Через 30 месяцев после инъекции зрение пациента остается стабильным при 20/20, и внешний вид желтого пятна остается неизменным без повторного появления субретинальной жидкости.

Друзы зрительного нерва должны быть приняты во внимание и тщательно наблюдаться как возможная причина перипапиллярной хориоидальной неоваскуляризации у детей. Ранибизумаб может быть успешным в лечении вне зарегистрированных показаний детей, страдающих хориоидальной неоваскуляризацией, ассоциированной с друзами зрительного нерва.

Пример 6

Два случая идиопатической хориоидальной неоваскуляризации (CNV) у педиатрических пациентов были пролечены интравитреальными инъекциями ранибизумаба (IVR).

Случай 1

Девятилетняя девочка была направлена для оценки снижения зрения в левом глазу в течение нескольких месяцев. Наилучшая корригированная острота зрения (BCVA) составляла 20/20 (OD) и 20/100 (OS). Медицинский и офтальмологический анамнезы были без особенностей, и внутриглазное давление (IOP) составляло 15 мм рт. ст. с двух сторон. Осмотр глаз с помощью щелевой лампы был в пределах границ нормы. Исследование глазного дна OD было без особенностей. Глазное дно слева показало элевацию желтого пятна с подозрением на субфовеальное кровоизлияние. FAG продемонстрировала относительно четко определяемую зону гиперфлюоресценции, соответствующую хориоидальной неоваскулярной мембране (CNVM) с поздней утечкой красителя, включая хориоретинальный анастомоз, который вовлекается при поздней стадии классической CNVM. OCT выявило субфовеальное CNVM с высокой отражаемостью, а также отслойку нейросенсорного слоя сетчатки, указывающую на классическую CNVM.

Под местной анестезией ранибизумаб (0,05 cc-0,5 мг/0,05 мл) вводили с помощью инъекции надвисочно на 3,5 мм кзади от лимба. Через месяц после IVR истечение уменьшилось, хотя и подозревали минимальную утечку во время поздней фазы FAG. Через месяц после второй инъекции OCT выявила редукцию субретинальной жидкости. Через два месяца после второй IVR BCVA улучшилось до 20/30, и при FAG CNVM окрашивалась без истечения. Через 14 месяцев после второй IVR острота зрения и повреждение были стабилизированы без каких-либо признаков прогрессирования или побочных эффектов. Серологические тесты IgG к вирусу краснухи и IgG к вирусу herpes simplex были положительными; все другие серологические тесты были отрицательными, но положительные серологические результаты не были связаны с CNV у пациента.

Случай 2

10-летняя девочка обратилась с нечетким зрением в ее правом глазу в течение одного месяца в анамнезе. BCVA составил 20/50 (OD) и 20/20 (OS). Медицинский и офтальмологический анамнезы были без особенностей. Осмотр глаза с помощью щелевой лампы и IOP были в пределах границ нормы. При фундоскопии при расширенном зрачке OS был нормальной; однако, в OD имелись четко определяемые желтые субретинальные экссудаты с ретинальным кровоизлиянием и субретинальной жидкостью, указывающие на классическую CNV, и в последующем подтвержденную с помощью OCT и FAG. Десятилетняя девочка обратилась с пониженной остротой зрения (20/50) в правом глазу. OCT и FAG продемонстрировали классическую CNV. После одной IVR острота зрения улучшилась до 20/40, а толщина сетчатки в области центральной ямки уменьшилась. Во время наблюдения исследовали остроту зрения, FAG, ICG, OCT, серологические тесты и возникновение глазных или системных побочных эффектов.

Под местной анестезией ранибизумаб (0,05 cc-0,5 мг/0,05 мл) вводили с помощью инъекции надвисочно на 3,5 мм кзади от лимба. Через два месяца после первой IVR FAG выявила, что повреждение окрашивалось красителем без истечения, и BCVA улучшилось до 20/40 с уменьшением толщины желтого пятна. В течение 12 месяцев наблюдения BCVA стабилизировалась, и не было зарегистрировано серьезных глазных или системных побочных эффектов. Серологические тесты на IgG к вирусу краснухи, IgG к токсоплазме и IgG к вирусу herpes simplex были положительными; другие серологические тесты, включая IgM к токсоплазме, были все отрицательными. Однако, положительные серологические результаты не были связаны с CNV у пациента.

Заключения

Во время 14 и 12 месяцев наблюдения для случаев 1 и 2, соответственно, очевидного рецидива или побочных эффектов отмечено не было. Настоящие случаи предполагают, IVR может быть эфффективным у детей с идиопатической CNV.

Пример 7

13-летняя девочка поступила с жалобами на сниженную остроту зрения в ее правом глазу (RE) в течение 6 недель. Наилучшая корригированная острота зрения (BCVA) составляла 20/80 в правом глазу и 20/20 в левом глазу (LE). Медицинский и офтальмологический анамнезы были без особенностей. Исследование переднего сегмента глаза и измерение внутриглазного давления были нормальными в обоих глазах. Исследование глазного дна при расширенном зрачке выявило элевацию дисков зрительного нерва с нечеткими границами в обоих глазах. В дополнение, в правом глазу наблюдали возвышающийся желтый очаг, простирающийся от диска зрительного нерва к желтому пятну. В обоих глазах аутофлуоресцентное изображение глазного дна продемонстрировало яркую узелковую аутофлуоресценцию, соответствующую друзам диска зрительного нерва (ONHD) на поверхности диска зрительного нерва. В правом глазу центральная зона относительной гипоаутофлуоресценции, окруженная выраженной гипоаутофлуоресценцией вследствие CNV и/или субретинальной жидкости/фибринозного экссудата, располагалось на височной стороне диска зрительного нерва. В правом глазу изображение, полученное в позднюю фазу флюоресцентной ангиографии, продемонстрировало центральную зону гиперфлюоресценции, соответствующую CNV, окруженную блокированной флюоресценцией от субретинальной жидкости/фибринозного экссудата. В обоих глазах изображение, полученное при спектральной оптической когерентной томографии (SD-OCT), показало неправильные выпячивания на протяжении всей площади диска зрительного нерва. В правом глазу изображение, полученное при двухмерном SD-OCT желтого пятна, показало юкстапапиллярную CNV с высокой отражаемостью и субретинальную жидкость, простирающуюся от диска зрительного нерва к желтому пятну.

Тогда под общей анестезией была дана интравитреальная инъекция 0,5 мг/0,05 мл ранибизумаба. Через один месяц после инъекции BCVA повысилась до 20/25. Серия изображений, полученных при SD-OCT на 1, 3 и 9 месяце, не показала субретинальной жидкости. BCVA сохранялась на том же уровне (20/25), и осложнений, связанных с инъекцией, не наблюдалось.

Пример 8

Пациенты мужского и женского пола 12 лет и старше были задействованы в 12-месячном, рандомизированном, двойном слепом, плацебо-контролируемом, мультицентровом исследовании, оценивающем эффективность и безопасность интравитреальных инъекций 0,5 мг ранибизумаба у пациентов с нарушением зрения вследствие VEGF-зависимого отека желтого пятна.

В исследование были включены пациенты, которым был установлен диагноз активного ME вследствие любых причин (для взрослых пациентов: кроме DME и RVO). Пациенты ранее лечения не получали (ранее не получали любое медикаментозное лечение/ исследуемое лечение поражения ME). BCVA должно быть между ≥24 и ≤83 знаков, проверяемое с 4 метров начального расстояния с применением таблиц для исследования остроты зрения ETDRS. Потеря зрения должна быть только вследствие наличия ME любых подходящих типов, исходя из глазных клинических данных, а также данных FA и OCT.

Из исследования исключены женщины, способные к деторождению, определенные как все женщины, физиологически способные к зачатию, только если они не применяли эффективные способы контрацепции во время получения доз исследуемого лечения. Дополнительно были исключены пациенты, которые (i) в анамнезе имеют злокачественное образование любой системы оганов в пределах последних 5 лет; (ii) в анамнезе имеют инсульт менее чем за 6 месяцев до скрининга; (iii) имеют активное системное воспаление или инфекцию, непосредственно связанное с заболеванием, являющимся причиной ME при скрининге; (iv) имеют активную диабетическую ретинопатию, активные глазные/окологлазные инфекционные заболевания или антивное внутриглазное воспаление при скрининге; (v) имеют подтвержденное внутриглазное давление (IOP) ≥25 мм рт. ст. вследствие любой причины при скрининге; (vi) имеют неоваскуляризацию радужной оболочки или неоваскулярную глаукому при скрининге; (vii) имеют ME на фоне DME или RVO (только для взрослых пациентов); (viii) применяют любые системные анти-VEGF лекарственные препараты в пределах 6 месяцев перед началом исследования; (ix) в анамнезе имеют фокальную/секторальную лазерную фотокоагуляцию с вовлечением области желтого пятна, применяемую для лечения ME в какое-либо время; (x) в анамнезе имеют внутриглазное лечение любыми антиангиогенными лекарственными препаратами (включая любые анти-VEGF агенты) или фотодинамическую терапию с вертепорфином (vPDT) в какое-либо время; (xi) в анамнезе имеют интравитреальное лечение кортикостероидами в какое-либо время; (xii) в анамнезе имеют витреоретинальные хирургические вмешательства в какое-либо время.

Пациентов рандомизировали на две группы лечения:

(1) Пациенты в контрольной группе плацебо не получают никакого активного лекарственного средства. Флакон с плацебо не содержит активного лекарственного средства (пустой стерильный флакон). Инъекция плацебо является имитацией интравитреальной инъекции с использованием инъекционного шприца без касающейся глаза иглы. Плацебо вводит пациенту исследователь открытого лечения, в месте проведения исследования, на основании решения о лечении, принятом исследователем слепой оценки. Инъекцию плацебо делают в начале исследования, с последующей индивидуальной схемой лечения на основании признаков активности заболевания, оцениваемых при каждом индивидуальном посещении по суждению и оценке исследователя. На 2 месяц всех взрослых пациентов, рандомизированных в группу плацебо, будут переводить на немаскированное лечение ранибизумабом, при котором индивидуальное лечение продолжается, на основании показаний активности заболевания.

(2) Пациенты в группе лечения ранибизумабом получают интравитреальные инъекции ранибизумаба, вводимого исследователем открытого лечения, в месте проведения исследования, на основании решения о лечении, принятом исследователем слепой оценки. В качестве лечения исследования предоставляют интравитреальную инъекцию ранибизумаба 0,5 мг/0,5 мл (флакон ранибизумаба для интравитреальной инъекции в концентрации, составляющей 10 мг/мл, соответствующей уровню дозы 0,5 мг). Интравитреальную инъекцию ранибизумаба 0,5 мг делали в исследуемый глаз в начале исследования с последующим дополнительным введением ранибизумаба по мере необходимости при посещениях для изучения отдаленных результатов, на основании показаний активности заболевания, оцениваемых при каждом индивидуальном визите и по суждению клинического исследователя.

Основным конечным показателем исследования будет оценка изменения в исследуемом глазу наилучшей корригированной остроты зрения (BCVA) от исходного уровня ко 2 месяцу. Дополнительными критериями результата являются (i) изменение BCVA в исследуемом глазу от исходного уровня по визитам вплоть до 2 месяца (ранибизумаб по сравнению с лечением плацебо); (ii) изменение в исследуемом глазу толщины центральной подобласти (CSFT) и объема центральной подобласти (CSFV) от исходного уровня с течением времени ко 2 месяцу (оценивали посредством оптической когерентной томографии (OCT)); (iii) наличие интра-/субретинальной жидкости в исследуемом глазу на 2 месяц (оценивали посредством изображений OCT); (iv) наличие активного ME истечения, оцениваемого посредством флюоресцентной ангиографии (FA) на 2 месяц (оценивали посредством фотографического изображения); (v) необходимость в неотложном лечении в 1 месяц; (vi) изменение средней BCVA в исследуемом глазу от исходного уровня с 1 месяца по 12 месяц (оценивали на исходном уровне, в 1 месяц, на 6 месяц, на 12 месяц; все ежемесячные показатели BCVA сравнивали с BCVA на исходном уровне); (vii) изменение в исследуемом глазу CSFT и CSFV от исходного уровня при визите (оценивали посредством OCT на исходном уровне, в 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 месяц); (viii) наличие интра-/субретинальной жидкости в исследуемом глазу на 2 месяц, 6 месяц и 12 месяц по сравнению с исходным уровнем (оценивали посредством OCT); (ix) наличие активного ME истечения в исследуемом глазу на 2 месяц, месяц 6, и месяц 12 по сравнению с исходным уровнем (оценивали посредством OCT); (x) наличие активного ME истечения в исследуемом глазу на 2 месяц, 6 месяц и 12 месяц по сравнению с исходным уровнем (оценивали посредством фотографических изображений (т.е. флюоресцентной ангиографии)); (xi) доля пациентов с приростом ≥1, ≥5, ≥ 0 и ≥15 знаков или достижение 84 знаков на 2 месяц, 6 месяц и 12 месяц (данный критерий результата отображает долю различных уровней прироста BCVA); (xii) доля пациентов с потерей >1, >5, >10 и >15 знаков на 2 месяц, 6 месяц и 12 месяц (данный критерий результата отображает долю различных уровней потери BCVA); (xiii) количество лечений ранибизумабом и повторных лечений исследуемого глаза во 2 месяц, 6 месяц, 12 месяц (общее количество инъекций и количество инъекций, сделанных в исследуемый глаз при визите); (xiv) тип, частота и тяжесть глазных и неглазных побочных эффектов в исследуемом глазу ко 2 месяцу, вплоть до 6 месяца и вплоть до 12 месяца.

Пример 9

Пациенты мужского и женского рода, 12 лет и старше, включены в 12-месячное, рандомизированное, двойное слепое, плацебо-контролируемое, мультицентровое исследование, оценивающее эффективность и безопасность интравитреальных инъекций 0,5 мг ранибизумаба у пациентов с нарушением зрения вследствие VEGF-зависимой хориоидальной неоваскуляризации.

В исследование включены пациенты, которым установлен диагноз активного CNV вследствие любых причин, за исключением wAMD и PM у взрослых. В исследуемом глазу присутствовали все типы поражений CNV. Пациенты ранее лечения не получали (не получали ранее любое медикаментозное лечение/исследуемое лечение поражения ME). BCVA должно быть между ≥24 и ≤83 знаков, проверяемое с 4 метров начального расстояния с применением таблиц для исследования остроты зрения ETDRS. Потеря зрения должна быть только вследствие наличия ME любых подходящих типов, исходя из глазных клинических данных, а также данных FA.

Из исследования исключены женщины, способные к деторождению, определенные как все женщины, физиологически способные к зачатию, только если они не применяли эффективные способы контрацепции во время получения доз исследуемого лечения. Дополнительно были исключены пациенты, которые (i) в анамнезе имели злокачественное образование любой системы оганов в пределах последних 5 лет; (ii) в анамнезе имели инсульт менее чем за 6 месяцев до скрининга; (iii) имели активное системное воспаление или инфекцию, непосредственно связанное с заболеванием, являющимся причиной ME при скрининге; (iv) имеют активную диабетическую ретинопатию, активные глазные/окологлазные инфекционные заболевания или антивное внутриглазное воспаление воспаление при скрининге; (v) имеют подтвержденное внутриглазное давление (IOP) ≥25 мм рт. ст. вследствие любой причины при скрининге; (vi) имеют неоваскуляризацию радужной оболочки или неоваскулярную глаукому при скрининге; (vii) имеют CNV на фоне PM или wAMD; (viii) применяют любые системные анти-VEGF лекарственные препараты в пределах 6 месяцев перед началом исследования; (ix) в анамнезе имеют фокальную/секторальную лазерную фотокоагуляцию с вовлечением области желтого пятна, применяемую для лечения ME в какое-либо время; (x) в анамнезе имеют внутриглазное лечение любыми антиангиогенными лекарственными препаратами (включая любые анти-VEGF агенты) или фотодинамическую терапию с вертепорфином (vPDT) в какое-либо время; (xi) в анамнезе имеют интравитреальное лечение кортикостероидами в какое-либо время; (xii) в анамнезе имеют витреоретинальные хирургические вмешательства в какое-либо время. Дополнительно можут использоваться другие обусловленные протоколом критерии включения / исключения.

Пациентов рандомизировали на две группы лечения:

(1) Пациенты в контрольной группе плацебо не получают никакого активного лекарственного средства. Флакон с плацебо не содержит активного лекарственного средства (пустой стерильный флакон). Инъекция плацебо является имитацией интравитреальной инъекции с использованием инъекционного шприца без касающейся глаза иглы. Плацебо вводит пациенту исследователь открытого лечения, в месте проведения исследования, на основании решения о лечении, принятом исследователем слепой оценки. Инъекцию плацебо делают в начале исследования, с последующей индивидуальной схемой лечения на основании признаков активности заболевания, оцениваемых при каждом индивидуальном посещении по суждению и оценке исследователя. На 2 месяц всех взрослых пациентов, рандомизированных в группу плацебо, будут переводить на немаскированное лечение ранибизумабом, при котором индивидуальное лечение продолжается, на основании показаний активности заболевания.

(2) Пациенты в группе лечения ранибизумабом получают интравитреальные инъекции ранибизумаба, вводимого исследователем открытого лечения, в месте проведения исследования, на основании решения о лечении, принятом исследователем слепой оценки. В качестве лечения исследования предоставляют интравитреальную инъекцию ранибизумаба 0,5 мг/0,5 мл (флакон ранибизумаба для интравитреальной инъекции в концентрации, составляющей 10 мг/мл, соответствующей уровню дозы 0,5 мг). Интравитреальную инъекцию ранибизумаба 0,5 мг делали в исследуемый глаз в начале исследования с последующим дополнительным введением ранибизумаба по мере необходимости при посещениях для изучения отдаленных результатов, на основании показаний активности заболевания, оцениваемых при каждом индивидуальном визите и по суждению клинического исследователя.

Основным конечным показателем исследования будет оценка изменения в исследуемом глазу наилучшей корригированной остроты зрения (BCVA) от исходного уровня ко 2 месяцу. Дополнительными критериями результата являются (i) изменение BCVA в исследуемом глазу от исходного уровня по визитам вплоть до 2 месяца (ранибизумаб по сравнению с лечением плацебо); (ii) изменение в исследуемом глазу толщины центральной подобласти (CSFT) и объема центральной подобласти (CSFV) от исходного уровня с течением времени ко 2 месяцу (оцениваемой посредством оптической когерентной томографии (OCT)); (iii) наличие интра-/субретинальной жидкости в исследуемом глазу на 2 месяц (оцениваемой посредством изображений OCT); (iv) (iv) наличие активного ME истечения, оцениваемого посредством флюоресцентной ангиографии (FA) на 2 месяц (оцениваемой посредством фотографического изображения); (v) изменение средней BCVA в исследуемом глазу от исходного уровня с 1 месяца по 12 месяц (оцениваемой на исходном уровне, в 1 месяц, на 6 месяц, на 12 месяц; все ежемесячные показатели BCVA сравнивали с BCVA на исходном уровне); (vi) изменение от исходного уровня CSFT и CSFV в исследуемом глазу при визите (оцениваемой посредством OCT на исходном уровне, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 месяц); (vii) наличие интра-/субретинальной жидкости в исследуемом глазу на 2 месяц, 6 месяц, и 12 месяц по сравнению с исходным уровнем (оцениваемой посредством OCT); (viii) наличие активного хориоретинального истечения в исследуемом глазу на 2 месяц, 6 месяц и 12 месяц по сравнению с исходным уровнем (оцениваемой посредством FA); (ix) доля пациентов с приростом ≥1, ≥5, ≥10 и ≥15 знаков или достижение 84 знаков на 2 месяц, 6 месяц и 12 месяц (данный критерий результата отображает долю различных уровней прироста BCVA); (x) доля пациентов с потерей >1, >5, >10 и >15 знаков на 2 месяц, 6 месяц и 12 месяц (данный критерий результата отображает долю различных уровней потери BCVA); (xi) количество лечения ранибизумабом и повторного лечения исследуемого глаза во 2 месяц, 6 месяц, 12 месяц (общее количество инъекций и количество инъекций, сделанных в исследуемый глаз при визите); (xii) тип, частота и тяжесть глазных и внеглазных побочных эффектов в исследуемом глазу ко 2 месяцу, вплоть до 6 месяца и вплоть до 12 месяца; (xiii) необходимость в неотложном лечении в 1 месяц.

Должно быть понятно, что изобретение было описано только в качестве примера, и изменения могут быть сделаны, оставаясь при этом в пределах объема правовых притязаний и сущности изобретения.

1. Применение ранибизумаба для лечения ребенка, имеющего хориоретинальное неоваскулярное нарушение или нарушение проницаемости, включающее введение в глаз указанного ребенка ранибизумаба в дозе 0,2 мг для детей в возрасте 2-4 лет и в дозе 0,3 мг для детей в возрасте 5-11 лет.

2. Применение по п.1, включающее введение первой дозы ранибизумаба, при этом вторую дозу ранибизумаба вводят по мере необходимости, но по меньшей мере через 4 недели после первой инъекции.

3. Применение по п.1, в котором хориоретинальное неоваскулярное нарушение является вторичным к заболеванию, вызывающему воспаление.

4. Применение по п.1, в котором хориоретинальное неоваскулярное нарушение является вторичным по отношению к травматическому повреждению сосудистой оболочки.

5. Применение по п.1, в котором хориоретинальное неоваскулярное нарушение является вторичным по отношению к дистрофии сетчатки.

6. Применение по п.5, в котором дистрофия сетчатки связана с желточной дегенерацией желтого пятна Беста, макулярной дистрофией Северной Каролины, болезнью Штаргардта, хороидеремией или ретинитом Коутса.

7. Применение по п.1, в котором хориоретинальное неоваскулярное нарушение является вторичным по отношению к новообразованию.

8. Применение по п.7, в котором новообразованием является хориоидальная опухоль.

9. Применение по п.1, в котором хориоретинальное неоваскулярное нарушение не является вторичным по отношению к кератоконусу, желточной дегенерации желтого пятна Беста, токсокарозу глаз или травматическому разрыву оболочки Бруха.

10. Применение по п.1, в котором нарушением проницаемости является отек желтого пятна.

11. Применение по п.10, в котором отек желтого пятна является вторичным по отношению к псевдофакии, увеиту, окклюзионному васкулиту, пигментному ретиниту, окклюзии ветви ретинальной вены (BRVO), окклюзии центральной вены сетчатки (CRVO), глазному ишемическому синдрому, лучевой нейропатии/ретинопатии зрительного нерва, поствоспалительной хориоидальной неоваскуляризации, пролиферативной диабетической ретинопатии (PDR), серповидно-клеточной ретинопатии, перифлебиту сетчатки или неартериитной ишемической невропатии зрительного нерва.

12. Применение по любому из предшествующих пунктов, при этом применение дополнительно включает применение лазерной фотокоагуляционной терапии (LPT) или фотодинамической терапии (PDT).

13. Применение по п.12, в котором начало LPT или PDT и введение антагониста VEGF происходит в пределах 1 месяца друг от друга.



 

Похожие патенты:

Изобретение относится к биохимии. Описано антитело для увеличения количества связываний антигена антителом, для улучшения удержания антитела в плазме или для стимулирования захвата антителом антигена в клетке, содержащее антигенсвязывающий домен и FcRn-связывающий домен человека, активность связывания антигена которого отличается в двух различных условиях концентрации кальция и является более низкой в условиях низкой концентрации кальция, чем в условиях высокой концентрации кальция, где низкая концентрация кальция представляет собой концентрацию ионизированного кальция от 0,1 до 30 мкМ, а высокая концентрация кальция представляет собой концентрацию ионизированного кальция от 100 мкМ до 10 мМ, где указанное антитело содержит по крайней мере четыре аминокислоты, выбранные из группы, включающей аминокислоты в положениях 30, 31, 32, 50 и 92 в соответствии с нумерацией по Kabat в легкой цепи, которые обладают хелатирующей активностью в отношении металла.

Данное изобретение относится к способам, включающим применение гидроксиапатитной хроматографии для выделения биспецифического антитела из раствора, который также содержит один или более чем один побочный продукт, характерный для производства биспецифических антител.

Изобретение относится к биотехнологии. Описана иммуносвязывающая молекула, содержащая: CDR1, CDR2 и CDR3 легкой цепи из донорной иммуносвязывающей молекулы зайцеобразного и CDR1, CDR2 и CDR3 тяжелой цепи из донорной иммуносвязывающей молекулы зайцеобразного, каркас вариабельной области легкой цепи человека и каркас вариабельной области тяжелой цепи человека, содержащий по меньшей мере четыре следующих аминокислоты: треонин (T) в положении 24, аланин (A) или глицин (G) в положении 56, треонин (T) в положении 84, валин (V) в положении 89 и аргинин (R) в положении 108 (нумерация AHo).

Изобретение относится к области биохимии, в частности к применению способа модификации двух доменов легкой цепи для получения антитела с повышенной стабильностью, по сравнению с антителом, не содержащей указанных замен.

Изобретение относится к области биохимии, в частности к выделенной молекуле нуклеиновой кислоты, кодирующей рекомбинантное антитело или его фрагмент, где рекомбинантное антитело или его фрагмент нейтрализует VEGF человека, а также к экспрессирующему вектору и клетке-хозяину, ее содержащей.

Настоящее изобретение относится к биотехнологии и фармацевтике, в частности к фармацевтической композиции для применения в ингибировании роста опухоли, резистентной к анти-VEGF-средствам.

Настоящее изобретение относится к области биотехнологии и генетической инженерии, в частности к способу получения ранибизумаба с применением новых сигнальных последовательностей для лёгкой и тяжёлой цепи ранибизумаба, соответственно.

Изобретение относится к биотехнологии. Представлено одноцепочечное антитело для лечения или диагностики, содержащее один полипептид, содержащий следующие домены, расположенные относительно друг друга в направлении от N-конца к С-концу следующим образом: VL1-CL1-CLH линкер1-VH1-CH11-шарнир1-CH21-CH31-HD линкер-VL2-CL2-CLH линкер2-VH2-CH12-шарнир2-CH22-CH32, где каждый из CLH линкера1, CLH линкера2 и HD линкера содержит аминокислотную последовательность, расщепляемую эндопептидазой на N- и C-концах.

Настоящее изобретение относится к иммунологии. Предложено антитело, которое связывается с фактором роста сосудистого эндотелия А (VEGF-А) человека и мыши, а также антигенсвязывающий фрагмент такого антитела.

Настоящее изобретение относится к биотехнологии, в частности к способу получения антител, подходящих для применения у собаки, которые специфично связываются с собачьим фактором роста нервов (NGF) и нейтрализуют способность собачьего NGF связываться с рецептором собачьего NGF р75 или TrkA, и соответствующим антителам.

Группа изобретений относится к биодеградируемым имплантатам с долговременным высвобождением белка в ткань млекопитающих. Раскрыт экструдированный биодеградируемый внутриглазной имплантат, содержащий биодеградируемую полимерную матрицу и белок, связанный с биодеградируемой полимерной матрицей, причем биодеградируемая полимерная матрица содержит первый поли(D,L-лактид-ко-гликолид) и второй поли(D,L-лактид-ко-гликолид), причем первый поли(D,L-лактид-ко-гликолид) имеет сложноэфирную концевую группу и соотношение D,L-лактид : гликолид, равное 75:25, а второй поли(D,L-лактид-ко-гликолид) имеет кислотную концевую группу и соотношение D,L-лактид : гликолид, равное 50:50.
Изобретение относится к области медицины, а именно к офтальмологии. Для хирургического лечения пациентов с пролиферативной витреоретинопатией при сахарном диабете проводят витреошвартэктомию, включающую установку порта для ирригации, порта для осветителя и порта для витреоретинальных инструментов, удаление стекловидного тела (СТ), выделение задней гиалоидной мембраны с использованием перфторорганического соединения (ПФОС), рассечение тракционных контактов задней гиалоидной мембраны с сетчаткой и последующее ее иссечение, удаление ПФОС, тампонаду витреальной полости.

Группа изобретений относится к химико-фармацевтической промышленности и представляет собой офтальмологический продукт, представляющий собой контейнер, содержащий жидкий препарат в виде глазных капель, содержащий хлорфенирамин и/или его фармацевтически пригодную соль, отличающийся тем, что: указанный жидкий препарат имеет рН от 7,0 до 9,0; контейнер включает: корпус контейнера для помещения жидкого препарата; носик, имеющий выход, через который должен выливаться препарат, помещенный в корпусе контейнера; и колпачок для закрытия выхода; и по меньшей мере одна из поверхности стенок внутреннего пространства носика и поверхности стенок колпачка, обращенной к выходу, содержит смолу, содержащую терефталат полибутилена; а также способ стабилизации жидкого препарата, содержащего хлорфенирамин и/или его фармацевтически пригодную соль и имеющего рН от 7,0 до 9,0, включающий помещение жидкого препарата, содержащего хлорфенирамин и/или его фармацевтически пригодную соль, в контейнер, в котором по меньшей мере часть области, образующей внутреннюю стенку контейнера, включает смолу, содержащую терефталат полибутилена.

Изобретение относится к области медицины, а именно к офтальмологии. Для хирургического лечения эндотелиально-эпителиальной дистрофии (ЭЭД) роговицы проводят локальное введение суспензии аутологичных мононуклеарных лейкоцитов крови.

Группа изобретений относится к области медицины, а именно к офтальмологии, и предназначена для лечения повреждения глаз. Для лечения повреждения глаз, которое выбирают из группы, состоящей из послеоперационного воспаления, послеоперационного фиброза, повреждения роговицы, рассечения катаракты, повреждений вследствие лазерного кератомилеза in situ (LASIK) и повреждения вследствие проведения фоторефрактивной кератэктомии (PRK), осуществляют введение субъекту эффективного количества ангиотензинового пептида, содержащего Nle3-A(1-7) (SEQ ID NO: 14).

Изобретение относится к медицине, а именно к офтальмологии и онкологии, и может быть использовано для лечения болезней, связанных с глазной неоваскуляризацией. Для этого вводят фармацевтическую композицию, предназначенную для внутриглазного введения путем внутриглазной инъекции.

Группа изобретений относится к медицине, в частности к системам доставки лекарственного средства в глаз. Композитный материал для доставки лекарственного средства в глаз, содержит состав среды, который содержит лекарственное средство, депообразующий материал и микрочастицы, при этом лекарственное средство находится и в депообразующем материале, и в микрочастицах.

Изобретение относится к способу лечения или предотвращения глазного заболевания, в частности лейкоплакии, гиперемии и воспаления век. Предлагается способ лечения или предотвращения глазного заболевания, расстройства или патологического состояния у больного, при этом способ включает введение в глаз больного композиции, содержащей терапевтически эффективное количество меланина для лечения или предотвращения глазного заболевания, расстройства или патологического состояния, где глазное заболевание, расстройство или патологическое состояние выбрано из группы, состоящей из лейкоплакии, гиперемии и воспаления век.

Группа изобретений относится к лекарственным средствам против хориоретинальных нарушений. Способ предотвращения или лечения хориоретинального нарушения, в частности способ предотвращения или уменьшения формирования рубца на сетчатке и/или сосудистой оболочке глаза у субъекта, предусматривает введение указанному субъекту паловаротена ((E)-4-(2-{3-[(1H-пиразол-1-ил)метил]-5,5,8,8-тетраметил-5,6,7,8-тетрагидронафта-лин-2-ил}винил)бензойной кислоты) в количестве, эффективном для лечения.

Изобретение относится к соединениям формулы (A) или их фармацевтически приемлемым солям, а также к фармацевтическим композициям, обладающим блокирующей натриевые каналы активностью, на их основе и способам лечения опосредованных этой активностью заболеваний.

Изобретение относится к области биохимии, в частности к антителу или его антигенсвязывающему фрагменту, специфически связывающемуся с IL-6, а также к фармацевтической композиции, его содержащей.

Изобретение относится к применению ранибизумаба в лечении хориоретинальных неоваскулярных нарушений или нарушений проницаемости у детей. Применение ранибизумаба для лечения ребенка включает введение в глаз указанного ребенка ранибизумаба в дозе 0,2 мг для детей в возрасте 2-4 лет и в дозе 0,3 мг для детей в возрасте 5-11 лет. Изобретение обеспечивает безопасное и эффективное лечение детей с хориоретинальными неоваскулярными нарушениями или нарушениями проницаемости за счет оптимально подобранных доз ранибизумаба. 12 з.п. ф-лы, 2 ил., 9 пр.

Наверх