Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека



Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами c7b ламы, способными специфически взаимодействовать с рекомбинантным белком her2/neu - аналогом природного рецептора эпидермального фактора роста egfr/erbb клеток человека
C07K2317/22 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2679075:

Федеральное бюджетное учреждение науки "Государственный научный центр вирусологии и биотехнологии "Вектор" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФБУН ГНЦ ВБ "Вектор" Роспотребнадзора) (RU)

Изобретение относится к области биотехнологии, конкретно к получению конъюгатов люминесцентных наночастиц диоксида кремния с антителами, и может быть использовано в диагностике для выявления гиперэкспрессирующегося на поверхности опухолевых клеток рецептора эпидермального фактора роста человека 2 (HER2/neu). Получают конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами ламы, характеризующийся тем, что люминесцентные наночастицы диоксида кремния со средним размером 50±5 нм имеют модифицированную эпоксидными группами гидрофильную поверхность, химически связанную с аминогруппами рекомбинантных однодоменных нано - моноантител ламы, имеющих аминокислотную последовательность SEQ ID NO:1, молекулярную массу 17 кДа и способных специфически взаимодействовать с рекомбинантным белком HER2/neu. Изобретение повышает эффективность использования конъюгатов молекул - маркеров с рекомбинантными нано – моноантителами, специфичными к белку HER2/neu. 1 з.п. ф-лы, 7 ил., 1 табл., 8 пр.

 

Изобретение относится к конъюгатам люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами С7b ламы, способными специфически взаимодействовать с рекомбинантным белком HER2/neu - аналогом природного рецептора эпидермального фактора роста EGFR/ERBB клеток человека и может быть использовано в медицине, биотехнологии и молекулярной иммунологии, в частности, в диагностике рака, а так же для терапии опухолевых заболеваний, характеризующихся гиперэкспрессией опухолевыми клетками человека белка HER2/neu, в качестве молекулы - курьера к таким клеткам, диагностических и/или лекарственных препаратов, узнающих и/или блокирующих рецептор HER2/neu.

По данным ВОЗ, более 14 миллионов человек в мире ежегодно подвергаются онкологическим заболеваниям. В России ежегодно регистрируется более 0,5 млн. новых случаев заболеваний, связанных с онкологией и 0,3 млн. летальных исходов. Например, абсолютное число новых случаев онкологических заболеваний в России в 2012 г. было 525931, что на 8.25% больше, чем в 2007 г. (Давыдов М.И., Аксель Е М. Статистика злокачественных новообразований 2014 г. / Евразийский онкологический журнал. 2016. №. 4. С. 692-79.). В настоящее время в России зарегистрировано около 3 млн. онкологических больных, которые требуют постоянного наблюдения и мониторинга (Шаповал А.И. Легутки Д.Б., Стаффорд Ф. и др. Иммуносигнатура (immunosignature) - пептидные микроэррей для диагностики рака и других заболеваний. / Российский онкологический журнал. 2014. Т. 19. №. 4. С. 6-11). Одной из причин высокой смертности при онкологических заболеваниях считается их позднее диагностирование и отсутствие эффективных противоопухолевых препаратов и стратегий лечения. В этой связи, ранняя диагностика злокачественных новообразований является актуальным и наиболее перспективным подходом для снижения инвалидности и смертности, вызванной раком.

Проблема лечения онкологических заболеваний основана на способности опухолевых клеток вырабатывать устойчивость к лекарственным препаратам (Барышникова М.А., Барышников А.Ю., Афанасьева Д.А. Молекулярные механизмы преодоления множественной лекарственной устойчивости липосомальными противоопухолевыми препаратами. / Российский биотерапевтический журнал. 2015. Т. 14. №. 1. С. 3-10), поэтому разработка новых подходов для диагностики онкологических заболеваний и их терапии является актуальной научной задачей. Для решения этой задачи необходимо конструировать и исследовать новые белковые молекулы, способные специфически и эффективно узнавать и нейтрализовать опухолевые клетки.

Среди огромного количества типов онкологических заболеваний, в настоящее время рак молочной железы (РМЖ) является основной причиной женской смертности. В мире ежегодно регистрируется более миллиона новых случаев, и более полумиллиона женщин погибает. В России ежегодно выявляется более 50 тыс. новых случаев и около 23 тыс. летальных. На 100 тыс. женщин в возрасте 15 лет и старше смертность составляет 34,06 % (Куликов А.Ю., Нгуен Т. Фармакоэкономический анализ одногодичной адъювантной терапии трастузумабом при неr2 - положительном раке молочной железы ранней стадии. / Фармакоэкономика. Современная фармакоэкономика и фармакоэпидемиология. 2010. №4. С. 28-34; Ягудина Р.И., Куликов А Ю., Нгуен Т. Обзор зарубежных фармакоэкономических исследований применения Герцептина при лечении рака молочной железы. / Фармакоэкономика. Современная фармакоэкономика и фармакоэпидемиология. 2009. №2. С. 28-35).

Рецептор HER2 на перерожденных клетках - один из наиболее значимых молекулярных маркёров при раке молочной железы в 20-30% случаях (Гришина К.А. Музаффарова Т.А., Хайленко В.А. и др. Молекулярно-генетические маркеры рака молочной железы. / Опухоли женской репродуктивной системы. 2016. Т. 12. №. 3. С. 36-42.; Косоруков В.С., Кособокова Е.Н., Пинюгина М.В. и др. Биологическая активность рекомбинантных антител против рецептора Her2, полученных из растительного источника. / Российский биотерапевтический журнал. 2015. №2. С. 105-112). При HER2 - положительном РМЖ на поверхности раковых клеток происходит гиперэкспрессия белка HER2, который способствует размножению и росту опухолевых клеток, тем самым ускоряет процесс формирования опухоли. Для снижения и полной остановки скорости формирования опухоли, необходимо блокировать белок - рецептор HER2, находящийся на поверхности перерожденных клеток. Более того, в случае HER2 - положительном РМЖ, имеется принципиальная возможность ранней диагностики заболевания и проведения терапии при использовании технологии рекомбинантных антител, способных специфически связываться с этим рецептором (Сакаева Д.Д. Ранний рак молочной железы. Различные аспекты комбинированного лечения. Новые подходы к неоадъювантной терапии раннего her2 позитивного рака молочной железы. / Злокачественные опухоли. 2013. №1 (5). С. 35-40).

Существенные усилия в разработке противоопухолевых препаратов отводятся адресной доставке биологических активных агентов к опухоли. Это позволяет обеспечить подавление роста опухоли с наименьшим количеством побочных эффектов за счет снижения концентрации, как правило, высоко токсичных лекарственных препаратов в организме больного (Ивонин А.Г., Пименов Е.В., Оборин В.А. и др. Направленный транспорт лекарственных препаратов: современное состояние вопроса и перспективы. / Известия Коми НЦ УрО РАН. 2012. №1 (9). С. 46-55; Антипов С.А., Дамбаев Г.Ц., Ермаков А.Е. и др. Направленная доставка противоопухолевых препаратов. / Российский биотерапевтический журнал. 2009. №1. С. 4-12). В области разработки противоопухолевых препаратов увеличивается количество исследований с применением технологии рекомбинантных антител. В настоящее время рынок спроса на препараты специфических моноклональных антител (МКА) превысил спрос на вакцинные препараты. По прогнозам, к 2020 г. рынок антител превысит 100 млрд. долл. За рубежом уже существует большое количество кандидатных терапевтических препаратов противоопухолевых МКА, которые проходят доклинические и клинические испытания. В тоже время следует отметить, что до сих пор не разработано ни одного альтернативного отечественного противоопухолевого препарата. Производимые в России противоопухолевые препараты являются либо дженериками либо производными зарубежных препаратов таргетных МКА, которые способны специфически связывать определенные аминокислотные участки (эпитопы) антигенов/белков/рецепторов, например HER2, на поверхности опухолевых клеток. Молекулы МКА могут находится как в свободном состоянии, так в комплексе (в конъюгации) с другими молекулами. При таком специфическом иммунном взаимодействии МКА с антигеном/белком/рецептором, в клетках блокируется синтез целевого антигена (белка - рецептора), вызывающего их опухолевый рост, а также стимулируется иммунная система пациента на «уничтожение» этих перерожденных клеток. Кроме этого, молекулы МКА в комплексе (в конъюгации) с другими молекулами открывают возможность создания молекулярно - таргетных флуоресцентных биомаркеров (в случае конъюгации с люминофорами), а также таргетных терапевтических препаратов (в случае конъюгации с веществами, проявляющими противораковую активность) (Бражник К.И., Барышникова М.А., Соколова З.А. и др. Новые направления в исследовании и ранней диагностике рака с применением детекционных систем на основе флуоресцентных нанокристаллов. / Российский биотерапевтический журнал. 2013. №3. С. 12-24). Например, широко известный препарат под названием Трастузумаб (Герцептин) (Roche, США) - это гуманизированные МКА, полученные на основе мышиных МКА, направленных против белка HER2. Трастузумаб (Герцептин) показал свою эффективность при сравнении со стандартными методами лечения. Относительный риск рецидива был снижен на 36%, а риск смертности уменьшился на 34% (Куликов А.Ю., Нгуен Т. Фармакоэкономический анализ одногодичной адъювантной терапии трастузумабом при неr2 - положительном раке молочной железы ранней стадии. / Фармакоэкономика. Современная фармакоэкономика и фармакоэпидемиология. 2010. №4. С. 28-34; Ягудина Р.И., Куликов А.Ю., Нгуен Т. Обзор зарубежных фармакоэкономических исследований применения Герцептина при лечении рака молочной железы. / Фармакоэкономика. Современная фармакоэкономика и фармакоэпидемиология. 2009. №2. С. 28-35). Такие препараты как Гертикад и Новотакс (Биокад, Россия), являются отечественными биоаналогами Трастузумаба (Герцептина) и при их применении для лечения РМЖ не было обнаружено существенной разницы от результатов использования трастузумаба (Жукова Л.Г. Современные возможности и перспективы таргетной терапии при раке молочной железы. / Практическая онкология. 2010. Т. 11. №. 3. С. 184.). Наряду со значительными успехами применения терапевтических полноразмерных антител в лечении опухолевых заболеваний, данный подход имеет ряд недостатков: низкую эффективность антител, тяжелые побочные эффекты, такие как кардиомиопатия, аллергические реакции, включая анафилаксию, гепатотоксичность, кожные реакции и др. (Деев СМ., Лебеденко Е.Н. Инженерия антител: молекулярный конструктор на основе модуля барназа - барстар. Биоорганическая химия. 2009. 35(6). С. 761-78), а также невосприимчивость опухолевых клеток к антителам, как первичную, так и приобретенную в процессе длительного применения таких препаратов (Hopper-Borge E., Nasto R.N., Ratushny V. et al. Mechanisms of tumor resistance to EGFR-targeted therapies / Exp Opin Ther Targets. 2009. V.13. №3. Р. 339-62; Wilken J.A., Maihie N. Primary trastuzumab resistance: new tricks for an old drug / Annals of the New York Academy of Sciences. 2010. Т. 1210. №. 1. С. 53-65.). В последние годы интенсивно разрабатываются препараты на основе малых однодоменных нано - моноантител, имеющих ряд преимуществ по сравнению с полноразмерными двухцепочечными (бивалентными) МКА. Одним из важных характеристик нано - моноантител является их сравнительно малый размер (10-15 кДа) по сравнению с размерами классических полноразмерных двухцепочечных антител (150 кДа) и одноцепочечных антител (30 кДа) (Деев С.М., Лебеденко Е.Н. Современные технологии создания неприродных антител для клинического применения. / Acta Nature (русскоязычная версия). 2009. Т. 1. №. 1). В работах (Беланова А.А. Золотухин П.В., Лебедева Ю.А. и др. История разработки и применение наноантител как инструмента современной медицины и энзимологии. / Scientific and Practical Journal of Health and Life Sciences 2015. № 2. 2015. С. 42; Тиллиб С.В. “Верблюжьи наноантитела” - эффективный инструмент для исследований, диагностики и терапии. / Молекулярная биология. 2011. Т. 45. №. 1. С. 77-85.) обобщаются преимущества этих препаратов перед классическими антителами:

→ сродство с антигеном выше, чем у классических антител;

→ возможность получения комплекса молекул наноантител с флуоресцентными молекулами для получения специфических красителей опухолевых клеток;

→ возможность хранения наноантител при 4°С в течение нескольких месяцев или при минус 20°С на протяжении нескольких лет, при сохранении специфичности взаимодействия с антигеном - мишенью;

→ термостабильность, позволяющая сохранить до 80% специфической активности наноантител после их недельной инкубации при 370С;

→ устойчивость к агрегации;

→ стабильность при экстремальных рН и в присутствии хаотропных агентов;

→ температура плавления 67-68°С с возможностью полной обратимой денатурации;

→ возможность наработки нано - моноантител в прокариотических клетках бактерий E.coli или в эукариотических клетках дрожжей, растений и животных;

→ низкая иммуногенность и др.

В качестве преимуществ так же можно выделить простоту всевозможных генно-инженерных манипуляций при конструировании нано - моноантител и их высокую адаптивность для различных задач, возможность создания их многофункциональных производных и др. (Тиллиб С.В., Иванова Т.И., Васильев Л.А. Фингерпринтный анализ селекции наноантител методом фагового дисплея с использованием двух вариантов фагов-помощников. / Acta Naturae (русскоязычная версия). 2010. №3. С. 100-108; Тиллиб С.В. “Верблюжьи наноантитела” - эффективный инструмент для исследований, диагностики и терапии. / Молекулярная биология. 2011. Т. 45. №. 1. С. 77-85.).

В 1993 г. группой бельгийских ученых, в сыворотке крови представителей семейства Camelidae (верблюды, ламы, викуньи), были обнаружены однодоменные наноантитела. Как выяснилось, однодоменные антитела состоят только из димера одной укороченной тяжелой цепи (без СН1), а легкая цепь отсутствует. Вариабельный участок таких антител формируется только одним вариабельным доменом, который связан через шарнирный регион с константным доменом. Для специфического узнавания и связывания эпитопа молекулы антигена молекуле такого наноантитела достаточно наличия лишь тяжелой цепи. Организация вариабельных доменов наноантител подобна той, что существует у классических антител, т.е. состоят из константных и гипервариабельных доменов. (Тиллиб С.В. Верблюжьи наноантитела эффективный инструмент для исследований, диагностики и терапии. / Молекулярная биология. 2011. Т. 45. № 1. С. 77-85).

Известны следующие изобретения : (Тиллиб С.В., Наноантитело, специфически связывающее белок сеа, способ его использования для детекции этого белка. / международная заявка WO 2013154460, опубл. 20.09.2013; Тиллиб С.В.. Наноантитело, специфически связывающее белок muc1, способ детекции белка muc1 с помощью наноантител. / международная заявка WO 2013129978, опубл. 28.11.2013; Ларин C.C., Захарова Е.С., Вихрева П.Н. и др. Наноантитело v9, связывающее vegf, и способ его получения, кодирующая v9 нуклеотидная последовательность и содержащий ее вектор, способ ингибирования пролиферации эндотелиальных клеток. / Патент РФ № 2395521, опубл. 27.07.2010), в которых показано, что рекомбинантные наноантитела способны эффективно связывать белки СЕА (Carcinoembryonic antigen), MUC1(Mucin 1) и VEGF (Vascular endothelial growth factor). В этих работах так же продемонстрировано, что способ получения рекомбинантных нано - моноантител довольно простой. Полученные нано - моноантитела имеют высокую растворимость, аффинность и специфичность, позволяющую узнавать некоторые «скрытые» эпитопы белков - мишеней (Tillib S. V. “Camel nanoantibody” is an efficient tool for research, diagnostics and therapy. / Molecular biology. 2011. Т. 45. №. 1. С. 66-73). Наноантитела, специфичные к антигену Chlamydia trachomatis, способны эффективно связываться с антигеном внутриклеточного паразита Chlamydia trachomatis и ингибировать развитие хламидийной инфекции (Зигангирова Н.А., Тиллиб С.В. Наноантитела, связывающие антиген Chlamydia rachomatis, способ подавления инфекции, вызванной Chlamydia trachomatis. / Патент РФ № 2487724, опубл. 20.07.2013).

Известно исследование, в результате которого было показано, что конъюгированные наноантитела L-DOS47 обладали большей связывающей активностью со специфическим антигеном немелкоклеточного рака легкого, чем нативные наноантитела AFAIKL2. В настоящее время данный конъюгат исследуется в качестве потенциального терапевтического препарата и проходит первую фазу клинических исследований (Tian B. Wong W.Y., Hegmann E. et al. Production and Characterization of a Camelid Single Domain Antibody - Urease Enzyme Conjugate for the Treatment of Cancer. / Bioconjugate chemistry. 2015. Т. 26. №. 6. С. 1144-55). Природные наноантитела, полученные при иммунизации ламы цельными человеческими клетками (из биопсийного материала), содержащими белок CXCL12, были способны связывать нативный белок и блокировать β-арестин 2, находящиеся в хемокиновом рецепторе CXCR7 и гиперэкспрессирующиеся в при гепатоцеллюлярной карциноме, раке мочевого пузыря, раке шейки матки, глиобластоме и др. Эти же наноантитела уменьшали секрецию ангиогенных (замедляющих рост клеток) факторов (Maussang D., Mujic-Delic A., Descamps F.J. et al. Llama-derived single variable domains (nanobodies) directed against chemokine receptor CXCR7 reduce head and neck cancer cell growth in vivo. / J. Biol. Chem. 2013. V. 288. № 41. Р. 29562-72). В исследованиях in vivo было показано, что наноантитела, конъюгированные с бета - лактомазой Enterobacter cloacea, обладают высокой противоопухолевой активностью, взаимодействуя с антигеном LS174T, который экспрессируется на карциноэмбриональных раковых клетках (Cortez-Retamozo V., Backmann N., Senter P.D. et al. Efficient cancer therapy with a nanobody-based conjugate. / Cancer Res. 2004. V. 64. № 8. 2853-57). Конъюгат наноантител с облученным цирконием, ингибировал рост опухоли у мышей с ксенотрансплантантами глиобластомы, по сравнению с контрольной группой животных, не обработанных таким конъюгатом. У некоторых мышей после лечения наблюдалось полное отсутствие раковых клеток (Vosjan M.J., Vercammen J., Kolkman J.A. et al. Nanobodies targeting the hepatocyte growth factor: potential new drugs for molecular cancer therapy. Mol. Cancer Ther. 2012. V. 11. № 4. 1017 -25). Таким образом, получение флуоресцентных конъюгатов на основе рекомбинантных нано - моноантител является приоритетным направлением в современной биотехнологии, биомедицине и биофармакологии. А флуоресцентные конъюгаты, проявляющие яркую, долгоживущую люминесценцию в красной области спектра, являются наиболее перспективными в качестве молекул - маркеров для диагностики многих онкологических заболеваний. (Здобнова Т. А., Лебеденко Е. Н., Деев С. М. Квантовые точки для молекулярной диагностики опухолей. / Acta Naturae (русскоязычная версия). 2011. №1. С. 30-50).

Наиболее близким аналогом (прототипом) к заявляемому изобретению, по совокупности существенных признаков и техническому результату, являются рекомбинантные нано - моноантитела, специфичные к белку - рецептору HER2/neu. Эти моноантитела были получены методом фагового дисплея отбором из пула природных поликлональных наноантител, полученных при иммунизации ламы биопсийным материалом от пациентки с диагнозом РМЖ (рак молочной железы), как описано в источнике (Even-desrumeaux K. Fourquet P., Secq V., et al. Single-domain antibodies: a versatile and rich source of binders for breast canser diagnostic approaches. / Molecular BioSystems. 2012. V. 8. №. 9. P. 2385-94). Далее указанные авторы использовали плазмиду pET14a для переклонирования нуклеотидной последовательности одного из наноантител в фагмиду pHEN1 и получения препарата рекомбинантных нано - моноантител (специфических молекул-курьеров к мишени - белку HER2/neu), конъюгированных с биотин - стрептовидиновым комплексом (молекулами - маркерами). Полученные таким образом, иммуно - химические конъюгаты нано - моноантител с биотин - стрептовидиновым комплексом, сорбированные на магнитных эпоксидных частицах, были использованы в цитохимическом анализе опухолевых тканей для разработки быстрой диагностики РМЖ (Even-desrumeaux K. Fourquet P., Secq V., et al. Single-domain antibodies: a versatile and rich source of binders for breast canser diagnostic approaches. / Molecular BioSystems. 2012. V. 8. №. 9. P. 2385-94).

Однако, полученные таким образом иммуно-химические конъюгаты нано-моноантител с биотин - стрептовидиновым комплексом, сорбированные на магнитных эпоксидных частицах обладают недостаточной опухоль-связывающей активностью со специфическим антигеном.

Техническим результатом заявляемого технического решения является увеличение эффективности использования конъюгатов молекул - маркеров с рекомбинантными нано-моноантителами, специфичными к белку HER2/neu вследствие повышения опухоль-связывающей активности конъюгата со специфическим антигеном за счет использования в качестве молекул - маркеров сферических наночастиц диоксида кремния.

Указанный технический результат достигается тем, что создан конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами С7b ламы, характеризующийся тем, что люминесцентные наночастицы диоксида кремния имеют модифицированную эпоксидными группами гидрофильную поверхность, химически связанную с аминогруппами рекомбинантных однодоменных нано - моноантител С7b ламы, имеющих аминокислотную последовательность SEQ ID №1 (приложение):

MQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSYAMAWFRQAPGKEREFVA

10 20 30 40 50

AISWSGANIYVADSVKGRFTISRDNAKDTVYLQMNSLKPEDTAVYYCAVK

60 70 80 90 100

LGFAPVEERQYDYWGQGTQVTVSS (124 а.о.),

110 120

молекулярную массу 17 кДа и способных специфически взаимодействовать с рекомбинантным белком HER2/neu - аналогом природного рецептора эпидермального фактора роста EGFR/ERBB клеток человека.

Люминесцентные наночастицы диоксида кремния имеют размер от 45 до 55 нм.

Основным отличием заявляемого конъюгата рекомбинантных нано - моноантител (специфических молекул - курьеров к мишени - белку HER2/neu) от выше указанного аналога (прототипа), является то, что в качестве молекул - маркеров используются сферические (наночастицы) диоксида кремния, допированные люминесцентными октаэдрическими кластерными комплексами молибдена, со средним размером 50±5 нм. Как известно, данные комплексы обладают высоким квантовым выходом, что обеспечивает исключительную яркость в широком спектре излучения, а также обладают высоким коэффициентом молярной экстинкции (в 10-100 раз выше, чем у других флуорофоров). Помимо этого, у кластерных комплексов имеется высокая устойчивость к фото деградации, устойчивость к фотовыцветанию в 100-1000 раз выше, чем у органических флуорофоров. Образование комплекса (конъюгата) между частицами диоксида кремния и молекулами наноантител проходит за счет химического взаимодействия гидрофильного покрытия наночастиц (эпоксидные или карбоксильные группы) и аминогруппы наноантител, а не через биотин - стрептовидиновый мостик, что снижает эффективность за счет присутствия в организме эндогенного биотина, конкурирующего с вводимыми в организм синтетическими биотинилированными компонентами (Vorotnikov Y. A. et al. On the synthesis and characterisation of luminescent hybrid particles: Mo 6 metal cluster complex/SiO 2. / RSC Advances. 2016. Т. 6. №. 49. С. 43367-43375).

Заявляемый конъюгат люминесцентных наночастиц диоксида кремния с однодоменными очищенными рекомбинантными нано - моноантителами, обеспечивает узнавание как рекомбинантного так и природного гиперэкспрессирующегося на поверхности опухолевых клеток, белок HER2/neu - рецептор эпидермального фактора роста клеток молочной железы человека. Полученный конъюгат обладает всеми преимуществами природного однодоменного наноантитела, в частности высокой специфичностью к белку HER2/neu, а так же простотой получения и ярко-красной люминесценцией на поверхности опухолевых клеток, которую можно легко детектировать с использованием конфокального или флуоресцентного микроскопа.

Изобретение иллюстрируется следующими графическими материалами. На фиг.1 представлена нуклеотидная последовательность кодирующее рекомбинантное нано-моноантитело C7b. На фиг.2 приведена аминокислотная последовательность рекомбинантного - моноантитела. На фиг.3 представлена схема получения экспессионной гибридной (рекомбинантной) ДНК - конструкции кодирующей рекомбинантное нано - моно антитело C7b. На фиг.4 приведена схема конструирования рекомбинантной плазмидной ДНК конструкции pET21a-C7b, находящейся под контролем промотора Т7. На фиг. 5 изображена электрофореграмма продукта экспресс последовательности рекомбинантного нано-моноантитела C7b в клетках E.coli штамма BL21(DE3) и очищенного препарата нано-моноантител C7b C7b в 12% SDS-ПААГ. На фиг. 6 представлен дот-блот анализ взаимодействия очищенного препарата рекомбинантных нано - моноантител C7b с антигеном - рекомбинантным белком - рецептором HER2/neu. На фиг. 7 приведена диаграмма исследования специфичности взаимодействия в ТФ-ИФА рекомбинантных нано - моноантител C7b с рекомбинантным белком - рецептором HER2/neu человека в концентрации 0,05 мкг/50 мкл.

Пример 1. Конструирование рекомбинантной плазмиды pET21а-C7b.

1.1. Получение нуклеотидной последовательности нано - моноантитела C7b ламы.

Нуклеотидная последовательность нано - моноантитела C7b ламы (GenBank: AFN61318.1) была синтезирована и клонирована в состав коммерческой плазмиды pGH, по нашему заказу, в коммерческой научно - производственной фирме (ДНК-Синтез, Россия).

Последовательность размером 468 пар нуклеотидов (п.н.), кодирующая 156 аминокислотных остатков (а.о.) нано - моноантитела C7b, соответственно, представлена на фиг. 1 и фиг. 2.

За основу была взята молекула ДНК (GenBank: AFN61318.1), которая состоит из 468 пар нуклеотидов (п.н.), в том числе (фиг. 1):

- последовательности, кодирующей природное нано - моноантитело ламы 372 п.н.;

- последовательности, кодирующей гексaгистидиновый блок His-tag 18 п.н., необходимый для аффинной очистки препарата рекомбинантного нано - моноантитела С7b;

- фрагмента 45 п.н., кодирующего пептид Avi tag для биотинилирования рекомбинантных нано-моноантител in vivo;

- 2-х глицин-сериновых мостика размером 21 и 12 п.н. соответственно.

Аминокислотная последовательность молекулы ДНК природного нано - моноантитела С7b состоит из 156 а.о. (фиг. 2), в том числе:

- последовательности, кодирующей природное нано - моноантитело ламы 124 а.о.;

- последовательности, кодирующей гексaгистидиновый блок His-tag 6 а.о., необходимый для аффинной очистки препарата рекомбинантного нано - моноантитела С7b;

- фрагмента 15 а.о., кодирующего пептид Avi tag для биотинилирования рекомбинантных нано - моноантител in vivo;

- 2-х глицин-сериновых мостика размером 7 и 4 а.о. соответственно.

1.2. Гидролиз плазмид pET21a(+) и pGH-C7b.

Получение экспрессирующей рекомбинантной плазмиды pET21а-C7b, кодирующей последовательность природного нано - моноантитела C7b, проводили по схеме, представленной на фиг. 3.

Векторную плазмиду pET21a(+) (Novagen, США) и плазмиду pGH-C7b, включающую синтезированную последовательность, кодирующую нано - моноантитело C7b, обрабатывали рестриктазами NdeI-XhoI (New England Biolabs, Англия). Полученный гидролизат разделяли с помощью электрофореза в 1% агарозном геле с последующим выделением аликвоты фрагмента и векторной части плазмиды с помощью набора “Cleanup Standard” (Евроген, Россия) согласно рекомендациям производителя.

1.3. Лигирование ДНК.

Для проведения лигазной реакции использовали 0,5 мкг препарата линеаризованной векторной плазмиды рЕТ21а(+), 0,7 мкг аликвоты фрагмента C7b и 200 е.а. (единиц активности) Т4 ДНК лигазы (СибЭнзим, Россия) в реакционном буфере “Quick ligation” (Евроген, Россия). Полученный таким образом препарат гибридной (рекомбинантной) плазмидной ДНК pET21a+C7b, которая представлена на фиг. 4, которую далее использовали для трансформирования культуры клеток E.coli BL21(DE3). Представленная на фиг. 4 ДНК - конструкция имеет размер 5842 п.н., кодирует целевой белок с молекулярной массой 17,0 кДа и состоит из следующих фрагментов:

- NdeI-XhoI - векторный фрагмент ДНК плазмиды рET21a(-) размером 5365 п.н. содержит промотор T7, обеспечивающий экспрессию последовательности нано - моноантитела C7b в прокариотических клетках; Ampicilin - ген устойчивости к ампициллину и pBR322 ori, обеспечивающие селекцию и размножение целевой плазмиды в клетках бактерий Escherichia coli; лактозный репрессор - ДНК - связывающий белок, который ингибирует экспрессию генов и обеспечивает экспрессию целевого белка после добавления индуктора изопропил-β-D-1-тиогалактопиранозид (ИПТГ); f1 origin - точка начала репликации f1, обеспечивающая клонирование вектора в комбинации с нитевидным бактериофагом М13;

- NdeI-XhoI - фрагмент ДНК размером 468 п.н., содержащий последовательность нано - антитела C7b; гескагистидиновый пептид Avi-tag, служащий в качестве сайта узнавания для биотин - холанзим - синтетазы E.coli для возможной сшивки с биотином in vivo.

Пример 2. Получение штамма Escherichia Coli BL21(DE3) - продуцента рекомбинантных нано - моноантител C7b. Коммерчески доступный штамм E.coli BL21(DE3) (Novagen, США) использовали для экспрессии гена рекомбинантного нано - моноантитела C7b.

2.1. Трансформация компетентных клеток E. coli гибридными плазмидами.

Трансформацию клеток E. coli BL21(DE3) проводили с применением раствора хлористого кальция по методу, описанному в руководстве (Маниатис Т, Фрич Э, Сэмбрук Дж. / Методы генетической инженерии. Молекулярное клонирование. Москва. Мир. 1984. с. 240-241). Клетки культивировали в 5 мл жидкой питательной среды LB до оптической плотности OD600=0.6, охлаждали во льду и аликвоту бактериальной культуры (1,5 мл) центрифугировали при 6000 rpm в течение 2 мин при 4°С. Супернатант удаляли, а осадок клеток ресуспендировали в 700 мкл охлажденного хлорида кальция и инкубировали на льду в течение 15 мин. Далее клетки осаждали при 6000 rpm в течение 2 мин при 4°С. Осадок клеток ресуспендировали в 100 мкл охлажденного раствора хлорида кальция, и к суспензии клеток добавляли 10 мкл реакционной лигазной смеси, с последующей инкубацией на льду в течение 30 мин. После инкубации проводили для клеток тепловой шок - выдерживали 5 мин при 37°С, затем к суспензии клеток добавляли 1 мл жидкой питательной среды LB и инкубировали при 37°С в течение 1часа. Трансформанты E.coli рассевали на LB - агар, содержащий 50-100 мкг/мл ампициллина.

2.2. Культивирование трансформированной культуры клеток штамма E.coli BL21(DE3)[pET21a-C7b] и индукция синтеза рекомбинантных нано - моноантител C7b.

Штамм E.coli BL21(DE3), трансформированный рекомбинантной плазмидой pET21a-C7b, культивировали в объеме 150 мл жидкой питательной среды LB с добавлением ампициллина в рабочей концентрации. Синтез рекомбинантного полипептида в клетках E.coli индуцировали 0,1 мM IPTG (изопропил-β-D-тиогалактозид). Отбор клонов клеток - продуцентов проводили по наличию синтезируемого ими белка в 15% полиакриламидном геле с додецилсульфатом натрия (SDS-ПААГ) (см. пример 4) и посредством анализа лизатов бактериальной культуры клеток со специфическим рекомбинантным антигеном HER2/neu (R&D systems, INC., США) в дот - блот анализе (см. пример 5). В качестве контроля использовали, полученный аналогичным способом, лизат культуры клеток штамма E.coli BL21(DE3), содержащих векторную плазмиду pET21.

Пример 3. Очистка рекомбинантных нано - моноантител C7b в денатурирующих условиях.

Очистку рекомбинантного белка (препарата нано - моноантител C7b), содержащего в своем составе полигистидиновый блок, проводили аффинной хроматографией на Ni-хеллатной смоле, согласно протоколу фирмы-производителя (GE Healthcare Life Sciences, Великобритания). Полученные клеточные лизаты штамма - продуцента E.coli BL21(DE3) и очищенный препарат рекомбинантных нано - моноантител C7b, анализировали методом белкового электрофореза по методу Лэммли в SDS-ПААГ (Laemmli UK. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. / Nature. 1970. V. 227. No. 5259. P. 680-685) (см. пример 4). Электрофоретическая подвижность синтезируемых рекомбинантных нано - моноантител C7b в 12% SDS-ПААГ составила 10-15 кДа (фиг. 5), где:

1 - лизат клеток E.coli, несущий рекомбинантные плазмиды pET21a+C7b до индукции IPTG (3 часа); 2 - лизат клеток E.coli, несущий плазмиды pET21a+C7b, после индукции IPTG (16 часов); 3 - белки, не связавшиеся на Ni-хеллатной смоле; 4 - слабоспецифические белки, снятые с колонки с помощью раствора, содержащего 40мМ имидозола; 5, 7 - 11 - фракции очищенных белков 1-5 белков после очистки на Ni-хеллатной смоле; 6 - маркеры молекулярной массы белков (Thermo Fisher Scientific, США).

Выше указанные результаты соответствуют литературным данным (Even-desrumeaux K. et al. Single-domain antibodies: a versatile and rich source of binders for breast canser diagnostic approaches. / Molecular BioSystems. 2012. V. 8. №. 9. Р. 2385-94). Концентрацию препарата рекомбинантных нано - моноантител C7b измеряли в соответствии с рекомендациями производителя в микрообъемах при помощи спектрофотометра «Implen NanoPhotometer NP80».

Пример 4. Белковый электрофорез в полиакриламидном геле с додецилсульфатом натрия (SDS-ПААГ).

Электрофорез проводили в разрешающем геле (состав: 30% акриламида; 1,5 M Tris (pH 8,8); 10% SDS; 10% аммония персульфата; TEMED (tetramethylethylenediamine) 1 мкл/мл) и концентрирующем геле (состав: 30% акриламида; 1M Tris (pH 6,8); 10% SDS; 10% аммония персульфата; TEMED 1 мкл/мл) в различных буферных растворах (верхний - 5Х трис-глициновый буферный раствор pH 8,3 (состав:1,25 мM Tris; 1,25 M глицина; 0,5 % SDS), нижний - 1Х трис-ацетатный буферный раствор pH 8,0 (состав: 40 мМ Tris-HCl; 40 мМ уксусной кислоты; 2 мМ EDTA (этилендиаминтетрауксусная кислота). Биологический материал смешивали с буферным раствором для нанесения и наносили в верхний концентрирующий гель. SDS-ПААГ вели при напряжении ~150В. Окраску гелей проводили при помощи раствора Кумасси G-250.

Пример 5. Дот - блот анализ.

Идентификацию полученных рекомбинантных нано - моноантител C7b проводили методом дот - блот анализа на нитроцеллюлозной мембране (Hybond-C Extra). На мембрану капельно наносили рекомбинантный белок HER2/neu, концентрация которого составляет 50 нг в точку диаметром 2 мм и высушивали при комнатной температуре в течение 15 минут. Далее мембрану переносили в смоченный водой держатель. Поверхность мембраны для неспецифического связывания блокировали 1% раствором бычьего сывороточного альбумина (БСА) в ФСБ (Фосфатный солевой буфер, 137 mM NaCl, 2.7mM KCl, 10mM Na2HPO4,1.74 mM KH2PO4 pH 7.4) с 0,1% Tween 20 (ФСБ-Т). После трехкратной промывки мембраны с ФСБ с 0,1% Tween 20, на местоположение сорбированного антигена HER2/neu капельно добавляли раствор препарата конъюгата нано - моноантител C7b с диоксидом кремния в концентрации 100 мкг/мл в 1% растворе БСА в ФСБ-Т и инкубировали в течение 10 мин при комнатной температуре, затем трехкратно промывали с ФСБ-Т. Далее на отмытую мембрану наносили раствор мышиных антител, специфичных против His-tag (Sigma-Aldrich, США) в рабочем разведении в 1%-ном растворе БСА на ФСБ -Т и инкубировали при комнатной температуре в течение 10 мин. После трехкратной промывки мембраны с ФСБ-Т, добавляли козьи анти - мышиные антитела, меченные щелочной фосфатазой. В качестве субстрата для щелочной фосфатазы использовали раствор 5-бром-4-хлор-3-индолил фосфат (BCIP) и нитро синий тетразол (NTB) в водном растворе. Ферментативную реакцию останавливали промывкой дистиллированной водой. Результат дот - блот анализа представлен на фиг. 6 (взаимодействие очищенного препарата рекомбинантных нано - моноантител C7b с антигеном - рекомбинантным белком - рецептором HER2/neu), где:

(К-) - (отрицательный контроль) - сорбированный на мембране бычий сывороточный альбумин, не содержащий His-tag блок, последовательно инкубированный с препаратом рекомбинантных нано - моноантител C7b, содержащих His-tag блок; c препаратом мышиных антител, специфичных против His-tag блока и козьими анти - мышиными антителами, меченными щелочной фосфатазой; К и Кх2 - иммунное взаимодействие сорбированного на мембране рекомбинантного белка - рецептора HER2/neu с препаратом нано - моноантител C7b, конъюгированных с люминесцентными наночистицами диоксида кремния (в однократной и двухкратной концентрации, соответственно) и последовательно c препаратом мышиных антител, специфичных против His-tag блока и козьими анти - мышиными антителами, мечеными щелочной фосфатазой; А - препарат сорбированных на мембране нано - моноантител C7b (без антигена HER2/neu), последовательно инкубированный c препаратом мышиных антител, специфичных против His-tag блока и козьими анти - мышиными антителами, мечеными щелочной фосфатазой; КаН - (без антигена HER2/neu) контроль взаимодействия препарата мышиных антител с рекомбинантным белком TBI ВИЧ содержащий гексагистидиновую метку, специфичных против His-tag блока с козьими анти - мышиными антителами, меченые щелочной фосфатазой; КмА - (без антигена HER2/neu) контроль взаимодействия мышиного антитела 29F2 против белка p24 ВИЧ с козьими анти - мышиными антителами, меченые щелочной фосфатазой.

Пример 6. Синтез наночастиц.

В круглодонной колбе смешивали 27,5 мл гептана и 14,5 мл ПАВа (поверхностно активное вещество) Brij L4. 17 мг комплекса (Bu4N)2[{Mo6I8}(NO3)6] растворяли в 2,5 мл 96 %-го этанола, затем добавляли 2,5 мл воды. К смеси ПАВ/гептан добавляли 0,8 мл раствора комплекса и 0,65 мл раствора аммиака (30%). Смесь оставляли при постоянном перемешивании на 1 час при комнатной температуре, после чего добавляли 1 мл тетраэтилортосиликата. Полученную смесь выдерживали при постоянном перемешивании при комнатной температуре в течение 3 дней, после чего вливали в 50 мл этанола. Осадок, образовавшийся при центрифугировании, промывали трехкратно 96 %-ным этанолом, с последующей трехкратной промывкой дистиллированной водой и однократной промывкой ацетоном. Осадок наночастиц, образовавшийся при центрифугировании, далее высушивали на воздухе (Vorotnikov Y. A. et al. On the synthesis and characterisation of luminescent hybrid particles: Mo 6 metal cluster complex/SiO 2. /RSC Advances. 2016. Т. 6. №. 49. С. 43367-43375).

Пример 7. Конъюгирование нано - моноантител C7b с молекулами SiO2.

7.1. Вариант конъюгирования № 1.

Перед началом проведения конъюгации было приготовлено 4 раствора:

а) буфер для промывания (0.1 M NaCl): 2,9 г NaCl растворяли в 30 мл дистиллированной воды, перемешивали до полного растворения и затем доводили объем раствора до 50 мл.

б) буфер для проведения конъюгации (карбонатный/бикарбонатный буфер): 0,29 г Na2CO3 и 0,19 г NaHCO3 растворяли в 30 мл дистиллированной воды и доводили объем раствора до 50 мл и pH до 10.

в) раствор для связывания свободных антител: 50 мг глицина растворяли в 10 мл воды, затем доводили объем раствора до 20 мл. К полученному раствору добавляли 0,014 мл ПАВа Triton X-100.

г) буфер для хранения: 2,9 г NaCl растворяли в 30 мл дистиллированной воды, перемешивали до полного растворения и затем доводили объем раствора до 50 мл. К полученному раствору добавляли 30 мг трис(гидроксиметил)аминометана (pH = 8).

Порядок проведения конъюгации. 10 мг наночастиц SiO2 с поверхностью, модифицированной эпоксидными группами, промывали двумя циклами центрифугирования/ресуспендирования 3 мл буфера для промывания. Затем осадок наночастиц SiO2 ресуспендировали в 1,5 мл буфера для проведения конъюгации. К полученной суспензии наночастиц SiO2 добавляли препарат очищенных наноантител с концентрацией 6,7 мг/мл в 0,5 мл забуференном растворе NaCl. Полученную смесь наночастиц SiO2 с наноантителами инкубировали при мягком перемешивании на магнитной мешалке (20 об./мин) на 24 часа при комнатной температуре. Далее конъюгат наночастиц SiO2 с наноантителами отмывали в 3 мл буфера для промывания и ресуспендировали в 3 мл раствора для связывания свободных антител. Суспензию конъюгата перемешивали на магнитной мешалке (250 об./мин) в течение 30 минут, после чего так же промывали двумя циклами центрифугирования/ресуспендирования 3 мл буфера для промывания и ресуспендировали в 1 мл буфера для хранения при 4°C.

7.2. Вариант конъюгирования № 2.

Перед началом проведения конъюгации было приготовлено 4 раствора.

а) буфер для промывания/проведения конъюгации: натрий-фосфатный буфер ФСБ (Фосфатный солевой буфер, 137 mM NaCl, 2.7mM KCl, 10mM Na2HPO4,1.74 mM KH2PO4, pH 7.4).

б) раствор для связывания свободных антител: 50 мг глицина растворяли в 10 мл воды, затем доводили объем раствора до 20 мл. К полученному раствору добавляли 0,014 мл ПАВа Triton X-100.

в) буфер для хранения: 2,9 г NaCl растворяли в 30 мл дистиллированной воды, перемешивали до полного растворения и, затем, доводили объем раствора до 50 мл. К полученному раствору добавляли 30 мг трис(гидроксиметил)аминометана (pH = 8).

Порядок проведения конъюгации. 10 мг наночастиц SiO2 с поверхностью, модифицированной аминогруппами, промывали двумя циклами центрифугирования/ресуспендирования 3 мл буфера для промывания/проведения конъюгации. После второго промывания наночастицы SiO2 ресуспендировали в 2 мл буфера для промывания/проведения конъюгации, содержащего 10% глутарового альдегида. Полученную суспензию наночастиц SiO2 перемешивали на магнитной мешалке (250 об./мин) в течение 2 часов при комнатной температуре, после чего промывали двумя циклами центрифугирования/ресуспендирования 3 мл буфера для промывания/проведения конъюгации. Далее наночастицы SiO2 ресуспендировали в 1,5 мл буфера для промывания/проведения конъюгации и добавляли антитела с концентрацией 6,7 мг/мл в 0,5 мл забуференного раствора NaCl. Полученную смесь наночастиц SiO2 с наноантителами инкубировали при мягком перемешивании на магнитной мешалке (20 об./мин) на 2 часа при комнатной температуре. Далее смесь наночастиц SiO2 с наноантителами промывали 3 мл буфера для промывания промывания/проведения конъюгации и ресуспендировали в 3 мл раствора для связывания свободных антител. Суспензию наночастиц SiO2 с наноантителами перемешивали на магнитной мешалке (250 об./мин) в течение 30 минут, после чего еще промывали двумя циклами центрифугирования/ресуспендирования 3 мл буфера для промывания/проведения конъюгации и ресуспендировали в 1 мл буфера для хранения при 4°C.

Пример 8. Твердофазный иммуноферментный анализ (ТФ-ИФА).

Исследование специфического взаимодействия очищенного препарата рекомбинантных нано - моноантител C7b с коммерческим препаратом рекомбинантного белка - рецептора HER2/neu человека (R&D system Inc. США).

Для проведения ТФ-ИФА использовали высокосорбционные стриповые 96-луночные полистироловые планшеты Nunc (Termoscientific, США). Сенсибилизацию ячеек планшетов очищенным препаратом рекомбинантных нано - моноантител C7b или их конъюгатом с молекулами диоксида кремния выполняли в трис - солевом буфере, содержащем 0,15M NaCl; 0,02M трис - HCl рН 7,4 (ТСБ) в объеме 100 мкл/лунка при 22°C в течение 18 часов. Титрование очищенного препарата рекомбинантных нано - моноантител C7b и их конъюгата с молекулами диоксида кремния проводили с разведения 1/100 (что соответствует 6700 и 3400 нг/лунка, соответственно) 2-х кратным шагом. После трехкратной отмывки с ТСБ с 0,05% твин-20 (ТСБ-Т) в лунки добавляли по 150 мкл блокировочного 1%-го раствора казеина в ТСБ-Т и инкубировали в течение 1 часа при 37°С. Затем раствор казеина удаляли и инкубировали сорбированные нано - моноантитела C7b с рекомбинантным белком HER2/neu человека, в ранее выбранном рабочем разведении 1/100 (что соответствует 50нг/лунка), в объеме 50 мкл/лунка 0,5%-го раствора казеина в ТСБ-Т и инкубировали в течение 1 часа при 37°С. После трехкратной отмывки лунок с ТСБ-Т буфером, в них добавляли по 100 мкл пероксидазного конъюгата антител Goat - anti human (Sigma-Aldrich, США), в ранее выбранном рабочем разведении 1/2000 и инкубировали в течение 1 часа при 37°С. После трехкратной отмывки лунок с ТСБ-Т буфером в них добавляли по 50 мкл жидкого субстрата на основе ТМБ (3,3',5,5'–Tetramethylbenzidine) и буфера, содержащего Н2О2 для окисления субстрата. Проявление иммунной реакции нано - моноантител с рекомбинантным антигеном HER2/neu и ферментативной реакции субстрата с Н2О2, проводили в течение 15 минут при комнатной температуре в защищенном от света месте. Ферментативную реакцию блокировали добавлением 50 мкл 1 N HCl в каждую лунку и измеряли оптическую плотность (ОП) субстратно-индикаторной смеси на спектрофотометре “Uniscan” при длине волны 450 нм.

В результате проведенного исследования в ТФ-ИФА было показано, что очищенный препарат рекомбинантных нано - моноантител C7b проявляет высокую аффинность к антигену - рекомбинантному белку HER2/neu – аналогу природного рецептора эпидермального фактора роста клеток молочной железы человека, взаимодействуя с ним до разведения антител 1/102400 (фиг. 7 - исследование специфичности взаимодействия в ТФ-ИФА рекомбинантных нано - моноантител C7b с рекомбинантным белком - рецептором HER2/neu человека в концентрации 0,05 мкг/50 мкл), что количественно выражается в 6,54 нг/100 мкл (таблица 1). Конъюгат препарата нано - моноантител C7b с люминесцентными наночастицами диоксида кремния в этом анализе наглядно взаимодействует с антигеном в концентрациях – от 3400 до 850 нг.

Таблица 1

Результат титрования в ТФ-ИФА препаратов нано - моноантител C7b с коммерческим препаратом рекомбинантного антигена, белком HER2/neu человека.

Шаги титрования препаратов Разведения препаратов в объеме 100 мкл/лунка Концентрация очищенного препарата наноантител C7b
(в нг/100 мкл)
Концентрация конъюгата препарата наноантител C7b с диоксидом кремния (в нг/100 мкл)
1 1/100 6700 3400
2 1/200 3350 1700
3 1/400 1675 850
4 1/800 837,5 425
5 1/1600 418,75 212,5
6 1/3200 209,37 106,25
7 1/6400 104,68 53,12
8 1/12800 52,34 26,56
9 1/25600 26,17 13,28
10 1/51200 13,08 6,64
11 1/102400 6,54 3,32
12 1/204800 3,27 1,66

Примечание к табл. 1: рекомбинантный антиген, белок HER2/neu человека (R&D system Inc. США) был использован в концентрации 100 мкг/мл.

Таким образом, примеры 1-8 наглядно подтверждают достижение заявляемого технического результата.

1. Конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами ламы, который обеспечивает узнавание гиперэкспрессирующегося на поверхности опухолевых клеток рецептора эпидермального фактора роста человека 2 (HER2/neu), характеризующийся тем, что люминесцентные наночастицы диоксида кремния имеют модифицированную эпоксидными группами гидрофильную поверхность, химически связанную с аминогруппами рекомбинантных однодоменных нано - моноантител ламы, имеющих аминокислотную последовательность SEQ ID NO:1, молекулярную массу 17 кДа и способных специфически взаимодействовать с рекомбинантным белком HER2/neu.

2. Конъюгат по п. 1, отличающийся тем, что люминесцентные наночастицы диоксида кремния имеют размер от 45 до 55 нм.



 

Похожие патенты:

Изобретение относится к сахарной промышленности, в частности к способам экспертизы качества сахара. Способ органолептической оценки запаха сахара заключается в применении массива восьми сенсоров на основе пьезокварцевых резонаторов с пленками поливинилпирролидона, пчелиного клея, дициклогексан-18-краун-6, бромкрезолового зеленого, полиэтиленгликольсукцината, полиэтиленгликоля ПЭГ-2000, Tween-40, триоктилфосфиноксида, массой 10-20 мкг, отборе в пробоотборник 5-10 г сахара, закрытии его герметично для получения равновесной газовой фазы над пробой, отборе 3 см3 газовой фазы и внесении в ячейку детектирования с прикрепленными в ней сенсорами, регистрации изменения сигналов всех сенсоров ∆F (Гц) в течение 120 секунд, формировании «визуального отпечатка» запаха в виде круговой диаграммы, расчете площади его фигуры S (Гц⋅с), расчете параметра подобия для анализируемой пробы и пробы стандарта по формуле; при значении ε более 0,10 делают вывод о значимом отличии запаха пробы и стандарта.

Изобретение относится к области биотехнологии, конкретно к способам для идентификации связывающих полипептидов (например, антител или их антигенсвязывающих фрагментов), которые специфически связываются с антигеном клеточной поверхности, что может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к композиции для специфического связывания гетеротипичного комплекса кератина 7 с кератином 19, что может быть использовано в медицине.

Изобретение относится к медицине, а именно к терапии, кардиологии и хирургии, и может быть использовано для прогнозирования исхода инфекционного эндокардита. Способ прогнозирования исхода инфекционного эндокардита включает забор образцов венозной крови, выделение геномной ДНК, аллель-специфическую полимеразную цепную реакцию с целью генотипирования по полиморфному локусу MTHFR Ala222Val(С677Т) гена метилентетрагидрофолатредуктазы лиц группы риска и у носителей генотипа MTHFR А1а222А1а(С677С) прогнозируют благоприятный исход заболевания, а у носителей генотипов MTHFR Ala222Val(C677T)/MTHFR Val222Val(T677T) прогнозируют 12,33-кратный риск летального исхода.
Изобретение относится к области физико-химических исследований и может быть использовано для обнаружения и идентификации запрещенных или ограниченных к обороту взрывчатых, наркотических, а также сильнодействующих ядовитых веществ.

Изобретение относится к медицине, а именно к фармакологии и клинической фармакологии, и может быть использовано с целью оценки функциональной активности гликопротеина-Р (Pgp) в гематоэнцефалическом барьере для осуществления эффективной и безопасной фармакотерапии ряда неврологических заболеваний.
Изобретение относится к медицине, а именно к стоматологии, и может быть использовано для подбора индивидуальных средств гигиены полости рта. Для осуществления способа индивидуального подбора средств гигиены полости рта у пациента осуществляют забор ротовой жидкости, очищают зубы механически без использования средств гигиены полости рта, определяют гидрофобность эмали зубов пациента методом «сидячей капли», из банка зубов, удаленных по медицинским показаниям, подбирают зубы, гидрофобность эмали которых соответствует гидрофобности эмали зубов пациента, зубы, предназначенные для исследования средств гигиены полости рта, очищают зубной щеткой средней жесткости с использованием соответствующего исследуемого средства гигиены, в качестве контроля используют зуб, не очищенный средством гигиены полости рта, зубы погружают в ротовую жидкость пациента и термостатируют при температуре 37°С, с интервалом исследования 1 час определяют время появления зубной бляшки на зубах и измеряют гидрофобность эмали зубов методом «сидячей капли», об эффективности средства гигиены полости рта судят по времени появления зубной бляшки и значению гидрофобности эмали по сравнению с контролем.

Изобретение относится к области биохимии, в частности к способу выбора реципиента при пересадке трупной почки, включающему выявление антигенов HLA-A, HLA-B и HLA-DR, сопоставление эпитопов антигенов HLA-A и HLA-B потенциального реципиента и донора, а также выбор реципиента по полученным данным.

Изобретение относится к области медицины, а именно к способам интерпретации результатов лабораторных анализов, и может быть использовано при раке яичников для улучшения результатов лечения путем увеличения количества курсов или изменения тактики адъювантной химиотерапии при неблагоприятных значениях маркеров.

Изобретение относится к области микробиологии и предназначено для идентификации дрожжей рода Pichia. Осуществляют предварительное обогащение дрожжей, осаждение их центрифугированием, выделение ДНК с проведением ПЦР в реальном времени.

Изобретение относится к биохимии и к медицине и представляет собой пептид формулы H[isoD][pS]GYEVHH, где остаток серина является фосфорилированным, а остаток аспарагиновой кислоты изомеризирован.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, в клетках яичника китайского хомячка (СНО).

Группа изобретений относится к иммунологии. Предложены гуманизированное моноклональное антитело к фактору D человека или его антигенсвязывающий фрагмент, его нуклеотидная последовательность, клетка и вектор, которые несут эти антитела, способ его получения и применение для получения композиций для лечения заболеваний и нарушений, ассоциированных с избыточной или неконтролируемой активацией системы комплемента.

Настоящее изобретение относится к области иммунологии. Предложено антитело, обладающее иммунологической реактивностью в отношении белка CAPRIN-1.

Настоящее изобретение относится к области биотехнологии, конкретно к новому агонисту инсулина, конъюгированному с инкретиновым белком, и может быть использовано в медицине.

Настоящее изобретение относится к иммунологии. Предложен связывающий агент, представляющий собой биспецифическое антитело, содержащее домен, связывающийся с клаудином (CLDN), а именно CLDN18.2, и домен, связывающийся с CD3.

Настоящее изобретение относится к области биотехнологии, конкретно к конъюгату белка инсулина с Fc-областью иммуноглобулина, и может быть использовано в медицине. Изобретение позволяет получить конъюгат инсулина с иммуноглобулином, в котором его составные части сайт-селективно связаны ковалентной связью через непептидный полимер-линкер.

Настоящее изобретение относится к области биотехнологии, конкретно к способу получения конъюгата физиологически активного полипептида с константной областью иммуноглобулина.

Изобретение относится к биохимии. Описан способ получения вирусоподобных частиц (VLP) на основе белка L1 папилломавируса человека (HPV), включающий: (a) культивирование трансформированных дрожжей, экспрессирующих белок L1 HPV; (b) выполнение осаждения сульфатом аммония в продукте трансформированных дрожжей, культивированных на стадии (а), для получения преципитата; (c) обработку преципитата, полученного посредством осаждения сульфатом аммония, NaCl, KCl или Na2CO3 в концентрации, находящейся в диапазоне от 0,35 до 0,60 М, с последующей инкубацией и удаление образовавшихся нерастворимых белков; и (d) выполнение хроматографии продукта, полученного на стадии (с), с получением вирусоподобных частиц (VLP) на основе белка L1 папилломавируса человека (HPV).

Настоящее изобретение относится к биотехнологии, в частности к композиции и способу ингибирования начала инфекции Staphylococcus aureus с применением такой композиции. Указанная композиция содержит терапевтически эффективное количество аналога полипептида лейкоцидина А S.
Изобретение относится к области биохимии. Предложен способ электроиммобилизации антител.

Изобретение относится к области биотехнологии, конкретно к получению конъюгатов люминесцентных наночастиц диоксида кремния с антителами, и может быть использовано в диагностике для выявления гиперэкспрессирующегося на поверхности опухолевых клеток рецептора эпидермального фактора роста человека 2. Получают конъюгат люминесцентных наночастиц диоксида кремния с рекомбинантными однодоменными нано - моноантителами ламы, характеризующийся тем, что люминесцентные наночастицы диоксида кремния со средним размером 50±5 нм имеют модифицированную эпоксидными группами гидрофильную поверхность, химически связанную с аминогруппами рекомбинантных однодоменных нано - моноантител ламы, имеющих аминокислотную последовательность SEQ ID NO:1, молекулярную массу 17 кДа и способных специфически взаимодействовать с рекомбинантным белком HER2neu. Изобретение повышает эффективность использования конъюгатов молекул - маркеров с рекомбинантными нано – моноантителами, специфичными к белку HER2neu. 1 з.п. ф-лы, 7 ил., 1 табл., 8 пр.

Наверх