Актг-подобный пептид с иммуносупрессорной функцией



Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией
Актг-подобный пептид с иммуносупрессорной функцией

Владельцы патента RU 2681317:

Федеральное государственное бюджетное учреждение науки Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук (ИБХ РАН) (RU)

Изобретение относится к области органической химии и фармацевтики, в частности к разработке метода медикаментозного лечения различных форм рассеянного склероза у человека. Предметом изобретения является пептид с последовательностью Abu-TGIRIS-Abu-NH2, где Abu - α-аминомасляная кислота, который при внутривенном введении крысам предотвращает развитие у них экспериментального аутоиммунного энцефаломиелита (ЭАЭ) - распространенной животной модели рассеянного склероза. 18 ил., 9 табл., 6 пр.

 

Область техники, к которой относится изобретение

Изобретение относится к области фармацевтики, в частности, к разработке метода медикаментозного лечения различных форм рассеянного склероза у человека.

Несмотря на активные исследования, до настоящего времени не предложено надежного этиотропного метода лечения рассеянного склероза. Механизм возникновения рассеянного склероза экспериментально не доказан. Основными патентообладателями средств терапии этого заболевания традиционно используется следующее описание этого процесса:

1. Причиной нарушения двигательных функций организма больного является разрушение миелиновых оболочек центральной нервной системы. На основании анализа клинической картины РС можно подразделить на четыре категории: RRMS - ремиттирующая форма (85% случаев в мире), PPMS (10% случаев) - первичная прогрессирующая форма, SPMS - вторичная прогрессирующая форма (как правило, развивается при прогрессии заболевания у пациентов с RRMS), PRMS - возвратно-прогрессирующую (5% случаев).

2. Миелиновые оболочки нейронов центральной нервной системы, состоящие из белков: ОБМ (MBP), основной белок миелина; ПЛП (PLP), протеолипидный протеин; МАГ (MAG) миелин-ассоциированный гликопротеин; МОГ (MOG), миелин-олигодендроцитарный гликопротеин, при возникновении рассеянного склероза разрушаются за счет аутоиммунной реакции, причем основной вклад в патологию вносят не Т, а В-лимфоциты.

3. В популяции В-лимфоцитов имеется субпопуляция клеток, продуцирующих ростовой лимфокин GM-CSF (гранулоцитарно-макрофагальный колониестимулирующий фактор). Активность этой популяции приводит к снижению уровня продукции тормозного медиатора иммунной системы IL-10. Подавление продукции GM-CSF или инактивация продуцирующих его клеток приводит к облегчению симптомов рассеянного склероза.

4. Т-лимфоциты, специфично распознающие антигены белков миелиновой оболочки (ОБМ, ПЛП, МАГ и МОГ), способны подавлять активность B-лимфоцитов, направленную на разрушение миелиновых оболочек. Поэтому стимуляция Т-клеточного ответа при рассеянном склерозе положительно сказывается на состоянии больных.

5. Под влиянием интерферонов, особенно интерферона β, происходит подавление активности B-лимфоцитов при одновременной стимуляции Т-лимфоцитов, благодаря чему происходит улучшение состояния пациентов с РС.

6. Снижение активности иммунной системы в целом или отдельных ее частей приводит к симптоматическому облегчению течения рассеянного склероза. Поэтому для лечения этого заболевания используются все основные классы иммунодепрессантов различной степени специфичности: неспецифические цитостатики и иммунодепрессанты, блокаторы проникновения лимфоцитов в ткани (антагонисты рецептора адгезии на эндотелии сосудов интегрина 4α), антитела, распознающие поверхностные рецепторы В-лимфоцитов (CD20, рецептор IL2), блокаторы S1P-рецепторов лимфоцитов, в частности финголимод. Эти соединения блокируют сфингозин-1-фосфатные рецепторы (S1P-рецепторы).

Анализ патентной литературы, а также публикаций и материалов маркетингового характера, позволяет предложить следующую классификацию типов лекарственных средств для терапии рассеянного склероза:

1. Неспецифические цитостатики, аналогичные применяемым для лечения онкологических заболеваний, и иммунодепрессанты кортикостероидной природы и на основе адренокортикотропного гормона;

2. Препараты интерферонов, в том числе, интерферонов β-1a, β-1b и γ, включая их химически модифицированные формы;

3. Модуляторы S1P-рецепторов - 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол (финголимод) и другие;

4. Т-клеточные вакцины, направленные на активацию или подавления антиген-зависимого распознавания белков миелина;

5. Блокаторы рецепторов на поверхности В-лимфоцитов: CD20 и субъединицы рецептора IL-2, рецептор Fcγ;

6. Антитела против лимфокина GM-CSF;

7. Пептиды, имитирующие ОБМ или другие антигены миелиновой оболочки;

8. Композиции известных субстанций, включая перечисленные выше.

9. Физиотерапевтические способы воздействия лечения и их комбинации с перечисленными медикаментозными средствами.

Уровень техники

Анализ научно-технической литературы в области разработки средств лечения рассеянного склероза позволил выявить следующие характеристики технического уровня и тенденций развития методов медикаментозного лечения рассеянного склероза.

Рассеянный склероз (РС) - англ. Multiple sclerosis (MS), представляет собой воспалительное заболевание, проявляющееся в нарушении миелиновой оболочки центральной нервной системы. РС широко распространен во всем мире. Например, в США в настоящее время зарегистрировано свыше 300000 пациентов с РС. Заболевание как правило начинается в достаточно молодом возрасте: у 70-80% пациентов первые симптомы РС проявились в возрасте от 20 до 40 лет (Anderson et al. Ann Neurology 31(3):333-6 (1992); Noonan et al. Neurology 58:136-8 (2002)). Диагностика РС основана на клиническом осмотре невропатологом, магнитно-резонансном исследовании ЦНС (МРТ), гистологическом анализе материалов биопсии и аутопсии (Lucchinetti et al. Ann Neurol 47:707-17 (2000)). Болезнь имеет множество различающихся клинических проявлений, затрагивающих функции спинного мозга, головного мозга, черепных нервов, мозжечка, когнитивные функции. Большинство пациентов с РС полностью утрачивают подвижность через 25 лет после появления первых симптомов заболевания. Более половины пациентов с РС через 15 лет после начала болезни могут передвигаться только на костылях. РС является самой распространенной в мире неврологической патологией у пациентов молодого возраста. До настоящего времени для лечения этой болезни не предложено эффективного этиотропного средства. Диагностика РС затруднена чрезвычайным многообразием клинических проявлений. При этом не выработано универсального метода клинической диагностики, позволяющего однозначно оценивать тяжесть заболевания. Использование МРТ, электроэнцефалографии и биохимический анализ пунктатов спинно-мозговой жидкости, хотя и дают ценные сведения о состоянии больного, не всегда могут быть интерпретированы однозначно. Многие частные проявления РС могут быть вызваны не связанными с ним причинами: инфекционными заболеваниями, сосудистыми патологиями, аутоиммунными заболеваниями различной природы (McDonald et al. Ann Neurol 50:121-7 (2001)). РС может быть подразделен на четыре формы: возвратно-ремиттирующую (приступообразную) RRMS - 80%-85% всех регистрируемых случаев, первичную прогрессирующую - PPMS (10-15% случаев), возвратно-прогрессирующую - PRMS (5% случаев) и вторично-прогрессирующую - SPMS (Kremenchutzky et al. Brain 122 (Pt 10):1941-50 (1999); Confavreux et al. N Engl J Med 343(20):1430-8 (2000)). Около 50% пациентов с RRMS приобретают симптомы SPMS через 10 лет после начала заболевания. Свыше 90% пациентов с RRMS в конечном итоге приобретают симптоматику SPMS (Weinshenker et al. Brain 112 (Pt 1):133-46 (1989)).

Иллюстрируя различия в особенностях течения различных форм РС, необходимо отметить, что в 2010 г в США было допущено к применению шесть препаратов для лечения RRMS, но ни один из них не был разрешен для лечения PPMS. Для лечения RRMS допущены препараты:

1) Класс интерферонов: ИФН-β-1a (REBIF® и AVONEX®); ИФН-β-1b (BETASERON®);

2) Ацетат глатирамера (COPAXONE®), полипептид со случайной последовательностью;

3) Натализумаб (TYSABRI®) - гуманизированное моноклональное антитело против α4-интегрина;

4) Митоксантрон (NOVANTRONE®), блокатор топоизомеразы II, цитостатик.

В ходе испытаний с различной степенью успеха использовались другие препараты: иммунодепрессанты-кортикостероиды, цитостатики метатрексат, циклофосфамид, азатиоприн, внутривенные инъекции нормального иммуноглобулина. По данным метаанализа публикаций, существующие методы лечения позволяют добиться улучшения у ~30% пациентов с RRMS, проявляющиеся в сокращении частоты и силы приступов (Filippini et al. Lancet 361:545-52 (2003)).

Использование для лечения РС других иммуномодулирующих препаратов, в частности, антител к TNFα (Infliximab) не только не облегчало, но и усугубляло течение РС (Lenercept Multiple Sclerosis Study Group and the University of British Columbia MS/MRI Neurology 53:457-65 (1999); Bielekova et al. Nat Med 6:1167-75 (2000), erratum appears in Nat Med 6:1412 (2000)).

В литературе господствует мнение, что патофизиология РС обусловлена воспалительной реакцией, регулируемой Т-лимфоцитами CD4+Th1-типа. Терапия препаратами ИФН-β и ацетата глатирамера, хотя и не приводят к стойкому излечению, позволяют купировать приступы болезни и замедлить инвалидизацию.

В последние десятилетия при исследовании спинно-мозговой жидкости пациентов с РС удалось убедительно доказать существование специфических для этого заболевания олигоклональных антител класса IgG, которые используются в диагностике РС (Siden A. J Neurol 221:39-51 (1979); McDonald et al. Ann Neurol 50:121-7 (2001); Andersson et al. Eur J Neurol 9:243-51 (2002); O'Connor, P. Neurology 59:S1-33 (2002)). Наличие таких олигоклональных антител, свободных легких цепей иммуноглобулинов, повышение уровня IgM в спинно-мозговой жидкости является признаком, усугубляющим прогноз течения РС у конкретного пациента (Rudick et al. Mult Scler 1:150-5 (1995); Zeman et al. Acta Cytol 45:51-9 (2001); Izquierdo et al. Acta Neurol Scand 105:158-63 (2002); Wolinsky J. J Neurol Sci 206:145-52 (2003); Villar et al. Ann Neurol 53:222-6 (2003)).

Антитела к белкам миелина: ОБМ и МОГ могут служить маркером тяжести РС (Reindl et al. Brain 122:2047-56 (1999); Egg et al. Mult Scler 7(5):285-9 (2001)). Особенно заметно накопление таких антител в спинно-мозговом ликворе пациентов с РС (Reindl et al. Brain 122:2047-56 (1999); Egg et al. Mult Scler 7(5):285-9 (2001); Andersson et al. Eur J Neurol 9:243-51 (2002)). Кроме этого, у пациентов с РС отмечается появление антител к ганглиозидам и нейрофиламентам (Mata et al. Mult Scler 5:379-88 (1999); Sadatipour et al. Ann Neurol 44:980-3 (1998)). По последним данным уровень антител к ОБМ и МОГ позволяет оценивать степень демиелинизации ЦНС у пациентов с RRMS (Berger et al. N Engl J Med 349:139-45 (2003)). Наличие антител к обоим указанным белкам миелина позволило предсказать скорое начало приступа у 76,5% наблюдавшихся пациентов, тогда как наличие антител только к MOG позволило выявить только 31,6% таких пациентов.

Многие специалисты в области РС считают, что наличие в ликворе плазматических клеток, продуцирующих антитела, является значимым фактором образования очагов демиелинизации при РС (Prineas and Wright, Lab Invest 38:409-21 (1978); Esiri M. Neuropathol Appl Neurobiol 6:9-21 (1980); Genain et al. Nat Med 5:170-5 (1999); Lucchinetti et al. Ann Neurol 47:707-17 (2000); Wingerchuk et al. Lab Invest 81:263-81 (2001)). Высокая концентрация B-лимфоцитов в ликворе является значимым отрицательным прогностическим признаком при РС (Cepok et al. Brain 124 (Pt 11):2169-76 (2001)).

У пациентов с RRMS, как и у больных с опсо-миоклональным синдромом, удается добиться стойкого улучшения состояния за счет внутривенного введения Ритуксимаба - гуманизированных моноклональных антител к CD20, основному поверхностному маркеру B-лимфоцитов (Pranzatelli et al. Neurology 60(Suppl1) PO5.128:A395 (2003); Cross et al. “Preliminary Results from a Phase II Trial of Rituximab in MS” (abstract) Eighth Annual Meeting of the Americas Committees for Research and Treatment in Multiple Sclerosis ACTRIMS 20-1 (2003)). See also Cree et al. “Tolerability and Effects of Rituximab “Anti-CD20 Antibody” in Neuromyelitis Optica and Rapidly Worsening Multiple Sclerosis” Meeting of the Am. Acad. Neurol. (2004).

Поверхностный антиген В-лимфоцитов CD20, известный также, как антиген дифференцировки B-лимфоцитов Bp35, представляет собой гидрофобный трансмембранный белок массой ~35 кДа, имеющийся как у зрелых B-лимфоцитов, так и у их предшественников (Valentine et al. J. Biol. Chem. 264(19):11282-11287 (1989); and Einfeld et al. EMBO J. 7(3):711-717 (1988)). Этот антиген часто (более чем в 90% случаев) обнаруживается на поверхности клеток неходжкинских лимфом (Anderson et al. Blood 63(6):1424-1433 (1984)). Однако, CD20 отсутствует на поверхности стволовых кроветворных клеток, плазматических клеток и других нормальных тканей человека (Tedder et al. J. Immunol. 135(2):973-979 (1985)). CD20 regulates an early step(s) in the activation process for cell cycle initiation and differentiation (Tedder et al., J. Immunol. 135(2): 973-979 (1985)). Высказывались предположения, что CD20 представляет собой кальциевый канал (Tedder et al. J. Cell. Biochem. 14D:195 (1990)).

С учетом высокой избирательности экспрессии CD20 на поверхности В-лимфоцитов и В-клеточных лимфом его традиционно используют в качестве мишени для адресации терапевтических агентов в этот тип опухолей. Именно с этой целью компанией Genetech из США был разработан препарат гуманизированных моноклональных антител Ритуксимаб (Rituximab) (RITUXAN®) (U.S. Pat. No. 5,736,137). В настоящее время он нашел широкое применение и для лечения РС, особенно RRMS.

Известен и ряд других препаратов гуманизированных моноклональных антител против CD20 человека и их конъюгатов с цитотоксическими агентами, предназначенных для внутривенного введения людям. В это число входят:

1. Ibritumomab Tiuxetan (ZEVALIN®) - конъюгированное с Иттрием-90 производное гуманизированных мышиных моноклональных антител 2B8 (Y2B8)” производства IDEC Pharmaceuticals, Inc. (U.S. Pat. No. 5,736,137). Клон 2B8 депонирован в ATCC под номером доступа HB11388 в июне 1993);

2. Tositumomab (BEXXAR™) - мышиные моноклональные антитела класса IgG2a меченные 131I производства Corixa (U.S. Pat. No. 5,595,721);

3. 1F5 - Мышиные моноклональные антитела и их гуманизированное производное (Press et al. Blood 69(2):584-591 (1987); WO03/002607, Leung, S.) Клон депонирован в ATCC под номером HB-96450;

4. huMax-CD20 - Мышиные моноклональные антитела 2H7 и их гуманизированное производное 2H7 (U.S. Pat. No. 5,677,180; WO 2004/035607) производства Genmab, Дания;

5. AME-133 - гуманизированное производное мышиного моноклонального антитела производства Applied Molecular Evolution;

6. IMMU-106 - гуманизированное производное мышиного моноклонального антитела А20 (US 2003/0219433, Immunomedics) и его искусственные производные с удаленным остатком Leu16 в антиген-связывающем центре, с двойной специфичностью связывания CD22/CD20, а также его конъюгат с IL-2 (US 2005/0069545A1; WO 2005/16969; Carr et al.);

7. hLL2xhA20 - моноклональные антитела с двойной специфичностью (WO 2005/14618, Chang et al.);

8. Моноклональные антитела L27, G28-2, 93-1B3, B-C1 и NU-B2, распространяемые группой International Leukocyte Typing Workshop (Valentine et al., In: Leukocyte Typing III (McMichael, Ed., p.440, Oxford University Press (1987));

9. Конъюгат моноклональных антител 1H4 с ауристатином Е производства Seattle Genetics;

10. Конъюгаты моноклональных антител против CD20 с IL2 производства EMD/Biovation/City of Hope;

11. Моноклональные антитела против CD20 производства EpiCyte;

12. Моноклональные антитела TRU 015 против CD20 производства Trubion.

Еще одним коммерчески доступным препаратом, активно применяемым для лечения РС путем воздействия на популяцию лимфоцитов, является Даклизумаб, рекомбинантное гуманизированное антитело класса IgG1, направленное против α-субъединицы (Тас) рецептора IL-2. Этот препарат обладает мощными иммуносупрессорными свойствами. Связываясь с субъединицей Тас высокоаффинного рецептора IL-2, экспрессирующегося на активированных Т-клетках, Даклизумаб специфично подавляет передачу сигнала через этот рецептор, угнетает опосредованную IL-2 активацию лимфоцитов, тормозит иммунную реакцию отторжения трансплантата.

Основное назначение даклизумаба - предотвращение острого отторжения почечного аллотрансплантата после пересадки. После 6 месячного применения и последующей отмены даклизумаба частота отторжения остается приемлемой. Увеличивает 6- и 12-месячную выживаемость больных после трансплантации. Антитела к даклизумабу обнаруживаются у 9% больных, но они не изменяют его сывороточные концентрации, эффективность и безопасность.

Мутагенной и канцерогенной активности не обнаружено. Многократное введение яванским макакам доз 1,5; 5,0 и 15 мг/кг/сут в течение 28 дней и однократное введение мышам доз 125 мг/кг не сопровождалось проявлениями токсичности.

Cmax у больных, перенесших аллогенную пересадку почки, после однократного введения дозы 1 мг/кг составляет 21±14 мкг/мл, после 5 инфузий (доза 1 мг/кг) каждые 14 дней - 32±22 мкг/мл. Полное насыщение рецепторов к IL-2 происходит при сывороточных концентрациях 0,5-0,9 мкг/мл, подавление опосредованной IL-2 биологической активности - при уровне в плазме 5-10 мкг/мл. Соблюдение режима дозирования позволяет поддерживать достаточные сывороточные концентрации на протяжении более 90 дней после трансплантации.

Еще одним препаратом, активно используемым для лечения РС, является иммунодепрессант финголимод. Механизм его действия заключается в том, что, проникая в лимфоциты, он метаболизируется сфингозинкиназой до активного метаболита финголимода фосфата. В низких наномолярных концентрациях финголимода фосфат связывается с S1P-рецепторами лимфоцитов 1, 3, и 4 типов и быстро проникает в центральную нервную систему (ЦНС) через гематоэнцефалический барьер, связываясь с S1P-рецепторами нервных клеток 1, 3, и 5 типов. Связывая S1P-рецепторы лимфоцитов, финголимода фосфат блокирует способность лимфоцитов покидать лимфатические узлы, что приводит к перераспределению лимфоцитов в организме. При этом не происходит уменьшения общего количества лимфоцитов в организме. Перераспределение лимфоцитов приводит к снижению лимфоцитарной инфильтрации ЦНС, уменьшению выраженности воспаления и степени повреждения нервной ткани. В течение 4-6 часов после однократного приема препарата в дозе 0,5 мг число лимфоцитов крови снижается приблизительно до 75% от исходного значения. При длительном ежедневном применении препарата число лимфоцитов продолжает снижаться в течение 2-х недель, достигая минимального показателя 500 клеток/мкл или приблизительно 30% от исходного уровня. У 18% больных отмечалось (по крайней мере, однократное) снижение числа лимфоцитов ниже 200 клеток/мкл. При регулярном приеме препарата снижение числа лимфоцитов сохранялось. Поскольку большинство Т- и В-лимфоцитов постоянно проходят через лимфоидные органы, влияние финголимода на эти клетки выражено в наибольшей степени. Однако около 15-20% Т-лимфоцитов, являющихся эффекторными клетками памяти и играющими важную роль в периферическом иммунном контроле, не проходят через лимфоидные органы и не подвержены воздействию финголимода. В течение нескольких дней после прекращения приема препарата в крови отмечается повышение числа лимфоцитов. Нормализация количества лимфоцитов происходит через 1-2 месяца после прекращения лечения. Постоянный прием финголимода приводит к небольшому снижению числа нейтрофилов приблизительно до 80% от исходного показателя. Моноциты не подвержены воздействию финголимода. При применении у пациентов с ремиттирующим РС (средний балл по шкале инвалидности, EDSS, 2,0) финголимод в дозе 0,5 мг снижает частоту клинических обострений болезни на 54%. При приеме препарата у 70-% отмечалась стабильная ремиссия в течение 2-х лет (по сравнению с 45,6% в группе плацебо). Финголимод достоверно снижал риск прогрессирования нетрудоспособности. При применении препарата достоверно увеличивалось время до наступления 3-месячного и 6-месячного периода подтвержденного прогрессирования нетрудоспособности (оцениваемого как повышение оценки по шкале EDSS от исходных показателей) по сравнению с плацебо. Результаты магнитно-резонансной томографии (МРТ) головного мозга больных ремиттирующим РС, на фоне лечения финголимодом подтверждают значительное снижение активности течения заболевания (интенсивности воспалительного процесса в ЦНС, размеров и количества очагов демиелинизации).

Результаты выполненного патентного поиска показывают, что в области патентования исследуемой темы явных лидеров не существует, тем не менее, основными патентодержателями являются американские компании Genetech и Novartis, университет Южной Калифорнии, университет Альберты (Канада), а также израильская компания Teva Pharmaceutical Industries Ltd. В целом, количество патентов по данной тематике достаточно велико, что свидетельствует о перспективности данного направления и патентоемкости рынка.

Для анализа и обобщения сведений, полученных из описаний изобретений, их можно сгруппировать по следующим направлениям.

1. Неспецифические цитостатики и иммунодепрессанты;

2. Препараты интерферонов, включая их химически модифицированные формы;

3. Блокаторы рецептора SlP;

4. Т-клеточные вакцины;

5. Блокаторы рецепторов на поверхности В-лимфоцитов;

6. Пептиды, имитирующие антигены миелиновой оболочки;

7. Блокаторы GM-CSF;

8. Композиции известных субстанций, включая перечисленные выше.

9. Физиотерапевтические способы воздействия лечения и их комбинации с перечисленными медикаментозными средствами.

Анализ отобранной информации свидетельствует, что организации и фирмы многих развитых стран мира проявляют интерес к проблеме лечения РС. Особенно интенсивно исследования проводятся в США.

Патенты по использованию пептидов предлагаемой нами последовательности для лечения РС нами не обнаружены, хотя имеется ряд патентов по использованию в этом качестве фрагментов ОБМ и других антигенов миелина.

В патенте РФ 2471482 «Композиция для лечения рассеянного склероза (варианты)», автора Фазылова М.Ф., патентообладателя «Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU)», дата подачи заявки (приоритет) 27.10.2011, опубликованном 10.01.2013, раскрывается изобретение, относящееся к области фармацевтики. Изобретение представляет собой фармацевтическую композицию для лечения РС, включающую терифлуномид в качестве активного начала и вспомогательные вещества при следующем соотношении компонентов, мас.%: терифлуномид - 3,0-13,5; лактоза и/или лудипресс LCE -48,5-65,0; крахмал - 7,0-16,0; микрокристаллическая целлюлоза и/или гипромеллоза - 20,0-30,0; коллидон VA-64 - 3,5-4,5; стеарат магния - 0,8-1,2; аэросил - 0,8-1,2; бенецел МР-824 - 13,5-15,5.

В патенте РФ 2492234 «Композиции для лечения рассеянного склероза (варианты)», автора Фусса А. (FR), патентообладателя «ТИксСЕЛЛ (FR)», дата подачи заявки (приоритет) 17.10.2008, опубликованного 10.09.2013, раскрывается изобретение, относящееся к получению популяции регуляторных Т-клеток (Tr1-клеток), направленных против антигена, ассоциированного с РС, и может быть использовано для восстановления нарушенной толерантности к белкам миелина. Выделяют популяцию Tr1-клеток, направленных против антигена, ассоциированного с РС, и имеющих в покое фенотип CD4+CD25-FoxP3-. Полученную популяцию Tr1-клеток в комбинации с одним или несколькими фармацевтически приемлемыми носителями либо в комбинации с одним или более фармацевтическим средством, применяемым для лечения РС, выбираемым из группы, включающей интерферон-β, глатимера ацетат, митоксантрон, циклофосфамид, метотрексат, азиатропин или натализумаб, используют в составе фармацевтических композиций для лечения РС.

В патенте РФ 2199339 «Способ лечения рассеянного склероза», авторов Барбас И.М., Тотолян Н.А., Скоромец А.А., Смирнов М.Н., Животовская М.Л., Яковлева В.С., патентообладателя «Общество с ограниченной ответственностью "БИОТЕХ"», дата подачи заявки (приоритет) 23.02.2001, опубликованном 27.02.2003, раскрывается метод лечения больных РС. Больным в стадии обострения вводят внутривенно капельно препарат интерлейкина-2 человека (IL-2), например Ронколейкин, в дозе не менее 1 млн. ME 1 раз в 7 дней. Способ позволяет значительно сократить сроки лечения больных РС с выраженным иммунодефицитом, добиться упреждения рецидивов RRMS, продлить период трудоспособности пациентов.

В патенте РФ 2130308 «Применение замещенных производных аденина для лечения рассеянного склероза», автора Беутлер Э.(US), патентообладатель «The Scripps Research Institute (US)», дата подачи заявки (приоритет) 18.02.1993, опубликовано 20.05.1999, МПК А61К 31/70 (1995.01) описывается новый способ лечения пациентов, страдающих РС, с помощью терапевтических средств, содержащих производные аденина, такие как 2-хлор-2-дезоксиаденозин. Препарат значительно улучшает состояние больного, не дает технических побочных эффектов в виде тошноты, рвоты, кожной сыпи, почечные или печеночные нарушения.

В патенте РФ 2137131 «Гибридная клеточная линия (варианты), препарат антител (варианты), способ диагностики рассеянного склероза у человека (варианты), способ лечения человека, полипептид», авторов Клайн Э.Л. (US), Зиммерман Д.Х. (US), патентообладатель «Molecular RX Inc. (US), CellMed Inc. (US)», дата подачи заявки (приоритет) 17.12.1993, опубликовано 10.09.1999, МПК G01N 33/53 (1995.01), C12N 5/08 (1995.01), C12N 15/06 (1995.01), A61K 38/17 (1995.01), A61K 39/00 (1995.01), C07K 14/435 (1995.01) описан метод выявления антигенов, ассоциированных с РС. Также предметом изобретения является метод получения гибридом, которые продуцируют моноклональные антитела, специфичные в отношении антигенов, ассоциированных с РС. Возможности применения изобретения заключается в диагностике РС и в текущем диспансерном наблюдении за больными РС с точки зрения развития болезни либо реакции на терапию. Техническим результатом изобретения является возможность диагностики и лечения РС и других демиелинизирующих заболеваний.

В патенте РФ 2563521 «Способы и композиции для диагностики и лечения аутоиммунной болезни, возникающей вследствие рассеянного склероза», Коуолз А.Дж. (GB), Джоунз Д.Л. (GB), Компстон А. (GB), патентообладатель «КЕМБРИДЖ ЭНТЕРПРАЙЗ ЛИМИТЕД (GB)», дата подачи заявки (приоритет) 08.10.2009, опубликовано 20.09.2015, Бюл. №26, МПК C12Q 1/68 (2006.01) описаны способы диагностики пациентов с PC. Способы предусматривают идентификацию пациентов с РС, имеющих повышенный риск развития рецидива аутоиммунного заболевания после курса истощения популяции лимфоцитов с применением гуманизированного моноклонального антитела против маркера В-лимфоцитов CD52. Также предусматриваются способы выбора схемы лечения для пациентов с PC и реагентов, пригодных для использования в вышеописанных способах.

В патенте РФ 2140247 «Способ лечения рассеянного склероза и дегенераций нервной системы», авторов Казанцева Н.В., Гусев Е.И., Макарова Л.Д., Тимофеев В.Т., патентообладатель Казанцева Наталья Вениаминовна, дата подачи заявки (приоритет) 30.12.1998, опубликовано 27.10.1999, МПК A61G 10/02 (1995.01), A61K 31/47 (1995.01), A61K 31/525 (1995.01), A61K 31/19 (1995.01) описан метод лечения РС с применением оксидантов. Больному назначают ежедневный прием препаратов, усиливающих митохондриальное окисление в терапевтических дозах. Помещают больного в лечебную барокамеру. Проводят компрессию до достижения избыточного давления 0,03-0,1 атм. Через 10-20 мин завершают сеанс, проводя декомпрессию. Ежедневно повторяют воздействие до 4-10 сеансов. Выбор параметров лечебного режима и количества сеансов проводится индивидуально в зависимости от тяжести и характера заболевания под контролем динамики неврологического статуса, капнограммы и/или КЩС, проводят повторные курсы лечения 2 раза в год, а при ухудшении состояния и чаще, под контролем ПОЛ, иммунного статуса, вызванных потенциалов мозга и ЭЭГ. В остром периоде аутоиммунного воспаления метод сочетают с гормонами, цитостатиками и иммуномодуляторами в меньшей, чем принято, дозе, под контролем иммунного статуса. Способ позволяет снижать содержание продуктов перекисного окисления липидов в плазме крови и повышать уровень естественной защиты организма.

В патенте РФ 2509573 «Лекарственное средство для лечения рассеянного склероза и способ лечения рассеянного склероза», автора Эпштейн О.И., патентообладатель Эпштейн О.И., дата подачи заявки (приоритет) 27.07.2010, опубликовано 20.03.2014, Бюл. №8, МПК A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан способ лечения рассеянного склероза с применением гомеопатических доз («активированная-потенцированная форма») антител к гамма-интерферону человека (ИФН-γ) и антител к мозгоспецифическому белку S-100.

В патенте РФ 2539034 «Лечение рассеянного склероза», авторов Штайдль С. (DE), Дюрр, М. (DE), Томассен-Вольф Э. (DE), Даунхэм М. (IT), Фрайзен Р. (NL), патентообладатель «МорфоСис АГ (DE)», дата подачи заявки (приоритет) 04.05.2010, опубликовано 10.01.2015, Бюл. №1, МПК C07K 16/22 (2006.01), C07K 16/24 (2006.01), C12N 15/13 (2006.01), A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан метод получения гуманизированных моноклональных антител, нейтрализующих активность гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF) и применения этих антител для лечения или профилактики пациентов с РС.

В патенте РФ 2384345 «Способ лечения рассеянного склероза» автора Фрона П.А. (US), патентообладатель, Genentech Inc. (US)», дата подачи заявки (приоритет) 02.06.2005, опубликованном 20.03.2010, Бюл. №8, МПК A61K 39/395 (2006.01) описана группа изобретений, включающая способ и изделие, предназначенные для лечения РС. Способ заключается во введении пациентам с ремиттирующей формой РС моноклональных гуманизированных антител против поверхностного рецептора В-лимфоцитов CD20 в количестве 0,5-4,0 г. Через 16-60 недель повторяют введение. Проводится до 4 и более воздействий антитела. Каждое из воздействий - в виде одной или двух доз антитела. Антитело может вводиться внутривенно, подкожно или эпидурально. При этом может использоваться второе лекарственное средство.

В патенте РФ 2390334 «Способ лечения рассеянного склероза», авторов Евдошенко Е.П., Маслянский А.Л., Заславский Л.Г., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Санкт-Петербургский государственный медицинский университет имени академика И.П. Павлова Федерального агентства по здравоохранению и социальному развитию", дата подачи заявки (приоритет) 17.12.2008, опубликовано 27.05.2010, Бюл. №15, МПК A61K 31/137 (2006.01), A61K 39/39 (2006.01), A61P 25/28 (2006.01) описан метод лечения больных РС, заключающийся в инфузии ритуксимаба в дозе 1 г с последующим введением митоксантрона в дозе 20 мг и повторной инфузии ритуксимаба в дозе 1 г через 13-15 дней. Перед инфузией ретуксимаба проводят премедикацию по описанному ранее методу. Способ позволяет достичь быстрого терапевтического эффекта и длительной ремиссии при всех формах РС без сопутствующей терапии, в т.ч. химиотерапии.

В патенте РФ 2208443 «Способ лечения рассеянного склероза» авторов Луцевич Э.В., Праздников Э.Н., Стулин И.Д., Самохин Г.Г., Савин А.А., Ушаков С.О., Вельшер Л.З., Золотовская И.К., патентообладатель Самохин Г.Г., дата подачи заявки (приоритет) 20.02.2001, опубликованном 10.03.2003, Бюл. №7, МПК A61K 35/39 (2000.01), A61K 31/197 (2000.01), A61K 31/44 (2000.01), A61K 31/375 (2000.01), A61K 31/395 (2000.01) описан способ лечения больных демиелинизирующими заболеваниями, в частности РС. Способ включает введение ингибитора протеолиза и водорастворимого антиоксиданта в разные поверхностные паховые лимфатические узлы в разовых дозах на порядок меньше среднетерапевтических со скоростью 0,4 мл/мин ежедневно в течение 20 суток.

В патенте РФ 2523058 «Способ терапии ремиттирующего рассеянного склероза», авторов Завалишин И.А., Елисеева Д.Д., Быковская С.Н., патентообладатель Общество с ограниченной ответственностью "Регенекс" (RU), дата подачи заявки (приоритет) 29.06.2012, опубликованном 20.07.2014, Бюл №20, МПК A61K 35/14 (2006.01), A61P 25/28 (2006.01) описан способ лечения ремиттирующего РС. Для этого больному в стадии ремиссии ремиттирующего РС вводят выращенные ex vivo аутологичные регуляторные Т-клетки CD4+CD25+Foxp3+ (супрессоры аутоиммунного ответа) из расчета 4,5-5,5 млн клеток на 1 кг веса пациента. Использование данного способа приводит к повышению уровня CD4+CD25+Foxp3+ регуляторных Т-клеток в 2 и более раза и поддержанию на уровне нормы, что позволяет пролонгировать состояние ремиссии заболевания до 12 месяцев.

В патенте РФ 2393861 «Композиция для лечения рассеянного склероза», авторов Страдомский Б.В., Вилков Г.А., патентообладатель Аверин К.М., Солодунов Ю.Ю., Страдомский Б.В., Вилков Г.А., дата подачи заявки (приоритет) 15.01.2009, опубликованном 10.07.2010, Бюл. №19, МПК A61K 31/4184 (2006.01), A61K 31/14 (2006.01), A61K 47/32 (2006.01), A61K 9/08 (2006.01), A61K 9/20 (2006.01), A61K 9/48 (2006.01), A61P 25/28 (2006.01) описана композиция (твердая или жидкая форма) для лечения РС, содержащая цитостатик трийодид 1,3-диэтилбензимидазолия в качестве активного начала, поливинилпирролидон низкомолекулярный медицинский, являющийся солюбилизатором и стабилизатором активного начала, и дополнительно в жидкой форме - спирт этиловый в качестве растворителя.

В патенте РФ 2414899 «Средства для лечения рассеянного склероза» авторов Страдомский Б.В., Вилков Г.А., патентообладатель Аверин К.М., Вилков Г.А., Страдомский Б.В., Солодунов Ю.Ю., дата подачи заявки (приоритет) 29.12.2009, опубликованном 27.03.2011, Бюл. №9, МПК A61K 31/4184 (2006.01), A61K 31/14 (2006.01), A61P 25/28 (2006.01) описана композиция (твердая или жидкая форма) для лечения РС на основе трийодида 1,3-диэтилбензимидазолия в качестве активного начала, поливинилпирролидона низкомолекулярного медицинского, являющегося солюбилизатором и стабилизатором активного начала, и дополнительно, в жидкой форме - спирт этиловый в качестве растворителя.

В патенте РФ 2278687 «Способ лечения ремиттирующего рассеянного склероза», авторов Гуфранова Р.Г., Новикова Л.Б., Сперанский В.В., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Башкирский государственный медицинский университет Федерального агентства по здравоохранению и социальному развитию" (ГОУ ВПО БГМУ РОСЗДРАВА РОССИИ) (RU), дата подачи заявки (приоритет) 16.06.2005, опубликованном 27.06.2006, Бюл. №18, МПК A61K 38/08 (2006.01), A61K 38/43 (2006.01), A61K 38/01 (2006.01), A61P 25/28 (2006.01), A61P 37/00 (2006.01) описан способ лечения РС. Комплексная терапия включает плазмаферез, интерферонотерапию, введение копаксона, цитостатиков, симптоматических и общеукрепляющих средств, циклоспорина А. При этом исключают введение стероидов и дополнительно в течение 10 дней вводят препараты: церулоплазмин внутривенно капельно по 100 мг и церебролизат внутримышечно по 10 мл. Способ обеспечивает достижение устойчивой ремиссии - до 12 месяцев - у 89,2% больных, снижение степени инвалидизации за счет восстановления регуляторных взаимоотношений нервной и иммунной систем.

В патенте РФ 2493845 «Композиция для лечения рассеянного склероза», автора Фазылов М.Ф., патентообладатель Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU), дата подачи заявки (приоритет) 07.06.2012, опубликованном 27.09.2013, Бюл. №27, МПК A61K 31/277 (2006.01), A61K 9/20 (2006.01), A61K 47/26 (2006.01), A61K 47/38 (2006.01), A61P 25/28 (2006.01) описано средство для лечения РС: композиция (твердая оральная дозированная форма) пригодна для сублингвальной, буккальной доставки или доставки через слизистую десны (Z)-2-циано-3-гидрокси-бут-2-эноик кислоты-(4'-трифторметилфенил)-амид (Терифлуномида) в качестве активного начала.

В патенте РФ 2471482 «Композиция для лечения рассеянного склероза», автора Фазылов М.Ф., патентообладатель Общество с ограниченной ответственностью "ВАЛЕНТА ИНТЕЛЛЕКТ" (RU), дата подачи заявки (приоритет) 27.10.2011, опубликованном 10.01.2013, Бюл. №1, МПК A61K 31/277 (2006.01), A61P 25/02 (2006.01), A61P 25/28 (2006.01) описана фармацевтическая композиция для лечения РС, включающая терифлуномид в качестве активного начала и вспомогательные вещества при следующем соотношении компонентов, мас.%: терифлуномид - 3,0-13,5; лактоза и/или лудипресс LCE -48,5-65,0; крахмал - 7,0-16,0; микрокристаллическая целлюлоза и/или гипромеллоза - 20,0-30,0; коллидон VA-64 - 3,5-4,5; стеарат магния - 0,8-1,2; аэросил - 0,8-1,2; бенецел МР-824 - 13,5-15,5.

В патенте РФ 2257915 «Способ лечения обострений рассеянного склероза», авторов Лиждвой В.Ю., Котов С. В., Сидорова О.П., патентообладатель Государственное учреждение Московский областной научно-исследовательский институт им. М.Ф. Владимирского (МОНИКИ им. М.Ф. Владимирского) (RU), дата подачи заявки (приоритет) 17.10.2003, опубликованном 10.08.2005, Бюл. №22, МПК A61K 39/395 (2000.01), A61K 31/185 (2000.01), A61B 5/107 (2000.01), A61P 25/28 (2000.01) описан способ включает определения интерферонового статуса у пациентов с РС с последующей лекарственной терапией. При этом дополнительно определяют площадь тела больного и при зарегистрированной I степени угнетения системы интерферонов в качестве лекарственной терапии назначают препарат «Антилимфолин Кз» в/в капельно в курсовой дозе (0,5-0,6)г×S, где S - площадь тела больного, через день, и тиоктацид в дозе 300-600 мг в/в капельно ежедневно курсом 6-8 дней. При II и III степени угнетения системы интерферонов назначают «Антилимфолин Кз» в курсовой дозе 0,4-0,5 г/м2 и 0,3-0,4 г/м2, а тиоктацид в дозе 600-900 мг и 900-1200 мг соответственно. Способ позволяет эффективно избирательно воздействовать на иммунную систему за счет совместного назначения иммуномодулятора и средства, ускоряющего его введение при подавлении активности провоспалительных цитокинов, что удлиняет ремиссию заболевания, предупреждая прогрессирование иммунологических нарушений.

В патенте РФ 2562571 «Педиатрические композиции для лечения рассеянного склероза» Коварик Д. (CH), Шмоудер Р. (US), Бастьен М.-К. (US), Давид О. (CH), Карлссон Г. (CH), Буйон Т. (CH), патентообладатель «НОВАРТИС АГ (CH)», дата подачи заявки (приоритет) 19.06.2009, конвенционный приоритет 20.06.2008 US 61/132,621, опубликованном 10.09.2015, Бюл. №25, МПК A61K 31/137 (2006.01), A61P 37/00 (2006.01), A61K 38/00 (2006.01), A61K 38/21 (2006.01), A61K 39/00 (2006.01), A61K 45/00 (2006.01) предложены: фармацевтическая композиция указанного назначения для детей, содержащая 0,25 мг и менее 2-амино-2-[2-(4-С220-алкилфенил)этил]пропан-1,3-диола или его фармацевтически приемлемой соли для введения 1 раз в день, применение указанного соединения (FTY720) по 0,25 мг и менее для изготовления лекарственного средства для лечения, предупреждения или замедления развития РС у пациента педиатрического возраста для введения 1 раз в день и соответствующий способ лечения, предупреждения или замедления развития РС у пациента педиатрического возраста.

В патенте РФ 2522251 «Вещества и способы лечения рассеянного склероза, опосредованного в клетками», авторов Букель П. (DE), Уве Я. (DE), патентообладатель ЗУППРЕМОЛЬ ГМБХ (DE), дата подачи заявки (приоритет) 02.09.2009, опубликованном 10.07.2014, Бюл. №19, МПК A61K 38/17 (2006.01), A61P 37/00 (2006.01) описан способ применения рекомбинантного растворимого Fcγ рецептора человека (Fc-гамма рецептор) при лечении РС, где РС представляет собой форму РС, опосредованную B клетками, и/или запускаемую аутоантителами форму РС. Изобретение относится к фармацевтической композиции, содержащей Fcγ рецептор для применения при лечении РС, где РС представляет собой форму РС, опосредованную B клетками, и/или запускаемую аутоантителами форму РС.

В патенте РФ 2438133 «Способ прогнозирования эффективности лечения рассеянного склероза глюкокортикоидами», авторов Вострякова С.А., Алифирова В.М., патентообладатель Вострякова С.А., Алифирова В.М., дата подачи заявки (приоритет) 11.01.2011, опубликованном 27.12.2011, Бюл. №36, МПК G01N 33/53 (2006.01) описан способ прогнозирования эффективности лечения РС глюкокортикоидами путем исследования крови, где определяют содержание в крови абсолютного количества лимфоцитов с признаками апоптоза, вычисляют индекс реализации запрограммированной клеточной смерти ИРА (%) до лечения, во время терапии и после лечения по формуле. При нарастании величины ИРА после лечения глюкокортикоидами по отношению к первоначальным его значениям оценивают лечение как эффективное, а при отсутствии динамики прогнозируют отрицательный эффект от использования гормональной терапии. Данное изобретение обеспечивает более точное определение эффективности лечения РС лабораторным методом.

В патенте РФ 2353367 «Способ лечения клинических проявлений рассеянного склероза», автора Соков Е.Л., патентообладатель Государственное образовательное учреждение высшего профессионального образования "Российский университет дружбы народов" (РУДН) (RU), дата подачи заявки (приоритет) 17.05.2007, опубликованном 27.04.2009, Бюл. №12. МПК A61K 31/573 (2006.01), A61K 31/167 (2006.01), A61K 33/14 (2006.01), A61K 35/14 (2006.01), A61P 25/28 (2006.01), A61P 23/02 (2006.01) описан способ лечения клинических проявлений РС. В шприц, предварительно наполненный 0,25-0,5 мл дексаметазона и 8-10 мл 1%-ного раствора лидокаина, осуществляют забор 2-4 мл аутокрови. При этом забор аутокрови производят из спонгиозной ткани ости лопатки или остистого отростка 4-го грудного позвонка. Введение смеси осуществляют внутрикостно в место забора аутокрови или в спонгиозную ткань другой кости. Способ обеспечивает повышение эффективности лечения клинических проявлений РС за счет активации метаболизма костной ткани и стимуляции иммунопоэза.

В патенте РФ 2569732 «Модуляторы рецептора S1P для лечения рассеянного склероза», авторов Хиштанд П.С. (CH), Шнелль К. (FR), патентообладатель НОВАРТИС АГ (CH), дата подачи заявки (приоритет) 25.06.2007, конвенционный приоритет 27.06.2006 GB 061272.1, опубликованном 27.04.2009, Бюл. №12, МПК A61K 31/137 (2006.01), A61P 37/02 (2006.01), A61P 25/28 (2006.01) описан способ лечения рецидивно-ремиттирующего РС (RRMS). Пациенту, нуждающемуся в таком лечении, вводят модулятор рецептора S1P перорально в суточной дозе 0,5 мг. Модулятор рецептора S1P представляет собой 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол или его фармацевтически приемлемую соль, например гидрохлорид. Изобретение позволяет замедлить прогрессирование рецидивно-ремиттирующего РС.

В патенте РФ 2495664 «Модуляторы рецептора S1P для лечения рассеянного склероза», авторов Хиштанд П.С. (CH), Шнелль К. (FR), патентообладатель НОВАРТИС АГ (CH), дата подачи заявки (приоритет) 25.06.2007, конвенционный приоритет 27.06.2006 GB 061272.1, опубликованном 20.10.2013, Бюл. №29, МПК A61K 31/137 (2006.01), A61K 31/397 (2006.01), A61K 45/06 (2006.01), A61P 25/28 (2006.01), A61P 43/00 (2006.01) описан способ лечения РС, состоящий в пероральном введении модулятора рецептора S1P - 2-амино-2-[2-(4-октилфенил)этил]пропан-1,3-диол или его фармацевтически приемлемую соль, в суточной дозе 0,5 мг. Метод обеспечивает профилактику или снижение интенсивности рецидивов рецидивно-ремиттирующего РС.

В патенте РФ 2209633 «Т-клеточная вакцина для лечения рассеянного склероза», авторов Вейнер Л.П. (US), Корреалле Х.Д. (AR), патентообладатель University of Southern Califormia (US), дата подачи заявки (приоритет) 18.09.1998, конвенционный приоритет 19.09.1997 US 60/059,534, опубликованном 10.08.2003, Бюл. №22, МПК A61K 39/00 (2000.01), A61K 35/14 (2000.01), C12N 5/08 (2000.01) описана вакцина, предназначенная для замедления развития РС. Вакцина содержит аттенуированные Т-клетки, выращенные в присутствии миелиновых белков, в частности в присутствии бычьих миелиновых белков. В предпочтительном варианте изобретения вакцина содержит аттенуированные Т-клетки, полученные выращиванием аутологичных циркулирующих мононуклеарных клеток в присутствии бычьих тотальных белков миелина, отбором и размножением Т-клеток с иммунной реакцией на миелиновые белки и аттенуацией клеток облучением. Преимущество изобретения в создании эффективного нетоксичного средства для лечения первичного или вторичного РС.

В патенте РФ 2121850 «Фармацевтическая композиция и способ лечения рассеянного склероза», авторов Кеннет У.Г. (CA), Кац И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 15.10.1992, конвенционный приоритет 22.10.1991 CA 2.053.799, опубликованном 20.11.1998, МПК A61K 38/10 (1995.01), A61K 38/16 (1995.01) описаны полипептиды и способ их использования для нейтрализации аутоантител против человеческого ОБМ. Фармацевтическая композиция в качестве, активного ингредиента включает пептид с длиной 8-25 а.о. Пептид способен нейтрализовать антитела к основному белку миелина. Доза введения пептида составляет 1-10 мг/кг веса тела.

В патенте РФ 2561582 «Инъекционная лекарственная форма олигопептидного препарата для лечения рассеянного склероза и способ ее получения» авторов Автушенко С.С., Сурков К.Г., Романов В.Д., Генкин Д.Д., Габибов А.Г., Белогуров А.А., Пономаренко Н.А., патентообладатель Российская Федерация в лице Министерства промышленности и торговли Российской Федерации (RU), Открытое Акционерное Общество "Фармсинтез" (RU), дата подачи заявки (приоритет) 19.11.2010, опубликованном 27.08.2015, Бюл. №24, МПК A61K 38/16 (2006.01), A61K 9/127 (2006.01), A61P 25/28 (2006.01) описана новая инъекционная лекарственная форма известных олигопептидов для лечения РС. Препарат содержит олигопептиды:

GGDRGAPKRGSGKDSHH;

GFGYGGRASDYKSAHK;

QGTLSKIFKLGGRDSRSGSPMARR,

заключенные в липосомы, состоящие из смеси маннозиалированого дипальмитоилфосфатидилэтаноламина, 2,3-Дипальмитоил-sn- глицеро- 1-фосфатидилхолина, а также лактозы в качестве криопротектора и α-токоферола в качестве антиокислителя. Описан способ приготовления препарата.

В патенте РФ 2418582 «1,3-диалкилбензимидазолия галогениды - средства для лечения рассеянного склероза», автор Страдомский Б.В., патентообладатель Аверин К.М., Страдомский Б.В., Солодунов Ю.Ю. (RU), дата подачи заявки (приоритет) 08.04.2010, опубликованном 20.05.2011, Бюл. №14, МПК A61K 31/14 (2006.01), A61K 31/4184 (2006.01), A61P 25/28 (2006.01) описан способ лечения с помощью цитостатика галогенида 1,3-диалкилбензимизадолия.

В патенте РФ 2519196 «Лекарственное средство для лечения патологического синдрома и способ лечения рассеянного склероза» автор Эпштейн О.И. патентообладатель Эпштейн О.И., дата подачи заявки (приоритет) 01.07.2011, опубликованном 10.06.2014, Бюл. №16, МПК A61K 39/395 (2006.01), A61P 25/28 (2006.01) описан способ лечения патологического синдрома, характерного для РС с помощью гомеопатических доз («активированная - потенцированная форма») антител к гамма-интерферону человека (ИФН-γ) и мозгоспецифическому белку S-100.

В патенте РФ 2448685 «Липосомы, содержащие олигопептиды - фрагменты основного белка миелина, фармацевтическая композиция и способ лечения рассеянного склероза», авторов Автушенко С.С., Сурков К.Г., Романов В.Д., Генкин Д.Д., Габибов А.Г., Белогуров А.А., Пономаренко Н.А., патентообладатель Российская Федерация в лице Министерства промышленности и торговли Российской Федерации (RU) и Открытое акционерное общество «Фармсинтез» (RU), дата подачи заявки (приоритет) 30.11.2009, опубликованном 27.04.2012, Бюл. №12, МПК A61K 9/127 (2006.01), A61K 38/02 (2006.01), A61K 38/17 (2006.01), C07K 14/47 (2006.01). A61P 37/00 (2006.01) описан способ получения липосом, содержащих олигопептиды - фрагменты основного белка миелина, фармацевтической композиции и способа лечения РС. Описан способ изготовления моноламеллярных липосом размером 100-200 нм, состоящих из смеси, содержащей 1 мас. часть тетраманнозил-три-L-лизин-диолеоил глицерола и 99 мас. частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина, и содержащих три олигопептида, последовательность которых соответствует последовательностям фрагментов: 46-62, 124-139 и 147-170 основного белка миелина. В качестве средства для лечения РС предложена фармацевтическая композиция, содержащая в качестве активного компонента моноламмелярные липосомы, а также способ лечения РС, включающий введение пациенту указанной фармацевтической композиции.

Описано также получение липосом, содержащих интегрированные (неконъюгированные ковалентно) олигопептиды, и их использования в качестве активного компонента в фармацевтических композициях, а также способ использования этих фармацевтических композиций для лечения РС. Авторы указывают, что использованные ими олигопептиды и их смеси, представляющие собой по химической структуре фрагменты ОБМ человека ранее описаны в патентах и публикациях. Такие олигопептиды обозначаются соответственно порядковому номеру первой и последней аминокислоты, считая от С-конца полной аминокислотной цепочки ОБМ. Например, ОБМ 18-32, то есть ASTMDHARHGFLPR, или, например ОБМ 75-98, то есть AGAPVVHPPLAIVTPAT. Известно, что часть пролиферирующих Т-клеток у больных РС направлена против ОБМ (Allegretta et al. Science. 247: 718-21 (1990)). Эти Т-клетки человека могут узнавать множественные эпитопы на молекуле ОБМ (Richer, I et al. J. Neuroimmun. 23:55-66 (1989)). ОБМ, по-видимому, также способен к активации некоторых Т-клеток без вовлечения антиген-презентирующих клеток (Altman, DM et al. Eur. J. Immunol. 17:1635-40 (1987)). Возможно, что небольшие олигопептиды - фрагменты ОБМ могут распознаваться Т-клетками без внутриклеточного процессинга просто за счет их способности связывать антигены основного комплекса гистосовместимости класса II на поверхности антиген-презентирующих клеток. Известны и хорошо изучены эпитопы (участки) ОБМ, ответственные за «узнавание» теми или иными специфическими Т-клетками, выделенными из крови больных PC и обеспечивающими иммунологическую «атаку» на ОБМ, а также В-клетками, которые вырабатывают аутоантитела, направленные против ОБМ. В связи с обнаружением таких эпитопов предпринимались и предпринимаются попытки с помощью коротких синтетических пептидов (олигопептидов), имеющих последовательность, гомологичную такому эпитопу ОБМ, вызвать состояние иммунологической толерантности или заблокировать (связать) аутоантитела против ОМБ. Признанной моделью РС человека у животных служит экспериментальный аутоиммунный энцефаломиелит (ЭАЭ), представляющий собой демиелинизирующий процесс, опосредованный Т-клетками. Течение ЭАЭ может быть приостановлено путем введением мышам синтетических пептидов, содержащих участки, гомологичные иммунодоминантным эпитопам ОБМ (Gaur, A. et al. Science. 258: 1491-94 (1992)). Более того, введение высоких доз ОБМ снижало количество аутореактивных Т-клеток и уменьшало клинические и патологические симптомы ЭАЭ у мышей (Gritchfield, J.M. et al. Science. 263: 1139-43 (1994)). Даже оральное введение ОБМ модулировало течение ЭАЭ за счет индукции периферической толерантности (Chen, W. et al. Science. 265:1237-40 (1994)). Было высказано предположение, что толерантность может быть индуцирована у больных PC с помощью перорального введения миелиновых антигенов (Weiner, H.L. et al. Science. 259:1321-24 (1993)). Комбинация миелиновых антигенов и синтетических пептидов указанных антигенов, введенная пероральным, и/или внутривенным, и/или эпидуральным путем, возможно, необходима для модулирования Т-клеток, В-клеток и макрофагов, участвующих в деструкции миелина у больных PC. Так, например, известны олигопептиды: ОБМ 75-98 (имеющий формулу AGAPVVHPPLAIVTPAT) [Заявка US 2005209156]; ОБМ 83-98 (имеющий формулу ENPVVHFFKNIVTPRT); ОБМ 146-160 (имеющий формулу AQGTLSKIFKLGGRD). Последние два были выбраны как носители эпитопов иммунодоминантных Т-клеток (Патент США №5858980). В публикации Warren, K.G. et al. Ann. Neurol. 35:280-289 (1994)) в качестве средства для лечения PC предложены олигопептидные фрагменты ОБМ, нейтрализующие или снижающие продукцию антител против ОБМ у пациентов, страдающих PC. Олигопептид ОБМ 84-102 был испытан в клиническом исследовании фазы I при лечении вторичного прогрессирующего PC. Дальнейшая разработка препарата была прекращена, поскольку не было выявлено влияния препарата на важнейшие показатели клинического течения PC (Goodkin, D.E. et al. Neurology. 54:1414-20 (2000)): неврологическая дисфункция и и скорость появления новых очагов демиелинизации в ЦНС. Также описан способ направленного подавления определенного клона Т-клеток, ответственного за развитие ЭАЭ у животных, и несущего интерферон-индуцибельный маркер CXCR3, с помощью ДНК-плазмиды, инкапсулированной в липосомы (Chen, W. et al. J Autoimmun. 28(1):30-40 (2007)). Также известно, что путь введения играет важную роль в осуществлении биологического (лечебного) эффекта олигопептидов - фрагментов ОБМ. Так, ингаляционное, но не пероральное введение энцефалитогенных пептидов - фрагментов ОБМ, несущих Т-клеточные доминантные эпитопы, приводило к уменьшению симптомов индуцированного у животных (Metzler, В et al. Int Immunol. (9):1159-65 (1993)). Хотя известно, что в случае использования липосомальных вакцин иммунный ответ усиливается вследствие того, что антигены, ассоциированные с липосомами, попадают непосредственно в антигенпрезентирующие клетки (Gluck, R. (1995) In Vaccine Design: The Submit and Adjuvant Approch (Powell M.F., Newman M.J., eds)., Plenum Press. P. 325-345), в случае олигопептидов - фрагментов ОМБ не является очевидным, что их введение в организм в составе тех или иных частиц приведет к появлению или усилению позитивного клинического эффекта. Описано, что олигопептиды - фрагменты ОБМ (в частности, ОБМ 68-86 и ОБМ 87-99, но не ОБМ 110-128) оказывают синергидный лечебный эффект на течение ЭАЭ, когда вводятся совместно. При этом также использование интраназального пути введения приводило к большему эффекту, чем подкожное введение смеси этих олигопептидов в полном адъюванте Фрейнда (Liu, J.Q. et al. Int Immunol. 10(8):1139-48 (1998)). Также предпринимались попытки усилить лечебное действие олигопептида - фрагмента ОБМ (а именно ОБМ 113-122) при ЭАЭ путем предварительной липофилизации олигопептида и внедрения в липосомы перед введением. Однако такая «липосомальная» адъюванитизация не приводила к усилению эффекта при подкожном введении (Avrilionis K and Boggs JM. J Neuroimmunol. 35(1-3):201-10 (1991)). Нельзя также не упомянуть глатирамера ацетат (ГА), представляющий собой сложную смесь полипептидов, полученных путем полимеризации четырех аминокислот: глутамата, лизина, аланина и тирозина (CAS No. 147245-92-9), который имеет следующую условную структурную формулу: (Glu, Ala, Lys, Туr), ХСН3СООН). Способность ГА предотвращать ЭАЭ у животных была обнаружена случайно, и хотя к настоящему моменту препарат проявил свою эффективность у десятков тысяч пациентов PC, окончательной и однозначной теории механизма его действия не предложено. Как считается, иммуноспецифические эффекты ГА включают в себя: вытеснение ОБМ из связи с белками основного комплекса гистосовместимости; ингибирующее влияние на Т-клеточные рецепторы миелин-специфичных лимфоцитов; индукция клона ГА-специфичных Т-лимфоцитов 2 типа, подавляющих иммунный ответ в очагах демиелинизации благодаря выбросу противовоспалительных цитокинов IL-4 и IL-10 и др. Таким образом, проблема эффективного лечения (или профилактики обострений) РС путем введения в организм пациента тех или иных коротких пептидов - фрагментов ОБМ и их сочетаний с помощью того или иного носителя и/или того или иного пути введения остается до конца нерешенной в клинической практике. Наиболее близким к настоящему изобретению является фармацевтическая композиция и способ лечения РС, описанные в патенте RU 2198893, выбранные в качестве прототипа. Однако в известном способе в качестве фрагмента ОБМ используют один пептид ОБМ (82-98) DENPVVHFFKNIVTPRT, что является недостаточным для индукции иммунологических реакций в отношении нескольких клональных пулов Т (или В) - лимфоцитов, обладающих активностью против нескольких эпитопов ОБМ. При этом именно постулируемая низкая антигенность этого короткого пептида указывается в качестве его преимущества. Кроме того, применение этого олигопептида у больных РС в клинике оказалось неэффективным. Задачей этого изобретения являлось создание средства (фармацевтической композиции), обладающего иммунокорригирующими свойствами, не вызывающего аллергических реакций и обладающего высокой активностью как в отношении экспериментальных моделей РС (в частности ЭAЭ), так и в отношении течения РС у больных этим заболеванием. Поставленная задача решена путем использования в качестве активного компонента средства для лечения РС смеси (1:1:1 по массе) трех олигопептидов - фрагментов ОБМ следующей структуры:

Олигопептиды - фрагменты ОБМ Формула/структура Соответствие положению последовательности аминокислот в ОБМ человека
1 GGDRGAPKRGSGKDSHH 46-62
2 GFGYGGRASDYKSAHK 124-139
3 QGTLSKIFKLGGRDSRSGSPMARR 147-170

причем указанная смесь заключена в моноламеллярные липосомы размером от 100 до 200 нм следующего состава: 1 мас. часть тетраманнозил-три-L-лизин-диолеоил глицерол и 99 мас. частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина. Как было выявлено в процессе работы над изобретением (исследовали вариации различных размеров и состава липосом), наибольшую способность снижать степень выраженности ЭАЭ у животных проявляла смесь вышеуказанных олигопептидов, в которой их соотношение в смеси составляло 1:1:1 по молярной массе, а состав липидов моноламеллярных липосом был: 1 часть по массе тетраманнозил-три-L-лизин-диолеоил глицерол и 99 частей 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина. Таким образом, согласно изобретению предложены моноламелллярные липосомы размером от 100 до 200 нм, содержащие смесь олигопептидов GGDRGAPKRGSGKDSHH; GFGYGGRASDYKSAHK; QGTLSKIFKLGGRDSRSGSPMARR, молярное соотношение между которыми составляет 1:1:1, при этом массовое соотношение смеси олигопептидов и липидного компонента липосом составляет 1:50, а липиды липосом представляют собой смесь тетраманнозил-три-L-лизин-диолеоил глицерола - 1 часть и 2,3-дипальмитоил-sn-глицеро-1-фосфатидилхолина - 99 частей по массе.

В патенте РФ 2157815 «Пептидная специфичность антител к MBP (основному белку миелина), содержащая его фармацевтическая композиция и способ лечения рассеянного склероза», авторы Кеннет У. (CA), Кэтз И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 20.10.1995, конвенционный приоритет 21.10.1994 US 08/327.357, опубликованном 20.10.2000, Бюл. №29, МПК C07K 7/06 (2000.01), A61K 38/08 (2000.01), A61P 25/24 (2000.01) описывается новый пептид, способный нейтрализовать или модулировать образование антител к миелиновому основному белку, имеющий формулу I R1-Val-His-Phe-Phe-Lys-Asn-Ile-R2, где R1 выбрано из группы, включающей Asn-Pro-Val-; Pro-Val-; Val-; Lys-Ser-His-Gly-Arg-Thr-Gln-Asp-Glu-Asn-Pro-Val-; Thr-Gln-Asp-Glu-Asn-Pro-Val-; водород и гидрокси; R2 выбрано из группы, включающей -Val; -Val-Thr; -Val-Thr-Pro; -Val-Thr-Pro-Arg-, водород и гидрокси, при условии, что R1 и R2 одновременно не являются водородом или гидроксилом, при этом данный пептид содержит замещения, добавления или делеции. Описывается также фармацевтическая композиция на основе соединения общей формулы (I) и способ лечения РС. Технический результат - повышение эффективности при лечении РС.

В патенте РФ 2198893 «Пептидные фрагменты основного белка миелина, фармацевтические композиции на их основе и применение данных композиций для лечения рассеянного склероза», авторов Кеннет У. (CA), Кэтз И. (CA), патентообладатель The Governors of the University of Alberta (CA), дата подачи заявки (приоритет) 03.04.1998, конвенционный приоритет 04.04.1997 CA 2.201.841, опубликованном 20.02.2003. Бюл. №5. МПК C07K 7/08 (2000.01). C07K 14/435 (2000.01). A61K 38/04 (2000.01), A61K 38/17 (2000.01), A61P 25/00 (2000.01) описан полипептид формулы Asp-Glu-Asn-Pro-Val-Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr, способный нейтрализовать антитела к основному белку миелина. Пептид может использоваться для лечения РС и обладает большей активностью по сравнению с ОБМ. Пептид не является токсичным и не проявляет себя в качестве иммуногенов. Описана также фармацевтическая композиция, содержащая пептид, а также способ лечения РС с его применением.

В патенте РФ 2138512 «Вакцина для профилактики или лечения опосредованной Т-клетками патологии или нерегулируемой репликации Т-клеток, способ получения вакцины, способ диагностики или прогнозирования восприимчивости к ревматоидному артриту или рассеянному склерозу, способ профилактики или лечения ревматоидного артрита или РС и содержащий пептид с последовательностью SGDQGGNE, являющийся агентом для обнаружения, профилактики или лечения рассеянного склероза», авторов Хауэл М. (US), Бростофф С.(US), Карло Д. (US), дата подачи заявки (приоритет) 21.03.1990, конвенционный приоритет 21.03.1989 US 326314, 18.07.1989 US 382085, 18.07.1989 US 382086, опубликовано 27.09.1999, МПК C07K 7/06 (1995.01), A61K 39/44 (1995.01), G01N 33/564 (1995.01), G01N 33/68 (1995.01) предложенная вакцина для профилактики или лечения опосредованной Т-клетками патологии или нерегулируемой репликации клонами Т-клеток в млекопитающих содержит активное вещество и фармацевтически переносимую среду, при этом в качестве активного вещества она содержит рецептор Т-клеток или его фрагмент, соответствующий рецептору Т-клеток, находящемуся на поверхности опосредующих данную патологию Т-клеток, или антиидиотипические антитела, являющиеся внутренним изображением данного рецептора или его упомянутого фрагмента, причем активное вещество взято в количестве, обеспечивающем иммунизацию. Ее готовят путем получения клонов Т-клеток, вызывающих опосредованную Т-клетками патологию, определения последовательности аминокислот рецепторов Т-клеток клонов Т-клеток, связанных с данной патологией, отбора сегментов данных рецепторов Т-клеток, характерных для упомянутых рецепторов Т-клеток, а не для рецепторов Т-клеток, не связанных с данной патологией, и отбора из упомянутых последовательностей тех, которые способны к индукции иммуногенной реакции относительно упомянутого рецептора Т-клеток, таким образом отбирая вакцину. Также предложены способ диагностирования или прогнозирования восприимчивости индивидуума к ревматоидному артриту, который заключается в том, что он включает обнаружение Т-клеток, содержащих вариабельный β-структурированный участок MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS или его фрагмент, индивидуально определяемый для каждого пациента, причем анормальная экспрессия Т-клеток, содержащих такой участок, указывает на наличие ревматоидного артрита или восприимчивость к ревматоидному артриту, а также способ профилактики или лечения ревматоидного артрита, который заключается в том, что он включает предотвращение связывания рецептора Т-клеток, содержащего последовательность MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS, или рецептора Т-клеток, содержащего в основном последовательность SGDQGGNE, с его партнером, и способ профилактики или лечения ревматоидного артрита в индивидууме, который заключается в том, что он включает цитотоксическую или цитостатическую обработку Т-клеток, MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASS, или Т-клеток, содержащих в основном последовательность SGDQGGNE в индивидууме.

Заявка на изобретение на патент РФ 2012157310 «Твердая пероральная фармацевтическая композиция агониста S1P или его фармацевтически приемлемой соли, способ ее получения и способ лечения и снижения частоты клинических обострений рассеянного склероза», автор Хрусталева А.О. (RU), заявитель Закрытое Акционерное Общество "БИОКАД" (ЗАО "БИОКАД") (RU), дата подачи заявки (приоритет) 27.12.2012, опубликовано 10.07.2014, Бюл. №19, МПК A61K 31/00 (2006.01) описывает способ получения твердой фармацевтической композиции перорального применения для лечения рецидивно-ремиттирующего РС и для уменьшения частоты клинических обострений заболевания и снижения риска прогрессирования инвалидности при рецидивно-ремиттирующем рассеянном склерозе, пригодная для перорального введения, включающая терапевтически эффективное количество агониста рецептора S1P (сфингозин-1-фосфата) и фармацевтически приемлемый носитель, отличающаяся тем, что фармацевтически приемлемый носитель не содержит микрокристаллической целлюлозы, сахарного спирта и кроскармеллозы (карбоксиметилцеллюлозы) или фармацевтически приемлемых производных кроскармеллозы.

Патент РФ 97108405 «Композиция (варианты), пептид (варианты) и способ для лечения рассеянного склероза (варианты)», авторов Гефтэр М. (US), Дивокс Б. (US), Пэйлиард К. (US), Розбард Д. (US), Смайлек Д. (US), Сэмсан М. (US), Фрэнзен Г. (US), Сю Д.-Х. (US), Ши Д.-Д. (US) заявитель «Имьюлоджик Фамэсьютикэл Копэрейшн (US)», дата подачи заявки (приоритет) 26.05.1997, опубликованный 10.05.1999 содержит описание средства лечения РС на основе пептидов из состава белков миелиновой оболочки.

Известна публикация Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906-913, описывающая синтез декапептида с последовательностью VKKPGSSVKV, соответствующего участку последовательности 11-20 тяжелой цепи IgG1, а также любых других типов тяжелых цепей иммуноглобулинов. Пептид соответствует области наибольшей гомологии с фрагментом адренокортикотропного гормона (АКТГ, кортикотропин) 13-22: VGKKRRPVKV. Авторы присвоили пептиду название Иммунокортин. Проведенное в дальнейшем исследование активности Иммунокортина показало, что в диапазоне концентраций 10-6-10-9 M он оказывает иммуносупрессорное действие in vitro: подавляет бласт-трансформацию тимоцитов (Navolotskaya, E.V., Zargarova, T.A., Lepikhova, T.N., Nurieva, R.I., Lipkin, V.M., and Zav’yalov, V.P. (2000) Immunol. Lett., 72, 93-99) и фагоцитарную активность перитонеальных макрофагов мыши (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906-913). Наряду с иммуносупрессорной Иммунокортин проявил нейротропную активность: при внутримозговых инъекциях крысам в дозах 5-50 мкг/животное пептид снижал анальгезию, индуцированную β-эндорфином или стрессом, в то же время усиливал болеутоляющее действие тафцина. Внутримозговое введение 5-10 мкг пептида кролику приводило к увеличению нормальной температуры тела животного на 0,7-1,3°С (Наволоцкая Е.В. Вторая жизнь антител Биохимия. 2014. Т. 79. №1. С. 5-12). Изучение связывания [3H]-иммунокортина с тимоцитами и перитонеальными макрофагами мыши показало, что эти клетки способны специфически и с высоким сродством (Kd комплекса пептид–рецептор составляла ~10-8-10-9М) связывать меченый пептид (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Завьялов В.П., Липкин В.М. (2000) Биоорган. химия, 26, 31-38). Известно, что в молекуле кортикотропина связывание с рецептором обеспечивает фрагмент 13-24 (Gispen, W.H. (1982) Acta Biol. Med. Ger., 41, 279-288). Было показано, что немеченый фрагмент АКТГ (13-24) на 100% ингибирует специфическое связывание меченого Иммунокортина как с тимоцитами, так и с макрофагами. В свою очередь, немеченый иммунокортин вытеснял меченный 125I фрагмент АКТГ (13-24) из комплекса с рецептором на мембранах головного мозга и коры надпочечников (Наволоцкая Е.В., Ванина В.И., Заргарова Т.А., Гочаренко Е.Н., Кудряшова Н.Ю., Алахая М.Я., Садовников В.Б., Семушина С.Г., Колобов А.А., Кампе-Немм Е.А., Юровский В.В., Липкин В.М. (2004) Биоорган. химия, 30, 350-355) крысы, а также на клетках T-лимфобластной линии MT-4 (Lepikhova, T.N., Navolotskaya, E.V., Zargarova, T.A., Nurieva, R.I., Lipkin, V.M., and Zav’yalov, V.P. (2000) Peptides, 21, 353-357). На основании этих результатов был сделан вывод о том, что Иммунокортин связывается с рецепторами к АКТГ на клетках иммунной, нервной и эндокринной систем. Известно, что взаимодействие кортикотропина с рецептором приводит к активации аденилатциклазы (Kapas, S., Cammas, F.M., Hinson, J.P., and Clark, A.J. (1996) Endocrinology, 137, 3291-3294). Иммунокортин активировал аденилатциклазу плазматических мембран тимоцитов и перитонеальных макрофагов мыши и увеличивал содержание cAMP в этих клетках (Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906-913). Аденилатциклазная система играет важную роль в регуляции функциональной активности мононуклеарных фагоцитов. Увеличение синтеза cAMP в перитонеальных макрофагах приводит к ингибированию продукции активных форм кислорода, а также к уменьшению синтеза и секреции простагландинов (Bromberg, Y., and Pick, E. (1981) Cell. Immunol., 61, 90-103). Все эти события на клеточном уровне проявляются как снижение активности макрофагов. В настоящее время нет данных о факте образования Иммунокортина или близких к нему пептидов в организме, а тем более, их концентрациях. Однако вполне вероятно, что такие пептиды действительно образуются в физиологических условиях в результате расщепления иммуноглобулинов различных классов в составе комплекса антиген–антитело в фагоцитах. Известно, что наиболее интенсивный процессинг Fc-субъединиц происходит в кислой среде фаголизосом (Tischenko, V.M., Zav’yalov, V.P., Medgyesi, G.A., Potekhin, S.A., and Privalov, P.L. (1982) Eur. J. Biochem., 126, 517-521). Образующиеся под действием кислых гидролаз пептиды посредством секреции или в результате гибели фагоцитов могут попадать в окружающую очаг воспаления среду и служить своеобразными «сигналами бедствия», вовлекающими клетки иммунной и других систем организма в процесс элиминации антигена. Напротив, Fab-фрагменты, из которых может образовываться Иммунокортин, в кислой среде имеют наболее кооперативную, устойчивую к протеолизу структуру (Schneider, I.I., De Dwe, C., and Trowet, D. (1982) J. Cell Biol., 88, 380-387). Однако в среде, близкой к нейтральной, кооперативность укладки вариабельных (VH) частей уменьшается, и они расщепляются под действием протеаз. При этом VH-домены могут явиться источником пептидов с АКТГ-подобной структурой. Поскольку расщепление Fab-фрагментов иммуноглобулинов в фаголизосомах происходит в незначительной степени, а Иммунокортин составляет лишь часть от общей массы иммуноглобулина, биологически значимые концентрации АКТГ-подобного пептида могут достигаться только при высокой скорости протеолитического процессинга. Исходя из этого, вероятной функцией таких пептидов может быть выполнение ими роли сигнала обратной связи в процессах, связанных с регуляцией иммунного ответа на уровне связывания и деградации антител с различными типами клеток. Таким образом, в результате ферментативного расщепления иммуноглобулинов в составе комплекса антиген-антитело в фагоцитах образуются пептиды, модулирующие функции иммунной, нервной, эндокринной и других систем организма. Эти пептиды играют роль сигнальных молекул активации (тафтсин, ригин, иммунорфин, p24 и его фрагменты) и подавления (Иммунокортин) иммунного ответа.

В основу изобретения была положена гипотеза о том, что иммуносупрессорная активность Иммунокортина и других АКТГ-подобных пептидов, в том числе, Abu-SSVKVS-Abu может быть использована для лечения РС путем подавления пролиферации популяций лимфоцитов, участвующих в аутоиммунном разрушении миелина, а возможно, и других компонентов нейрональной ткани. В качестве аргумента в пользу вероятной эффективности и безопасности этого пептида выдвинут тезис об эндогенном происхождении этого пептида (вероятно, он образуется в естественных условиях за счет деградации иммуноглобулинов). Таким образом, он может проявить лучшее соотношение специфической и иммуносупрессорной активности побочных эффектов (снижение иммунной защиты и неспецифическая токсичность) по сравнению с известными средствами лечения РС. Таким образом, прототипом нашего изобретения является работа Наволоцкая Е.В., Заргарова Т.А., Лепихова Т.Н., Туробов В.Л., Нуриева Р.И., Малкова Н.В., Липкин В.М., Завьялов В.П. (1999) Биохимия, 64, 906-913.

Раскрытие изобретения

В порядке решения поставленных задач предложена последовательность пептида Abu-TGIRIS-Abu (Abu - α-аминомасляная кислота), которая отличается от прототипной последовательности Abu-SSVKVS-Abu отсутствием остатков лизина.

На основании сравнения последовательностей Abu-TGIRIS-Abu и Abu-SSVKVS-Abu предполагается, что перечисленные признаки способны обеспечить более высокую специфическую иммуносупрессорную активность предложенного пептида Abu-TGIRIS-Abu, в частности, за счет увеличения аффинности к рецепторам лимфоцитов и за счет увеличения устойчивости в биологических жидкостях. Кроме того, достигается упрощение синтеза пептида Abu-TGIRIS-Abu по сравнению с прототипом за счет исключения остатков лизина.

В процессе осуществления изобретения проводят следующие экспериментальные процедуры:

1. Твердофазный синтез пептида Abu-TGIRIS-Abu с применением Boc/Bzl- и Fmoc/tBu -защищенных производных аминокислот, очистка и характеристика чистоты;

2. Жидкофазный синтез пептида Abu-TGIRIS-Abu с применением схем REMA (последовательно повторяющийся избыток смешанных ангидридов - repetitive excess mixed anhydride) и методом конденсации фрагментов, очистка и характеристика чистоты;

3. Биологические испытания пептида Abu-TGIRIS-Abu in vivo по способности купировать симптоматику РС на модели экспериментального аутоиммунного энцефаломиелита у крыс (ЭАЭ), оценка биологической безопасности пептида;

Краткое описание графических изображений

Фиг. 1. Принцип ТФПС с использованием MBHA-линкера и Boc/Bzl-защищенных производных аминокислот

(А) модификация полистирола метилбензнгидриламиногруппой (MBHA) для получения амидных форм пептидов. (В) Иллюстрация принципа удаления избытков реагентов в ходе синтеза пептидов в ТФПС.

Фиг. 2. Твердофазный синтез пептида Abu-TGIRIS-Abu-NH2 c применением Boc/Bzl- -защищенных производных аминокислот и защитой боковой цепи Arg посредством тозильной группы. Полимерная подложка с MBHA-линкером обозначена в виде закрашенного круга. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показана с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидилполимера. (1), (3), (5), (7), (11), (13): Boc-Xaa-OH (3 экв.), O-(бензотриазол-1-ил)-N,N,N',N'-тетраметилурониум тетрафторборат - TBTU (2,7 экв.), HOBt (3 экв.), N-метилморфолин - NMM (3 экв.), диметилформамид - DMF; (2), (4), (6), (8), (10), (12), (14), (16): 1) TFA/DCM 50/50 2) DIPEA; (9), (15): Boc-Xaa-OH (6 экв.), DCC (3 экв.); (17) HF, «ловушка» (скэвенджер) карбокатионов.

Фиг. 3. Твердофазный синтез пептида Abu-TGIRIS-Abu-NH2 c применением Boc/Bzl- методологии защитой боковой цепи аргинина посредством протонирования. Полимерная подложка с MBHA-линкером обозначена в виде закрашенного круга. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показана с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидил-полимера. (1), (3), (5), (7), (11), (13), (15): Boc-Xaa-OH (3 экв.), TBTU (2.7 экв.), HOBt (3 экв.), NMM (3 экв.), DMF; (2), (4), (6), (8), (10), (12), (14), (16): 1) TFA/DCM 50/50 2) DIPEA; (9): Boc-Xaa-OH (6 экв.), DCC (3 экв.); (17) HF, «ловушка» (скэвенджер) карбокатионов.

Фиг. 4. Твердофазный синтез пептида Abu-TGIRIS-Abu-NH2 c применением Boc/Bzl- -защищенных производных аминокислот и защитой боковой цепи Arg посредством нитрогруппы. Полимерная подложка с MBHA-линкером обозначена в виде закрашенного круга. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показана с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидилполимера. (1), (3), (5), (7), (9), (11), (13), (15): Boc-Xaa-OH (3 экв.), TBTU (2,7 экв.), HOBt (3 экв.), NMM (3 экв.), DMF; (2), (4), (6), (8), (10), (12), (14), (16): 1) TFA/DCM 50/50 2) DIPEA; (17) HF, «ловушка» (скэвенджер) карбокатионов.

Фиг. 5. Rink-линкер для получения амидных форм пептидов в Fmoc/tBu-защищенных производных аминокислот ТФПС.

Фиг. 6. Твердофазный синтез пептида Abu-TGIRIS-Abu-NH2 c применением Fmoc/tBu--защищенных производных аминокислот. Полимерная подложка с Rink-амидным линкером обозначена в виде закрашенного круга. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показаны с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидилполимера. (1), (3), (5), (7), (11), (13), (15): Fmoc-Xaa-OH (2.9 экв.), TBTU (3 экв.), HOBt (3 экв.), NMM (3 экв.), DMF; (2), (4), (6), (8), (10), (12), (14), (16): 4-MePip/DMF 20/80; (9); (17) TFA, H2O 95/5 v/v

Фиг. 7. Активация аминокислоты с образованием смешанного ангидрида и его реакция с растущей пептидной цепью (общая схема). R2=изобутил, изопропил.

Фиг. 8. Синтез пептида Abu-TGIRIS-Abu-NH2 в растворе c применением Boc/Bzl -защищенных производных аминокислот методом REMA. Растущая пептидная цепь обозначена в виде прямой линии. Актуальные для превращения функциональные группы показаны с N-конца растущей пептидной цепи (слева). Номера в колонке используются с двойной целью: ими пронумерованы стадии синтеза, а также обозначены химические реагенты для осуществления превращений пептидилполимера. (1), (3), (5), (7), (9), (11), (13), (15): 1) TFA/AcOH 50/50 2) NMM; (2), (4), (6), (8), (10), (12), (14): Boc-Xaa-OH (2.2 экв.), алкилхлорформиат (2 экв.), NMM (2,2 экв.); (16) HF, «ловушка» (скэвенджер) карбокатионов.

Фиг. 10. Исходные фрагменты для получения амидной формы пептида Abu-TGIRIS-Abu методом синтеза в растворе конденсацией фрагментов.

Фиг. 11. Активация производного Arg(H+) и образование пептида и примеси δ-лактама.

Фиг. 12. Синтез защищенного дипептида Arg-Ile в отсутствии оснований. а) получение этилизолейцината гидроксибензотриазолида (6); b) получение активированного производного Arg(H+)OX и его реакция c (6).

Фиг 13. Первичная схема синтеза пептида Abu-TGIRIS-Abu-NH2 в растворе методом конденсации фрагментов.

Фиг 14. Примеры взаимодействия пентафторфениловых эфиров аминокислот, полученных in situ с различными нуклеофилами. (а) реакция с аминокислотой, имеющей незамещенный С-конец; (b) реакция с незамещенным пептидом; с пример не идущей реакции; (d) реакция с этиловым эфиром пептида.

Фиг 15. Оптимизированная схема синтеза пептида Abu-TGIRIS-Abu-NH2 в растворе методом конденсации фрагментов.

Фиг. 16. Двунаправленная реакционная способность активированных для ацилирования пептидных фрагментов в реакции с аминами (другими пептидными фрагментами).

Фиг. 17. Синтез псевдопролиновых производных пептидов.

Фиг. 18. Биологические испытания терапевтической эффективности пептида Abu-TGIRIS-Abu-NH2 в сравнении с пептидом Abu-SSVKVS-Abu-NH2 in vivo на модели ЭАЭ у крыс. По оси абсцисс отложено время с момента иммунизации животных миелином. По оси ординат отложен индекс тяжести клинических проявлений ЭАЭ в баллах. Контрольная группа крыс с ЭАЭ получала плацебо, n=10. Экспериментальные группы крыс с ЭАЭ ежедневно получали пептид Abu-SSVKVS-Abu-NH2 в дозе 400 мкг/кг, n=10 или пептид Abu-TGIRIS-Abu-NH2 в дозе 400 мкг/кг, n=10. Для каждой временной точки показана стандартная ошибка измерения в пределах группы.

Осуществление изобретения

Целевые продукты - пептиды - относятся к классу органических соединений амидов. Пептиды в большинстве случаев получают взаимодействием аминогруппы одной аминокислоты с карбоксильной группой другой аминокислоты. В результате взаимодействия образуется амидная (пептидная) связь. В общей практике органической химии синтетические работы по получению амидов часто являются достаточно тривиальной деятельностью. Кроме того, большинство амидов являются хорошо кристаллизующимися веществами, что облегчает их выделение из реакционной смеси и очистку.

Однако наличие в молекулах аминокислот функциональных групп боковых цепей и необходимость сохранения хирального центра при α-атоме углерода приводят к возникновению проблемы селективности в химических превращениях аминокислот и, как следствие, к тому, что синтез пептидов гораздо более трудоемок, сложен, а порой непредсказуем, чем получение обычных амидов. Кроме того, в случае пептидов, перекристаллизация, как один из немногих методов очистки пептидов от примесей исходных веществ и побочных продуктов, также является более трудоемкой деятельностью, а главное, является (в отличие от амидов) не столь надежной процедурой. Следует добавить, что в синтезе пептидов иногда имеет место быть и другая проблема, связанная с плохой растворимостью полупродуктов. Следствием этого является медленная скорость превращений в разбавленном растворе реагентов в соответствии с законом действующих масс.

Ввиду этих обстоятельств, синтез пептидов требует использования щадящих условий реакций образования амидной связи, а также порой проведения реакций в среде специальных растворителей. В мировой науке накоплен большой арсенал различных реагентов и реакционных сред для осуществления синтеза пептидов. Реагенты различаются, по токсичности, реакционной способности, цене, а также по удобству работы.

Однако, к настоящему времени, ввиду отсутствия дешевого и надежного метода очистки конечных соединений и полупродуктов пептидной природы, хроматографические методы остаются практически единственным универсальным инструментом получения чистых образцов пептидов, приводя при этом к существенному удорожанию продукта. Тем не менее, и хроматографические методы не всегда позволяют достичь желаемой степени очистки. Таким образом, в случае синтеза неописанного в литературе пептида, необходимо экспериментальное тестирование различных вариантов схем образования пептидной связи, особенно в случае, если требуются значительные количества конечных соединений.

Существуют варианты попутного синтеза, в какой-то мере объединяющие в себе качества хроматографических колонок и реактора, называемых «твердофазными» (ТФПС). Эти методы основаны на том, что растущая пептидная цепь химически связана с полимерной подложкой. Это обстоятельство позволяет использовать избытки реагентов для достижения высокой конверсии химических превращений. Избытки реагентов можно достаточно легко удалить из объема пептидилполимера (эта операция аналогична процессу элюирования в хроматографии), таким образом, существенно облегчается очистка продуктов реакции от растворимых исходных соединений. Кроме того, частично решается проблема растворимости полупродуктов в ходе синтеза. Следствием этих преимуществ является высокая скорость синтеза пептидов в твердофазных вариантах (при отсутствии осложнений, например, агрегации).

Однако твердофазные методы не всегда обеспечивают высокие выходы, и, соответственно, экономическую эффективность схемы синтеза по следующим причинам:

- На каждой стадии необходимо тщательно контролировать полноту конверсии реакции на полимерной положке.

- Избытки конденсирующих реагентов могут вызывать побочные реакции.

- За рядом исключений, простых и надежных методов аналитического контроля как степени конверсии реакций, так и наличия побочных реакций, в литературе не описано. На практике обычно лишь качественно определяют остаточное число аминогрупп после проведения реакции конденсации.

- Конверсия даже на уровне 99% существенно сказывается на накоплении побочных продуктов в растущей пептидной цепи. Такие примеси в количестве менее 1%, накапливающиеся на каждой химической операции с пептидилполимером называют микрогетерогенностью образца синтезируемого пептида.

- Нековалентные взаимодействия как между цепями пептида, так и внутри цепи (агрегация) могут приводить к замедлению химических превращений, осуществляемых с пептидом.

- Условия снятия пептидов с полимерной положки могут быть весьма деструктивными.

- Стоимость получения образцов пептидов выше, чем при синтезе в растворе, за счет более высокого расхода реагентов.

Ходе осуществления изобретения использовалось сочетание методов ТФПС и синтез в растворе, поскольку было обнаружено, что некоторые стадии дают неудовлетворительный выход целевых продуктов при проведении реакций на твердой фазе. Ввиду этих обстоятельств были апробированы несколько различных вариаций методов. В частности, целевые пептиды были синтезированы с использованием Boc/Bzl и Fmoc/tBu-защищенных производных аминокислот ТФПС, а также методами синтеза в растворе: REMA-методом и конденсацией фрагментов.

1 Синтез пептида Abu-TGIRIS-Abu-NH2 твердофазным методом с использованием Boc/Bzl-защищенных производных аминокислот

В ходе осуществления изобретения выполняют синтез целевого пептида с использованием полистирола, модифицированного МВНА-линкером (Фиг. 1) с использованием Boc/Bzl-защищенных производных аминокислот ТФПС. Этот метод существенно лучше апробирован на практике, нежели метод с использованием Fmoc/tBu-защищенных производных аминокислот. Кроме того, Boc/Bzl-защищенные производные аминокислот для ТФПС имеют наименьшие рыночные цены. В случае использования Boc/Bzl-защищенных производных аминокислот для ТФПС стандартными защитными группами боковых цепей Ser и Thr является бензильная (в виде бензилового эфира), a Arg - тозильная. Комбинация этих защитных групп и линкера требуют удаления пептида с полимерной подложки и депротекции с помощью сильных кислот. В рамках раскрываемого изобретения для осуществления этих двух превращений используют безводную фтористоводородную кислоту.

Синтез пептида Abu-TGIRIS-Abu-NH2 (Фиг. 2) начинают с конденсации остатка α-аминомасляной кислоты с аминогруппой МВНА-модифицированного полистирола посредством реагента сочетания TBTU. Выбор именно этого реагента был обусловлен его низкой токсичностью и высокой реакционной способностью. Проводят две последовательные реакции конденсации: в течение 1 часа и в течение 18 часов. После повторной конденсации, степень конверсии реакции ацилирования аминогруппы контролируют качественно с использованием нингидринового теста и количественно с помощью пикриновой кислоты (Табл. 1). Использование обоих этих методов по отдельности может приводить к ошибочным результатам. Совместное использование снижает вероятность ошибки. Удаление Вос-группы осуществляют с помощью двукратного воздействия на пептидилполимер 50% раствором трифторуксусной кислоты в дихлорметане.

Таблица 1

Протокол синтеза пептида Abu-TGIRIS- Abu-NH2 с использованием Boc/Bzl- защищенных производных аминокислот, Arg(Tos))a

Условия: Результат:
Xaa Реагент Растворитель Нингидриновый тест %b Пикриновый тест %c
1 2 3 4 5
Abu TBTU DMF >98 99,5
Ser(Bzl) TBTU DMF >98 99,6
Ile TBTU DMF >98 99,5
Arg(Tos) TBTU DMF >98 99,2
Ile TBTU DMF <85 10,6
Ile TBTU (5 экв.) DMF <85 11,4
Ile HATU DMF <85 17,3
Ile (Boc - Ile)2O DMF <85 24,9d
Ile (Boc - Ile)2O DMA <85 32,4d
Ile (Boc - Ile)2O NMP <85 48,4d
Ile Boc-Ile-OPfp DMF <85 9,6
Gly TBTU DMF >98 99,4
Thr(Bzl) TBTU DMF >98 99,5
Abu TBTU DMF >85 89,4
Abu (Boc - Abu)2O DMF >98 98,5

а) Результаты мониторинга конверсий реакций ацилирования аминогрупп после повторной конденсации; b) качественная оценочная величина; c) среднее арифметическое двух измерений; d) после трех последовательных конденсаций.

Три последующие аминокислоты (Ser(Bzl), Ile, Arg(Tos)) встраивают в пептидную цепь целевого продукта аналогичным образом и с таким же контролем. Обнаруживают, что ацилирование α-аминогруппы Arg Boc-Ile с использованием TBTU происходит с низкой скоростью. Поэтому проводят замену ацилирующего реагента: вместо гидроксибензотриазолирового эфира, генерируемого с помощью TBTU, в реакцию вводят симметричный ангидрид (Boc - Ile)2O, генерируемый с помощью DCC. Симметричные ангидриды обладают повышенной реакционной способностью, что подтверждается при оценке степени конверсии в реакции ацилирования (Boc - Ile)2O. Использование других активированных эфиров: Boc-Ile-OPfp и Boc-Ile-OAt (генерируемого с использованием HATU и HOAt) также не приводит к полному ацилированию α-амино группы остатка Arg. Отдельно устанавливают, что его реакционная способность существенно уступает (Boc - Ile)2O. С целью повышения степени конверсии реакции ацилирования остатка Arg реакцию проводят в различных апротонных растворителях. Наилучший результат достигается при использовании (Boc - Ile)2O в N-метил-2-пирролидоне (NMP). Тем не менее, полная конверсия не достигается даже после трех последовательных повторов реакции. С целью исключения накопления продуктов элиминации Ile5, остаток Arg модифицируют с помощью бензойного ангидрида при катализе 4-(диметиламино)пиридина (DMAP).

Реакции конденсации Gly и Thr(Bzl) с использованием TBTU протекают без осложнений. Конденсация Abu проходит медленно при использовании TBTU, поэтому вместо нее используют более трудоемкую процедуру с применением симметричного ангидрида (Boc - Abu)2O. Обнаруживают, что в отличие от реакции (Boc - Ile)2O с Arg(Tos) на пептидил-полимере, взаимодействие (Boc - Abu)2O с Thr(Bzl) происходит с существенным приростом конверсии и практически полностью завершается после повторной конденсации. На Фиг. 2 показана итоговая схема синтеза пептида Abu-TGIRIS-Abu-NH2 c применением Boc/Bzl- защищенных производных аминокислот и производного аргинина Arg(Tos).

Таким образом, хотя синтез целевого проводится достаточно быстро, эффективность предложенной схемы синтеза неудовлетворительна ввиду низкой степени конверсии реакции ацилирования остатка Arg. Причиной низкой скорости реакции может быть агрегация четырех гидрофобных остатков Arg(Tos)-Ile-Ser(Bzl)-Abu. Агрегация в том или ином виде приводит к снижению реакционной способности модифицируемых функциональных групп и, как следствие, низким химическим выходам как реакций сочетания аминокислот. При агрегации пептидных цепей происходит снижение набухаемости пептидилполимера. Эксперименты по количественной оценке объема пептидилполимера не проводились, а визуальная оценка не позволяет сделать однозначный вывод о коллапсировании пептидилполимера. Другим объяснением пониженной реакционной способности Arg(Tos)-Ile-Ser(Bzl)-Abu может быть формирование стабильной конформации тетрапептида, в которой доступ к аминогруппе затруднен.

С целью повышения эффективности синтеза была используют альтеративную схему получения целевого пептида с использованием менее гидрофобного производного Arg, в котором боковая цепь защищена протонированием остатка гуанидина. Соответствующие производное Boc-Arg(H+)-OH находит ограниченное применение в ТФПС, поскольку работа с ним требует мер предосторожности, связанных с необходимостью исключения сильных оснований из реакций конденсации аминокислот с аминогруппами полимера. Следует отметить, что остаток Arg является единственным, у которого в рамках метода Boc/Bzl- защищенных производных аминокислот можно варьировать защитные группы.

Таблица 2

Протокол синтеза пептида Abu-TGIRIS- Abu-NH2 с использованием Boc/Bzl- защищенных производных аминокислот, Arg(H+))a

Условия: Результат:
Xaa Реагент Растворитель Нингидриновый тест %b Пикриновый тест %c
1 2 3 4 5
Abu TBTU DMF >98 99,4
Ser(Bzl) TBTU DMF >98 99,3
Ile TBTU DMF >98 99,2
Arg(H+) TBTU DMF >98 99,4
Ile TBTU DMF <85 35,6d
Ile TBTU NMP <85 45,3d
Ile (Boc - Ile)2O DMF >85 89,2d
Ile (Boc - Ile)2O DMA >85 91,3d
Ile (Boc - Ile)2O NMP >85 90,5d
Gly TBTU DMF >98 99,4
Thr(Bzl) TBTU DMF >98 99,5
Abu TBTU DMF >98 99,5

а) Результаты мониторинга конверсий реакций ацилирования аминогрупп после повторной конденсации; b) качественная оценочная величина; c) среднее арифметическое двух измерений; d) после трех последовательных конденсаций.

Синтез и контроль проводят по схеме, аналогичной схеме с использованием производного Arg(Tos) (Табл. 2, Фиг. 3). Устанавливают, что при использовании гидроксибензотриазолилового активированного эфира Boc-Ile-OBt (генерируемого с TBTU) степень конверсии при ацилировании выше, чем в предыдущей схеме, а при использовании симметричного ангидрида (Boc - Ile)2O - достаточно полной, но едва достигающей 90% даже после трех последовательных конденсаций. Следует, однако, подчеркнуть, что последняя N-концевая аминокислота Abu встраивается в пептидную цепь с использованием менее трудоемкого варианта, а именно с использованием конденсирующего реагента TBTU.

Виду того, что смена защитной группы боковой цепи Arg приводит к повышению конверсии реакции ацилирования Arg, используют еще одну схему синтеза, в которой боковая цепь остатка Arg защищается нитрогруппой. Этот вариант синтеза наиболее эффективен: все реакции конденсации выполняют с использованием конденсирующего реагента TBTU (Табл. 3, Фиг. 4).

Таблица 3

Протокол синтеза пептида Abu-TGIRIS- Abu-NH2 с использованием Boc/Bzl- защищенных производных аминокислот, Arg(NO2))a

Условия: Результат:
Xaa Реагент Растворитель Нингидриновый тест %b Пикриновый тест %c
1 2 3 4 5
Abu TBTU DMF >98 99,2
Ser(Bzl) TBTU DMF >98 99,1
Ile TBTU DMF >98 99,4
Arg(NO2) TBTU DMF >98 99,5
Ile TBTU DMF >85 95,6
Ile TBTU NMP >98 99,4
Gly TBTU DMF >98 99,3
Thr(Bzl) TBTU DMF >98 99,3
Abu TBTU DMF >98 99,3

а) Результаты мониторинга конверсий реакций ацилирования аминогрупп после повторной конденсации; b) качественная оценочная величина; c) среднее арифметическое двух измерений.

Следующим важным шагом является удаление защитных групп боковых цепей аминокислот и снятие пептида с полимерной подложки. Химическое превращение осуществляют с помощью безводного фтористого водорода с добавкой м-крезола или гептилмеркаптана, которые выполняют функцию ловушки («скэвенджера»), обеспечивая в присутствии сильной кислоты образование реакционноспособного карбокатиона (Таблица 4).

В таблице 2 представлены результаты экспериментов по синтезу образцов пептидилполимеров с использованием трех различных защитных групп боковой цепи Arg. Образцы пептидилполимеров вводят в реакцию с безводным фтористым водородом в различных условиях, реакционные смеси обрабатывают и анализируют посредством ВЭЖХ и масс-спектрометрии (MALDI).

На основании полученных результатов делают вывод, что инкубация реакционных смесей в течение 1 ч. при 0°С недостаточна для полного удаления защитных групп. В тоже время, увеличение времени выдержки приводит к деструкции остатков Thr через N→O миграцию остатка Abu и элиминирование по реакции ретро-Михаэля. Кроме того, использование м-крезола выгоднее с точки зрения химического выхода продукта (по данным ВЭЖХ).

В образцах пептидилполимера синтезированного с использованием защищенного производного Arg(H+) выявляют присутствие значительного количества продукта, в котором остаток Arg замещен на остаток орнитина, а боковая цепь орнитина проацилирована остатком Abu. Это показывает, что остаток Arg в условиях реакции конденсации с производным α-аминомасляной кислоты подвергается депротонированию. Подобные побочные реакции известны в литературе на других примерах.

В образцах пептидилполимера, синтезированного с использованием защищенного производного Arg(NO2), обнаруживают значительное количество продукта, который идентифицируют как пептид, в котором остаток Arg замещен на остаток орнитина. Конверсия Arg в орнитин под действием фтористого водорода также известна, но эта побочная реакция, как правило, протекает с низкой скоростью.

C учетом результаты предварительных экспериментов проводят две дополнительные реакции со фтористым водородом в присутствии м-крезола с временем выдержки 2 часа образцов пептидилполимеров с защитными группами Arg(Tos) и Arg(H+). Во втором случае получают максимальный выход целевого пептида (по данным ВЭЖХ площадь пика составляет 29%). Однако, хроматографическая очистка позволяет получить гомогенный образец пептида с выходом очищенного продукта 7%. Значительное снижение выхода обусловлено во-первых, необходимостью отбрасывать значительное количество фракций, содержащих как целевой пептид вместе с плохо отделяемыми примесями. Во-вторых, при анализе выхода реакции методом ВЭЖХ не учитывается экстинкция примесей, которые поглощают в УФ области хуже, чем целевой продукт.

Таблица 4

Результаты обработки HF пептидилполимеров Abu-TGIRIS-Abu-NH-MBHA-PS

а) Оценочная величина, основанная на интегрировании пиков хроматограммы неочищенной реакционной смеси; b) Идентифицированные пики в масс-спектре образца неочищенной реакционной смеси

Таким образом, в ходе осуществления изобретения с помощью Boc/Bzl-защищенных производных аминокислот получают гомогенный образец целевого продукта - пептида Abu-TGIRIS-Abu-NH2 (в амидной форме). Однако, констатируют низкий итоговый выход схемы.

2 Синтез пептида Abu-TGIRIS-Abu-NH2 твердофазным методом с использованием Fmoc/tBu-защищенных производных аминокислот

Изменение способа связывания пептида с полимерной подложкой, а также некоторые изменения в химической природе защитных групп, используемых при использовании Fmoc/tBu-защищенных производных аминокислот, позволяют решить проблему медленного ацилирования остатка Arg. С другой стороны, удаление пептидов с полимерной подложки в этом варианте проходит в среде менее сильной трифторуксусной кислоты. Из литературы известно гораздо меньше примеров деструкции пептидов в этих условиях, хотя реакции боковых цепей аминокислот со скевенджерами известны и в среде трифторуксусной кислоты. В случае использования Fmoc/tBu-защищенных производных аминокислот для ТФПС стандартными защитными группами боковых цепей Ser и Thr является трет-бутильная, а одной из стандартных защитных групп Arg - пентаметилдигидробензофуранилсульфонильная (Pbf).

Кроме того, существует возможность использовать более широкий ряд активированных производных защищенного Ile.

Синтез пептида (Фиг. 2) начина.n с конденсации остатка Fmoc-защищенной α-аминомасляной кислоты c аминогруппой полистирольной подложки, модифицированной Rink-линкером (Фиг. 5) с использованием реагента сочетания TBTU. Периодичность реакций ацилирования и методы контроля полноты ацилирования аналогичными тем, которые применяют при контроле реакций ТФПС с применением Boc/Bzl-защищенных производных аминокислот. Аналогичным образом три последующие аминокислоты (Ser(tBu), Ile, Arg(Tos)) также успешно были встроены в пептидную цепь целевого продукта (Фиг. 6).

В результате выполнения анализа устанавливают, что сочетание гидроксибензотриазолилового активированного эфира Fmoc-Ile-OBt, получаемого активацией TBTU, с пептидилполимером Arg(Pbf)-Ile-Ser(tBu)-Abu-Rink-PS протекает с низкой скоростью, как и в случае Boc-защищенных производных аминокислот. В ходе экспериментального поиска активированного производного Fmoc-Ile с достаточной реакционной способностью устанавливают (Табл. 5), что использование фторида Fmoc-Ile-F для ацилирования приводит к полной конверсии. Fmoc-Ile-F получают с помощью реагента TFFH. Дальнейшие реакции конденсаций защищенных производных аминокислот завершают с использованием TBTU.

Следует также отметить, что для оценки полноты ацилирования аминогруппы Arg проводят реакцию конденсации производного Fmoc-Ile-OBt в среде растворителя, содержащего так называемую «хаотропную добавку», а именно KSCN 4 M в диметилформамиде. Хаотропную добавку используют для предотвращения агрегации и, как следствие, улучшения химического выхода реакций на коллапсирующих полимерах. Однако, наблюдалось лишь незначительное ускорение реакции.

Анализируя этот факт, было установлено, что причиной медленной скорости ацилирования аминогруппы Arg является не коллапс (агрегация) пептидилполимера, а неблагоприятные стерические взаимодействия. В подтверждение этой гипотезы свидетельствуют два факта. Во-первых, из всего набора исследованных ацилирующих реагентов наиболее реакционноспособным является фторид Fmoc-Ile-F, обладающий наименьшим размером уходящей группы. Кроме того, симметричный ангидрид (Fmoc - Ile)2O обладает умеренной реакционной способностью (в отличие от (Boc - Ile)2O), при этом Fmoc группа имеет больший размер, чем Boc, и следовательно, создает более существенные стерические препятствия взаимодействию реакционных центров.

Удаление защитных групп и снятие пептида с полимерной положки осуществляют с помощью трифторуксусной кислоты, используя воду в качестве скэвенджера катионов. С помощью ВЭЖХ показывают наличие в реакционной смеси целевого продукта (около 35%). Многократное хроматографическое разделение реакционной смеси позволяет получить гомогенный образец пептида с выходом очищенного продукта 12%. С помощью масс-спектрометрии идентифицируют целевой продукт, а также ряд примесей: 1067,58 (+Pbf), 773,49 (Arg ->Orn) и 1016,61 (Arg ->Orn(Abu-Thr-Gly)). Тот факт, что наблюдается трансформация Arg в орнитин, свидетельствует о возможности реакции ацилирования защищенной гуанидиновой группы остатка Arg высоко реакционноспособными ацилирующими агентами.

Таблица 5

Протокол синтеза пептида Abu-TGIRIS- Abu-NH2 c использованием Fmoc/tBu-защищенных производных аминокислот a

Условия: Результат:
Xaa Реагент Растворитель Нингидриновый тест %b Пикриновый тест %c
1 2 3 4 5
Abu TBTU DMF >98 99.6
Ser(tBu) TBTU DMF >98 99.2
Ile TBTU DMF >98 99.3
Arg(Pbf) TBTU DMF >98 99.7
Ile TBTU DMF <85 12.3
Ile TBTU DMA <85 16.8
Ile TBTU NMP <85 21.2
Ile TBTU 4M KSCN в DMF <85 24.8
Ile TBTU NMP <85 25.5d
Ile (Fmoc - Ile)2O NMP <85 34.4
Ile HATU NMP <85 47.9
Ile Fmoc-Ile-F NMP >85 89.1
Ile Fmoc-Ile-F NMP >98 98.6d
Gly TBTU DMF >98 99.4
Thr(tBu) TBTU DMF >98 99.5
Abu TBTU DMF >98 99.5

а) Результаты мониторинга конверсий реакций ацилирования аминогрупп после повторной конденсации; b) качественная оценочная величина; c) среднее арифметическое двух измерений; d) после трех последовательных конденсаций.

Таким образом, было устанавливают, что твердофазные варианты синтеза, хотя и позволяют получать целевой продукт в ограниченных количествах, не пригодны для его препаративной наработки в объемах, необходимых для выполнения биологических испытаний. Принципиальной проблемой при этом являются стерические препятствия, возникающие в момент, когда на полимере находится остаток Arg(PG)-Ile-Ser(PG)-Abu. Возможно, этот фрагмент на полистирольных носителях имеет необычную конформацию, в которой за счет нековалентных взаимодействий аминогруппа оказывается скрыта от массивных электрофильных реагентов.

3 Жидкофазный синтез пептида Abu-TGIRIS-Abu-NH2 методом REMA

Для повышения эффективности синтеза пептида Abu-TGIRIS-Abu-NH2 пользуют метод REMA: метод повторяющихся избытков смешанных ангидридов. Этот метод не является твердофазным, реакции протекают в растворе. Преимуществом метода является возможность исключения неблагоприятных стерических взаимодействий тетрапептид-полимера, влияющих на выходы при ТФПС. REMA-метод отличается следующими особенностями:

Во-первых, в этом методе используется избыток (1,6-2 экв.) смешанных ангидридов (Фиг. 7). Избыток необходим для достижения полной конверсии реакции ацилирования. Карбонильный атом углерода угольной кислоты («2») имеет пониженную электронную плотность и не вступает во взаимодействие с нуклеофилами (следует отметить, что иногда, особенно в случае образования связи Pro-Pro, смешанный ангидрид реагирует по второму карбонильному атому углерода с образованием побочного продукта - уретана). Во-вторых, обработка реакционной смеси и выделение продукта конденсации основано на добавлении к реакционной смеси водного раствора слабого основания (гидрокарбоната калия). При этом продукт обычно осаждается из водно-органической фазы, избыток смешанного ангидрида подвергается гидролизу, а продукт гидролиза - карбоксилатанион защищенной аминокислоты находится при этом в растворе. Таким образом, происходит отделение продукта реакции от избытка одного из реагентов. После высушивания продукт подвергается удалению защиты с аминогруппы и процесс повторяется. Ввиду наличия повторяющейся последовательности манипуляций, REMA-метод сходен с твердофазными методами синтеза. Отличиями является отсутствие разделения фаз реагентов и, как следствие, возможность контролировать как полноту протекания каждой стадии, так и наличие побочных продуктов.

Ввиду того, что избыток смешанного ангидрида гидролизуется при использовании основного катализа, синтез проводят, используя Вос-производные аминокислот. Кроме того, боковую цепь Arg защищают тозильной группой, так как особенности проведения конденсаций с производными Arg(H+) приводят к введению в реакционную среду дополнительных реагентов, очистка от которых сложнее при проведении синтеза в растворе по сравнению с ТФПС. Наличие тозильной защитной группы обуславливает использование фтористого водорода для ее удаления в конце синтеза. Для защиты боковых цепей Ser и Thr от возможной реакции O-ацилирования используют бензильные защитные группы. Таким образом, схема синтеза целевого пептида химически напоминает метод ТФПС с использованием Boc/Bzl-защищенных производных аминокслот, однако с точки зрения методологии проведения превращений отличается от него.

Синтез начинают с получения амида α-аминомасляной кислоты. Затем, в соответствии с общей схемой (Фиг. 8 и 9) проводят наращивание пептидной цепи. В отличие от ТФПС-вариантов, удаление N-a-Boc групп проводят смесью TFA/AcOH. Использование этого реагента при синтезе в растворе снижает вероятность расщепления бензиловых эфиров. Все стадии синтеза контролируют хроматографически. Устанавливают, что стадии удаления Boc-группы, а также большинство стадий конденсации проходят без осложнений (Табл. 6).

Таблица 6.

Протокол синтеза пептида Abu-TGIRIS- Abu-NH2 методом REMAa

Условия: Соотношение, %b:
Xaa Реагент Растворитель Пептид Уретан
1 2 3 4 5
Ser(Bzl) i-BuOC(O)Cl DMF-THF >97 <3
Ile i-BuOC(O)Cl DMF-THF >97 <3
Arg(Tos) i-BuOC(O)Cl DMF-THF >97 <3
Ile i-BuOC(O)Cl DMF-THF <10 >90
Ile i-PrOC(O)Cl DMF-THF ок. 40 ок. 60
Ile PivCl DMF-THF <20 >80
Gly i-BuOC(O)Cl DMF >97 3
Thr(Bzl) i-BuOC(O)Cl DMF >97 <3
Abu i-BuOC(O)Cl DMF ок. 20 ок. 80
Abu i-PrOC(O)Cl DMF ок. 90 ок. 10

а) Результаты мониторинга конверсий реакций ацилирования аминогрупп c 2 экв. смешанного ангидрида; b) качественная оценочная величина (ТСХ).

В ходе синтеза обнаруживают, что продукт Boc-Ile-Arg(Tos)-Ile-Ser(Bzl)-Abu-NH2 образуется с низким выходом, а основным продуктом при этом является уретан ROC(O)-Ile- Arg(Tos)-Ile-Ser(Bzl)-Abu-NH2. Проблему селективности частично снимают за счет замены хлорформиата, используемого для получения смешанного ангидрида, на реагент, в котором карбонатный атом углерода стерически экранирован (изопропилхлорформиат).

Этот результат свидетельствует о том, что тетрапептид Arg(Tos)-Ile-Ser(Tos)-Abu-NH2 существует как на полимерной положке, так и в растворе в конформации, в которой аминогруппа стерически экранирована от взаимодействия с электрофилами. Использование симметричного ангидрида (Boc - Ile)2O в NMP (реагент, который в условиях Boc/Bzl ТФПС проявляет наибольшую реакционную способность) не приводит к улучшению выхода. Обнаруживают, что реакция идет с низкой скоростью и сопровождается высоким уровнем рацемизации остатка Ile.

Как и в случае ТФПС Boc/Bzl-защищенных производных аминокислот, конденсация смешанного ангидрида Abu протекает с недостаточной скоростью по карбонильной группе Abu (как следствие, гептапептид быстрее реагирует с карбонатным атомом углерода в соответствующем смешанном ангидриде с образованием уретана). Проблему решают сменой реагента на изопропилхлорформиат.

Удаление защитных групп с помощью безводного фтористого водорода, в условиях аналогичных методу ТФПС с использованием Boc/Bzl-защищенных производных аминокислот, приводит к получению целевого продукта. После хроматографической очистки суммарный химический выход продукта составляет ~21%.

Хотя метод REMA показывает более высокую продуктивность по сравнению с обоими вариантами ТФПС, его использование на практике ограничивается следующими факторами:

- Низкая селективность в реакции получения пентапептида Boc-Ile-Arg(Tos)-Ile-Ser(Bzl)-Abu-NH2.

- Трудоемкость очистки Boc-Ile-Arg(Tos)-Ile-Ser(Bzl)-Abu-NH2 от примеси уретана.

- Необходимость использования для снятия защитных групп высокотоксичного фтористого водорода.

4 Жидкофазный синтез пептида Abu-TGIRIS-Abu-NHz методом конденсации фрагментов

Выбор фрагментов для сборки целевого пептида по варианту 1 (Фиг. 10) обусловливается наличием в молекуле целевого пептида остатка Gly: активация пептидов, содержащих Gly, к рацемизации. Выбор фрагментов для сборки целевого пептида по варианту (2) основан на известных данных об уровне рацемизации алкиламинокислот. Для ряда конденсирующих агентов на модельных пептидах было показано, что этот уровень достаточно низок.

Особенностью жидкофазного способа синтеза пептидов методом конденсации фрагментов является отсутствие защитных групп боковых цепей Ser и Thr. Это связано с тем, что при синтезе в растворе не используются большие избытки активированных производных аминокислот. Кроме того, имеются литературные данные, полученные на модельных пептидах, о способах подавления реакций O-ацилирования при условии отсутствия избытков ацилирующих агентов. В ходе проведения реакций конденсаций, защита боковой цепи Arg обеспечивается протонированием гуанидиновой функциональной группы Arg.

Ключевой химической стадией запланированного синтеза является образование связи Arg-Ile. Из литературы известно, что активация остатка Arg несущего различные защитные группы боковой цепи, с той или иной скоростью подвержена циклизации в 4-лактам. Эта реакция катализируется основаниями, в том числе, аминогруппами защищенных аминокислот или пептидов, которые нужно ацилировать карбоксильной группой Arg. В условиях ТФПС эта побочная реакция практически не сказывается на качестве синтезируемого пептида, потому что образовавшийся при активации δ-лактам остается в растворе и элюируется из объема пептидилполимера при смене реагентов.

В связи с этим было проведено изучение реакции Boc-Arg(H+)-O- c гидрохлоридом этилового эфира Ile при нейтрализации его различными слабоосновными аминами (Фиг. 11). Активацию Boc-Arg(H+)-O- проводят в условиях отсутствия основных реагентов. Соотношение продуктов определяют с помощью ВЭЖХ (Табл. 7). Использование даже такого слабого основания, как NMM для высвобождения свободной аминогруппы из гидрохлорида этилового эфира изолейцина приводит к накоплению значительного количества δ-лактама. В ходе экспериментов о снижению выхода этой побочной реакции устанавливают, что наилучшим конденсирующим реагентом является дициклогексилкарбодиимид в присутствии 1-гидоксибензотриазола (Табл. 7, строка 10). Пониженная температура реакции в этом случае (Табл. 7, строка 11) благоприятно сказывается на селективности, но скорость реакции сочетания оказывается низкой.

Таблица 7

Влияние природы активирующего агента и третичного амина на содержание в реакционной смеси пептида и δ-лактама

Известна реакция ацилирования нитратом активированного эфира защищенного аргинина соли этилового эфира тирозина и 1-гидроксибензотриазола. Синтез соли этилового эфира Ile с 1-гидроксибензотриазолом проводят, как описано ранее с использованием активированного производного Boc-Arg.

В связи с проблемами растворимости, методика получения соли гидроксибензотриазола с этиловым эфиром Tyr применительно к производному Ile не применима, поэтому был использован иной способ получения соединения (6). Карбоксильную группу Ile силилируют триметилсилилхлоридом в присутствии акцептора хлористого водорода триэтиламина, α-аминогруппу алкилируют тритил-хлоридом, силиловый эфир омыляют, а освободившуюся карбоксильную группу превращают в этиловый эфир (5) алкилированием йодистым этилом в присутствии карбоната калия. Затем удаляют тритильную группу действием раствора 1-гидроксибензотриазола в трифторэтаноле (Фиг. 12а). Суммарный выход продукта низок, что объясняется лабильностью тритильной группы.

Используя полученные данные о том, что лучшим из активирующих агентов в реакции сочетания является комбинация дициклогексилкарбодиимида с 1-гидроксибензотриазола (Табл. 7), проводят активацию этими реагентами, а затем вводят в реакционную смесь соединение (6) (Фиг. 12b). Обнаруживают, что реакция соединения (6) в отсутствие третичных аминов существенно более селективна (Табл. 8, строка 1), чем в эксперименте, описанном выше с использованием третичных аминов в качестве оснований. Оценивают влияние температуры на селективность этой реакции, а также определяют селективность при использовании ряда других реагентов. Наилучший результат получают с использованием DCC и HOBt при -5°С. После очистки выход продукта в виде гидрохлорида составляет 56%.

Таблица 8

Влияние природы активирующего агента и температуры реакции на содержание в реакционной смеси пептида и δ-лактама в реакции ацилирования соединения (6)

Условия: Содержание в реакционной смеси, %
Активирующий реагент Температура, С Дипептид Лактам
1 2 3 4 5
1 DCC, HOBt 20 85 5
2 DCC, HOBt 0 75 3
3 DCC, HOBt -5 73 2
4 DCC, HOBt -18 50 <1
5 i-PrOC(O)Cl -5 68 9
6 i-PrOC(O)Cl -18 53 3
7 i-BuOC(O)Cl -18 54 2
8 PivCl -18 56 4
9 PivCl 0 67 8
10 DCC, PfpOH 20 80 10

При синтезе целевого пептида используют схему, приведенную на Фиг. 13. Ввиду того, что остаток Ser подвержен О-ацилированию в несколько большей степени, чем остаток Thr, пептидные связи с участием Ser образовывали последними. Для предотвращения нейтрализации протонированной гуанидиниевой группировки остатка Arg в ходе синтеза использовалось одно из самых слабых оснований - NMM. Конденсации проводят с помощью метода смешанных ангидридов в условиях предложенных в литературе для модельных пептидов.

Обнаруживают, что образование связи Ile - Arg идет с хорошим выходом. Тем не менее, суммарный усредненный выход пептида Abu-TGIRIS-Abu-NH2 (23%) лишь незначительно превосходит выход, полученный с помощью метода REMA. Существенный вклад в такую невысокую эффективность вносит как трудоемкость (количество химических превращений) получения этилизолейцината гидроксибензотриазолида (6) так и невысокий суммарный химический выход, получаемый при синтезе этого соединения.

Ввиду того, что принципиальным фактором, определяющим высокую селективность образования амидной связи Arg(H+X-)-Ile, является отсутствие оснований в реакционной среде, было предположено, что данное превращение может быть осуществлено непосредственно с Ile. Однако, Ile, как и все аминокислоты, нерастворим в органических растворителях. Тем не менее, известно, что в ряде случаев смесь пиридина, трифторуксусной кислоты и диметилформамида переводит аминокислоты в раствор. Более того, полученные растворы вступают во взаимодействие с активированными эфирами N-защищенных аминокислот, а продуктами являются дипептиды. Кроме того, известны реагенты для получения активированных эфиров, в частности, пентафторфениловых, которые в качестве второго продукта реакции (помимо самого активированного эфира) дают соль сильной органической кислоты и пиридина. Далее, в процитированной выше работе, активированный эфир защищенного Arg получали именно с помощью такого реагента.

Устанавливают, что при взаимодействии Boc-Arg(H+)-OPfp (8) (полученного из Boc-Arg(H+)-O- и пентафторфенилтрифторацетата) и Не образуется дипептид Вос-Arg(H+CF3CO2)-Ile (9, Фиг. 14а) наряду с примесью δ-лактама (выход 67 и 8% соответственно).

Удаление Вос-защиты из дипептида 9 приводит к тому, то полученная соль дипептида 12 легко реагирует с пентафторфениловым эфиром Ile (11) в среде диметилформамида в присутствии трифтоацетата пиридиния, который является вторым продуктом реакции получения эфира 11 (Фиг. 14b). Общий выход двух стадий составляет 71%. Продукт этого превращения, трипептид 13 является аналогом интермедиата синтеза целевого пептида. Он может быть получен с помощью пяти последовательных стадий, четыре из которых (Фиг. 14) проводятся в однореакторном режиме, то есть Ile и дипептид 12 вводятся во взаимодействие с соответствующими активированными эфирами 8 и 11 без промежуточного выделения последних. Общий химический выход этилтрипептида 13 по итогам проведения 6 стадий составляет около 10% (с расчетом по Ile) в предыдущем варианте, а сам трипептид получают с 2суммарным выходом 38%.

Устанавливают, что пентафторфениловые эфиры Thr и Gly не являются удовлетворительными субстратами для этого метода (Фиг. 14с). Gly слабо растворим в среде, содержащей трифторацетат пиридиния, а активированный эфир оказывается нестабильным из-за наличия незащищенной гидроксильной группы. Ввиду низкой концентрации Gly в реакционной смеси пентафторфениловый эфир медленно реагирует с единственным доступным нуклеофилом - гидроксильными группами соседних молекул активированного эфира. Однако, дипептид 18, содержащий свободную гидроксильную группу, вступает во взаимодействие с пентафторфениловым эфиром α-аминомасляной кислоты (17) с высокой эффективностью (Фиг. 14d). В этих условиях фрагмент 19, необходимый для синтеза целевого пептида получают с выходом 70%.

Найденные улучшения учитывают при разработке итоговой схемы синтеза пептида Abu-TGIRIS-Abu-NH2 в растворе методом конденсации фрагментов (Фиг. 15). По этой схеме целевой продукт получают с суммарным усредненным химическим выходом 30%.

Метод пригоден для масштабирования, так как в нем не используются высокотоксичные соединения.

5. Сопоставление эффективности методов синтеза пептида

Таким образом, в ходе осуществления изобретения устанавливают, что для синтеза пептида Abu-TGIRIS-Abu-NH2 наиболее эффективным методом является синтез в растворе с использованием конденсации фрагментов. Чистота и идентичность синтезированных образцов пептида подтверждена методом ВЭЖХ с масс-спектрометрической детекцией.

6 Сопоставление терапевтической эффективности действия пептидов Abu-SSVKVS-Abu-NH2 и Abu-TGIRIS-Abu-NH2

Тестирование способности пептидов Abu-TGIRIS-Abu-NH2 (предмет изобретения) и Abu-SSVKVS-Abu-NH2 (прототип) подавлять развитие экспериментального аутоиммунного энцефаломиелита (ЭАЭ) проводят на крысах линии DA, которые генетически предрасположены к развитию симптоматики аутоиммунных заболеваний, в том числе демиелинизации в результате воспалительной реакции иммунной системы как следствие сенсибилизации организма аутологичным миелин содержащим препаратом. В данной системе возможно определение диапазона активных концентраций препарата и эффективности его действия в плане предотвращения или замедления прогресса процесса демиелинизации. Модель предполагает возможность статистической обработки и анализа результатов экспериментов в полном соответствии с требованиями, предъявляемыми к современному фармацевтическому производству.

Гомогенат спинного мозга беспородных крыс готовят по методике [Christine Beeton, Adriana Garcia, K. George ChandyJ Vis Exp. 2007; (5): 224]. Экспериментальной группе из 10 крыс линии DA массой 220-250 г и аналогичной группе контроля в подушечки каждой из двух задних лап вводят гомогенат спинного мозга, смешанный с неполным адъювантом Фрейнда в пропорции 1:1, в суммарном объеме 100 мкл в каждую лапу. На следующий день после иммунизации каждому животному внутрибрюшинно вводят пептид Abu-TGIRIS-Abu-NH2 или Abu-SSVKVS-Abu-NH2 в дозировке 400 мкг/кг массы тела в объеме 100 мкл стерильного апирогенного физиологического раствора. Животным контрольной группы вводят 100 мкл физиологического раствора. Далее животным в течение 18 следующих суток ежедневно вводят аналогичную дозу одного из испытуемых препаратов или плацебо. Крыс ежедневно взвешивают и фиксируют в баллах индекс тяжести клинических проявлений ЭАЭ по следующей шкале: 0 - нет симптомов, 1 - снижение тонуса хвоста, 2 - нарушение установочного рефлекса, 3 - частичный паралич, 4 - полный паралич, 5 - животные погибли или умирают. В сомнительных случаях индекс фиксируют с занижением. Признаки ЭАЭ у животных контрольной группы фиксируются с 8 по 14 день с начала эксперимента (Фиг. 18). Пик заболевания длится 2-3 дня и приходился на 11-14 сутки с начала эксперимента. На Фиг. 18 видно, что у животных экспериментальной группы, получающей прототипный пептид Abu-SSVKVS-Abu-NH2, заболевание начинается на 1 сутки позже, чем у контрольной. Группа, получающая пептид Abu-TGIRIS-Abu-NH2, оказывается защищена от возникновения тяжелой формы паралича: тяжесть симптомов у этих животных не достигает 2 баллов.

Список используемых в тексте сокращений и терминов

ВЭЖХ Высокоэффективная Жидкостная Хроматография

ВЭЖХ-МС Высокоэффективная Жидкостная Хроматография с Масс-спектрометрическим Детектором

ГКГ, МHС Главный комплекс гистосовместимости

ДИ Доверительный интервал

ТКР Т-клеточный рецептор

ЛС Лекарственное средство

МКП Микросателлитный повтор

РС Рассеянный склероз

ОШ Отношение шансов

ПДРФ Анализ полиморфизма длин рестрикционных фрагментов ДНК

ТСХ Тонкослойная хроматография

ТФПС Твердофазный Пептидный Синтез.

экв Эквивалент (мольный)

ЯМР Ядерный Магнитный Резонанс

AcMe Ацетон

AcOH Уксусная кислота

Abu Остаток α-аминомасляной кислоты

АРОЕ Аполипопротеин Е

Boc Трет-бутоксикарбонильная защитная группа

Boc2O Ди-трет-бутилпирокарбонат

i-BuOC(O)Cl Изобутилхлорформиат

tBu, tBu Трет-бутильная защитная группа

Bz2O Бензойный ангидрид

Bzl Бензильная защитная группа

C5 C5 компонент комплемента

C18 Сорбент, содержащий октадецильные алкильные группы

CIITA (MHC2TA) Трансактиватор ГКГ класса II

Cbz, Z Nα-бензилоксикарбонильная защитная группа

CCL3 (MIP-1 alpha, SCYA3) Лиганд СС-хемокинов 3

CCL5 Лиганд СС-хемокинов 5

CCR Рецептор СС-хемокинов

CD45 рецептор протеин-тирозинфосфатазы типа C

CD58 Поверхностный маркер лимфоцитов

2-ClZ 2-хлорбензилоксикарбонильная защитная группа

CTG С-концевая группа

CTLA4 - Ассоциированный с цитотоксическими Т-лимфоцитами белок

DCC Дициклогексилкарбодиимид

DCM Дихлорметан

DIC Диизопропилкарбодиимид

DIPEA Диизопропилэтиламин

DMA Диметилацетамид

DMAP 4-N,N-Диметиламинопиридин

DMF Диметилформамид

DMP 2,2-Диметоксипропан (диметкеталь ацетона)

DMSO Диметилсульфоксид

ESR1 (ESR, ERG) - Эстрогеновый рецептор 1

Et Этильный заместитель

Et3N, TEA Триэтиламин

Fas-ligand - Fas-лиганд

Fmoc Флоуренилметильная защитная группа

Gly, G Остаток аминокислоты глицина

HATU 7-Аза -гидроксибензотриазол-1-ил-тетраметилурония гексафторфосфат

HLA Лейкоцитарный антиген человека в составе ГКГ

HMDS Гексаметилдисилазан

HOAt 7-Аза- 1-гидроксибензотриазол

HOBt 1-Гидроксибензотриазол

HONSu N -окисисукцинимид

HPLC High performance liquid chromatography

НТР Нетранслируемая область гена

ICAM-1 Молекула адгезии ICAM-1

IFNγ Интерферон гамма

IL - Интерлейкин (ИЛ)

IL-1ra Антагонист рецептора интерлейкина-1

IL-2RA, IL-2R, CD25 Альфа-цепь рецептора интерлейкина-2

IL-4R Рецептор интерлейкина-4

IL-7RA - α-цепь рецептора интерлейкина-7

Ile, I Остаток аминокислоты изолейцина

2,6-Lu 2,6-лутидин

LFA-3 (lymphocyte function-associated antigen 3) Поверхностный маркер лимфоцитов CD58

LTα Лимфотоксин альфа

Lys, K Остаток аминокислоты лизина

MALDI Matrix Assisted Laser Desorbtion Ionisation (Десорбция и Ионизация с помощью Лазерного Излучения, Ассистируемая Матриксом).

MBHA Метилбензгидриламинный линкер

МВР Основный белок миелина (ОБМ)

Me Метильный заместитель

2-MePr 2-Метоксипропен

MOG миелиновый олигодендроцитный гликопротеин (МОГ)

MSA Метансульфокислота

NMM N-метилморфолин

NMP N-метилпирролидон

NO2 Нитрогруппа

OPN Остеопонтин, секретируемый фосфопротеин 1

PAI-1 (serpine 1) Ингибитор 1 активатора плазминогена

Pbf 2,2,3,4,6,7-пентаметилдигидробензофуранил-5-сульфонильная защитная группа

PG Защитная группа

PivCl Пивалоил хлорид (хлорангидрид триметилуксусной кислоты)

PS Полистирол (кросс-сшитый 1% дивинилбензолом, в контексте ТФПС)

i-PrOC(O)Cl Изопропилхлорформиат

гPr3SiH Триизопропилсилан

Ph3C Трифенилметил

Pfp Пентафторфенил

PPTS Пиридиния пара-толуолсульфонат

PTPRC Рецептор протеин-тирозинфосфатазы типа C

pTSA п-Толуолсульфокислота

Py Пиридин

PyBOP Бензотриазол-1-ил-окситрипирролидинфосфония гексафторфосфат

R, Arg Остаток аминокислоты аргинина.

RANTES Лиганд СС-хемокинов 5

REMA Повторяющийся избыток смешаных ангидридов (repetitive excess mixed anhydride) Ser, S Остаток аминокислоты серина

Ser(ΨH,HPro) Псевдопролиновая защитная группа боковой цепи серина на основе формальдегида

Ser (ΨMe,MePro) Псевдопролиновая защитная группа боковой цепи серина на основе ацетона

SH2D2A Специфический адаптерный белок T клеток

SPPS Твердофазный Пептидный Синтез (Solid Phase Peptide Synthesis)

SNP (single nucleotide polymorphism) точечная мутация ДНК

TAC1 протахикинин-1

TPA - тканевой активатор плазминогена

TCR β- Т-клеточный рецептор, бета цепь

TFFH Тетраметилфторформамидиния гексафторфосфат

Thr, T Остаток аминокислоты треонина

TFE Трифторэтанол

TGFβ1 трансформирующий ростовой фактор бета1

THF Тетрагидрофуран

TMS Триметилсилил

TNF (TNFα) Фактор некроза опухолей

Trt Трифенилметил, тритил

TSAd Специфический адаптерный белок T-клеток

UGB Утероглобин (секреторный белок клеток Клара)

UCP2 Деассоциирующий белок 2

UTR Нетранслируемая область гена

Val, V Остаток аминокислоты валина

Xaa Остаток аминокислоты.

Пептид с последовательностью Abu-TGIRIS-Abu-NH2 (Abu - α-аминомасляная кислота), синтезируемый твердофазным или жидкофазным способом, отличающийся способностью подавлять развитие экспериментального аутоиммунного энцефаломиелита у крыс.



 

Похожие патенты:

Изобретение относится к применению пептида Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанка) для коррекции дисбиоза при хроническом иммобилизационном стрессе. Пептид Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанк) растворяли в физиологическом растворе и вводили экспериментальным животным (крысам) парентерально (внутрибрюшинно) в дозе 250 мкг/кг массы тела за 15 минут до начала стрессорного воздействия в объеме из расчета 1 мл на 1 кг массы тела.

Изобретение относится к биотехнологии, в частности к иммунологии, и представляет собой иммуногенный модифицированный белок, содержащий (i) белок, имеющий суперспиральный домен, и (ii), по меньшей мере, один положительно заряженный пептид, связанный с С-концом или N-концом суперспирального домена, где указанный модифицированный белок имеет последовательность, как показано в SEQ ID NO: 42 (IMX313P), или имеет последовательность, как показано в SEQ ID NO: 7.

Изобретение относится к области биотехнологии, конкретно к комплексу антиген-МНС-наночастицы, где антигеном является связанный с рассеянным склерозом антиген, и может быть использовано в медицине.

Изобретение относится к биотехнологии. Описан пептидный лиганд, специфичный к человеческому калликреину, который включает полипептид, содержащий по меньшей мере три реакционноспособные группы, разделенные последовательностями по меньшей мере двух петель, и молекулярный остов, формирующий ковалентные связи с реакционно-способными группами полипептида с образованием на молекулярном остове по меньшей мере двух петель полипептида, при этом петли пептидного лиганда включают пять аминокислот и одна петля содержит фрагмент GrA(ψCH2NH)HQ/TxLGr, где Gr означает реакционно-способную группу.

Данное изобретение относится к иммунологии. Предложен выделенный пептид-эпитоп, полученный из ассоциированной с кинетохором молекулы 2 (KNTC2) и обладающий способностью к индукции цитотоксических T-лимфоцитов (CTL) в присутствии антигенпрезентирующей клетки (APC), несущей HLA-A*0201.

Изобретение относится к полипептидам, которые действуют как модуляторы активности комплемента, фармацевтическим композициям, содержащим указанные полипептиды, и к способам применения таких модуляторов в качестве терапевтических средств, для лечения связанных с комплементом заболеваний, например, таких как воспалительное заболевание, рана, повреждение.

Изобретение относится к способу уменьшения частоты возникновения, тяжести и/или длительности мукозита полости рта у субъекта, подвернутого воздействию повреждающей дозы облучения или химиотерапевтических агентов, включающему введение указанному субъекту эффективного количества пептида, содержащего аминокислотную последовательность длиной до 7 аминокислот, причем указанный пептид содержит аминокислотную последовательность Х1Х2Х3Р (SEQ ID NO: 56), в которой: Х1 представляет собой R; Х2 представляет собой I или V, причем Х2 может быть N-метилированным; Х3 представляет собой I или V, причем Х3 может быть N-метилированным; Р представляет собой пролин; при этом SEQ ID NO: 56 представляет собой первые четыре аминокислоты на N-конце указанного пептида, или его фармацевтической соли, сложного эфира или амида, и фармацевтически приемлемого носителя, разбавителя или вспомогательного вещества; или пептида, содержащего аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 5, 7, 10, 14, 17, 18, 22, 23, 24, 27, 28, 31, 34, 35, 63, 64, 66-69, 72, 76, 77, 90 и 92, или его фармацевтической соли, сложного эфира или амида, и фармацевтически приемлемого носителя, разбавителя или вспомогательного вещества.

Изобретение относится к соединению формулы (1), где Ха и Ya каждый представляет собой одинарную связь, пептид А ракового антигена представляет собой пептид, состоящий из аминокислотной последовательности RMFPNAPYL (SEQ ID NO: 2), аминогруппа N-концевой аминокислоты пептида А ракового антигена присоединена к Ya в формуле (1) и карбонильная группа С-концевой аминокислоты пептида А ракового антигена присоединена к гидроксильной группе в формуле (1), R1 представляет собой пептид С ракового антигена, пептид С ракового антигена имеет последовательность, отличную от таковой пептида А ракового антигена, который является пептидом, состоящим из любой аминокислотной последовательности, выбранной из приведенных ниже аминокислотных последовательностей: CMTWNQMNL (SEQ ID NO: 3) и CYTWNQMNL (SEQ ID NO: 4), и тиоэфирная группа цистеинового остатка пептида С ракового антигена присоединена к тиоэфирной группе в формуле (1), или его фармацевтически приемлемой соли.

Изобретение относится к фармакологии и касается композиции для приготовления противоопухолевого средства в виде раствора для инъекций. Композиция содержит аллоферон в концентрации от 0,05 до 0,1 мас.%, цис-дихлордиамминплатину в концентрации от 0,01 до 0,05 мас.% и воду.

Изобретение относится к применимому в медицине соединению формулы I,где n - целое число от 1 до 1500, m - целое число от 1 до 10, каждая из единиц Globo Н (Fucα1→2 Galβ1→3 GalNAcβ 1→3 Galα1→4 Galβ1→4 Glc) ковалентно связана с субъединицей гемоцианина фиссуреллы (KLH) через остатки основных аминокислот, выбранные из аргинина, лизина, гистидина и их комбинации, посредством изображенного линкера, причем отношение эпитопов к молекулам-носителям находится в диапазоне от 750 до 3000.

Изобретение относится к медицине и фармацевтической промышленности, а именно к применению настоя манжетки обыкновенной при гипоксии головного мозга. Применение настоя манжетки обыкновенной Alchemilla vulgaris L., полученного обработкой измельченной до 1-3 мм надземной части манжетки водой при соотношении сырья к экстрагенту 1:20 на кипящей водяной бане в течение 15 мин с последующим охлаждением при комнатной температуре в течение 45 мин, процеживанием и отжиманием сырья, доведением объема полученного настоя до 200 мл, при этом настой в качестве активных веществ содержит 7,7% эллаготанинов и 7,1% полисахаридов, в качестве средства с мембраностабилизирующим действием при гипоксии головного мозга.

Изобретение относится к фармацевтической композиции, а именно к композиции для профилактики или лечения дегенеративного неврологического заболевания. Фармацевтическая композиция для профилактики или лечения дегенеративного неврологического заболевания, содержащая экстракт смеси, содержащей (i) шелковицу и (ii) кожицу Poria cocos в качестве действующего вещества, при этом смесь экстрагирована с использованием воды, спирта или смеси воды и спирта, и в смеси от 4 до 7 весовых частей шелковицы приходятся на 1 весовую часть кожицы Poria cocos, при этом фармацевтическая композиция способна (i) улучшать пространственную память, (ii) улучшать когнитивную память, (iii) увеличивать экспрессию нейронных клеток (NeuN), (iv) уменьшать экспрессию маркера апоптоза (FJB), (v) ингибировать образование β-амилоида, (vi) способствовать образованию нейротрофического ростового фактора, (vii) ингибировать активность ацетилхолинэстеразы (AChE), (viii) ингибировать цитотоксичность, (ix) подавлять фосфорилирование тау-белка или (х) давать любую комбинацию перечисленного.

Объектом изобретения являются замещенные производные имидазо[1,2-b]пиридазина формулы IIB или его фармацевтически приемлемые соли. В формуле IIB Е обозначает -О-, -СН2- или -С(О)-; Q обозначает -СН2-; Z обозначает водород или метил; V обозначает N; R12 обозначает водород; R15 обозначает дифторметоксигруппу; R16 обозначает водород или галоген; R21 обозначает гидрокси(С1-С6)алкил; или R21 обозначает азетидинил, пиперидинил, пиперазинил, морфолинил или 3-азабицикло[3.2.1]октанил, любая из этих групп необязательно может содержать 1, 2 или 3 заместителя, независимо выбранных из группы, включающей трифторметил, гидроксигруппу, C1-С6-алкилсульфонил, оксогруппу, карбоксигруппу и С2-С6-алкоксикарбонил; и R23 обозначает водород.

Изобретение относится к гидрокситриглицеридам, их синтезу, фармацевтической и/или нутрицевтической композиции, которая содержит по меньшей мере один из указанных гидрокситриглицеридов, и к способу, который включает введение пациенту терапевтически эффективного количества по меньшей мере одного из указанных гидрокситриглицеридов или по меньшей мере одной из указанных фармацевтических и/или нутрицевтических композиций для профилактики и/или лечения по меньшей мере одного заболевания, выбранного из рака, метаболических/сердечно-сосудистых заболеваний и/или неврологических/воспалительных заболеваний.

Изобретение относится к новому соединению формулы (1) и его энантиомеру. Соединение обладает свойствами аффинного связывания с субъединицами α2δ потенциально-зависимых кальциевых каналов и может быть использовано при лечении нейропатической боли, в частности головной боли и мигрени, в лечении заболеваний центральной нервной системы и/или периферической нервной системы, например, выбранных из эпилепсии, ишемического цереброваскулярного заболевания, инсульта, церебральных новообразований, болезни Альцгеймера, болезни Пика, болезни Хантингтона, деменции, болезни Паркинсона и других.В формуле (1) R1 представляет собой С1-4 алкильную группу,R2 представляет собой или иR3 представляет собой водород или С1-4 алкильную группу.

Изобретение относится к ингибиторам PDE1 активности формулы I (значения радикалов указаны в формуле изобретения) в свободной форме или в форме фармацевтически приемлемой соли, к способам их получения, к способам лечения заболеваний, связанных с ингибирующей PDE1 активностью, и к фармацевтическим композициям, содержащим указанные соединения.

Изобретение относится к медицине, а именно к неврологии, и может быть использовано для терапии болезни Альцгеймера. Предложено применение пептида общей формулы ацетил-D-LYS-Lys-ARG-ARG-амид для лечения болезни Альцгеймера.

Настоящее изобретение относится к фармацевтической промышленности, а именно к способу профилактики или лечения дегенеративного неврологического заболевания субъекта.

Изобретение относится к медицине и фармации и касается фармацевтической композиции нейропротекторного действия в форме лиофилизата для изготовления инъекционной или инфузионной лекарственных форм, содержащей в качестве действующего вещества гексаметилендиамид бис-(N-моносукцинил-L-глутамил-L-лизина) и функциональные добавки, в качестве которых используют лиопротекторы и криопротекторы в определенном количественном соотношении компонентов при использовании рекомендованных режимов сушки и замораживания.
Изобретение относится к области медицины. Предложено применение композиции, содержащей уридин или фосфат уридина и докозагексаеновую кислоту и/или эйкозапентаеновую кислоту для получения продукта для улучшения памяти и/или лечения или предупреждения нарушения функции памяти, предпочтительно у субъекта с 24, 25 или 26 баллами по краткой шкале оценки психического статуса (MMSE), где композиция содержит фосфолипиды, холин, витамин Е, витамин С, селен, витамин В12, витамин В6 и фолиевую кислоту.

Изобретение относится к применению пептида Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанка) для коррекции дисбиоза при хроническом иммобилизационном стрессе. Пептид Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанк) растворяли в физиологическом растворе и вводили экспериментальным животным (крысам) парентерально (внутрибрюшинно) в дозе 250 мкг/кг массы тела за 15 минут до начала стрессорного воздействия в объеме из расчета 1 мл на 1 кг массы тела.

Изобретение относится к области органической химии и фармацевтики, в частности к разработке метода медикаментозного лечения различных форм рассеянного склероза у человека. Предметом изобретения является пептид с последовательностью Abu-TGIRIS-Abu-NH2, где Abu - α-аминомасляная кислота, который при внутривенном введении крысам предотвращает развитие у них экспериментального аутоиммунного энцефаломиелита - распространенной животной модели рассеянного склероза. 18 ил., 9 табл., 6 пр.

Наверх