Модулирование бета-дамасценона у растений

Изобретение относится к области биохимии, в частности к трансгенной растительной клетке табака, обладающей повышенной экспрессией или активностью неоксантин-синтазы по сравнению с клеткой растения табака дикого типа, к растению, растительному материалу табака и табачной композиции, содержащим вышеуказанную клетку. Также раскрыт способ повышения содержания каротиноидов у растения табака, предусматривающий повышение экспрессии или активности неоксантин-синтазы у растения. Изобретение также относится к способу получения растения табака с повышенным содержанием бета-дамасценона по сравнению с растением табака дикого типа, предусматривающему повышение экспрессии или активности неоксантин-синтазы у растения. Изобретение позволяет эффективно получать растение табака с повышенным содержанием каротиноидов. 6 н. и 3 з.п. ф-лы, 7 ил., 7 пр.

 

Область техники

Настоящее изобретение относится к полинуклеотидным последовательностям неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы из Nicotiana tabacum и их вариантам, гомологам и фрагментам. Так, в частности, описана модификация экспрессии неоксантин-синтазы или активности кодируемого таким образом белка с целью изменения количества бета-дамасценона, которое можно выявить в аэрозоле нагретого табака, что в результате дает новые вкусовые профили у табака.

Уровень техники

Бета-дамасценон является влияющим на аромат фактором в образующемся в результате сухой перегонки аэрозоле высушенного табака. Он имеет характерный фруктовый вкус приготовленного яблока, который также можно встретить в природе у Rosa damascena Mill (дамасской розы), что, таким образом, указывает на существование ферментативного пути его синтеза у некоторых растений. Цветки Rosa damascena известны за их тонкий запах, и их собирают в промышленных объемах ради розового масла, применяемого в парфюмерии и для получения розовой воды. Цветочные лепестки также иногда применяют непосредственно для придания приятного запаха или вкуса пище или напитку, и полагают, что они безопасны для употребления человеком.

Каротиноиды являются потенциальными предшественниками для получения бета-дамасценона. Термическое окисление неоксантина приводит к образованию бета-дамасценона. Неоксантин является окисленным производным каротиноида, являющимся представителем класса ксантофиллов, и состоит из восьми изопреноидных блоков. У увядших и высушенных листьев свободный неоксантин отсутствует или выявляется лишь на очень низких уровнях. В ходе пути биосинтеза растительных каротиноидов, который имеет место в таких пластидах, как хлоропласты, ферменты, известные как участвующие в образовании неоксантина, принадлежат к классу неоксантин-синтаз. Неоксантин-синтаза катализирует образование неоксантина из виолаксантина и кодируется полинуклеотидом АВА4. Ликопин-бета-циклаза также катализирует образование неоксантина из виолаксантина и кодируется полинуклеотидом NeSy. 9-цис-эпоксикаротиноиддиоксигеназа(ы) катализирует расщепление цис-неоксантина до Сгб-алленового-апо-альдегида и ксаноксина и кодируется полинуклеотидом NCED2.

В данной области техники все еще существует потребность в растительных материалах, таких как табак, с модифицированными вкусовыми профилями. Целью настоящего изобретение является удовлетворение такой потребности.

Сущность изобретения

Соответствующие гены АВА4, NeSy и NCED2 были клонированы и секвенированы из Nicotiana tabacum и было проведено исследование влияния измененной экспрессии таких генов. Предполагают, что кодируемые полинуклеотидами NeSy и NCED2 ферменты являются компонентами пути биосинтеза каротиноидов, и было обнаружено, что положительная регуляция экспрессии полинуклеотида NeSy и отрицательная регуляция экспрессии полинуклеотида NCED2 в растении повышают содержание каротиноидов. Тем не менее, не наблюдали измененную выработку бета-дамасценона. К удивлению было обнаружено, что повышение экспрессии полинуклеотида АВА4 не только повышало содержание каротиноидов, но также значительно повышало содержание бета-дамасценона в аэрозоле, образованном после нагрева высушенного табака, полученного из табачного растения. Эти результаты были еще более неожиданными, так как полинуклеотид NeSy кодирует фермент, который принимает участие на той же стадии в пути биосинтеза каротиноидов, что и полинуклеотид АВА4, но было обнаружено, что полинуклеотид NeSy не оказывал значительного влияния на уровни бета-дамасценона. Не желая привязываться к любой конкретной теории, настоящие результаты позволяют предположить, что кодируемая полинуклеотидом АВА4 неоксантин-синтаза играет центральную роль в синтезе бета-дамасценона у Nicotiana tabacum. Это дает возможность получения растений, у которых уровни бета-дамасценона изменены и, таким образом, в результате изменены вкусовые профили. Можно сконструировать растения, у которых изменено содержание их каротиноидов. Такие растения могут иметь питательную ценность для потребителя. В дополнение к этому, изменение содержания каротиноидов растения можно использовать для получения растений, которые являются устойчивыми к гербицидам, ингибирующим биосинтез каротиноидов, что может расширить применение ингибиторов каротиноидов в качестве гербицидов для сельскохозяйственных культур, которые в настоящее время чувствительны к таким соединениям. Преимущественно, такие модификации практически не изменяют внешний вид растений, что является важным критерием для приемлемости в промышленном применении и для достижения максимума урожаев растений и т. п.

Аспекты и варианты осуществления настоящего изобретения изложены в прилагаемой формуле изобретения. В соответствии с одним аспектом настоящее изобретение относится к выделенному полинуклеотиду, содержащему последовательность, кодирующую неоксантин-синтазу и обладающую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 1 или SEQ ID NO: 6, или состоящему или фактически состоящему из нее.

В соответствии с другим аспектом настоящее изобретение относится к кодируемому полинуклеотидом выделенному полипептиду.

В соответствии с другим аспектом настоящее изобретение относится к выделенному полипептиду, обладающему по меньшей мере 66% идентичности последовательности с SEQ ID NO: 2 или по меньшей мере 60% идентичности последовательности с SEQ ID NO: 7.

В соответствии с другим аспектом настоящее изобретение относится к конструкту, вектору или вектору экспрессии, содержащему выделенный полинуклеотид(ы).

В соответствии с другим аспектом настоящее изобретение относится к мутантной, не встречающейся в природе или трансгенной растительной клетке, содержащей описываемые в настоящем документе выделенный полинуклеотид(ы), полипептид или конструкт, вектор или вектор экспрессии, и причем экспрессия или активность неоксантин-синтазы является измененной по сравнению с контрольным растением или растением дикого типа.

В соответствии с одним вариантом осуществления мутантное, не встречающееся в природе или трансгенное растение содержит растительную клетку.

В соответствии с другим аспектом настоящее изобретение относится к способу изменения содержания каротиноидов растений, включающему следующие стадии: (i) изменение экспрессии или активности неоксантин-синтазы в растении, предпочтительно, причем неоксантин-синтаза охватывает полинуклеотидную последовательность или полипептидную последовательность, изложенные в настоящем документе; (ii) измерение содержания каротиноидов по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было модифицировано по сравнению с контрольным растением, у которого экспрессия или активность неоксантин-синтазы не была изменена.

В соответствии с одним вариантом осуществления у растения также изменена экспрессия или активность ликопин-бета-циклазы или 9-цис-эпоксикаротиноиддиоксигеназы или их комбинации.

В соответствии с одним вариантом осуществления ликопин-бета-циклаза охватывает полинуклеотидную последовательность, изложенную в SEQ ID NO: 8, или обладает с ней по меньшей мере 60% идентичности последовательности, или полипептидная последовательность охватывает изложенную в SEQ ID NO: 9 или обладает с ней по меньшей мере 60% идентичности последовательности, и причем 9-цис-эпоксикаротиноиддиоксигеназаохватывает полинуклеотидную

последовательность, изложенную в SEQ ID NO: 13, или обладает с ней по меньшей мере 60% идентичности последовательности.

В соответствии с другим аспектом настоящее изобретение относится к способу изменения содержания бета-дамасценона растений, включающему следующие стадии: (i) изменение экспрессии или активности неоксантин-синтазы в растении, предпочтительно, причем неоксантин-синтаза охватывает описанную в настоящем описании полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания бета-дамасценона по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного в стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание бета-дамасценона в нем было модифицировано по сравнению с контрольным растением, у которого экспрессия или активность неоксантин-синтазы не была изменена.

В соответствии с другим аспектом настоящее изобретение относится к мутантному, не встречающемуся в природе или трансгенному растению или растительному материалу который происходит или может происходить от них и который получен или который можно получить с помощью способа(способов), описанного в настоящем документе.

В соответствии с другим аспектом настоящее изобретение относится к мутантному, не встречающемуся в природе или трансгенному растению, у которого экспрессия неоксантин-синтазы или активность кодируемого таким образом белка была повышена; причем содержание лютеина или содержание бета-каротина в зеленом листе или комбинированное содержание лютеина и бета-каротина растения является более высоким, чем в контрольном растении, у которого экспрессия или активность неоксантин-синтазы не была повышена; и причем содержание бета-дамасценона в аэрозоле высушенного растительного материала по меньшей мере на 10% выше, чем в аэрозоле из контрольного растения, предпочтительно, причем: (i) содержание лютеина в зеленом листе растения составляет по меньшей мере приблизительно 18 мг /100 г; (ii) содержание бета-каротина у растения составляет по меньшей мере приблизительно 12 мг / 100 г; и (iii) содержание бета-дамасценона в аэрозоле, полученном в результате нагревания листовой биомассы из растения, составляет по меньшей мере приблизительно 1 нг/мг.

В соответствии с другим аспектом настоящее изобретение относится к растительному материалу, включающему биомассу, семена или листья из описанных в настоящем документе растений.

В соответствии с другим аспектом настоящее изобретение относится к табачному продукту, содержащему растительные клетки, по меньшей мере часть растения или растительного материала, описанного в настоящем документе.

В соответствии с другим аспектом настоящее изобретение относится к способу получения бета-дамасценона, включающему следующие стадии: (а) получение по меньшей мере части растения, растительного материала или табачного продукта, которые описаны в настоящем документе; и (b) их нагрев с получением аэрозоля, содержащего бета-дамасценон. Дополнительно аспекты включают нижеперечисленное.

Химерный ген, содержащий один или несколько описанных в настоящем документе выделенных полинуклеотидов, функционально связанных с одним или несколькими регуляторными последовательностями.

Полинуклеотидный конструкт, содержащий один или несколько описанных в настоящем документе выделенных полинуклеотидов и содержащий по меньшей мере 15-30 нуклеотидов, 30-50 нуклеотидов, 50-100 нуклеотидов, 100-150 нуклеотидов, 150-200 нуклеотидов, 200-300 нуклеотидов, 300-400 нуклеотидов, 400-500 нуклеотидов, 500-600 нуклеотидов или 600-700 нуклеотидов или состоящий или фактически состоящий из них. Потребительский продукт, который включает описанные в настоящем документе растительный материал, биомассу, семя или листья или в котором они были использованы.

Линия клеток, содержащая описанные в настоящем документе выделенный полинуклеотид, химерный ген, полинуклеотидный конструкт, двухцепочечную РНК, конъюгат или вектор экспрессии и т. п. Способ изменения экспрессии одного или нескольких описанных в настоящем документе полинуклеотидов или активности одного или нескольких кодируемых ими полипептидов в клетке, причем указанный способ включает введение описываемых в настоящем документе химерного гена, полинуклеотидного конструкта, двухцепочечной РНК, конъюгата или вектора экспрессии.

Способ определения, выделения, амплификации или анализа одного или нескольких описанных в настоящем документе полинуклеотидов, причем способ включает стадию получения содержащего полинуклеотид образца и гибридизацию указанного полинуклеотида с полинуклеотидной молекулы, содержащей нуклеотидную последовательность по меньшей мере из 10 смежных нуклеотидов из выделенной нуклеотидной последовательности. Способ изменения содержания каротиноидов и содержания бета-дамасценона, или содержания каротиноидов, или содержания бета-дамасценона по меньшей мере в части растения по сравнению с контрольным растением, включающий применение средства, которое изменяет экспрессию одного или нескольких описанных в настоящем документе полинуклеотидов или активность кодируемого ними белка. Применение средства, которое изменяет экспрессию одного или нескольких описанных в настоящем документе полинуклеотидов или активность кодируемого ними белка для изменения содержания каротиноидов и содержания бета-дамасценона, или содержания каротиноидов, или содержания бета-дамасценона по меньшей мере в части растения по сравнению с контрольным растением.

В соответствии с одним вариантом осуществления средство представляет собой химерный полинуклеотидный ген, полинуклеотидный конструкт, содержащий один или несколько полинуклеотидов, антисмысловую РНК, двухцепочечную РНК, кДНК, конъюгат, содержащий один или несколько полинуклеотидов или по меньшей мере одну ненуклеотидную или неполинуклеотидную часть, ковалентно связанную с ними, рибозим, мутаген, "цинковый палец", малую молекулу или мегануклеазу или является их производным.

В соответствии с другим вариантом осуществления полинуклеотидный фрагмент(ы) кодирует антисмысловую нуклеиновую кислоту, рибозим, РНК, которая воздействует на опосредуемый сплайсосомой транс-сплайсинг, интерферирующую РНК, гидовую РНК или другую нетранслируемую РНК и т. п. В соответствии с другим вариантом осуществления полинуклеотидный фрагмент(ы) кодирует интерферирующую РНК.

Краткое описание чертежей

Фигура 1. Упрощенный вариант пути синтеза каротиноидов у растений. Неоксантин и лютеин являются предшественниками-кандидатами, участвующими в образовании бета-дамасценона в листьях. Дополнительные, но до сих пор не охарактеризованные стадии включают, соответственно, образование гликозидов и бактериальное разложение в ходе сушки.

Фигура 2. (А) кДНК-последовательность NtABA4, амплифицированная из К326, применяемого для конструирования растений 35S::NtABA4; (В) транслированная последовательность NtABA4; (С) прямые (F) и обратные (R) праймеры, применяемые для амплификации последовательности NtABA4. 5' cacс последовательность в F-праймере необходима для клонирования в векторы pENTER Gateway.

Фигура 3. Клонирование и секвенирование геномной последовательности табака из Hicks Broadleaf, соответствующей копии гена NtABA4. (А) Такая геномная последовательность с пятью экзонами и четырьмя нитронами охватывает в сумме 1808 п. о. (1792 + 16 п. о. интронных границ). (В) кДНК NtABA4 (Т) и клонированная геномная изоформа N1ABA4 (CQ) не являются идентичными. (С) Прогнозируемая копия NIABA4 длинной 786 п. о., выведенная из геномной последовательности (Sbjct), отличается по 7 аминокислотам от клонированной кДНК N1ABA4 (Query), включающей один серии в положении 9 в транзитном пептиде хлоропласта, который отсутствует в геномной копии.

Фигура 4. (А) кДНК-последовательность NtNeSy, амплифицированная из К326, применяемая для конструирования растений 35S::NtNeSy; (В) транслированная последовательность NtNeSy; (С) прямые (F) и обратные (R) праймеры, применяемые для амплификации последовательности NtNeSy. 5' cacс последовательность в F-праймере необходима для клонирования в векторы pENTER Gateway.

Фигура 5. (А) Частичная кДНК-последовательность NtNCED2, применяемая для конструирования растений с NtNCED2-интерферирующей РНК. (В) Прямой (F) или обратный (R) праймеры, применяемые для амплификации частичной последовательности NtNCED2. 5' cacс последовательность в F-праймере необходима для клонирования в векторы pENTER Gateway.

Фигура 6. Концентрации лютеина, бета-каротина и полуколичественный анализ неоксантина в "зеленых" образцах (листовые пулы) отобранных линий TN90-4, 35S::NtNeSy-l_2 (NeSyl-2), 35S::NIABA4-2_2 (АВА4-2_2) и с NtNCED2-интерферирующей РНК-1_4 (CED2-1_4).

Фигура 7. Содержание бета-дамасценона в аэрозоле (аэрозоль), высушенном табаке (табак) и прессованных видах (прессованный) табака после образования аэрозоля у линий TN90-4 (TN90 контроль), 35S::NtNeSy-l_2 (NeSyl-2), 35S::NtABA4-2_2 (АВА4-2-2) и с NtNCED2-интерферирующей РНК-1_4 (CED2-1_4). В трех повторностях проведен количественный анализ бета-дамасценона, включающий симулятор курения, захват аэрозоля и количественный анализ бета-дамасценона. По результатам анализа Т-критерия видно, что содержание бета-дамасценона в аэрозоле линии NtABA4-2_2 является статистически отличным от TN90-4 (Р<0,01) и что содержание бета-дамасценона в прессованном виде линии NtABA4-2_2 является статистически отличным от TN90-4 (Р<0,05).

Определения

Используемые в рамках настоящей заявки технические термины и выражения обычно имеют значение, традиционно применяемое к ним в области техники, связанной с растениями и молекулярной биологией. Все последующие определения терминов применимы ко всему содержанию настоящей заявки. Слово "включающий" не исключает другие элементы или стадии, а обозначения в форме единственного числа не исключают формы множественного числа. Отдельная стадия может соответствовать функциям нескольких признаков, перечисленных в формуле изобретения. Термины "приблизительно", "фактически" и "примерно" в контексте заданного исчисляемого значения или диапазона относятся к значению или диапазону, которые находятся в пределах 20%, в пределах 10% или в пределах 5%, 4%, 3%, 2% или 1% от заданного значения или диапазона.

Термин "выделенный" относится к любому объекту, который взят из его естественной среды, но термин не означает какую-либо степень очистки.

"Вектор" относится к носителю на основе нуклеиновой кислоты, который включает комбинацию компонентов на основе нуклеиновой кислоты для обеспечения возможности транспорта нуклеиновой кислоты, конструктов нуклеиновой кислоты и конъюгатов нуклеиновой кислоты и т. п. Подходящие векторы включают способные к внехромосомной репликации эписомы, такие как кольцевые двухцепочечные плазмиды на основе нуклеиновой кислоты, линеаризированные двухцепочечные плазмиды на основе нуклеиновой кислоты и другие векторы любого происхождения.

"Вектор экспрессии" является носителем на основе нуклеиновой кислоты, который содержит комбинацию компонентов на основе нуклеиновой кислоты для обеспечения возможности экспрессии нуклеиновой кислоты, такой как полинуклеотид АВА4, конструктов нуклеиновой кислоты и конъюгатов нуклеиновой кислоты и т. п. Подходящие векторы экспрессии включают способные к внехромосомной репликации эписомы, такие как кольцевые двухцепочечные плазмиды на основе нуклеиновой кислоты, линеаризированные двухцепочечные плазмиды на основе нуклеиновой кислоты и другие функционально эквивалентные векторы экспрессии любого происхождения. Вектор экспрессии содержит по меньшей мере промотор, расположенный выше и функционально связанный с нуклеиновой кислотой, конструктами нуклеиновой кислоты или конъюгатом нуклеиновой кислоты, определения которым даны ниже.

Термин "конструкт" относится к фрагменту двухцепочечной рекомбинантной нуклеиновой кислоты, включающему один или несколько полинуклеотидов. Конструкт включает "матричную цепь", спаренную основаниями с комплементарной "смысловой или кодирующей цепью". Указанный конструкт может быть вставлен в вектор в двух возможных ориентациях, либо в такой же (или смысловой) ориентации, либо в обратной (или антисмысловой) ориентации по отношению к ориентации промотора, расположенного в векторе, таком как вектор экспрессии.

"Промотор" относится к элементу/последовательности нуклеиновой кислоты, обычно расположенным выше и функционально связанным с двухцепочечным фрагментом ДНК. Промоторы могут быть полностью производными от участков, близких к представляющему интерес нативному гену, или могут быть составлены из различных элементов, производных от различных нативных промоторов или сегментов синтетической ДНК.

Термины "гомология, идентичность или сходство" относятся к степени сходства последовательности у двух полипептидов или у двух молекул нуклеиновой кислоты при сравнении с помощью выравнивания последовательностей. Степень гомологии у двух сравниваемых последовательностей дискретной нуклеиновой кислоты зависит от числа идентичных или соответствующих нуклеотидов в сравниваемых положениях. Процентную идентичность можно определить при помощи визуального осмотра и математического расчета. Альтернативно, процентную идентичность двух последовательностей нуклеиновой кислоты можно определить путем сравнения информации о последовательности при помощи компьютерной программы, такой как ClustalW, BLAST, FASTA или Smith-Waterman. Термин "растение" относится к любому растению на любой стадии цикла его жизни или развития и его потомству. В соответствии с одним вариантом осуществления растением является "табачное растение", которое относится к роду Nicotiana. Предпочтительные виды табачного растения описаны в настоящем документе.

"Растительная клетка" относится к структурной и функциональной единице растения. Растительная клетка может быть в форме протопласта без клеточной стенки, выделенной отдельной клетки или культивированной клетки или в виде части более высоко организованной единицы, такой как без ограничения ткань растения, орган растения или целое растение. Термин "растительный материал" относится к любой твердой, жидкой или газообразной композиции или их комбинации, получаемой из растения, включая биомассу, листья, стебли, корни, цветки или части цветков, плоды, пыльцу, яйцеклетки, зиготы, семена, черенки, выделения, экстракты, культуры клеток или тканей или любые другие части или продукты из растений. В соответствии с одним вариантом осуществления растительный материал включает биомассу, семя или листья или состоит из них. В соответствии с другим вариантом осуществления растительный материал включает листья или состоит из них.

Термин "сорт" относится к популяции растений, которая имеет постоянные характеристики, отделяющие их от других растений того же вида. Несмотря на обладание одним или несколькими отличительными признаками, сорт дополнительно характеризуется очень малой общей изменчивостью между индивидуумами в рамках такого сорта. Сорт зачастую реализуют коммерчески.

Применяемый в настоящем документе термин "линия" или "селекционная линия" указывает на группу растений, которые применяют в ходе селекции растений. Линию можно отличить от сорта, поскольку она демонстрирует малую изменчивость между индивидуумами по одному или нескольким представляющим интерес признакам, несмотря на то, что может быть некоторая изменчивость между индивидуумами по другим признакам.

Термин "изменение" может относиться к уменьшению, ингибированию, увеличению или к иному влиянию на экспрессию или активность полипептида. Термин также может относиться к уменьшению, ингибированию, увеличению или к иному влиянию на активность кодирующего полипептид гена, что может включать без ограничения изменение транскрипционной активности.

Применяемый в настоящем документе термин "уменьшить" или "уменьшенный" относится к уменьшению, составляющему от приблизительно 10% до приблизительно 99%, или уменьшению, составляющему по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98%, по меньшей мере 99% или по меньшей мере 100% или более, количества или активности, как, например, без ограничения активности полипептида, транскрипционной активности и экспрессии белка.

Применяемый в настоящем документе термин "ингибировать" или "ингибированный" относится к уменьшению, составляющему от приблизительно 98% до приблизительно 100%, или уменьшению, составляющему по меньшей мере 98%, по меньшей мере 99%, а в частности 100%, от количества или активности, как, например, без ограничения активности полипептида, транскрипционной активности и экспрессии белка.

Применяемый в настоящем документе термин "увеличить" или "увеличенный" относится к увеличению, составляющему от приблизительно 5% до приблизительно 99%, или к увеличению, составляющему по меньшей мере 5%, по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98%, по меньшей мере 99% или по меньшей мере 100% или более от количества или активности, как, например, без ограничения активности полипептида, транскрипционной активности и экспрессии белка. Термин "контроль" в контексте контрольного растения означает растение или растительную клетку, у которой экспрессия или активность фермента не была модифицирована (например, увеличена или уменьшена), и поэтому она может послужить в качестве сравнения с растением, у которого была модифицирована экспрессия или активность фермента. Контрольное растение может содержать пустой вектор. Контрольное растение может соответствовать растению дикого типа.

Подробное описание изобретения

В соответствии с одним вариантом осуществления настоящее изобретение относится к выделенному полинуклеотиду, содержащему полинуклеотидную последовательность, обладающую по меньшей мере 60% идентичности последовательности с любой из описанных в настоящем документе последовательностей, включая любой из показанных в перечне последовательностей полинуклеотидов, или состоящему или фактически состоящему из них. Соответственно, выделенный полинуклеотид содержит последовательность, обладающую по меньшей мере 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности к ним, или состоит или фактически состоит из нее.

В соответствии с другим вариантом осуществления настоящее изобретение относится к выделенному полинуклеотиду, содержащему полинуклеотидную последовательность, кодирующую неоксантин-синтазу и обладающую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 1, или состоящему или фактически состоящему из нее. Соответственно, выделенный полинуклеотид содержит последовательность, обладающую по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 1, или состоит или фактически состоит из нее.

В соответствии с другим вариантом осуществления настоящее изобретение относится к выделенному полинуклеотиду, содержащему полинуклеотидную последовательность, кодирующую ликопен-бета-циклазу и обладающую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 8, или состоящему или фактически состоящему из нее. Соответственно, выделенный полинуклеотид содержит последовательность, обладающую по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 8, или состоит или фактически состоит из нее.

В соответствии с другим вариантом осуществления настоящее изобретение относится к выделенному полинуклеотиду, содержащему полинуклеотидную последовательность, кодирующую 9-цис-эпоксикаротиноиддиоксигеназу и обладающую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 1, или состоящему или фактически состоящему из нее. Соответственно, выделенный полинуклеотид содержит последовательность, обладающую по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 13, или состоит или фактически состоит из нее. Применяемый в настоящем документе термин "полинуклеотид" относится к полимеру нуклеотидов, который может быть немодифицированной или модифицированной дизоксирибонуклеиновой кислотой (ДНК) или рибонуклеиновой кислотой (РНК). Таким образом, полинуклеотидом может быть без ограничения геномная ДНК, комплементарная ДНК (кДНК), мРНК или антисмысловая РНК или их фрагмент(ы). Кроме того, полинуклеотидом может быть одноцепочечная или двухцепочечная ДНК, ДНК, которая является смесью одноцепочечных и двухцепочечных участков, гибридная молекула, включающая ДНК и РНК, или гибридная молекула со смесью одноцепочечных и двухцепочечных участков, или ее фрагментах фрагменты). В дополнение к этому, полинуклеотид может состоять из трехцепочечных участков, включающих ДНК, РНК, или и ту, и другую, или их фрагмент(ы). Полинуклеотид может включать одно или несколько модифицированных оснований, таких как фосфотиоаты, и может быть пептидной нуклеиновой кислотой. Обычно, полинуклеотиды можно подбирать из выделенных или клонированных фрагментов кДНК, геномной ДНК, олигонуклеотидов, или отдельных нуклеотидов, или комбинации из вышеупомянутых. Несмотря на то, что описанные в настоящем документе полинуклеотидные последовательности показаны в качестве последовательностей ДНК, последовательности включают их соответствующие последовательности РНК и комплементарные им (например, полностью комплементарные) последовательности ДНК или РНК, включая обратно комплементарные им последовательности.

Термин "полинуклеотид NtABA4" относится к полинуклеотидам, кодирующим неоксантин-синтазу из Nicotiana tabacum, и включает другие полинуклеотиды, содержащие полинуклеотиды с существенной гомологией (то есть сходством последовательностей) или существенной идентичностью с SEQ ID NO: 1 или SEQ ID NO: 6 или состоящие или фактически состоящие из них; полинуклеотидные варианты, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичности последовательности с последовательностью из SEQ ID NO: 1 или SEQ ID NO: 6; фрагментам полинуклеотида NtABA4, включающим фрагменты SEQ ID NO: 1 или SEQ ID NO: 6; фрагментам из SEQ ID NO: 1 или SEQ ID NO: 6 с существенной гомологией (то есть сходством последовательностей) или существенной идентичностью с ними, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 1 или SEQ ID NO: 6. Полинуклеотид NtABA4 также включает последовательности, характеризующиеся достаточной или значительной степенью идентичности или сходства с SEQ ID NO: 1 или SEQ ID NO: 6 для кодировки полипептида, который функционирует как неоксантин-синтаза. В соответствии с одним вариантом осуществления термин "полинуклеотид NtABA4" относится к полимеру нуклеотидов, который содержит полинуклеотид, обозначенный в настоящем документе как SEQ ID NO: 1 или SEQ ID NO: 6, состоит или фактически состоит из него. Термин "полинуклеотид NtNeSY" относится к полинуклеотидам, кодирующим ликопин-бета-циклазу из Nicotiana tabacum, и включает другие полинуклеотиды, содержащие полинуклеотиды со значительной гомологией (то есть сходством последовательности) или значительной идентичностью с SEQ ID NO: 8, состоящие или фактически состоящие из них; фрагментам полинуклеотида NtNeSy, включающим фрагменты из SEQ ID NO: 8; полинуклеотидным вариантам, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичности последовательности с последовательностью SEQ ID NO: 8; фрагментам из SEQ ID NO: 8 со значительной гомологией (то есть сходством последовательности) или значительной к ним идентичностью, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 8; и фрагментам из SEQ ID NO: 8 со значительной гомологией (то есть сходством последовательности) или значительной идентичностью к ним, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 8. Полинуклеотид NtNeSy также включает последовательности, характеризующиеся достаточной или значительной степенью идентичности или сходства с SEQ ID NO: 8 для кодировки полипептида, который функционирует как ликопен бета-циклаза. В соответствии с одним вариантом осуществления термин "полинуклеотид NtNeSy" относится к полимеру нуклеотидов, который содержит полинуклеотид, обозначенный в настоящем документе как SEQ ID NO: 8, который обладает 100% идентичности последовательности с нею, состоит или фактически состоит из него. Термин "полинуклеотид NtNCED2" относится к полинуклеотидам, кодирующим 9-цис-эпоксикаротиноиддиоксигеназу из Nicotiana tabacum, и включает другие полинуклеотиды, содержащие полинуклеотиды со значительной гомологией (то есть сходством последовательности) или значительной идентичностью с SEQ ID NO: 13 состоящие или фактически состоящие из них; полинуклеотидным вариантам, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичности последовательности с последовательностью SEQ ID NO: 13; фрагментам полинуклеотида NtNeSy, включающим фрагменты из SEQ ID NO: 13; фрагментам из SEQ ID NO: 13 со значительной гомологией (то есть сходством последовательности) или значительной к ним идентичностью, которые обладают по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 13. Полинуклеотид NtNCED2 также включает последовательности, характеризующиеся достаточной или значительной степенью идентичности или сходства с SEQ ID NO: 13 для кодировки полипептида, который функционирует как 9-цис-эпоксикаротиноиддеоксигеназа. В соответствии с одним вариантом осуществления термин "полинуклеотид NtNCED2" относится к полимеру нуклеотидов, который содержит полинуклеотид, обозначенный в настоящем документе как SEQ ID NO: 13 со 100% идентичностью последовательности к ней, состоит или фактически состоит из него.

Описываемый в настоящем документе полинуклеотид как правило будет содержать фосфодиэфирные связи, хотя в некоторых случаях включены полинуклеотидные аналоги, которые могут иметь альтернативные остовы, включающие, например, фосфорамидатные, фосфортиоатные, фосфородитиоатные или О-метилфофорамидитные мостики; пептидные полинуклеотидные остовы и мостики. Другие аналогичные полинуклеотиды включают полинуклеотиды с остовами с положительным зарядом, неионными остовами и нерибозными остовами. Модификации рибозофосфатного остова могут быть получены для различных целей, например, для увеличения стабильности и полураспада таких молекул в физиологических условиях или в качестве зондов на биочипе. Можно получить смеси встречающихся в природе полинуклеотидов и аналогов; альтернативно можно получить смеси различных полинуклеотидных аналогов и смеси встречающихся в природе полинуклеотидов и аналогов.

Известен ряд полинуклеотидных аналогов, включая, например, фосфорамидатные, фосфотиоатные, фосфородитиоатные, О-метилфосфорамидитные мостики и пептидные полинуклеотидные остовы и мостики. Другие аналогичные полинуклеотиды включают полинуклеотиды с остовами с положительным зарядом, неионными остовами и нерибозными остовами. Также включены полинуклеотиды, содержащие один или несколько карбоциклических сахаров.

Другие аналоги включают пептидные полинуклеотиды, которые являются пептидными полинуклеотидными аналогами. Такие остовы являются практически неионными в нейтральных условиях в отличие от высоко заряженного фосфодиэфирного остова встречающихся в природе полинуклеотидов. Это может в результате обеспечить преимущества. Во-первых, пептидный полинуклеотидный остов может характеризоваться улучшенной кинетикой гибридизации. Пептидные полинуклеотиды подвергаются большим изменениям при температуре плавления по несоответствующим по сравнению с предпочтительно соответствующим парам оснований. У ДНК и РНК обычно наблюдают 2-4°С падение температуры плавления для внутренних несоответствий. При неионном пептидном полинуклеотидном остове спад становится ближе к 7-9°С. Аналогично, в связи с их неионной природой гибридизация оснований, присоединенный к своим остовам, является относительно малочувствительной к концентрации солей. В дополнение к этому, пептидные полинуклеотиды могут не распадаться или распадаются в меньшей степени посредством действия клеточных ферментов и, таким образом, могут быть более стабильными. Помимо применений раскрываемых полинуклеотидов и комбинаций их фрагментов настоящее изобретение относится к применению фрагментов в качестве зондов в анализах на основе гибридизации нуклеиновых кислот или праймеров для применения для анализов на основе амплификации нуклеиновых кислот. Такие фрагменты обычно содержат по меньшей мере приблизительно 10,11,12, 13, 14,15, 16, 17, 18, 19 или 20 или более смежных нуклеотидов последовательности ДНК. В соответствии с другими вариантами осуществления фрагмент ДНК содержит по меньшей мере приблизительно 10, 11, 12, 13, 10, 15, 20, 30, 40, 50 или 60 или более смежных нуклеотидов последовательности ДНК. Таким образом, в соответствии с одним аспектом также настоящее изобретение относится к способу определения полинуклеотида АВА4, включающему применение зондов или праймеров или и того, и другого. Иллюстративными праймерами являются изложенные в SEQ ID NO: 3-5. В соответствии другим аспектом также настоящее изобретение относится к способу определения полинуклеотида NeSy, включающему применение зондов или праймеров или и того, и другого. Иллюстративными праймерами являются изложенные в SEQ ID NO: 10-12. В соответствии с другим аспектом также настоящее изобретение относится к способу определения полинуклеотида NCED2, включающему применение зондов или праймеров или и того, и другого. Иллюстративными праймерами являются изложенные в SEQ ID NO: 14-16.

Основные параметры, влияющие на выбор условий гибридизации, и методологические руководства по разработке подходящих условий описаны в Sambrook, J., Ε. F. Fritsch, and T. Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). С помощью знаний о генетическом коде в сочетании с описанными в настоящем документе аминокислотными последовательностями можно получить множество вырожденных олигонуклеотидов. Такие олигонуклеотиды пригодны в качестве праймеров, например, для полимеразных цепных реакций (ПЦР), посредством которых выделяют и амплифицируют фрагменты ДНК. В соответствии с некоторыми вариантами осуществления вырожденные праймеры можно применять в качестве зондов для генетических библиотек. Такие библиотеки могут включать без ограничения кДНК-библиотеки, геномные библиотеки и даже электронные ДНК-библиотеки и библиотеки маркеров экспрессируемых последовательностей. Определенные посредством такого способа гомологичные последовательности затем можно применять в качестве зондов для определения гомологов указанных в настоящем документе последовательностей. Также потенциально пригодны полинуклеотиды и олигонуклеотиды (например, праймеры или зонды), которые гибридизируются в менее жестких условиях, как правило умеренно жестких условиях и обычно условиях высокой жесткости, с описанным в настоящем документе полинуклеотидом(полинуклеотидами). Основные параметры, влияющие на выбор условий гибридизации, и методологические руководства по разработке подходящих условий изложены в Sambrook, J., Ε. F. Fritsch, and T. Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.) и могут быть легко определены специалистами в данной области, исходя, например, из длины или состава оснований полинуклеотида.

Один вариант достижения умеренно жестких условий включает применение раствора для предварительной промывки, содержащего 5х стандартный раствор цитрата натрия, 0,5% додецилсульфата натрия, 1,0 мМ этилендиаминтетрауксусную кислоту (рН 8,0), гибридизационного буфера из приблизительно 50% формамида, 6х стандартного раствора цитрата натрия и температуры гибридизации, составляющей приблизительно 55°С (или другие сходные гибридизационные растворы, такие как раствор, содержащий приблизительно 50% формамида при температуре гибридизации, составляющей приблизительно 42°С), и условий промывания приблизительно 60°С, в 0,5х стандартном растворе цитрата натрия, 0,1% додецилсульфата натрия. Обычно, условия высокой жесткости определяют как описанные выше гибридизационные условия, но с промыванием при температуре примерно 68°С, 0,2х стандартным раствором цитрата натрия, 0,1% додецилсульфатом натрия. SSPE (lx SSPE представляет собой 0,15 M хлорид натрия, 10 мМ фосфат натрия и 1,25 мМ этилендиаминтетрауксусная кислота, рН 7,4) может быть альтернативой для стандартного раствора цитрата натрия (1х стандартный раствор цитрата натрия представляет собой 0,15 M хлорида натрия и 15 мМ цитрата натрия) в гибридизационных и промывочных буферах; промывания осуществляют в течение 15 минут после завершения гибридизации. Следует понимать, что температуру промывания и концентрацию соли для промывания в случае необходимости можно корректировать для достижения необходимой степени жесткости посредством применения основных принципов, управляющих реакциями гибридизации и стабильностью дуплекса, которые известны специалистам в данной области и дополнительно описаны ниже (см., например, Sambrook, J., Ε. F. Fritsch, and T. Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y). При гибридизации полинуклеотида с целевым полинуклеотидом неизвестной последовательности предполагают, что длина гибрида будет равна длине гибридизирующегося полинуклеотида. При гибридизации полинуклеотидов известной последовательности длину гибрида можно определить посредством выравнивания последовательностей полинуклеотидов и выявления участка или участков с оптимальной комплементарностью последовательностей. Температура гибридизации для гибридов с предполагаемой длиной менее 50 пар оснований должна быть на 5-10°С меньше, чем температура плавления гибрида, причем температуру плавления определяют в соответствии со приведенными далее уравнениями. Для гибридов длинной менее 18 пар оснований температура плавления (°С)=2(число оснований А+Т)+4(число оснований G+C). Для гибридов длиной свыше 18 пар оснований температура плавления (°C)=81,5+16,6(log10 [Na+])+0,41(% G+C)-(600/N), где Ν является числом оснований в гибриде, a [Na+] представляет собой концентрацию ионов натрия в гибридизационном буфере ([Na+] для 1х стандартного раствора цитрата натрия=0,165 М). Как правило, каждый такой гибридизирующийся полинуклеотид имеет длину, которая составляет по меньшей мере 25% (обычно по меньшей мере 50%, 60% или 70%, наиболее часто по меньшей мере 80%) от длины полинуклеотида, с которым он гибридизируется, и обладает по меньшей мере 60% идентичности последовательности (например, по меньшей мере 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100%) с полинуклеотидом, с которым он гибридизируется.

Любому специалисту в данной области будет понятно, что линейная ДНК имеет две возможные ориентации: 5-3' направление и 3-5' направление. Например, если эталонная последовательность расположена в 5-3' направлении, и если вторая последовательность расположена в 5'-3' направлении в рамках той же полинуклеотидной молекулы/нити, то эталонная последовательность и вторая последовательность ориентированы в одном направлении или имеют одинаковую ориентацию. Как правило, промоторная последовательность и представляющий интерес ген под контролем данного промотора расположены в одинаковой ориентации. Однако, что касается эталонной последовательности, расположенной в 5'-3' направлении, если вторая последовательность расположена в 3'-5' направлении в рамках той же полинуклеотидной молекулы/нити, то эталонная последовательность и вторая последовательность ориентированы в антисмысловом направлении или имеют антисмысловую ориентацию. Две последовательности, имеющие антисмысловые ориентации относительно друг друга, могут быть альтернативно описаны как имеющие одинаковую ориентацию, если эталонная последовательность (в 3'-5' направлении) и обратно комплементарная последовательность эталонной последовательности (эталонной последовательности, расположенной в 5'-3') расположены в рамках одной полинуклеотидной молекулы/нити. Изложенные в настоящем документе последовательности показаны в 5-3' направлении. Приведенные в настоящем документе рекомбинантные конструкты можно применять для трансформации растений или растительных клеток с целью изменения уровней экспрессии или активности белка. Рекомбинантный полинуклеотидный конструкт может включать полинуклеотид, кодирующий один или несколько полинуклеотидов, которые описаны в настоящем документе, функционально связанные с регуляторным участком, подходящим для экспрессии полипептида в растении или растительной клетке. Таким образом, полинуклеотид может включать кодирующую последовательность, которая кодирует описанный в настоящем документе полипептид. Растения у которых изменены уровни экспрессии или активности белка могут включать мутантные растения, не встречающиеся в природе растения, трансгенные растения, созданные человеком растения или генетически сконструированные растения. Соответственно, трансгенное растение содержит геном, который был изменен путем стабильного встраивания рекомбинантной ДНК. Рекомбинантная ДНК включает ДНК, которая была генетически сконструирована и построена вне клетки, и включает ДНК, содержащую встречающуюся в природе ДНК или кДНК или синтетическую ДНК. Трансгенное растение может включать растение, регенерированное из исходно трансформированной растительной клетки, и трансгенных растений-потомков из более поздних поколений или скрещиваний трансформированного растения.

Кодируемый рекомбинантным полинуклеотидом полипептид может представлять собой нативный полипептид или может быть гетерологичным по отношению к клетке. В некоторых случаях рекомбинантный конструкт содержит полинуклеотид, который изменяет экспрессию, функционально связанную с регуляторным участком. Примеры подходящих регуляторных участков описаны в настоящем документе.

Предусмотрены векторы, содержащие рекомбинантные полинуклеотидные конструкты, такие как описанные в настоящем документе. Подходящие основы вектора включают, например, основы, которые традиционно применяют в данной области, такие как плазмиды, вирусы, искусственные хромосомы, бактериальные искусственные хромосомы, искусственные дрожжевые хромосомы или искусственные хромосомы бактериофага. Подходящие векторы экспрессии включают без ограничения плазмиды и вирусные векторы, полученные, например, из бактериофага, бакуловирусов и ретровирусов. На рынке доступно множество векторов и систем экспрессии.

Векторы также могут включать, например, точки начала репликации, участки прикрепления к матриксу или маркеры. Маркерный ген может придавать пригодный для отбора фенотип растительной клетке. Например, маркер может придавать биоцидную устойчивость, такую как устойчивость к антибиотикам (например, канамицину, G418, блеомицину или гигромицину) или к гербициду (например, глифосату, хлорсульфурону или фосфинотрицину). В дополнение к этому, вектор экспрессии может включать последовательность метки, предназначенную для облегчения манипулирования или определения (например, очистки или локализации) эксспрессируемого полипептида. Последовательности метки, такие как люцифераза, бета-глюкуронидаза, зеленый флуоресцентный белок, глутатион-S-трансфераза, полигистидин, с-myc или гемагглютининовые последовательности, обычно экспрессируют в виде химеры с кодируемым полипептидом. Такие метки могут быть вставлены в любом положении полипептида, в том числе либо на карбоксильном конце, либо на аминоконце.

Растение или растительную клетку можно трансформировать путем введения интегрированного в его/ее геном рекомбинантного полинуклеотида, что делает ее стабильно трансформированной. Описанные в настоящем документе растение или растительная клетка, таким образом, могут быть стабильно трансформированными. Стабильно трансформированные клетки, как правило, сохраняют интродуцированный полинуклеотид с каждым клеточным делением. Растение или растительную клетку также можно временно трансформировать с тем, чтобы рекомбинантный полинуклеотид не интегрировался в его/ее геном. Временно трансформированные клетки, как правило, теряют все или некоторую часть интродуцированного рекомбинантного полинуклеотида с каждым делением клетки, так что интродуцированный рекомбинантный полинуклеотид не может быть определен в дочерних клетках после значительного числа клеточных делений.

В данной области техники доступен ряд способов трансформации растительной клетки, все из которых охвачены в настоящем документе, включая баллистическую трансфекцию, методики с генной пушкой, опосредованную агробактериями трансформацию, опосредованную вирусным вектором трансформацию и электропорацию Система на основе Agrobacterium для встраивания чужеродной ДНК в растительные хромосомы была широко исследована, модифицирована и используется для генетической инженерии растений. "Голые" молекулы рекомбинантной ДНК, содержащие последовательности ДНК, соответствующие рассматриваемому очищенному белку табака, функционально связанные в смысловой и антисмысловой ориентации с регуляторными последовательностями, соединяют с соответствующими последовательностями Т-ДНК при помощи общепринятых способов. Их вводят в протопласты табака при помощи методик с применением полиэтиленгликоля или при помощи методик электропорации, обе из которых являются стандартными. Альтернативно, такие векторы, содержащие молекулы рекомбинантной ДНК, кодирующие рассматриваемый очищенный белок табака, вводят в живые клетки Agrobacterium, которые затем переносят ДНК в клетки табака. Трансформацию "голой" ДНК без сопутствующих векторных последовательностей Т-ДНК можно осуществить путем слияния протопластов табака с ДНК-содержащими липосомами или путем электропорации. "Голую" ДНК, не сопровождаемую векторной последовательностью Т-ДНК, также можно применять для трансформации клеток табака с помощью инертных, летящих с высокой скоростью микрочастиц.

Если клетку или культивируемую ткань применяют в качестве реципиентной ткани для трансформации, то растения при необходимости можно регенерировать из трансформированных культур при помощи известных специалистам в данной области методик. Выбор регуляторных участков для включения в рекомбинантный конструкт зависит от нескольких факторов, включая без ограничения эффективность, возможность проведения отбора, индуцируемость, необходимый уровень экспрессии и предпочтительную для клетки или ткани экспрессию. Изменение экспрессии кодирующей последовательности путем соответствующего выбора и расположения регуляторных участков по отношению к кодирующей последовательности является рутинной задачей для любого специалиста в данной области. Транскрипцию полинуклеотида можно изменять таким же способом. Некоторые подходящие регуляторные участки инициируют транскрипцию только, или преимущественно, в определенных типах клеток. Способы определения и характеристики регуляторных участков в растительной геномной ДНК хорошо известны из уровня техники.

Подходящие промоторы включают тканеспецифичные промоторы, узнаваемые тканеспецифичными факторами, присутствующими в различных тканях или типах клеток (например, специфичные для корня промоторы, специфичные для побега промоторы, специфичные для ксилемы промоторы), или присутствующими во время различных стадий развития, или присутствующими в ответ на различные условия окружающей среды. Подходящие промоторы включают конститутивные промоторы, которые могут быть активированы в большинстве типов клеток без необходимости специфичных индуцирующих факторов Примеры подходящих промоторов для контроля выработки полипептида RNAi включают промотор вируса мозаики цветной капусты 35S (CaMV/35S), SSU, OCS, Iib4, usp, STLS1, B33, nos или убиквитиновые или фазеолиновые промоторы. Специалисты в данной области смогут создать множество вариантов рекомбинантных промоторов. Тканеспецифичные промоторы являются элементами управления транскрипцией, которые активны только в конкретных клетках или тканях в конкретные моменты времени в ходе развития растения, к примеру, в вегетативных тканях или репродуктивных тканях. Тканеспецифичная экспрессия может быть преимущественной, например, когда предпочтительна экспрессия полинуклеотидов в определенных тканях. Примерами тканеспецифичных промоторов под контролем развития включают промоторы, которые могут инициировать транскрипцию только (или преимущественно только) в определенных тканях, таких как вегетативные ткани, например, корни или листья, или репродуктивные ткани, такие как плод, сямязачатки, семена, пыльца, пыльники, цветки или любая эмбриональная ткань. Специфичные для репродуктивных тканей промоторы могут быть, например, специфичными для пыльников, специфичными для семязачатков, специфичными для зачатков, специфичными для эндосперма, специфичными для покровов семяпочки, специфичными для семян или покровов семян, специфичными для пыльцы, специфичными для лепестков, специфичными для чашелистика или их комбинациями.

Подходящие специфичные для листьев промоторы включают пируватный, ортофосфатдикиназный (PPDK) промотор из С4 растения (маис), промотор cab-mlCa+2 из маиса, промотор (Atmyb5) гена, родственного myb Arabidopsis thaliana, рибулозабифосфаткарбоксилазные (RBCS) промоторы (например, генов RBCS1, RBCS2 и RBCS3A томата, экспрессирующиеся в листьях и сеянцах на стадии роста на свету, RBCS1 и RBCS2, экспрессирующиеся при развитии плодов томатов, или рибулозабифосфаткарбоксилазный промотор, который экспрессируется практически исключительно в мезофильных клетках листовых пластинок и влагалищах листа на высоких уровнях).

Подходящие специфичные для старения промоторы включают промотор томата, активный в ходе созревания плодов, старения и опадания листьев, маисовый промотор гена, кодирующего цистеиновую протеазу. Можно применять подходящие специфичные для пыльников промоторы. Специалистом в данной области могут быть выбраны подходящие специфичные для корня промоторы. Подходящие специфичные для семян промоторы включают как специфичные для семени промоторы (такие промоторы активны в ходе развития семян, к примеру, промоторы запасных белков семени), так и промоторы прорастания семян (такие промоторы активны в ходе прорастания семени). Такие предпочтительные для семени промоторы включают без ограничения Ciml (индуцируемый цитокином элемент); CZ19B1 (маисовый зеин, 19 кДа); milps (миоинозитол-1-фосфат-синтаза); mZE40-2, также известный как Zm-40; nuclc и celA (синтаза целлюлозы). Гамма-зеиновый является специфичным для эндосперма промотором. Glob-1 является специфичный для эмбриона промотором. Для двудольных растений специфичные для семян промоторы включают без ограничения бета-фазеолина бобовых, напиновый, р-конглицининовый, лектина сои, круцифериновый и т. п. Для однодольных растений специфичные для семян промоторы включают без ограничения промотор маисового зеина, 15 кДа, промотор зеина 22 кДа, промотор зеина 27 кДа, промотор g-зеина, промотор гамма-зеина 27 кДа (такой как промотор gzw64A, см. номер доступа в Genbank S78780), промотор гена waxy, промотор shrunken 1, промотор shrunken 2, промотор гена глобулина 1 (см. номер доступа в Genbank L22344), промотор Itp2 , промотор ciml, промоторы маиса endl и end2, промотор nud, промотор Zm40, eepl и еер2; led, промотор тиоредоксина Н; промотор mlipl5, промотор PCNA2; и промотор shrunken-2.

Примеры индуцируемых промоторов включают промоторы, чувствительные к нападению патогена, анаэробным условиям, высокой температуре, свету, засухе, холодной температуре или высокой концентрации соли. Индуцируемые патогеном промоторы включают промоторы связанных с патогенезом белков (белки PR), которые индуцируются после инфицирования патогеном (например, белки PR, белки SAR, бета-1,3-глюканазы, хитиназы).

Помимо растительных промоторов другие подходящие промоторы могут иметь бактериальное происхождение (например, промотор октопинсинтазы, промотор нопалинсинтазы и другие промоторы, полученные из Ti-плазмид) или могут быть получены из вирусных промоторов (например, промоторов 35S и 19S РНК вируса мозаики цветной капусты (CaMV), конститутивных промоторов вируса табачной мозаики, промоторов 19S и 35S вируса мозаики цветной капусты (CaMV), промотора 35S вируса мозаики норичника). Термин "полипептид NtABA4" относится к полипептиду, кодирующему так называемую "неоксантин-синтазу" из Nicotiana tabacum, и включает другие полипептидные варианты, содержащие аминокислотную последовательность, кодируемую полинуклеотидным вариантом по меньшей мере приблизительно с 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичностью последовательности с SEQ ID NO: 1, или полинуклеотидным вариантом по меньшей мере приблизительно с 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% и 99% идентичностью последовательности с SEQ ID NO: 6, состоящие или фактически состоящие из нее; полипептидный вариант, обладающий по меньшей мере приблизительно 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичности последовательности с SEQ ID NO: 2, или полипептидный вариант, обладающий по меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичности последовательности SEQ ID NO: 7; фрагменты полипептида NtABA4 с SEQ ID NO: 2 или SEQ ID NO: 7; и фрагменты из SEQ ID NO: 2 или SEQ ID NO: 7, которые обладают по меньшей мере приблизительно 60%, 65%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 2 или SEQ ID NO: 7, соответственно. Полипептид(ы) NtABA4 также включает последовательности, характеризующиеся достаточной или значительной степенью идентичности или сходства с SEQ ID NO: 2 или SEQ ID NO: 7 для функционирования в качестве неоксантин-синтазы. Фрагменты полипептида NtABA4, как правило, сохраняют неоксантин-синтазную активность. Полипептиды NtABA4 также включают мутантов, полученных в результате введения любого типа изменений (например, вставок, делеций или замен аминокислот; модификаций в структурах гликозилирования; модификаций, которые затрагивают рефолдинг или изомеризации, трехмерные структуры или получаемые в результате самосборки структуры), которые могут быть преднамеренно сконструированы или выделены естественным путем, при условии, что они все еще функционируют как неоксантин-синтаза. Полипептиды NtABA4 могут находиться в линейной форме, или их можно циклизировать при помощи известных способов. Термин "полипептид NtABA4" также может относиться к полипептиду, кодируемому посредством SEQ ID NO: 1 или SEQ ID NO: 6, который обладает 100% идентичности последовательности с ними, или полипептиду, содержащему последовательность, изложенную в SEQ ID NO: 2 или SEQ ID NO: 7, которая обладает 100% идентичности последовательности с ними, состоящему или фактически состоящему из нее.

Термин " полипептид NtNeSy" относится к полипептиду, кодирующему ликопин-бета-циклазу из Nicotiana tabacum, и включает другие полипептидные варианты, содержащие аминокислотную последовательность, кодируемую полинуклеотидом по меньшей мере с приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичностью последовательности с SEQ ID NO: 9, состоящие или фактически состоящие из нее; полипептидный вариант, обладающий по меньшей мере 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 9; фрагменты полипептида NtNeSy с SEQ ID NO: 9; и фрагменты из SEQ ID NO: 9, которые обладают меньшей мере приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с соответствующими фрагментами из SEQ ID NO: 9. Полипептиды NtNeSy также включают последовательности, характеризующиеся достаточной или значительной степенью идентичности или сходства с SEQ ID NO: 9 для функционирования как ликопен-бета-циклаза. Фрагменты полипептида NtNeSy, как правило, сохраняют активность ликопен-бета-циклазы. Полипептиды NtNeSy также включают варианты и мутантов, полученных в результате введения любого типа изменений (например, вставок, делеций или замен аминокислот; модификаций в структурах гликозилирования; модификаций, которые затрагивают рефолдинг или изомеризации, трехмерные структуры или получаемые в результате самосборки структуры), которые могут быть преднамеренно сконструированы или выделены естественным путем, при условии, что они все еще функционируют как ликопен-бета-циклаза. Полипептиды NtNeSy могут находиться в линейной форме, или их можно циклизировать при помощи известных способов. Термин "полипептид NtNeSy" также может относиться к полипептиду, содержащему последовательность, изложенную в SEQ ID NO: 9, состоящему или фактически состоящему из нее, со 100% идентичности последовательности к ней. Термин "полипептид NtNCED2" относится к полипептиду, кодирующему 9-цис-эпоксикаротиноидциоксигеназу из Nicotiana tabacum, и включает полипептид, содержащий аминокислотную последовательность, кодируемую полинуклеотид ой с 100% идентичности последовательности с SEQ ID NO: 13, состоящий или фактически состоящий из нее; или полипептидный вариант, содержащий аминокислотную последовательность, кодируемую полинуклеотидом по меньшей мере с приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% или 99% идентичностью последовательности с SEQ ID NO: 13, состоящий или фактически состоящий из нее. Также предусмотрены фрагменты полипептида NtNCED2, которые, как правило, сохраняют активность 9-цис-эпоксикаротиноиддиоксиназы. Полипептиды NtNCED также включают варианты и мутантов, полученных в результате введения любого типа изменений (например, вставок, делеций или замен аминокислот; модификаций в структурах гликозилирования; модификаций, которые затрагивают рефолдинг или изомеризации, трехмерные структуры или получаемые в результате самосборки структуры), которые могут быть преднамеренно сконструированы или выделены естественным путем, при условии, что они все еще функционируют как 9-цис-эпоксикаротиноиддиоксиназа. Полипептиды NtNCED2 могут находиться в линейной форме, или их можно циклизировать при помощи известных способов. В соответствии с другим аспектом настоящее изобретение относится к выделенному полипептиду, содержащему полипептидную последовательность, обладающую по меньшей мере 60% идентичности последовательности с любыми из описанных в настоящем документе последовательностей, включая любой из показанных в перечне последовательностей полипептидов, состоящему или фактически состоящему из нее. Соответственно, выделенный полипептид содержит последовательность, обладающую по меньшей мере 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с ними, состоит или фактически состоит из нее.

Полипептиды включают варианты, полученные в результате введения любого типа изменений (например, вставок, делеций или замен аминокислот; модификаций в структурах гликозилирования; модификаций, которые затрагивают рефолдинг или изомеризации, трехмерные структуры или получаемые в результате самосборки структуры), которые могут быть преднамеренно сконструированы или выделены естественным путем. Варианты могут иметь изменения, которые создают молчащую модификацию и в результате приводят к получению функционально эквивалентного белка. Предумышленные аминокислотные замены могут быть выполнены на основе сходства полярности, заряда, растворимости, гидрофобности, гидрофильности и амфипатической природы остатков, при условии сохранения вторичной связывающей активности вещества. Например, отрицательно заряженные аминокислоты включают аспарагиновую кислоту и глутаминовую кислоту; положительно заряженные аминокислоты включают лизин и аргинин; и аминокислоты с незаряженными полярными концевыми группами, имеющие сходные значения гидрофильности, включают лейцин, изолейцин, валин, глицин, аланин, аспарагин, глутамин, серии, треонин, фенилаланин и тирозин. Консервативные замены можно осуществить, например, в соответствии с представленной ниже таблицей. Аминокислоты в одном блоке во втором столбце и предпочтительно в одной строке в третьем столбце можно заменять друг другом:

АЛИФАТИЧЕСКИЕ Неполярные Gly, Ala, Pro, Ile, Leu, Val
Полярные-незаряженные Cys, Ser, Thr, Met, Asn, Gly
Полярные-заряженные Asp, Glu, Lys, Arg
АРОМАТИЧЕСКИЕ His, Phe, Trp, Туr

Полипептид может представлять собой зрелый белок, или незрелый белок, или белок, полученный из незрелого белка. Полипептиды могут находиться в линейной форме, или их можно циклизировать при помощи известных способов. Полипептиды, как правило, включают по меньшей мере 10, по меньшей мере 20, по меньшей мере 30 или по меньшей мере 40 смежных аминокислот.

В соответствии с одним вариантом осуществления настоящее изобретение относится к выделенному полипептиду N1ABA4, содержащему последовательность, кодирующую неоксантин-синтазу и обладающую по меньшей мере приблизительно 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 2 или приблизительно 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 7, состоящему или фактически состоящему из нее. В соответствии с другим вариантом осуществления настоящее изобретение относится к выделенному полипептиду NtNeSy, содержащему последовательность, кодирующую ликопин-бета-циклазу и обладающую по меньшей мере приблизительно 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99% или 100% идентичности последовательности с SEQ ID NO: 9, состоящему или фактически состоящему из нее.

В соответствии с другим вариантом осуществления, настоящее изобретение относится к выделенному полипептиду NtNCED2, кодируемому полинуклеотидом NtNCED2, который описаны в настоящем документе.

В настоящем документе также раскрыты фрагменты полипептидных последовательностей, соответственно, такие фрагменты сохраняют активность последовательности полной длины.

Мутантные полипептидные варианты можно применять для создания мутантных, не встречающихся в природе или трансгенных растений (например, мутантных, не встречающихся в природе, трансгенных, созданных человеком или генетически сконструированных растений), включающих один или несколько мутантных полипептидных вариантов. Соответственно, мутантные полипептидные варианты сохраняют активность немутантного полипептида. Активность мутантного полипептидного варианта может быть выше, ниже или приблизительно такой же как у немутантного полипептида. Мутации в описанных в настоящем документе нуклеотидных последовательностях или полипептидах могут включать созданные человеком мутации или генетически сконструированные мутации. Мутации в описанных в настоящем документе нуклеотидных последовательностях и полипептидах могут представлять собой мутации, которые получены или которые можно получить с помощью способа, который включает стадию in vitro или in vivo манипуляций. Мутации в описанных в настоящем документе нуклеотидных последовательностях и полипептидах могут представлять собой мутации, которые получены или которые можно получить с помощью способа, который включает вмешательство человека. К примеру, способ может включать мутагенез при помощи экзогенно добавляемых химических веществ, таких как мутагенные, тератогенные или канцерогенные соединения, например, этилметансульфонат (EMS), которые производят случайные мутации генетического материала. В качестве еще одного примера, способ может включать один или несколько стадий генетической инженерии, таких как один или несколько стадий генетической инженерии, которые описаны в настоящем документе, или их комбинации. В качестве еще одного примера, способ может включать один или несколько стадий скрещивания растений.

Применяемый в настоящем документе термин "не встречающийся в природе" означает, что объект, такой как полипептид, полинуклеотид или растение и т. п., не обнаруживается в природе и, вследствие этого, явно исключает объекты, которые существуют в природе. Такие не встречающиеся в природе объекты могут быть структурно модифицированными, синтезированными или обработанными человеком. В соответствии с определенными вариантами осуществления мутация не является встречающейся в природе мутацией, которая существует в природе в нуклеотидной последовательности или полипептиде, таком как ген или белок.

Полипептид можно получить путем культивирования трансформированных или рекомбинантных клеток-хозяев в культуральных условиях, подходящих для экспрессии полипептида. Полученный в результате экспрессированный полипептид можно затем отчистить от такой культуры при помощи известных способов очистки. Очистка полипептида может включать использование колонки для аффинной хроматографии, содержащей средства, которые будут связываться с полипептидом; один или несколько стадий пропускания через колонку с такими аффинными смолами; один или несколько стадий, включающих хроматографию с гидрофобными взаимодействиями или иммуноаффинную хроматографию. Альтернативно, полипептид также можно экспрессировать в форме, которая будет способствовать очистке. Например, его можно экспрессировать в виде химерного полипептида, такого как химеры со связывающимся с мальтозой полипептидом, глутатион-5-трансферазой или тиоредоксином. На рынке доступны наборы для экспрессии и очистки химерных полипептидов. Полипептид можно пометить эпитопом и затем очистить с помощью направленного на такой эпитоп специфичного антитела. Для дополнительной очистки полипептида можно задействовать один или несколько стадий жидкостной хроматографии, такой как обращенно-фазная хроматография. Для получения практически гомогенного рекомбинантного полипептида можно задействовать несколько или все вышеописанные стадии очистки в различных комбинациях. Очищенный таким образом полипептид может практически не содержать другие полипептиды и обозначаться в настоящем описании как "практически очищенный полипептид"; такие очищенные полипептиды включают полипептиды, фрагменты, варианты и т. п. Экспрессию, выделение и очистка полипептидов и фрагментов можно выполнить при помощи любой подходящей методики, включая без ограничения описанные в настоящем документе способы. Также можно использовать колонку для аффинной хроматографии, такую как колонку с созданными к полипептидам моноклональными антителами для аффинной очистки экспрессированных полипептидов. Такие полипептиды можно удалить из колонки для аффинной хроматографии при помощи традиционных методик, например, в высокосолевом элюирующем буфере, а затем диализировать в буфер с более низким содержанием солей для применения, или посредством изменения рН или других компонентов, в зависимости от используемой аффинной матрицы, или конкурентно удалить при помощи встречающегося в природе субстрата с аффинным фрагментом.

Полипептид также можно получить с помощью известного традиционного химического синтеза. Способы создания полипептидов или их фрагментов с помощью средств синтеза известны специалистам в данной области. Синтетически созданные полипептидные последовательности, благодаря общим первичным, вторичным или третичным структурным или конформационным характеристикам с нативными полипептидами, могут обладать подобными с ним биологическими свойствами, в том числе биологической активностью. Применяемый в настоящем документе термин "не встречающийся в природе" описывает объект (например, полинуклеотид, генетическую мутацию, полипептид, растение, растительная клетка и растительный материал), который не формируется в природе или который не существует в природе. Такие не встречающиеся в природе объекты или искусственные объекты могут быть созданы, синтезированы, инициированы, модифицированы, подвергнуты изменениям или манипуляциям при помощи описанных в настоящем документе или известных в данной области способов. Таким образом, к примеру, не встречающееся в природе растение, не встречающаяся в природе растительная клетка или не встречающийся в природе растительный материал можно создать при помощи традиционных методик селекции растений, таких как методики возвратного скрещивания, или при помощи генетических манипуляций, таких как антисмысловая РНК, интерферирующая РНК, мегануклеаза и т. п. В качестве дополнительного примера, не встречающееся в природе растение, не встречающаяся в природе растительная клетка или не встречающийся в природе растительный материал можно создать посредством интрогрессии или посредством переноса одной или нескольких генетических мутаций (например, одного или нескольких полиморфизмов) из первого растения или растительной клетки во второе растение или растительную клетку (которая сама по себе может встречаться в природе) так, чтобы полученное в результате растение, растительная клетка или растительный материал или их потомство включали генетическую структуру (например, геном, хромосому или их сегмент), которая не формируется в природе или которая не существуют в природе. Полученные в результате растение, растительная клетка или растительный материал, таким образом, являются искусственными или не встречающимися в природе. Таким образом, искусственное или не встречающееся в природе растение или такую растительную клетку можно создать при помощи модификации генетической последовательности в первом, встречающемся в природе растении или такой растительной клетке, даже если полученная в результате генетическая последовательность встречается в природе во втором растении или растительной клетке, которая содержит иной генетический фон от первого растения или растительной клетки. Различия в генетическом фоне можно определить по фенотипическим отличиям или с помощью известных из уровня техники методик молекулярной биологии, таких как секвенирование нуклеиновой кислоты, наличие или отсутствующие генетических маркеров (например, микросателлитных РНК-маркеров). Также настоящее изобретение относится к описываемым в настоящем документе антителам, которые иммунореактивны с полипептидами NtABA4, или NtNeSy, или NtNCED2. Изложенные в настоящем документе полипептиды, фрагменты, варианты, химерные полипептиды и т. п. можно использовать в качестве "иммуногенов" для получения иммунореактивных к ним антител. Такие антитела могут специфично связываться с полипептидом посредством антигенсвязывающих участков антитела. Специфично связывающиеся антитела являются антителами, которые специфично распознают и связывают полипептид, гомологи и варианты, но не другие молекулы. В соответствии с одним вариантом осуществления антитела являются специфичными к полипептидам с аминокислотной последовательностью, которая изложена в настоящем документе, и не дают перекрестную реакцию с другими полипептидами.

Более конкретно, полипептиды, фрагмент, варианты, химерные полипептиды и т. п. содержат антигенные детерминанты или эпитопы, которые вызывают образование антител. Такие антигенные детерминанты или эпитопы могут быть либо линейными, либо конформационными (прерывистые). Линейные эпитопы состоят из одной секции аминокислот полипептида, в то время как конформационные или прерывистые эпитопы состоят из аминокислотных секций из различных участков полипептидной цепи, которые сводятся в непосредственный близкий контакт при фолдинге полипептида. Эпитопы можно выявить с помощью любых известных из уровня техники способов. Кроме того, эпитопы из полипептидов можно применять в качестве аналитических реагентов в анализах и для очистки специфически связывающихся антител из таких веществ, как поликлональная сыворотка или супернатанты культивированных гибридом. Такие эпитопы или их варианты можно получить при помощи известных из уровня техники методик, таких как твердофазный синтез, химическое или ферментативное расщепление полипептида, или при помощи методики с применением рекомбинантной ДНК. Как поликлональные, так и моноклональные антитела к полипептидам можно получить с помощью стандартных методик. Также настоящим описанием предусмотрены линии гибридомных клеток, которые вырабатывают специфичные к полипептидам моноклональные антитела. Такие гибридомы можно получить или выявить при помощи стандартных методик. Для получения антител, различных животных-хозяев можно иммунизировать посредством инъекции полипептида, фрагмента, варианта или их мутантов. Такие животные-хозяева могут включать без ограничения кроликов, мышей и крыс, и они составляют далеко не полный перечень. Можно применять различные адъюванты для увеличения иммунологической реакции. В зависимости от вида-хозяина, такие адъюванты включают без ограничения адъювант Фрейнда (полный или частичный), минеральные гели, такие как гидроксид алюминия, поверхностно-активные вещества, такие как лизолецитин, плюроновые полиолы, полианионы, пептиды, масляные эмульсии, гемоцианин лимфы улитки, динитрофенол и потенциально полезные для человека адъюванты, такие как BCG (бацилла Кальмета-Герена) и Corynebacterium parvum. Моноклональные антитела можно выделить посредством стандартных методик. Такие моноклональные антитела могут принадлежать к любому классу иммуноглобулинов, включая IgG, IgM, IgE, IgA, IgD, и любому его подклассу.

Антитела также можно применять в анализах для определения наличия полипептидов или фрагментов либо in vitro , либо in vivo. Антитела также можно использовать при очистке полипептидов или фрагментов посредством иммуноаффинной хроматографии.

Композиции, которые могут изменять (например, увеличивать) экспрессию или активность NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более, или трех или более из них), включают без ограничения специфичные к последовательности полинуклеотиды, которые могут препятствовать транскрипции одного или нескольких эндогенных генов; специфичные к последовательности полинуклеотиды, которые могут препятствовать трансляции РНК-транскриптов (например, двухцепочечные РНК, siRNA, рибозимы); специфичные к последовательности полипептиды, которые могут препятствовать стабильности одного или нескольких белков; специфичные к последовательности полинуклеотиды, которые могут препятствовать ферментативной активности одного или нескольких белков или связывающей активности одного или нескольких белков по отношению к веществам или регуляторным белкам; антитела, которые характеризуются специфичностью к одному или нескольким белкам; соединения в виде малых молекул, которые могут препятствовать стабильности одного или нескольких белков, или ферментативной активности одного или нескольких белков, или связывающей активности одного или нескольких белков; белки с "цинковыми пальцами", которые связывают один или несколько полинуклеотидов; и мегануклеазы, которые обладают активностью по отношению к одному или нескольким полинуклеотидам. Методики редактирования гена, генетические методики редактирования и методики редактирования генома хорошо известны в данной области.

Антисмысловая методика является одним из хорошо известных способов, который можно применять для изменения экспрессии полипептида. Подлежащий подавлению полинуклеотид гена клонируют и функционально связывают с регуляторным участком и последовательностью окончания транскрипции так, чтобы транскрибировалась антисмысловая цепь РНК. Рекомбинантный конструкт затем трансформируют в растения и получают антисмысловую цепь РНК. Полинуклеотид не должен быть полной последовательностью подлежащего подавлению гена, но, как правило, будет практически комплементарным по меньшей мере части смысловой цепи подлежащего подавлению гена.

Полинуклеотид может быть транскибирован в рибозим, или каталитическую РНК, которая затрагивает экспрессию мРНК. Рибозимы могут быть сконструированы для специфичного образования пары почти с любой целевой РНК и расщепления фосфодиэфирного остова в конкретном местоположении, таким образом функционально инактивируя целевую РНК. Гетерологические полинуклеотиды могут кодировать рибозимы, сконструированные для расщепления конкретных мРНК-транскриптов, таким образом предотвращая экспрессию полипептида. Рибозимы типа hammerhead подходят для разрушения конкретных мРНК, хотя можно использовать различные рибозимы, которые расщепляют мРНК в последовательностях сайт-специфического распознавания. Рибозимы типа hammerhead расщепляют мРНК в местоположениях, определяемых фланкирующими участками, которые формируют комплементарные пары оснований с целевой мРНК. Единственным требованием является то, чтобы целевая РНК содержала 5'-UG-3' нуклеотидную последовательность. Построение и получение рибозимов типа hammerhead хорошо известны из уровня техники. Последовательность рибозимов типа hammerhead может быть включена в стабильную РНК, как например, транспортную РНК (тРНК), для увеличения эффективности расщепления in vivo.

В соответствии с одним вариантом осуществления специфичный для последовательности полинуклеотид, который может препятствовать трансляции РНК-транскрипта(транскриптов), представляет собой интерферирующую РНК. РНК-интерференция или РНК-сайленсинг является эволюционно консервативным процессом, посредством которого специфичные РНК могут быть назначены мишенью для ферментативного расщепления. Для инициирования каскада реакций с интерферирующей РНК вводят двухцепочечную РНК (двухцепочечную РНК), или она вырабатывается клеткой (например, вирус с двухцепочечной РНК или полинуклеотиды интерферирующей РНК). Двухцепочечную РНК можно преобразовать во множество малых дуплексов интерферирующих РНК длиной 21-23 п. о. посредством РНКаз III, которые являются специфичными к двухцепочечным РНК эндонуклеазами. Малые интерферирующие РНК затем могут распознаваться РНК-индуцируемыми комплексами сайленсинга гена, которые способствуют раскручиванию малой интерферирующей РНК посредством АТФ-зависимого процесса. Раскрученная антисмысловая цепь малой интерферирующей РНК направляет активированные РНК-индуцируемые комплексы сайленсинга гена к целевым мРНК, содержащим последовательность, комплементарную малой антисмысловой цепи интерферирующей РНК. Целевая мРНК и антисмысловая цепь могут формировать спираль A-формы, и большая бороздка спирали A-формы может распознаваться активированными РНК-индуцируемыми комплексами сайленсинга гена. Целевая мРНК может расщепляться активированными РНК-индуцируемыми комплексами сайленсинга гена в отдельном участке, определяемом участком связывания 5'-конца цепи малой интерферирующей РНК. Активированные РНК-индуцируемые комплексы сайленсинга гена могут использоваться повторно для катализа другого события расщепления.

Векторы экспрессии интерферирующей РНК могут включать конструкты интерферирующей РНК, кодирующие полинуклеотиды интерферирующей РНК, которые характеризуются РНК-интерференционной активностью посредством снижения уровней экспрессии мРНК, пре-мРНК или родственных вариантов РНК. Векторы экспрессии могут включать промотор, располагаемый выше и функционально связанный с конструктом интерферирующей РНК, который дополнительно описан в настоящем документе. Векторы экспрессии интерферирующей РНК могут включать подходящий минимальный коровый промотор, представляющий интерес конструкт интерферирующей РНК, верхний (5') регуляторный участок, нижний (3') регуляторный участок, включая сигналы окончания транскрипции и сигналы полиаденилирования, и другие известные специалистам в данной области последовательности, такие как различные маркеры для отбора. Полинуклеотиды можно получить в различных формах, включая двухцепочечные структуры (то есть двухцепочечную молекулу РНК, включающую антисмысловую цепь и комплементарную смысловую цепь), двухцепочечные шпилькообразные структуры или одноцепочечные структуры (то есть ssRNA-молекулу, содержащую только антисмысловую цепь). Структуры могут включать дуплексную, асимметричную дуплексную, шпилькообразную или асимметричную шпилькообразную вторичную структуру, обладающую самокомплементарными смысловыми и антисмысловыми цепями. Двухцепочечная интерферирующая РНК может быть ферментативно преобразована до двухцепочечных малых интерферирующих РНК. Одна из цепей дуплекса малой интерферирующей РНК может гибридизироваться с комплементарной последовательностью в целевой мРНК и родственных вариантах РНК. Дуплексы малой интерферирующей РНК/мРНК распознаются РНК-индуцируемыми комплексами сайленсинга гена, которые могут расщеплять РНК во множестве сайтах зависящим от последовательности образом, что в результате приводит к деструкции целевой мРНК и родственных вариантов РНК.

Молекулы двухцепочечной РНК могут включать молекулы малой интерферирующей РНК, собранные из отдельного олигонуклеотида в структуры по типу стебель-петля, причем самокомплементарные смысловые и антисмысловые участки молекулы малой интерферирующей РНК соединены посредством полинуклеотидных или неполинуклеотидных линкеров, а также кольцевую одноцепочечную РНК с двумя или более петельными структурами и стеблем, включающим самокомплементарные смысловые и антисмысловые цепи, причем кольцевая РНК может процессироваться либо in vivo, либо in vitro с образованием активной молекулы малой интерферирующей РНК, способной опосредовать интерференцию РНК.

Также предусмотрено применение малых шпилькообразных молекул РНК. Они включают специфичную антисмысловую последовательность, помимо обратно комплементарной (смысловой) последовательности, как правило, отделенную спейсерной или петлевой последовательностью. Отщепление спейсера или петли дает одноцепочечную молекулу РНК и обратно комплементарную ей последовательность так, что они могут гибридизироваться с образованием двухцепочечной молекулы РНК (необязательно при помощи дополнительных стадий процессинга, которые могут привести в результате к добавлению или удалению одного, двух, трех или более нуклеотидов либо с 3' конца, либо с 5' конца у любой из обеих цепей). Спейсер может иметь достаточную длину для того, чтобы сделать возможной гибридизацию антисмысловой и смысловой последовательностей и формирование двухцепочечной структуры (или стебля) до отщепления спейсера (и, необязательно, последующих стадий процессинга, которые могут привести к добавлению или удалению одного, двух, трех, четырех или более нуклеотидов либо с 3' конца, либо с 5' конца у любой из обеих цепей). Спейсерная последовательность, как правило, является неродственной нуклеотидной последовательностью, которая расположена между двумя комплементарными участками нуклеотидной последовательности, которые, при связывании в двухцепочечный полинуклеотид составляют малую шилькообразную РНК. Спейсерная последовательность обычно включает от приблизительно 3 до приблизительно 100 нуклеотидов. Любой представляющий интерес полинуклеотид РНК можно получить посредством подбора подходящего состава, размера петли и длины стебля последовательности для получения шпилькообразного дуплекса. Подходящий диапазон для конструирования длин стебля шпилькообразного дуплекса включает длины стебля, составляющие по меньшей мере приблизительно 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 нуклеотидов, такой как приблизительно 14-30 нуклеотидов, приблизительно 30-50 нуклеотидов, приблизительно 50-100 нуклеотидов, приблизительно 100-150 нуклеотидов, приблизительно 150-200 нуклеотидов, приблизительно 200-300 нуклеотидов, приблизительно 300-400 нуклеотидов, приблизительно 400-500 нуклеотидов, приблизительно 500-600 нуклеотидов и приблизительно 600-700 нуклеотидов. Подходящий диапазон для конструирования длин петель шпилькообразного дуплекса включает длины петель, составляющие приблизительно 4-25 нуклеотидов, приблизительно 25-50 нуклеотидов или более длинные, если длина стебля шпилькообразного дуплекса является значительной. В соответствии с определенными вариантами осуществления двухцепочечная РНК или молекула ssRNA составляет в длину от приблизительно 15 до приблизительно 40 нуклеотидов. В соответствии с другим вариантом осуществления молекула малой интерферирующей РНК является молекулой двухцепочечной РНК или ssRNA в длину от приблизительно 15 до приблизительно 35 нуклеотидов. В соответствии с другим вариантом осуществления молекула малой интерферирующей РНК является молекулой двухцепочечной РНК или ssRNA в длину от приблизительно 17 до приблизительно 30 нуклеотидов. В соответствии с другим вариантом осуществления молекула малой интерферирующей РНК является молекулой двухцепочечной РНК или ssRNA в длину от приблизительно 19 до приблизительно 25 нуклеотидов. В соответствии с другим вариантом осуществления молекула малой интерферирующей РНК является молекулой двухцепочечной РНК или ssRNA в длину от приблизительно 21 до приблизительно 23 нуклеотидов. В соответствии с определенными вариантами осуществления шпилькообразные структуры с дуплексными участками длиннее 21 нуклеотида могут способствовать эффективному сайленсингу с участием малой интерферирующей РНК, независимо от петлевой последовательности и длины.

Целевая мРНК-последовательность обычно составляет в длину от приблизительно 14 до приблизительно 50 нуклеотидов. Целевую мРНК можно, таким образом, просканировать в отношении участков длиной от приблизительно 14 до приблизительно 50 нуклеотидов, которые предпочтительно соответствуют одному или нескольким из следующих критериев для целевой последовательности: соотношение A+T/G+C, составляющее от приблизительно 2:1 до приблизительно 1:2; динуклеотид АА или динуклеотид СА на 5'-конце целевой последовательности; последовательность, составляющая по меньшей мере 10 последовательных нуклеотидов, уникальных для целевой мРНК (т. е. последовательность не присутствует в других мРНК-последовательностях того же растения); и отсутствие "проходов" из более трех последовательных гуаниновых (G) нуклеотидов или более трех последовательных цитозиновых (С) нуклеотидов. Такие критерии можно оценить при помощи различных известных в данной области методик, например, компьютерные программы, такие как BLAST, можно применять для поиска в общедоступных базах данных с целью определения, является ли выбранная целевая последовательность уникальной для целевой мРНК. Альтернативно целевую последовательность можно выбрать (и малую последовательность интерферирующей РНК сконструировать) при помощи коммерчески доступного программного обеспечения (например, OligoEngine, Target Finder и the small interfering RNA Design Tool, которые являются коммерчески доступными).

В соответствии с одним вариантом осуществления выбирают целевые последовательности мРНК, которые составляют в длину от приблизительно 14 до приблизительно 30 нуклеотидов и которые соответствуют одному или нескольким описанным выше критериям. В соответствии с другим вариантом осуществления выбирают целевые последовательности мРНК, которые составляют в длину от приблизительно 16 до приблизительно 30 нуклеотидов и которые соответствуют одному или нескольким описанным выше критериям. В соответствии со следующим вариантом осуществления выбирают целевые последовательности мРНК, которые составляют в длину от приблизительно 19 до приблизительно 30 нуклеотидов и которые соответствуют одному или нескольким описанным выше критериям. В соответствии с другим вариантом осуществления выбирают целевые последовательности мРНК, которые составляют в длину от приблизительно 19 до приблизительно 25 нуклеотидов и которые соответствуют одному или нескольким описанным выше критериям.

В соответствии с иллюстративным вариантом осуществления молекулы малой интерферирующей РНК включают специфичную антисмысловую последовательность, которая комплементарна по меньшей мере 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 или более смежным нуклеотидам из любой из описанных в настоящем документе полинуклеотидных последовательностей.

Специфичная антисмысловая последовательность, включаемая молекулой малой интерферирующей РНК, может быть идентичной или практически идентичной комплементарной цепи целевой последовательности. В соответствии с одним вариантом осуществления специфичная антисмысловая последовательность, включаемая молекулой малой интерферирующей РНК, является по меньшей мере приблизительно на 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентичной комплементарной цепи целевой последовательности мРНК. Способы определения идентичности последовательности известны из уровня техники и могут быть определены, например, с помощью программы BLASTN, программного обеспечения, разработанного University of Wisconsin Computer Group (GCG), или предоставленного на веб-сайте NCBI.

Специфичная антисмысловая последовательность молекул малой интерферирующей РНК может характеризоваться вариабельностью по различию (например, по нуклеотидной замене, включая транзицию или трансверсию) в одном, двух, трех, четырех или более нуклеотидах из последовательности целевой мРНК. При наличии таких нуклеотидных замен в антисмысловой цепи молекулы двухцепочечной РНК комплементарный нуклеотид в смысловой цепи, с которой заменяющий нуклеотид будет, как правило, формировать пару оснований с помощью водородной связи, может быть или может не быть соответственно заменен. Также предусмотрены двухцепочечные молекулы РНК, у которых одна или несколько нуклеотидных замен встречаются в смысловой последовательности, но не в антисмысловой цепи. Если антисмысловая последовательность молекулы малой интерферирующей РНК содержит одно или несколько несовпадений между нуклеотидной последовательностью малой интерферирующей РНК и описанной выше целевой нуклеотидной последовательностью, то несоответствия могут быть обнаружены на 3' конце, 5' конце или в центральной части антисмысловой последовательности. В соответствии с другим вариантом осуществления молекулы малой интерферирующей РНК содержат специфичную антисмысловую последовательность, которая способна к селективной гибридизации в жестких условиях с частью встречающегося в природе целевого гена или целевой мРНК. Как известно специалистам в данной области вариации жесткости условий гибридизации можно достигать посредством изменения времени, температуры или концентрации растворов, применяемых для стадий гибридизации и промывки. Подходящие условия также могут частично зависеть от применяемых конкретных нуклеотидных последовательностей, например, последовательности целевой мРНК или гена.

Одним способом индукции сайленсинга с помощью двуцепочечной РНК в растениях является трансформация при помощи генного конструкта с образованием шпилькообразной РНК (см. Smith et al. (2000) Nature, 407, 319-320). Такие конструкты содержат инвертированные участки целевой генной последовательности, отделенные посредством соответствующего спейсера. Вставка функционального растительного интронного участка как спейсерного фрагмента дополнительно увеличивает эффективность индукции генного сайленсинга в связи с получением шпилькообразной РНК с вырезанными нитронами (Wesley et al. (2001) Plant J., 27, 581-590). Соответственно, длина стебля составляет от приблизительно 50 нуклеотидов до приблизительно 1 тысячи нуклеотидов в длину. Способы получения шпилькообразной РНК с вырезанными нитронами хорошо описаны в данной области (см., например, Bioscience, Biotechnology, and Biochemistry (2008) 72, 2, 615-617). Молекулы интерферирующей РНК, имеющие дуплексную или двухцепочечную структуру, например двухцепочечная РНК или малая шпилькообразная РНК, могут иметь тупые концы или могут иметь 3' или 5' липкие концы. Применяемый в настоящем документе термин "липкий конец" относится к неспаренному нуклеотиду или нуклеотидам, которые выступают вперед из дуплексной структуры, когда 3'-конец одной цепи РНК выходит за рамки 5'-конца другой цепи (3' липкий конец), или наоборот (5' липкий конец). Формирующие липкий конец нуклеотиды могут представлять собой рибонуклеотиды, дезоксирибонуклеотиды или их модифицированные версии. В соответствии с одним вариантом осуществления по меньшей мере одна цепь молекулы интерферирующей РНК имеет 3' липкий конец длиной от приблизительно 1 до приблизительно 6 нуклеотидов. В соответствии с другими вариантами осуществления 3' липкий конец составляет в длину от приблизительно 1 до приблизительно 5 нуклеотидов, от приблизительно 1 до приблизительно 3 нуклеотидов и от приблизительно 2 до приблизительно 4 нуклеотидов.

Если молекула интерферирующей РНК содержит 3' липкий конец на одном конце молекулы, то другой конец может быть тупым концом или также также иметь липкий конец (5' или 3'). Если молекула интерферирующей РНК содержит липкий конец на обоих концах молекулы, то длина липких концов может быть одинаковой или отличаться. В соответствии с одним вариантом осуществления молекула интерферирующей РНК содержит 3' липкие концы, составляющие от приблизительно 1 до приблизительно 3 нуклеотидов, на обоих концах молекулы. В соответствии со следующим вариантом осуществления молекула интерферирующей РНК является двухцепочечной РНК, имеющей 3' липкий конец из 2 нуклеотидов на обоих концах молекулы. В соответствии с еще одним вариантом осуществления нуклеотиды, содержащие липкий конец интерферирующей РНК, являются динуклеотидами ТТ или динуклеотидами UU.

При определении процентной идентичности молекулы интерферирующей РНК, содержащей один или несколько липких концов, с целевой последовательностью мРНК, липкий конец(концы) можно брать или не брать в расчет. Например, нуклеотиды от 3' липкого конца и до 2 нуклеотидов из 5'- или 3'-концов двойной цепи можно модифицировать без значительной потери активности молекулы малой интерферирующей РНК.

Молекулы интерферирующей РНК могут содержать одну или несколько 5' или 3'-кэп-структур. Молекула интерферирующей РНК может содержать кэп-структуру на 3'-конце смысловой цепи, антисмысловой цепи или как смысловой, так и антисмысловой цепи; или на 5'-конце смысловой цепи, антисмысловой цепи, или как смысловой, так и антисмысловой цепи молекулы интерферирующей РНК. Альтернативно, молекула интерферирующей РНК может содержать кэп-структуру как на 3'-конце, так и на 5'-конце молекулы интерферирующей РНК. Термин "кэп-структура" относится к химической модификации, включенной в любой конец олигонуклеотида, которая защищает молекулу от экзонуклеазного расщепления, и может также способствовать доставке или локализации в рамках клетки.

Другая применимая к молекулам интерферирующей РНК модификация представляет собой химическую связь с молекулой интерферирующей РНК одного или нескольких фрагментов или конъюгатов, которые усиливают активность, распространение по клетке, клеточное поглощение, биодоступность или стабильность молекулы интерферирующей РНК. Полинуклеотиды можно синтезировать или модифицировать хорошо известными из уровня техники способами. Химические модификации могут включать без ограничения 2' модификации, введение искусственных оснований, ковалентное присоединение к лиганду и замещение фосфатных связей на тиофосфатные связи. В соответствии с таким вариантом осуществления целостность дуплексной структуры усиливают посредством по меньшей мере одной, а как правило двух, химических связей. Химическое связывание можно выполнить посредством любой из множества хорошо известных методик, например, путем введения ковалентных, ионных или водородных связей; гидрофобных взаимодействий, Ван-дер-Ваальсовых или стэкинг-взаимодействий; с помощью металл-ионной координации или посредством применения пуриновых аналогов.

Нуклеотиды в одной или обеих из двух отдельных цепей можно модифицировать для изменения активации клеточных ферментов, таких как, например, без ограничения определенные нуклеазы. Методики уменьшения или ингибирования активации клеточных ферментов известны в данной области техники, включая без ограничения 2'-амино-модификации, 2'-фтор-модификации, 2'-алкил-модификации, модификации незаряженного остова, морфолино-модификации, 2'-О-метил-модификации и фосфорамидат. Таким образом, по меньшей мере одна 2'-гидроксильная группа нуклеотидов на двухцепочечной РНК замещена химической группой. Также, можно модифицировать по меньшей мере один нуклеотид с образованием запертого нуклеотида. Такой запертый нуклеотид содержит метиленовый или этиленовый мостик, который соединяет 2'-кислород рибозы и 4-углерод рибозы. Введение запертого нуклеотида в олигонуклеотид повышает сродство для комплементарных последовательностей и увеличивает температуру плавления на несколько градусов.

С молекулой интерферирующей РНК могут быть конъюгированы лиганды, например, для повышения ее клеточной абсорбции. В соответствии с определенными вариантами осуществления гидрофобный лиганд конъюгируют с молекулой для облегчения направленного проникновения через клеточную мембрану. Такие подходы применяют для облегчения проникновения антисмысловых олигонуклеотидов в клетки. В некоторых случаях конъюгация катионного лиганда с олигонуклеотидами часто приводит к повышенной устойчивости к действию нуклеаз. Иллюстративные примеры катионных лигандов включают пропиламмоний и диметилпрориламмоний. Антисмысловые олигонуклеотиды могут сохранять их высокое сродство связывания с мРНК, когда катионный лиганд распределен по всему олигонуклеотиду. Описанные в настоящем документе молекулы и полинуклеотиды можно получить при помощи хорошо известных методик твердофазного синтеза. Дополнительно или в качестве альтернативы можно использовать любые другие известные из уровня техники средства такого синтеза.

Различные варианты осуществления направлены на векторы экспрессии, содержащие один или несколько полинуклеотидов NtABA4, или NtNeSy, или NtNCED2, или конструкты интерферирующей РНК, которые содержат один или несколько полинуклеотидов.

Различные варианты осуществления направлены на векторы экспрессии, содержащие один или несколько полинуклеотидов NtABA4, или NtNeSy, или MNCED2, или один или несколько конструктов интерферирующей РНК. Различные варианты осуществления направлены на векторы экспрессии, содержащие один или несколько полинуклеотидов NtABA4, или NtNeSy, или NtNCED2, или один или несколько конструктов интерферирующей РНК, кодирующих один или несколько полинуклеотидов интерферирующей РНК, способных гибридизироваться сами с собой с образованием шпилькообразной структуры, причем конструкт содержит (а) один или несколько из описанных в настоящем документе полинуклеотидов; (b) вторую последовательность, кодирующую спейсерный элемент, который образует петлю шпилькообразной структуры; и (с) третью последовательность, содержащую обратно комплементарную последовательность первой последовательности, расположенную в той же ориентации, что и первая последовательность, причем вторая последовательность расположена между первой последовательностью и третьей последовательностью, а вторая последовательность функционально связана с первой последовательностью и с третьей последовательностью.

Раскрываемые последовательности можно использовать для построения различных полинуклеотидов NtABA4, или NtNeSy, или NtNCED2, которые не образуют шпилькообразные структуры. Например, двухцепочечная РНК может образовываться путем (1) транскрибции первой цепи ДНК при помощи функциональной связи с первым промотором и (2) транскрибции обратно комплементарной последовательности первой цепи фрагмента ДНК при помощи функциональной связи со вторым промотором. Каждая цепь полинуклеотида может транскрибироваться из одного вектора экспрессии, или из различных векторов экспрессии. Дуплекс РНК, обладающий активностью интерферирующей РНК, может быть ферментативно преобразован в малые интерферирующие РНК для изменения уровней РНК.

Таким образом, различные варианты осуществления направлены на векторы экспрессии, содержащие один или несколько полинуклеотидов NtABA4, или NtNeSy, или NtNCED2, или конструктов интерферирующей РНК, кодирующих полинуклеотиды интерферирующей РНК, способные к гибридизации самих с собой, причем конструкт содержит (а) один или несколько из описанных в настоящем документе полинуклеотидов; (b) вторую последовательность, содержащую комплементарную (например, обратно комплементарную) последовательность первой последовательности, расположенную в той же ориентации, что и первая последовательность.

Настоящее изобретение относится к различным композициям и способам изменения эндогенных уровней экспрессии одного или нескольких из полипептидов NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более, трех или более из них) посредством стимуляции совместной супрессии экспрессии гена. Явление совместной супрессии встречается в результате введения множества копий трансгена в растительную клетку-хозяина. Встраивание множества копий трансгена может в результате привести к измененной экспрессии трансгена и целевого эндогенного гена. Степень совместной супрессии зависит от степени идентичности последовательности у трансгена и целевого эндогенного гена. Сайленсинг как эндогенного гена, так и трансгена может происходить в результате избыточного метилирования подвергаемых сайленсингу локусов (т. е. представляющего интерес эндогенного промотора и эндогенного гена), что может препятствовать транскрипции. Альтернативно, в некоторых случаях совместная супрессия эндогенного гена и трансгена может происходить в результате пост-транскрипционного сайленсинга гена, при котором могут производиться транскрипты, но повышенные степени распада препятствуют накоплению транскриптов. Полагают, что механизм совместной супрессии путем пост-транскрипционного генного сайленсинга схож с РНК-интерференцией в том, что РНК, по видимому, является как ключевым инициатором, так и целью в таких процессах, и они могут быть опосредованы по меньшей мере частично с помощью одинакового молекулярного механизма, возможно посредством РНК-управляемого расщепления мРНК.

Совместная супрессия нуклеиновых кислот может быть достигнута посредством встраивания множества копий нуклеиновой кислоты или ее фрагментов в виде трансгенов в геном представляющего интерес растения. Растение-хозяина можно трансформировать при помощи вектора экспрессии, содержащего промотор, функционально связанный с нуклеиновой кислотой или ее фрагментами. Согласно различным вариантам осуществления настоящее изобретение относится к векторам экспрессии для стимуляции совместной супрессии эндогенных генов, содержащим промотор, функционально связанный с полинуклеотидом. Согласно различным вариантам осуществления настоящее изобретение относится к способам изменения уровня экспрессии полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или их комбинации из двух или более или трех или более) путем встраивания множества копий полинуклеотида(ов) в геном (табачного) растения, включающим трансформацию растительной клетки-хозяина вектором экспрессии, который содержит промотор, функционально связанный с полинуклеотидом.

Настоящее изобретение относится к различным композиция и способам изменения уровня экспрессии эндогенного гена путем изменения трансляции мРНК. Растительную (табачную) клетку-хозяина можно трансформировать при помощи вектора экспрессии, содержащего промотор, функционально связанный с полинуклеотидом, расположенный в антисмысловой ориентации по отношению к промотору, для обеспечения экспрессии полинуклеотидов РНК, имеющих последовательность, комплементарную части мРНК.

Различные векторы экспрессии для изменения трансляции мРНК могут содержать промотор, функционально связанный с полинуклеотидом, в котором последовательность расположена в антисмысловой ориентации по отношению к промотору. Длины полинуклеотидов антисмысловой РНК могут варьировать и могут составлять приблизительно 15-20 нуклеотидов, приблизительно 20-30 нуклеотидов, приблизительно 30-50 нуклеотидов, приблизительно 50-75 нуклеотидов, приблизительно 75-100 нуклеотидов, приблизительно 100-150 нуклеотидов, приблизительно 150-200 нуклеотидов и приблизительно 200-300 нуклеотидов.

Также настоящее изобретение относится к способам получения мутантных полинуклеотидов и полипептидов. Любое представляющее интерес растение, включая растительную клетку или растительный материал, можно генетически модифицировать при помощи различных способов, известных для индукции мутагенеза, включая сайт-направленный мутагенез, направленный на олигонуклеотид мутагенез, химически индуцированный мутагенез, индуцированный облучением мутагенез, мутагенез с использованием модифицированных оснований, мутагенез с использованием "рваной" дуплексной РНК, мутагенез с разрывом двойной цепи, мутагенез с использованием штаммов-хозяев с нарушением репарации, мутагенез путем общего генного синтеза, перестановка в ДНК и другие эквивалентные способы.

Альтернативно, гены могут быть целью для инактивации путем введения транспозонов (например, IS-элементов) в геномы представляющих интерес растений. Такие мобильные генетические элементы могут быть введены посредством полового перекрестного оплодотворения, а мутанты со вставкой могут быть подвергнуты скринингу на предмет потери активности белка. Нарушенный ген в родительском растении может быть введен в другие растения путем скрещивания родительского растения с растением, не подвергнутым транспозон-индуцированному мутагенезу, при помощи, например, полового перекрестного оплодотворения. Можно использовать любые известные специалистам в данной области стандартные методики селекции. В соответствии с одним вариантом осуществления один или несколько генов могут быть инактивированы путем вставки одного или нескольких транспозонов. Мутации могут привести в результате к гомозиготному нарушению одного или нескольких генов, к гетерозиготному нарушению одного или нескольких генов или к комбинации как гомозиготного, так и гетерозиготного нарушений при нарушении более одного гена. Подходящие перемещающиеся генетические элементы включают ретротранспозоны, ретропозоны и SPNE-подобные элементы. Такие способы известны специалистам в данной области.

Альтернативно, гены могут быть мишенью для инактивации путем введения, рибозимов полученных из ряда малых кольцевых РНК, которые способны самостоятельно расщепляться и реплицироваться в растениях. Такие РНК могут реплицироваться либо самостоятельно (вироидные РНК), либо при помощи вируса-хелпера (сателлитные РНК). Примеры подходящих РНК включают полученные из вируса "солнечной" пятнистости авокадо РНК и сателлитные РНК, полученные из вируса кольцевой пятнистости табака, вируса временной полосатости люцерны, вируса бархатистой пятнистости табака, вируса пятнистости паслена черного и вируса пятнистости клевера подземного. Различные целевые РНК-специфичные рибозимы известны специалистам в данной области.

Согласно некоторым вариантам осуществления экспрессию полипептида изменяют с помощью нетрансгенных средств, таких как создание мутации в гене. Способы, при помощи которых случайным образом интродуцируют мутацию в генную последовательность, могут включать химический мутагенез, EMS-мутагенез и радиационный мутагенез. Способы при помощи, которых интродуцируют одну или несколько целевых мутаций в клетку, включают без ограничения методику редактирования генома, в частности, опосредованный нуклеазой с "цинковыми пальцами" мутагенез, tilling (целенаправленные индуцированные локальные поражения в геномах), гомологичную рекомбинацию, направленный на олигонуклеотид мутагенез и опосредованный мегануклеазой мутагенез.

Некоторыми неограничивающими примерами мутаций являются делеции, вставки и миссенс-мутации по меньшей мере одного нуклеотида, однонуклеотидные полиморфизмы и однократный повтор последовательности. После мутации можно осуществить скрининг для выявления мутаций, которые создают преждевременные стоп-кодоны или иным образом нефункциональные гены. После мутации можно осуществить скрининг для выявления мутаций, которые создают функциональные гены, которые могут экспрессироваться на повышенных уровнях. Скрининг мутантов можно осуществлять при помощи секвенирования или посредством применения одного или нескольких специфичных к гену или белку зондов или праймеров. Также можно создавать специфичные мутации в полинуклеотидах, которые могут в результате привести к измененной экспрессии генов, измененной стабильности мРНК или измененной стабильности белка. Такие растения в настоящем описании названы "не встречающимися в природе" или "мутантными" растениями. Как правило, мутантные или не встречающиеся в природе растения будут включать по меньшей мере часть чужеродной или синтетической или созданной человеком нуклеиновой кислоты (например, ДНК или РНК), которая не присутствовала в растении до того, как над ним произвели манипуляции. Чужеродная нуклеиновая кислота может представлять собой отдельный нуклеотид, два или более нуклеотидов, два или более смежных нуклеотидов, или два или более несмежных нуклеотидов, к примеру, по меньшей мере 10, 20, 30, 40, 50,100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400 или 1500 или более смежных или несмежных нуклеотидов.

Мутантные или не встречающиеся в природе растения могут иметь любую комбинацию из одной или нескольких мутаций, которые в результате приводят к измененным уровням белка. Например, мутантные или не встречающиеся в природе растения могут иметь отдельную мутацию в отдельном гене, множественные мутации в отдельном гене, отдельную мутацию в двух или более или трех или более генах или множественные мутации в двух или более или трех или более генах. В качестве следующего примера, мутантные или не встречающиеся в природе растения могут иметь одну или несколько мутаций в специфической части гена(генов), к примеру, в участке гена, который кодирует активный центр белка или его часть. В качестве следующего примера, мутантные или не встречающиеся в природе растения могут иметь одну или несколько мутаций в участке за пределами одного или нескольких генов, к примеру, в участке выше или ниже гена, который регулирует, при условии, что они изменяют активность или экспрессию гена(ов). Расположенные выше элементы могут включать промоторы, энхансеры или участки связывания с факторами транскрипции. Некоторые элементы, такие как энхансеры, могут располагаться выше или ниже гена, который он регулирует. Элемент(ы) не должен располагаться рядом с геном, который он регулирует, поскольку было обнаружено, что некоторые элементы расположены на несколько сотен тысяч пар оснований выше или ниже гена, который он регулирует. Мутантные или не встречающиеся в природе растения могут иметь одну или несколько мутаций, расположенных в рамках первых 100 нуклеотидов гена(ов), в рамках первых 200 нуклеотидов гена(ов), в рамках первых 300 нуклеотидов гена(ов), в рамках первых 400 нуклеотидов гена(ов), в рамках первых 500 нуклеотидов гена(ов), в рамках первых 600 нуклеотидов гена(ов), в рамках первых 700 нуклеотидов гена(ов), в рамках первых 800 нуклеотидов гена(ов), в рамках первых 900 нуклеотидов гена(ов), в рамках первой 1000 нуклеотидов гена(ов), в рамках первых 1100 нуклеотидов гена(ов), в рамках первых 1200 нуклеотидов гена(ов), в рамках первых 1300 нуклеотидов гена(ов), в рамках первых 1400 нуклеотидов гена(ов) или в рамках первых 1500 нуклеотидов гена(ов). Мутантные или не встречающиеся в природе растения могут иметь одну или несколько мутаций, расположенных в рамках первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого или пятнадцатого набора 100 нуклеотидов гена(ов) или их комбинаций. Раскрыты мутантные или не встречающиеся в природе растения (например, описанные в настоящем документе мутантные, не встречающиеся в природе или трансгенные растения и т. п.), содержащие мутантные полипептидные варианты.

В соответствии с одним вариантом осуществления семена растений подвергают мутагенезу и затем проращивают в мутантные растения первого поколения. Растениям первого поколения затем дают самоопылиться и из семян растения первого поколения выращивают растения второго поколения, которые затем подвергают скринингу на предмет мутаций в их локусах. Хотя подвергнутый мутагенезу растительный материал можно подвергнуть скринингу на предмет мутаций, преимуществом скрининга растений второго поколения является то, что все соматические мутации соответствуют генеративным мутациям. Любому специалисту в данной области будет понятно, что разнообразие растительных материалов, включая без ограничения семена, пыльцу, ткань растения или растительные клетки, можно подвергнуть мутагенезу с целью создания мутантных растений. Тем не менее, тип подвергаемого мутагенезу растительного материала может оказывать влияние при скрининге растительной нуклеиновой кислоты в отношении мутаций. Например, если пыльцу подвергают мутагенезу до опыления не подвергнутого мутагенезу растения, то из полученных в результате такого опыления семян выращивают растения первого поколения. Каждая клетка растений первого поколения будет содержать созданные в пыльце мутации; таким образом, такие растения первого поколения можно затем подвергнуть скринингу в отношении мутаций, вместо того, чтобы ждать до второго поколения.

Для создания мутаций можно применять мутагены, которые создают преимущественно точечные мутации и короткие делеции, вставки, трансверсии и или транзиции, в том числе химические мутагены или радиацию. Мутагены включают без ограничения этилметансульфонат, метилметансульфонат, N-этил-N-нитрозомочевину, триэтилмеламин, N-метил-N-нитрозомочевину, прокарбазин, хлорамбуцил, циклофосфамид, диэтилсульфат, акриламидный мономер, мелфалан, азотистый иприт, винкристин,диметилнитрозамин, N-метил-N'-нитронитрозогуанидин, нитрозогуанидин, 2-аминопурин, 7,12-диметил-бенз(а)антрацен, этиленоксид, гексаметилфосфорамид, бисульфан, диэпоксиалканы (диэпоксиоктан, диэпоксибутан и т. п.), 2-метокси-6-хлор-9[3-(этил-2-хлоро-этил)аминопропиламино]акридина дигидрохлорид и формальдегид.

Также предусмотрены спонтанные мутации в локусе, которые могут не быть следствием непосредственного действия мутагена, при условии, что они приводят к получению необходимого фенотипа. Подходящие мутагенные средства также могут включать, например, ионизирующую радиацию, такую как рентгеновское излучение, гамма-лучи, радиацию с быстрыми нейтронами и УФ-излучение. Любой известный специалистам в данной области способ получения нуклеиновой кислоты растения можно применять для получения нуклеиновой кислоты для скрининга мутаций. Полученную нуклеиновую кислоту из отдельных растений, растительных клеток или растительного материала можно необязательно объединить в пул с целью ускорения скрининга в отношении мутаций в популяции растений, происходящей из подвергнутых мутагенезу растительных тканей, клеток или материала. Одно или несколько растений, растительных клеток или растительных материалов последующих поколений можно подвергнуть скринингу. Размер не обязательно объединенной в пул группы зависит от чувствительности применяемого способа скрининга.

После необязательного объединения в пул образцов нуклеиновой кислоты, их можно подвергнуть полинуклеотид-специфичным методикам амплификации, таким как полимеразная цепная реакция. Любой один или несколько праймеров или зондов, специфичных к гену или последовательностям, расположенным непосредственно рядом с геном, можно использовать для амплификации последовательностей в необязательно объединенном в пул юбразце нуклеиновой кислоты. Иллюстративными праймерами являются изложенные в SEQ ID NO: 3-5, 10-12 и 14-16. Предпочтительно, один или несколько праймеров или зондов сконструированы для амплификации участков локуса, где наиболее вероятно появление пригодных мутаций. Наиболее предпочтительно, праймер сконструирован для определения мутаций в участках полинуклеотида. Кроме того, для праймера(ов) и зонда(ов) предпочтительно избегать известных полиморфных сайтов с целью облегчения скрининг в отношении точечных мутаций. Для облегчения определения продуктов амплификации один или несколько праймеров или зондов можно помечать при помощи любого стандартного способа введения метки. Праймер(ы) или зонд(ы) можно сконструировать на основании описанных в настоящем документе последовательностей при помощи способов, которые хорошо известны в данной области техники.

Для облегчения определения продуктов амплификации праймер(ы) или зонд(ы) можно помечать при помощи любого стандартного способа введения метки. Их можно сконструировать на основании описанных в настоящем документе последовательностей при помощи способов, которые хорошо известны в данной области техники.

Полиморфизмы можно выявить с помощью известных в данной области средств, и некоторые из них были описаны в литературе.

Согласно дополнительному аспекту настоящее изобретение относится к способу получения мутантного растения. Способ включает получение по меньшей мере одной клетки растения, содержащей ген, кодирующий функциональный полинуклеотид NtABA4, или NtNeSy, или NtNCED2 (или комбинацию из двух или более или трех или более из них). Затем, по меньшей мере одну клетку растения обрабатывают в условиях, эффективных для изменения активности полинуклеотида NtABA4, или NtNeSy, или NtNCED2. По меньшей мере одну мутантную растительную клетку затем размножают в мутантное растение, причем мутантное растение имеет измененный уровень полипептидов NtABA4, или NtNeSy, или NtNCED2 (или комбинацию из двух или более или трех или более из них) по сравнению с уровнем в контрольном растении. В соответствии с одним вариантом осуществления такого способа получения мутантного растения стадия обработки включает воздействие по меньшей мере на одну клетку описанным выше химическим мутагенным средством и в условиях, эффективных для получения по меньшей мере одной мутантной растительной клетки. В соответствии с другим вариантом осуществления такого способа стадия обработки включает воздействие по меньшей мере на одну клетку источником радиации в условиях, эффективных для получения по меньшей мере одной мутантной растительной клетки. Термин "мутантное растение" включает растения-мутанты, у которых генотип является модифицированным по сравнению с контрольным растением, соответственно с помощью средств, отличных от генетической инженерии или генетической модификации.

Согласно некоторым вариантам осуществления мутантное растение, мутантная растительная клетка или мутантный растительный материал могут содержать одну или несколько мутаций, которые встречаются в природе у другого растения, растительной клетки или растительного материала и придают необходимый признак. Такая мутация может быть введена (например, интрогессирована) в другое растение, растительную клетку или растительный материал (например, растение, растительную клетку или растительный материал с отличным генетическим фоном по сравнению с растением, из которого получили мутацию) для придания им признака. Таким образом, к примеру, мутация, которая встречается в природе у первого растения, может быть введена во второе растение, такое как второе растение с отличным генетическим фоном по сравнению с первым растением. Специалист в данной области, таким образом, сможет провести поиск и выявить растение, несущее в природе в своем геноме один или нескольких мутантных аллелей описанных в настоящем документе генов, которые придают необходимый признак. Мутантный аллель(аллели), который встречается в природе, можно перенести во второе растение посредством различных способов, включая селекцию, возвратное скрещивание и интрогрессию, с получением линий, сортов или гибридов, которые имеют одну или несколько мутаций в описанных в настоящем документе генах. Растения, у которых наблюдают необходимый признак, можно с помощью скрининга выделить из пула мутантных растений. Соответственно, отбор выполняют с использованием информации об описанных в настоящем документе нуклеотидных последовательностях. Следовательно, возможно проведение скрининга в отношении генетического признака по сравнению с контролем. Такой скрининговый подход может включать применение обсуждаемых в настоящем документе традиционных методик амплификации и/или гибридизации нуклеиновых кислот. Таким образом, дополнительный аспект по настоящему изобретению относится к способу выявления мутантного растения, включающему следующие стадии: (а) получение образца, содержащего полинуклеотид NtABA4, или NtNeSy, или NtNCED2, из растения; и (b) определение последовательности нуклеиновой кислоты полинуклеотида, причем отличие в последовательности полинуклеотида NtABA4, или NtNeSy, или NtNCED2 по сравнению с полинуклеотидной последовательностью контрольного растения указывает на то, что указанное растение является мутантным растением по NtABA4, или NtNeSy, или NtNCED2. В соответствии с другим аспектом настоящее изобретение относится к способу выявления мутантного растения, у которого накапливаются повышенные уровни либо (i) каротиноида, или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона, по сравнению с контрольным растением, включающему следующие стадии: (а) получение образца из подлежащего скринингу растения; (b) определение того, содержит ли указанный образец одну или несколько мутаций в полинуклеотиде NtABA4, или NtNeSy, или NtNCED2; и (с) определение (i) содержания каротиноида или бета-дамасценона; или (ii) каротиноида и бета-дамасценона в указанном растении; причем если указанное растение содержит одну или несколько мутаций в полинуклеотиде NtABA4, или NtNeSy, или NtNCED2, которые изменяют экспрессию или активность кодируемого белка по сравнению с контрольным растением, и часть табачного растения имеет повышение либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона по меньшей мере на 5% по сравнению с контрольным табачным растением, у которого экспрессия или активность NtABA4, или NtNeSy, или NtNCED2 не была изменена, то это указывает на мутантное растение, которое накапливает повышенные уровни либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона. В соответствии с другим аспектом настоящее изобретение относится к способу получения мутантного растения, которое накапливает повышенные уровни либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона по сравнению с контрольным растением, включающему следующие стадии: (а) получение образца из первого растения; (b) определение того, содержит ли указанный образец одну или несколько мутаций в полинуклеотиде NtABA4, или NtNeSy, или NtNCED2, которые приводят к накоплению повышенных уровней либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона; и (с) перенос одной или нескольких мутаций во второе растение. Мутацию(мутации) можно перенести во второе растение при помощи различных известных из уровня техники способов, таких как посредством генетической инженерии, манипуляции с генами, интрогрессии, селекции растений, возвратного скрещивания и т. п. В соответствии с одним вариантом осуществления первым растением является встречающееся в природе растение. В соответствии с одним вариантом осуществления второе растение имеет отличный генетический фон по сравнению с первым растением. В соответствии с другим аспектом настоящее изобретение относится к способу получения мутантного растения, которое накапливает повышенные уровни либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона по сравнению с контрольным растением, включающему следующие стадии: (а) получение образца из первого растения; (b) определение того, содержит ли указанный образец одну или несколько мутаций в полинуклеотиде NtABA4, или NtNeSy, или NtNCED2, которые приводят к накоплению повышенных уровней либо (i) каротиноида или бета-дамасценона; либо (ii) каротиноида и бета-дамасценона; и (с) интрогрессия одной или нескольких мутаций из первого растения во второе растение. В соответствии с одним вариантом осуществления стадия интрогрессии включает селекцию растений, необязательно включающую возвратное скрещивание и т. п. В соответствии с одним вариантом осуществления первым растением является встречающееся в природе растение. В соответствии с одним вариантом осуществления второе растение имеет отличный генетический фон по сравнению с первым растением. В соответствии с одним вариантом осуществления первое растение не является культиваром или элитным культиваром. В соответствии с одним вариантом осуществления второе растение является культиваром или элитным культиваром. Следующий аспект относится к мутантному растению (включая мутантное растение культивара или элитного культивара), которое получено или которое можно получить посредством описанных в настоящем документе способов. В соответствии с некоторыми вариантами осуществления "мутантные растения" могут иметь одну или несколько мутаций, локализованных только в специфическом участке растения, к примеру в рамках последовательности полинуклеотида(ов) NtABA4, или NtNeSy, или NtNCED2. В соответствии с таким вариантом осуществления остальная геномная последовательность мутантного растения будет такой же или практически такой же, как и у растения до мутагенеза.

В соответствии с некоторыми вариантами осуществления мутантные растения могут иметь одну или несколько мутаций, локализованных в нескольких участках растения, к примеру, в рамках последовательности полинуклеотида NtABA4, или NtNeSy, или NtNCED2 и в одном или нескольких дополнительных участках генома. В соответствии с таким вариантом осуществления остальная геномная последовательность мутантного растения не будет такой же или не будет практически такой же, как у растения до мутагенеза. В соответствии с определенными вариантами осуществления мутантные растения могут не иметь одну или несколько мутаций в одном или нескольких, двух или более, трех или более, четырех или более, пяти или более экзонах полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутаций в одном или нескольких, двух или более, трех или более, четырех или более, пяти или более интронах полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутаций в промоторе полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутаций в 3' нетранслируемом участке полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутации в 5' нетранслируемом участке полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутации в кодирующем участке полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или могут не иметь одну или несколько мутаций в некодирующем участке полинуклеотида NtABA4, или NtNeSy, или NtNCED2; или любой комбинации из двух или более, трех или более, четырех или более, пяти или более, или шести или более их частей.

Согласно следующему аспекту настоящее изобретение относится к способу выявления растения, растительной клетки или растительного материала, содержащего мутацию в гене, кодирующем NtABA4, или NtNeSy, или NtNCED2, включающему: (а) осуществление мутагенеза растения, растительной клетки или растительного материала; (b) получение образца нуклеиновой кислоты из указанного растения, растительной клетки или растительного материала или их потомства; и (с) определение последовательности нуклеиновой кислоты гена, кодирующего NtABA4, или NtNeSy, или NtNCED2, или его варианта или фрагмента, причем отличие указанной последовательности указывает на наличие в ней одной или нескольких мутаций. Белки с "цинковыми пальцами" можно применять для изменения экспрессии или активности одного или нескольких из описанных в настоящем документе полинуклеотидов NtABA4, или NtNeSy, или NtNCED2. В соответствии с различными вариантами осуществления геномную последовательность ДНК, содержащую часть или всю кодирующую последовательность полинуклеотида, модифицируют посредством опосредованного нуклеазами с "цинковыми пальцами" мутагенеза. Проводят поиск в геномной последовательности ДНК в отношении уникального сайта для связывания белка с "цинковыми пальцами". Альтернативно, проводят поиск в геномной последовательности ДНК в отношении двух уникальных сайтов для связывания белка с "цинковыми пальцами", причем оба сайта находятся на противоположных цепях и близко друг к другу, например, на расстоянии 1, 2, 3, 4, 5, 6 или более пар оснований. Таким образом, настоящее изобретение относится к белкам с "цинковыми пальцами", которые связываются с полинуклеотидами.

Белок с "цинковым пальцем" может быть сконструирован для распознавания выбранного целевого сайта в гене. Белок с "цинковым пальцем" может содержать любую комбинацию мотивов, полученных из естественных ДНК-связывающих доменов "цинковых пальцев" и отличных от естественных ДНК-связывающих доменов "цинковых пальцев" в результате укорочения или удлинения или с помощью процесса сайт-направленного мутагенеза, сопряженного со способом отбора, таким как без ограничения отбор фаговым дисплеем, отбор по двойным бактериальным гибридам или отбор по одному бактериальному гибриду. Термин "отличный от естественных ДНК-связывающих доменов "цинковых пальцев"" относится к ДНК-связывающему домену "цинкового пальца", который связывает последовательности из трех пар оснований в целевой нуклеиновой кислоте и который не встречается в клетке или в организме, содержащем подлежащую модификации нуклеиновую кислоту. Способы конструирования белка с "цинковым пальцем", который связывает специфические нуклеотидные последовательности, которые являются уникальными для целевого гена, известны из уровня техники.

Нуклеазу с "цинковым пальцем" можно построить путем получения химеры из первого полинуклеотида, кодирующего белок с "цинковым пальцем", который связывается с полинуклеотидом, и второго полинуклеотида, кодирующего неспецифичную эндонуклеазу, такую как без ограничения эндонуклеаза по типу IIS. Химерный белок из белка с "цинковым пальцем" и нуклеазы может содержать спейсер, состоящий из двух пар оснований, или альтернативно спейсер может состоять из трех, четырех, пяти, шести, семи или более пар оснований. В соответствии с различными вариантами осуществления нуклеаза с "цинковым палцем" приводит к разрыву двойной цепи в регуляторном участке, кодирующем участке или некодирующем участке геномной последовательности ДНК полинуклеотида и приводит к уменьшению уровня экспрессии полинуклеотида или уменьшению активности кодируемого им белка. Расщепление посредством нуклеаз с "цинковым пальцем" зачастую приводит в результате к образованию делеций ДНК в сайте расщепления после репарации ДНК посредством негомологичного соединения концов. В соответствии с другими вариантами осуществления можно выбрать белок с "цинковым пальцем" для связывания с регуляторной последовательностью полинуклеотида. Более конкретно, регуляторная последовательность может содержать сайт инициации транскрипции, стартовый кодон, участок экзона, границу между экзоном и интроном, терминатор или стоп-кодон. Таким образом, настоящее изобретение относится к мутантому, не встречающемуся в природе или трансгенному растению или растительным клеткам, получаемым посредством опосредованного нуклеазой с "цинковым пальцем" мутагенеза в непосредственной близости к одному или нескольким описанным в настоящем документе полинуклеотидам, и способам получения такого растения или растительной клетки посредством опосредованного нуклеазой с "цинковым пальцем" мутагенеза. Способы доставки белка с "цинковым пальцем" и нуклеазы с "цинковым пальцем" в табачное растение сходные со способами, которые описаны ниже для доставки мегануклеазы.

В соответствии с другим аспектом описаны способы получения мутантных, не встречающихся в природе или трансгенных или иначе генетически модифицированных растений при помощи мегануклеаз, таких как I-CreI. Встречающиеся в природе мегануклеазы, а также рекомбинантные мегануклеазы можно применять для специфического создания двухцепочечного разрыва в отдельном сайте или в относительно небольшом количестве сайтов в геномной ДНК растения с получением нарушения одного или нескольких описанных в настоящем документе полинуклеотидов. Мегануклеаза может быть сконструированной мегануклеазой с измененными свойствами распознавания ДНК. Мегануклеазные белки можно доставлять в растительные клетки с помощью ряда известных в данной области механизмов.

Настоящее изобретение относится к применению мегануклеаз для инактивации полинуклеотида(ов) NtАВА4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них) в растительной клетке или растении. В частности, настоящее изобретение относится к способу инактивации полинуклеотида в растении при помощи мегануклеазы, включающему: а) получение растительной клетки, содержащей описанный в настоящем документе полинуклеотид; (b) введение мегануклеазы или кодирующего мегануклеазу конструкта в указанную растительную клетку; и (с) предоставление мегануклеазе возможности практически инактивировать полинуклеотид(ы). Мегануклеазы можно применять для расщепления сайтов распознавания мегануклеазы в кодирующих участках полинуклеотида. Такое расщепление зачастую приводит в результате к появлению делеции ДНК в сайте распознавания мегануклеазы после репарации мутагенной ДНК посредством негомологичного соединения концов. Такие мутации в кодирующей последовательности гена, как правило, являются достаточными для инактивации гена. Такой способ модификации растительной клетки включает, во-первых, доставку кассеты экспрессии мегануклеазы в растительную клетку при помощи подходящего способа трансформации. Для наивысшей эффективности необходимо связывание кассеты экспрессии мегануклеазы с маркером для отбора и отбор успешно трансформированных клеток в присутствии средства для отбора. Такой подход в результате приведет к встраиванию кассеты экспрессии мегануклеазы в геном, что, однако, может быть нежелательным, если растение может нуждаться в разрешении регуляторного органа В таких случаях кассета экспрессии мегануклеазы (и связанный маркерный ген для отбора) можно отделить в последующих поколениях растений при помощи стандартных методик селекции. Альтернативно, растительные клетки изначально можно трансформировать кассетой экспрессии мегануклеазы без маркера для отбора и можно вырастить на средах без средства для отбора. В таких условиях доля обработанных клеток будет получать кассету экспрессии мегануклеазы и будет временно экспрессировать сконструированную мегануклеазу без встраивания кассеты экспрессии мегануклеазы в геном. Поскольку это не обуславливает эффективность трансформации, такая последняя процедура трансформации требует, чтобы большее число обработанных клеток было подвергнуто скринингу для получения необходимой модификации генома. Описанный выше подход также можно применять для модификации растительной клетки при применении белка с "цинковым пальцем" или нуклеазы с "цинковым пальцем".

После доставки кассеты экспрессии мегануклеазы растительные клетки выращивают изначально в условиях, которые являются обычными для конкретной использованной процедуры трансформации. Это может означать выращивание трансформированных клеток на средах при температурах ниже 26°С, зачастую в темноте. Такие стандартные условия можно применять в течение некоторого периода времени, предпочтительно 1-4 дня, чтобы дать возможность растительной клетке восстановиться после процесса трансформации. В любой момент времени после начального периода восстановления температуру роста можно повышать для стимулирования активности сконструированной мегануклеазы для расщепления и мутации сайта распознавания мегануклеазы.

Для определенных задач может быть необходимо точное удаление полинуклеотида из генома растения. Такие задачи можно решить при помощи пары сконструированных мегануклеаз, каждая из которых расщепляет сайт распознания мегануклеазы на любой стороне предполагаемой делеции. Также можно применять TAL-эффекторные нуклеазы (TALEN), которые способны распознавать и связывать ген и производить разрывы двойных цепей в геноме. Таким образом, в соответствии с другим аспектом, настоящее изобретение относится к описанным в настоящей документе способам получения мутантных, не встречающихся в природе или трансгенных или иначе генетически модифицированных растений при помощи TAL-эффекторных нуклеаз.

Растения, подходящие для применения при генетической модификации, включают без ограничения однодольные и двудольные растения и растительные клеточные системы, включая виды из одного из следующих семейств: Acanthaceae, Alliaceae, Alstroemeriaceae, Amaryllidaceae, Apocynaceae, Arecaceae, Asteraceae, Berberidaceae, Bixaceae, Brassicaceae, Bromeliaceae, Cannabaceae, Caryophyllaceae, Cephalotaxaceae, Chenopodiaceae, Colchicaceae, Cucurbitaceae, Dioscoreaceae, Ephedraceae, Erythroxylaceae, Euphorbiaceae, Fabaceae, Lamiaceae, Linaceae, Lycopodiaceae, Malvaceae, Melanthiaceae, Musaceae, Myrtaceae, Nyssaceae, Papaveraceae, Pinaceae, Plantaginaceae, Poaceae, Rosaceae, Rubiaceae, Salicaceae, Sapindaceae, Solanaceae, Taxaceae, Theaceae или Vitaceae.

Подходящие виды могут включать представителей родов Abelmoschus, Abies, Acer, Agrostis, Allium, Alstroemeria, Ananas, Andrographis, Andropogon, Artemisia, Arando, Atropa, Berberís, Beta, Bixa, Brassica, Calendula, Camellia, Camptotheca, Cannabis, Capsicum, Carthamus, Catharanthus, Cephalotaxus, Chrysanthemum, Cinchona, Citrullus, Coffea, Colchicum, Coleus, Cucumis, Cucúrbita, Cynodon, Datura, Dianthus, Digitalis, Dioscorea, Elaeis, Ephedra, Erianthus, Erythroxylum, Eucalyptus, Festuca, Fragaria, Galantinas, Glycine, Gossypium, Helianthus, Hevea, Hordeum, Hyoscyamus, Jatropha, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Lycopodium, Manihot, Medicago, Mentha, Miscanthus, Musa, Nicotiana, Oryza, Panicum, Papaver, Parthenium, Pennisetum, Petunia, Phalaris, Phleum, Pinus, Poa, Poinsettia, Populus, Rauwolfia, Ricinus, Rosa, Saccharum, Salix, Sanguinaria, Scopolia, Seeale, Solanum, Sorghum, Spartina, Spinacea, Tanacetum, Taxus, Theobroma, Triticosecale, Triticum, Unióla, Veratrum, Vinca, Vitis и Zea. Подходящие виды могут включать Panicum spp., Sorghum spp., Miscanthus spp., Saccharum spp., Erianthus spp., Populus spp., Andropogon gerardii (бородач), Pennisetum purpureum (пеннисетум красный), Phalaris arundinacea (канареичник красный), Cynodon dactylon (свинорой пальчатый), Festuca arundinacea (овсяница тросниковая), Spartina pectinata (спартина гребенчатая), Medicago sativa (люцерна), Arundo donax (арундо тростниковый), Sécale cereale (рожь), Salix spp. (ива), Eucalyptus spp. (эвкалипт), Triticosecale (тритикале), bamboo, Helianthus annuus (подсолнечник), Carthamus tinctorius (сафлор), Jatropha curcas (ятрофа), Ricinus communis (клещевина), Elaeis guineensis (пальма), Linum usitatissimum (лен), Brassica júncea, Beta vulgaris (сахарная свекла), Manihot esculenta (кассава), Lycopersicon esculentum (томат), Lactuca sativa (салат), Musyclise alca (банан), Solanum tuberosum (картофель), Brassica olerácea (брокколи, капуста цветная, капуста брюссельская), Camellia sinensis (чай), Fragaria ananassa (клубника), Theobroma cacao (какао), Coffe ycliseca (коые), Vitis vinifera (винград), Ananas comosus (ананас), Capsicum annum (горький и сладкий перец), Allium сера (лук), Cucumis meló (дыня), Cucumis sativus (огурец), Cucúrbita maxima (тыква), Cucúrbita moschata (тыква), Spinacea olerácea (шпинат), Citrullus lanatus (арбуз), Abelmoschus esculentus (окра), Solanum melongena (баклажан), Rosa spp. (роза), Dianthus caryophyllus (гвоздика), Petunia spp. (петуния), Poinsettia pulcherrima (молочай), Lupinus albus (люпин), Unióla paniculata (овес), полевица (Agrostis spp.), Populus tremuloides (осина), Pinus spp. (сосна), Abies spp. (ель), Acer spp. (клен), Hordeum vulgare (ячмень), Poa pratensis (мятлик), Lolium spp. (райграс) и Phleum pratense (тимофеевка), Panicum virgatum (просо), Sorghu yclise или (сорго, суданская трава), Miscanthus giganteus (мискант), Saccharum sp. (сахарный тросник), Populus balsamifera (тополь), Zea mays (кукруза), Glycine max (соя), Brassica napus (канола), Triticum aestivum (пшеница), Gossypium hirsutum (хлопок), Oryza sativa (рис), Helianthus annuus (подсолнечник), Medicago sativa (люцерна), Beta vulgaris (сахарная свекла) или Pennisetum glaucum (просо американское).

Согласно различным вариантам осуществления настоящее изобретение относится к мутантным табачным растениям, не встречающимся в природе табачным растениям или трансгенным табачным растениям, модифицированным с целью изменения уровней генной экспрессии с получением, таким образом, растений, таких как табачное растение, у которых уровень экспрессии полипептида изменен в представляющих интерес тканях растения по сравнению с контрольным растением. Раскрываемые композиции и способы можно применять в отношении любых видов рода Nicotiana, включая N. rustica и N. tabacum (например, LA В21, LN KYI71, TI 1406, Basma, Galpao, Penque, Beinhart 1000-1 и Petico). Другие виды включают N. acaulis, Nyclise ta, N yclise ta var. multiflora, N yclise na, N. alata, N. amplexicaulis, N. arentsii, N yclise ta, N. benavidesii, N. benthamiana, N. bigelovii, N. bonahensis, N. cavicola, N. clevelandii, N. cordifolia, N. corymbosa, N. debneyi, N. excelsior, N. forgetiana, N. fragrans, N. glauca, N. glutinosa, N goodspeedii, N. gossei, N hybrid, N. ingulba, N. kawakamii, N. knightiana, N. langsdorffii, N. linearis, N. longiflora, N yclise та, N. megalosiphon, N. miersii, N. noctíflora, N. nudicaulis, N. obtusifolia, N. occidentalis, N. occidentalis subsp. hesperis, N. otophora, N. paniculata, N. pauciflora, N. petunioides, N. plumbaginifolia, N. quadrivalvis, N. raimondii, N. repanda, N. rosulata, N. rosulata subsp. ingulba, N. rotundifolia, N. setchellii, N. simulons, N. solanifolia, N. spegazzinii, N. stocktonii, N. suaveolens, N. sylvestris, N. thyrsiflora, N. tomentosa, N. tomentosiformis, N. trigonophylla, N. umbrática, N yclise ta, N. velutina, N. wigandioides и N.x sanderae.

Также в настоящем документе предусмотрено применение культиваров табака и элитных культиваров табака. Трансгенным, не встречающимся в природе или мутантным растением, таким образом, может быть сорт табака или элитный культивар табака, который содержит один или несколько трансгенов или одну или несколько генетических мутаций или их комбинацию. Генетическая мутация(мутации) (например, один или несколько полиморфизмов) может представлять собой мутации, которые не существуют в природе у отдельного сорта табака или культивара табака (например, элитного культивара табака) или может представлять собой генетическую мутацию(мутации), которые встречаются в природе, при условии, что мутация не встречается в природе у отдельного сорта табака или культивара табака (например, элитного культивара табака).

Особенно пригодные сорта Nicotiana tabacum включают табак типа Берлей, темного типа, типа для дымовой сушки и восточного типа. Неограничивающими примерами сортов или культиваров являются: BD 64, СС 101, СС 200, СС 27, СС 301, СС 400, СС 500, СС 600, СС 700, СС 800, СС 900, Coker 176, Coker 319, Coker 371 Gold, Coker 48, CD 263, DF911, DT 538 LC, Galpao tobacco, GL 26H, GL 350, GL 600, GL 737, GL 939, GL 973, HB 04P, HB 04P LC, HB3307PLC, Hybrid 403LC, Hybrid 404LC, Hybrid 501 LC, К 149, К 326, К 346, К 358, К394, К 399, К 730, KDH 959, КТ 200, KT204LC, КУЮ, KY14, KY 160, KY 17, KY 171, KY 907, KY907LC, KTY14xL8 LC, Little Crittenden, McNair 373, McNair 944, msKY 14xL8, Narrow Leaf Madole, Narrow Leaf Madole LC, NBH 98, N-126, N-777LC, N-7371LC, NC 100, NC 102, NC 2000, NC 291, NC 297, NC 299, NC 3, NC 4, NC 5, NC 6, NC7, NC 606, NC 71, NC 72, NC 810, NC BH 129, NC 2002, Neal Smith Madole, OXFORD 207, PD 7302 LC, PD 7309 LC, PD 7312 LC 'Periq'e' tobacco, PVH03, PVH09, PVH19, PVH50, PVH51, R 610, R 630, R 7-11, R 7-12, RG 17, RG 81, RG H51, RGH 4, RGH 51, RS 1410, Speight 168, Speight 172, Speight 179, Speight 210, Speight 220, Speight 225, Speight 227, Speight 234, Speight G-28, Speight G-70, Speight H-6, Speight H20, Speight NF3, Tl 1406, Tl 1269, TN 86, TN86LC, TN 90, TN 97, TN97LC, TN D94, TN D950, TR (Tom Rosson) Madole, VA 309, VA359, AA 37-1, В 13P, Xanthi (Mitchell-Мог), Bel-W3, 79-615, Samsun Holmes NN, KTRDC number 2 Hybrid 49, Burley 21, KY 8959, KY 9, MD 609, PG 01, PG 04, P01, P02, РОЗ, RG11, RG 8, VA 509, AS44, Banket Al, Basma Drama B84/31, Basma I Zichna ZP4/B, Basma Xanthi BX 2A, Batek, Besuki Jember, С104, Coker 347, Criollo Misionero, Delcrest, Djebel 81, DVH 405, Galpao Comum, HB04P, Hicks Broadleaf, Kabakulak Elassona, Kutsage El, LABU21, NC 2326, NC 297, PVH 2110, Red Russian, Samsun, Saplak, Simmaba, Talgar28, Wislica, Yayaldag, Prilep HC-72, Prilep P23, Prilep PB 156/1, Prilep Ρ12-2/1, Yaka JK-48, Yaka JB 125/3, TI-1068, KDH-960, Tl-1070, TW136, Basma, TKF 4028, L8, TKF 2002, GR141, Basma xanthi, GR149, GR153, Petit Havana. Также предусмотрены полученные в результате преобразования из приведенных выше подсорта, даже если в настоящем документе конкретно не указано.

Согласно вариантам осуществления настоящее изобретение также относится к композициям и способам получения мутантных растений, не встречающихся в природе растений, гибридных растений или трансгенных растений, которые были модифицированы с целью изменения экспрессии или активности полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них) или полипептида NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них). Предпочтительно, полученные мутантные растения, не встречающиеся в природе растения, гибридные растения или трансгенные растения могут иметь схожий или практически такой же общий внешний вид как и у контрольных растений. Различные фенотипические характеристики, такие как степень зрелости, количество листьев на растение, высота стебля, образованный листом угол, размер листа (ширина и длина), межузловое расстояние и пропорция от середины средней жилки до края листовой пластинки, можно оценить по результатам полевых наблюдений.

Согласно одному аспекту настоящее изобретение относится к семени описанного в настоящем документе мутантного растения, не встречающегося в природе растения, гибридного растения или трансгенного растения. Предпочтительно, семя представляет собой семя табака. Согласно следующему аспекту настоящее изобретение относится к пыльце или семязачатку описанного в настоящем документе мутантного растения, не встречающегося в природе растения, гибридного растения или трансгенного растения. Кроме того, настоящее изобретение относится к описанному в настоящем документе мутантному растению, не встречающемуся в природе растению, гибридному растению или трансгенному растению, которые дополнительно содержат нуклеиновую кислоту, придающую мужскую стерильность.

Также настоящее изобретение относится к тканевой культуре регенерируемых клеток описанного в настоящем документе мутантного растения, не встречающегося в природе растения, гибридного растения или трансгенного растения или его части, при этом культура регенерирует в растения, способные экспрессировать все морфологические и физиологические характеристики родителя. Регенерируемые клетки включают без ограничения клетки листьев, пыльцы, зачатков, семядолей, гипокотилей, корней, корневых кончиков, пыльниковых мешков, цветков и их части, семязачатков, побегов, черешков, стеблей, мякоти и оболочек или полученных из них каллуса или протопластов.

Одной целью является получение мутантных, трансгенных или не встречающихся в природе растений, которые характеризуются измененными уровнями каротиноидов или бета-дамасценона или измененными уровнями каротиноидов и бета-дамасценона при сохранении практически такого же внешнего вида при сравнении с контрольным растением. Соответственно, в настоящем документе описаны мутантные, трансгенные или не встречающиеся в природе растения или растительные клетки, которые обладают измененными уровнями каротиноидов или бета-дамасценона или измененными уровнями каротиноидов и бета-дамасценона по сравнению с контролными клетками или контрольными растениями. Мутантные, трансгенные или не встречающиеся в природе растения или растительные клетки были модифицированы с целью изменения синтеза или активности одного или нескольких из описанных в настоящем документе ферментов путем изменения экспрессии описанных в настоящем документе полинуклеотидных последовательностей, кодирующих один или несколько полипептидов. Согласно следующему аспекту настоящее изобретение относится к мутантным, не встречающимся в природе или трансгенным растению или клетке, у которых изменена экспрессия или активность одного или нескольких из описанных в настоящем документе ферментов, а часть растения (например, листья) характеризуется повышением или понижением уровней каротиноидов по меньшей мере на 5% по сравнению с контрольным растением, у которого не была изменена экспрессия или активность указанного фермента(ферментов). Согласно еще одному аспекту настоящее изобретение относится к мутантным, не встречающимся в природе или трансгенным растению или клетке, у которых экспрессия неоксантин-синтазы или активность кодируемого белка изменена таким образом, и у которых уровни бета-дамасценона в аэрозоле повышены по меньшей мере на 5% по сравнению с аэрозолем от контрольного растения. Изменение содержания каротиноидов по сравнению с контрольным растением может представлять собой изменение, составляющее по меньшей мере приблизительно 5%, по меньшей мере приблизительно 10%, по меньшей мере приблизительно 20%, по меньшей мере приблизительно 25%, по меньшей мере приблизительно 30%, по меньшей мере приблизительно 40%, по меньшей мере приблизительно 50%, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 70%, по меньшей мере приблизительно 75%, по меньшей мере приблизительно 80%, по меньшей мере приблизительно 90%, по меньшей мере приблизительно 95%, по меньшей мере приблизительно 96%, по меньшей мере приблизительно 97%, по меньшей мере приблизительно 98%, по меньшей мере приблизительно 99%, или приблизительно 100%, или более, к примеру 200%, или 300%, или более.

Изменение содержания бета-дамасценона по сравнению с контрольным растением может представлять собой изменение, составляющее по меньшей мере приблизительно 5%, по меньшей мере приблизительно 10%, по меньшей мере приблизительно 20%, по меньшей мере приблизительно 25%, по меньшей мере приблизительно 30%, по меньшей мере приблизительно 40%, по меньшей мере приблизительно 50%, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 70%, по меньшей мере приблизительно 75%, по меньшей мере приблизительно 80%, по меньшей мере приблизительно 90%, по меньшей мере приблизительно 95%, по меньшей мере приблизительно 96%, по меньшей мере приблизительно 97%, по меньшей мере приблизительно 98%, по меньшей мере приблизительно 99%, или приблизительно 100%, или более, к примеру 200%, или 300%, или более.

Предпочтительно, содержание лютеина в части растения (например, листьях) составляет по меньшей мере приблизительно 18 мг / 100 г, предпочтительно по меньшей мере приблизительно 18,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 19 мг / 100 г, предпочтительно по меньшей мере приблизительно 19,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 20 мг / 100 г, предпочтительно по меньшей мере приблизительно 25 мг /100 г или более.

Предпочтительно, содержание бета-каротина в части растения (например, листьях) составляет по меньшей мере приблизительно 11,5 мг / 100 г собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 12 мг / 100 г, предпочтительно по меньшей мере приблизительно 12,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 13 мг / 100 г, предпочтительно по меньшей мере приблизительно 13,5 мг/ 100 г, предпочтительно по меньшей мере 14 мг / 100 г, предпочтительно по меньшей мере приблизительно 14,5 мг / 100 г или предпочтительно по меньшей мере приблизительно 15 мг / 100 г или более.

Предпочтительно, содержание лютеина в части растения (например, листьях) составляет по меньшей мере приблизительно 18 мг / 100 г собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 18,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 19 мг / 100 г, предпочтительно по меньшей мере приблизительно 19,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 20 мг / 100 г, предпочтительно по меньшей мере приблизительно 25 мг / 100 г или более, а содержание бета-каротина в части растения (например, листьях) составляет по меньшей мере приблизительно 11,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 12 мг / 100 г, предпочтительно по меньшей мере приблизительно 12,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 13 мг /100 г, предпочтительно по меньшей мере приблизительно 13,5 мг / 100 г, предпочтительно по меньшей мере 14 мг / 100 г, предпочтительно по меньшей мере приблизительно 14,5 мг / 100 г или предпочтительно по меньшей мере приблизительно 15 мг /100 г или более.

Предпочтительно, уровни бета-дамасценона в аэрозоле сожженных или нагретых листьев составляет по меньшей мере приблизительно 1 нг/мг сожженного или собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 1,05 нг/мг, предпочтительно по меньшей мере приблизительно 1,1 нг/мг, предпочтительно по меньшей мере приблизительно 1,15 нг/мг или предпочтительно по меньшей мере приблизительно 2 нг/мг или более.

Предпочтительно, (i) содержание лютеина в части растения (например, листьях) составляет по меньшей мере приблизительно 18 мг / 100 г собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 18,5 мг / 100 г, предпочтительно по меньшей мере приблизительно 19 мг / 100 г, предпочтительно по меньшей мере приблизительно 19,5 мг /100 г, предпочтительно по меньшей мере приблизительно 20 мг / 100 г; предпочтительно по меньшей мере приблизительно 25 мг / 100 г или более; предпочтительно, (ii) содержание бета-каротина в части растения (например, листьях) составляет по меньшей мере приблизительно 11,5 мг / 100 г собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 12 мг / 100 г, предпочтительно по меньшей мере приблизительно 12,5 мг /100 г, предпочтительно по меньшей мере приблизительно 13 мг / 100 г, предпочтительно по меньшей мере приблизительно 13,5 мг / 100 г, предпочтительно по меньшей мере 14 мг / 100 г, предпочтительно по меньшей мере приблизительно 14,5 мг / 100 г или предпочтительно по меньшей мере приблизительно 15 мг / 100 г или более; и (iii) предпочтительно, уровни бета-дамасценона в аэрозоле сожженных или нагретых листьев составляют по меньшей мере приблизительно 1 нг/мг сожженного или собранного растительного (например, листового) материала, предпочтительно по меньшей мере приблизительно 1,05 нг/мг, предпочтительно по меньшей мере приблизительно 1,1 нг/мг, предпочтительно по меньшей мере приблизительно 1,15 нг/мг или предпочтительно по меньшей мере приблизительно 2 нг/мг или более.

Растение можно нагреть до 100°С или выше, к примеру, по меньшей мере 125°С, по меньшей мере 150°С, по меньшей мере 175°С или по меньшей мере 200°С, для высвобождения аэрозоля.

В соответствии с еще одним аспектом настоящее изобретение относится к мутантному, не встречающемуся в природе или трансгенному растению, у которого экспрессия фермента, выбранного из группы, состоящей из неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы или комбинации из двух или более или трех или более из них (указанные комбинации раскрыты в настоящем документе), или активность кодируемого белка таким образом повышена и (i) содержание лютеина в части растения (например, листьях) составляет по меньшей мере приблизительно 18 мг / 100 г собранного растительного (например, листового) материала; (ii) содержание бета-каротина в части растения (например, листьях) составляет по меньшей мере приблизительно 11,5 мг / 100 г собранного растительного (например, листового) материала; и (iii) уровни бета-дамасценона в аэрозоле сожженных или нагретых листьев составляет по меньшей мере приблизительно 1 нг/мг сожженного или собранного растительного (например, листового) материала. Предпочтительно внешний вид указанного растения является практически таким же, как и у контрольного растения. Предпочтительно растением является табачное растение.

Согласно вариантам осуществления настоящее изобретение также относится к композициям и способам получения мутантных, не встречающийся в природе или трансгенных растений, которые были модифицированы с целью изменения экспрессии или активности неоксантин-синтазы, или экспрессии или активности ликопин-бета-циклазы, или экспрессии или активности 9-цис-эпоксикаротиноиддиоксигеназы, что может в результате дать растения или растительные компоненты (например, листья, такие как зеленые листья или высушенные листья) с измененными уровнями каротиноидов (например, но без ограничения, лютеина или бета-каротина или и того, и другого) по сравнению с контролем. Согласно вариантам осуществления настоящее изобретение также относится к композициям и способам получения мутантных, не встречающихся в природе или трансгенных растений, которые были модифицированы с целью изменения экспрессии или активности комбинации двух или более или трех или более из неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы. Таким образом, согласно одному варианту осуществления настоящее изобретение относится к изменению экспрессии или активности неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы; согласно другому варианту осуществления настоящее изобретение относится к изменению экспрессии или активности неоксантин-синтазы и ликопин-бета-циклазы; согласно другому варианту осуществления настоящее изобретение относится к изменению экспрессии или активности неоксантин-синтазы и 9-цис-эпоксикаротиноиддиоксигеназы; и согласно другому варианту осуществления настоящее изобретение относится к изменению экспрессии или активности ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы или любой другой комбинации этих двух или более последовательностей. Изменение уровней каротиноидов у растений может обладать питательными преимуществами для потребителя, особенно при повышении уровней каротиноидов в растении. Изменение уровней каротиноидой у растений можно применять для создания растений, которые устойчивы к гербицидам, подавляющим биосинтез каротиноидов, особенно при повышении уровней каротиноидов в растении. Таким образом, согласно одному варианту осуществления настоящее изобретение относится к композициям и способам получения мутантных, не встречающихся в природе или трансгенных растений, которые были модифицированы с целью повышения экспрессии или активности вышеупомянутых полинуклеотидов и их комбинаций, что может в результате дать растения или растительные компоненты (например, листья, такие как зеленые листья или высушенные листья) с улучшенными питательными преимуществами или повышенной устойчивостью к гербицидам. Согласно вариантам осуществления настоящее изобретение также относится к композициям и способам получения мутантных, не встречающихся в природе или трансгенных растений, которые были модифицированы с целью изменения экспрессии или активности неоксантин-синтазы, что может в результате дать растения или растительные компоненты (например, нагретые сухие листья) с измененными уровнями бета-дамасценона по сравнению с контролем. Таким образом, в соответствии со следующим вариантом осуществления настоящее изобретение относится к композициям и способам получения мутантных, не встречающихся в природе или трансгенных растений, которые были модифицированы с целью изменения экспрессии или активности неоксантин-синтазы, что может дать растения или растительный материал, такой как нагретые или сожженные сухие табачные листья, в которых изменены уровни бета-дамасценона. Таким образом, повышение или уменьшение содержания бета-дамасценона может дать растительный материал с измененным вкусовым профилем. В соответствии с одним конкретным вариантом осуществления настоящее изобретение относится к композициям и способам получения мутантных, не встречающихся в природе или трансгенных растений, которые были модифицированы с целью повышения экспрессии или активности неоксантин-синтазы, что может дать растения или растительный материал, такой как нагретые или сожженные сухие табачные листья, в которых повышены уровни бета-дамасценона. Повышение содержания бета-дамасценона может дать растительный материал, который характеризуется вкусовым профилем со вкусом приготовленного яблока. Понижение содержания бета-дамасценона может дать растительный материал, который характеризуется модифицированным вкусовым профилем. В соответствии с некоторыми вариантами осуществления упоминание в настоящем документе бета-дамасценона может также включать его предшественников. Такая модификация может также изменять содержание каротиноидов у растений.

Предпочтительно, мутантные, не встречающиеся в природе или трансгенные растения, полученные согласно описанным в настоящем документе способам, имеют схожий или практически такой же внешний вид, как и у контрольных растений. В соответствии с одним вариантом осуществления высота стебля мутантных, не встречающихся в природе или трансгенных растений практически такая же, как и у контрольным растений через, например, один, два или три или более месяцев после пересадки в поле или через 10, 20, 30 или 36 или более дней после прищипывания верхушек. Например, высота стебля мутантных, не встречающихся в природе или трансгенных растений не превышает высоту стебля контрольных растений. В соответствии с другим вариантом осуществления содержание хлорофилла у мутантных, не встречающихся в природе или трансгенных растений практически такое же, как и у контрольных растений. В соответствии с другим вариантом осуществления высота стебля мутантных, не встречающихся в природе или трансгенных растений практически такая же, как и у контрольных растений, и содержание хлорофилла у мутантных, не встречающихся в природе или трансгенных растений практически такое же, как и у контрольных растений. В соответствии с другими вариантами осуществления размер, или форма, или количество, или окраска листьев у мутантных, не встречающихся в природе или трансгенных растений практически такие же, как и у контрольных растений. Предпочтительно растением является табачное растение.

В соответствии с другим аспектом настоящее изобретение относится к способу изменения содержания каротиноидов по меньшей мере в части растения (например, листьях), включающему следующие стадии: (i) изменение экспрессии или активности фермента, выбранного из группы, состоящей из неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы или комбинации из двух или более или трех или более из них (указанные комбинации раскрыты выше), у растения, предпочтительно, при этом неоксантин-синтаза, ликопин-бета-циклаза и 9-цис-эпоксикаротиноиддиоксигеназа охватывают описанную в настоящем документе полинуклеотидную последовательность или описанную в настоящем документе полипептидную последовательность; (ii) измерение содержания каротиноидов по меньшей мере в части (например, листьях) мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было изменено по сравнению с контрольным растением. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение.

В соответствии с другим аспектом настоящее изобретение относится к способу повышения содержания каротиноидов по меньшей мере в части растения (например, листьях), включающему следующие стадии: (i) повышение экспрессии или активности фермента, выбранного из группы, состоящей из неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы или комбинации из двух или более или трех или более из них (указанные комбинации раскрыты выше), у растения, предпочтительно, при этом неоксантин-синтаза, ликопин-бета-циклаза и 9-цис-эпоксикаротиноиддиоксигеназа охватывают описанную в настоящем документе полинуклеотидную последовательность или описанную в настоящем документе полипептидную последовательность; (ii) измерение содержания каротиноидов по меньшей мере в части (например, листьях) мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было повышено по сравнению с контрольным растением. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение.

В соответствии с другим аспектом настоящее изобретение относится к способу понижения содержания каротиноидов по меньшей мере в части растения (например, листьях), включающему следующие стадии: (i) понижение экспрессии или активности фермента, выбранного из группы, состоящей из неоксантин-синтазы, ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы или комбинации из двух или более или трех или более из них (указанные комбинации раскрыты выше), у растения, предпочтительно, при этом неоксантин-синтаза, ликопин-бета-циклаза и 9-цис-эпоксикаротиноиддиоксигеназа охватывают описанную в настоящем документе полинуклеотидную последовательность или описанную в настоящем документе полипептидную последовательность; (ii) измерение содержания каротиноидов по меньшей мере в части (например, листьях) мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было понижено по сравнению с контрольным растением. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение.

Повышение экспрессии по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100% или более, такое как 200% или 300% или более, которое включает повышение транскрипционной активности, или экспрессии белка, или и того, и другого.

Повышение активности по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100% или более, такое как 200% или 300% или более.

Уменьшение экспрессии по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой уменьшение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100%, что включает уменьшение транскрипционной активности или экспрессии белка или и того, и другого.

Уменьшение активности по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой уменьшение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100%.

Повышение содержания каротиноидов по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или до 100% или более, такое как 200% или 300% или более.

Понижение содержания каротиноидов по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой понижение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или до 100%.

В соответствии с другим аспектом настоящее изобретение относится к способу изменения содержания бета-дамасценона у растения, включающему следующие стадии: (i) изменение экспрессии или активности неоксантин-синтазы в растении, предпочтительно, причем неоксантин-синтаза охватывает описанную в настоящем описании полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания бета-дамасценона по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного в стадии (i), или аэрозоля из него; и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание бета-дамасценона в нем было модифицировано по сравнению с контрольным растением, у которого экспрессия или активность неоксантин-синтазы не была изменена. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение. Соответственно, содержание бета-дамасценона измеряют в аэрозоле, образовавшемся после нагревания высушенных табачных листьев.

В соответствии с другим аспектом настоящее изобретение относится к способу повышения содержания бета-дамасценона у растения, включающему следующие стадии: (i) повышение экспрессии или активности неоксантин-синтазы в растении, предпочтительно, причем неоксантин-синтаза охватывает описанную в настоящем описании полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания бета-дамасценона по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного в стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание бета-дамасценона в нем было повышено по сравнению с контрольным растением, у которого экспрессия или активность неоксантин-синтазы не была повышена. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение. Соответственно, содержание бета-дамасценона измеряют в аэрозоле, образовавшемся после нагревания высушенных табачных листьев.

В соответствии с другим аспектом настоящее изобретение относится к способу уменьшения или подавления (например, практически подавления) содержания бета-дамасценона у растения, включающему следующие стадии: (i) уменьшение или подавление экспрессии или активности неоксантин-синтазы в растении, предпочтительно, причем неоксантин-синтаза охватывает описанную в настоящем описании полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания бета-дамасценона по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного в стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание бета-дамасценона в нем было уменьшено или подавлено по сравнению с контрольным растением, у которого экспрессия или активность неоксантин-синтазы не была уменьшена или подавлена. Предпочтительно, внешний вид указанного мутантного, не встречающегося в природе или трансгенного растения практически такой же, как и у контрольного растения. Предпочтительно растением является табачное растение. Соответственно, содержание бета-дамасценона измеряют в аэрозоле, образовавшемся после нагревания высушенных табачных листьев.

Повышение экспрессии неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100% или более, такое как 200% или 300% или более, которое включает повышение транскрипционной активности, или экспрессии белка, или и того, и другого. Повышение активности неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100% или более, такое как 200% или 300% или более. Уменьшение экспрессии неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой уменьшение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100%, что включает уменьшение транскрипционной активности или экспрессии белка или и того, и другого.

Уменьшение активности неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой уменьшение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или 100% или более.

Повышение содержания неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой повышение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или до 100% или более, такое как 200% или 300% или более. Понижение содержания неоксантин-синтазы по сравнению с контрольным растением может составлять от приблизительно 5% до приблизительно 100%, или представлять собой понижение, составляющее по меньшей мере 10%, по меньшей мере 20%, по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95%, по меньшей мере 98% или до 100%.

Описанные в настоящем документе полинуклеотиды и рекомбинантные конструкты можно применять для изменения экспрессии описанных в настоящем документе ферментов у представляющих интерес видов растений, соответственно, табака. Для повышения генной экспрессии у растений можно применять ряд основанных на использовании полинуклеотидов способов. К примеру, можно получить конструкт, вектор или вектор экспрессии, совместимый с подлежащим трансформации растением, который содержит представляющий интерес ген наряду с расположенным выше промотором, который может обеспечивать сверхэкспрессию гена в растении. Иллюстративные промоторы описаны в настоящем документе. После трансформации и выращивания в подходящих условиях промотор может управлять экспрессией с изменением (например, повышением) уровней такого фермента в растении или в его конкретной ткани. В соответствии с одним иллюстративным вариантом осуществления создают вектор, несущий полинуклеотид NtABA4, или NtNeSy, или NtNCED2 (или любую из их комбинаций, которые описаны в настоящем документе) для сверхэкспрессии гена в растении. Вектор несет подходящий промотор, такой как промотор 35S CaMV вируса табачной мозайки, выше трансгена, управляющий его конститутивной экспрессией во всех тканях растения. Вектор также несет ген устойчивости к антибиотику для обеспечения возможности отбора трансформированных каллусных и клеточных линий. Таким образом, согласно различным вариантам осуществления настоящее изобретение относится к способам изменения (например, повышения) уровня экспрессии полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или любых их комбинаций, которые описаны в настоящем документе) путем встраивания множества копий полинуклеотида в геном растения, включающим трансформацию растительной клетки-хозяина вектором экспрессии, который содержит промотор, функционально связанный с полинуклеотидом NtABA4, или NtNeSy, или NtNCED2. Полипептид NtABA4, или NtNeSy, или NtNCED2, кодируемый посредством рекомбинантного полинуклеотида, может представлять собой нативный полипептид или может быть гетерологичным по отношению к клетке.

Согласно настоящему изобретению табачное растение, несущее мутантный аллель NtABA4, или NtNeSy, или NtNCED2 (или любые их комбинации, которые описаны в настоящем документе), можно применять в программе селекции растения с целью создания полезных линий, сортов и гибридов. Так, в частности, мутантный аллель интрогрессируют в описанные выше коммерчески важные сорта. Таким образом, настоящее изобретение относится к способам селекции растений, которые включают скрещивание описанных в настоящем документе мутантного растения, не встречающегося в природе растения или трансгенного растения с растением, характеризующимся иной генетической природой. Способ может дополнительно включать скрещивание растения-потомка с другим растением и необязательный повтор скрещивания до получения потомства с необходимыми генетическими признаками или генетическим фоном. Одной целью, которую можно достичь с помощью таких способов скрещивания, является введение необходимого генетического признака в другие сорта, селекционные линии, гибриды или культивары, в частности такие, которые представляют коммерческий интерес. Другой целью является обеспечение накопления генетических модификаций различных генов в отдельном сорте, линиях, гибридах или культиварах растений. Предусмотрены внутривидовые, а также межвидовые скрещивания. Получаемые в результате таких скрещиваний растения-потомки, также называемые селекционными линиями, представляют собой примеры не встречающихся в природе растений по настоящему изобретению.

В соответствии с одним вариантом осуществления настоящее изобретение относится к способу получения не встречающегося в природе табачного растения, включающему следующие стадии: (а) скрещивание мутантного или трансгенного табачного растения со вторым табачным растением с получением табачного семени-потомка; (b) выращивание табачного семени-потомка в подходящих для роста растения условиях с получением не встречающегося в природе табачного растения. Способ может дополнительно включать: (с) скрещивание предыдущего поколения не встречающегося в природе табачного растения с самим собой или с другим табачным растением с получением табачного семени-потомка; (d) выращивание табачного семени-потомка из стадии (с) в подходящих для роста растения условиях с получением дополнительных не встречающихся в природе табачных растений; и (е) повтор стадий скрещивания и выращивания (с) и (d) множество раз с получением последующих поколений не встречающихся в природе табачных растений. Способ перед стадией (а) необязательно может включать стадию получения родительского растения, характеризующееся генетической природой, которая отличается и которая не идентична по сравнению с мутантным или трансгенным растением. В соответствии с некоторыми вариантами осуществления в зависимости от программы селекции стадии скрещивания и выращивания повторяют от 0 до 2 раз, от 0 до 3 раз, от 0 до 4 раз, от 0 до 5 раз, от 0 до 6 раз, от 0 до 7 раз, от 0 до 8 раз, от 0 до 9 раз или от 0 до 10 раз с целью получения поколений не встречающихся в природе табачных растений. Возвратное скрещивание является примером такого способа, включающего, что потомство скрещивают с одним из его родителей или другим растением, генетически похожим на его родителя с целью получения растения-потомка следующего поколения, которое имеет генетическую природу, близкую к природе одного из родителей. Методики селекции растений, в частности селекции табачных растений, хорошо известны и могут быть использованы в способах согласно настоящему изобретению. Настоящее изобретение дополнительно относится к полученным с помощью таких способов не встречающимся в природе табачным растениям.

В соответствии с некоторыми вариантами осуществления описанных в настоящем документе способов линии, полученные в результате селекции и скрининга на вариантные гены, оценивают в поле с помощью стандартных полевых процедур. Включают контрольные генотипы, в том числе исходное немутантное растение, а образцы располагают в поле по рандомизированной полноблочной схеме или другой подходящей полевой схеме. Для табака применяют стандартные сельскохозяйственные практические методики, например, табак собирают, взвешивают и отбирают образцы для химического и другого традиционного тестирования перед и в ходе сушки. Статистические анализы данных проводят для подтверждения сходства выбранных линий с родительской линией. Цитогенетические анализы избранных растений необязательно проводят для подтверждения хромосомного набора и взаимосвязей при конъюгации хромосом.

Для переноса мутантных аллелей гена в другие растения табака или их селекции в других растениях табака в селекционной программе с отбором по маркерам (MAS) можно применять ДНК-фингерпринтинг, однонуклеотидный полиморфизм, микросателлитные маркеры и другие методики, как описано в настоящем документе. Например, селекционер может получить сегрегирующие популяции в результате гибридизаций содержащего мутантный аллель генотипа с необходимым с точки зрения сельского хозяйства генотипом. Растения в поколениях F2 или полученных в результате возвратного скрещивания поколениях можно подвергнуть скринингу с помощью маркера, разработанного на основе геномной последовательности или ее фрагмента, с применением одной из перечисленных в настоящей документе методик. Растения, выявленные как обладающие мутантным аллелем, можно подвергнуть возвратному скрещиванию или самоопылению с получением второй подлежащей скринингу популяции. В зависимости от ожидаемой схемы наследования или используемой MAS-методики может быт необходимо самоопыление отобранных растений перед каждым циклом возвратного скрещивания для облегчения выявления необходимых отдельных растений. Возвратное скрещивание или другую селекционную процедуру можно повторять до тех пор, пока не будет получен необходимый фенотип рекуррентного родителя.

Согласно настоящему раскрытию в селекционной программе успешные скрещивания дают растения F1, которые являются фертильными. Отобранные растения F1 можно скрестить с одним из родителей, а растения первого полученного в результате возвратного скрещивания поколения подвергнуть самоопылению с получением популяции, которую снова подвергают скринингу в отношении экспрессии вариантного гена (например, нуль-версии гена). Способ возвратного скрещивания, самоопыления и скрининга повторяют, например, по меньшей мере 4 раза до тех пор, пока окончательный скрининг не позволит получить растение, которое является фертильным и достаточно похожим на рекуррентного родителя. При желании, такое растении самоопыляют, а потомство после этого еще раз подвергают скринингу для подтверждения того, что у растения наблюдается экспрессия вариантного гена. В соответствии с некоторыми вариантами осуществления популяцию растений поколения F2 подвергают скринингу в отношении экспрессии вариантного гена, например, выявляют растение, которое не экспрессирует полипептид вследствие отсутствия гена, согласно стандартным способам, например, с помощью ПЦР-способа с применением праймеров на основе информации нуклеотидной последовательности в отношении полинуклеотидов, в том числе полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или любых их комбинаций), как описано в настоящем документе.

Гибридные сорта табака можно получить путем предупреждения самоопыления женских родительских растений (то есть семенного родителя) первого сорта, обеспечения возможности пыльце от мужских родительских растения второго сорта оплодотворить женские родительские растения и предоставления возможности гибридным семенам F1 сформироваться на женских растениях. Самоопыление женских растений можно предупредить путем удаления несозревших пестиков цветков на ранней стадии развития цветка. Альтернативно, формирование пыльцы можно предупредить на женских родительских растениях с помощью некоторой формы мужской стерильности. Например, мужскую стерильность можно получить с помощью цитоплазматической мужской стерильности (CMS) или трансгенной мужской стерильности, при которой трансген подавляет микроспорогенез и/или формирование пыльцы, или самонесовместимости. Особенно пригодны женские родительские растения, содержащие CMS. Согласно вариантам осуществления, в которых женские родительские растения являются носителями CMS, собирают пыльцу от мужских фертильных растений и вручную наносят на рыльца несущих CMS женских родительских растений, а полученные в результате семена F1 собирают.

Описываемые в настоящем документе сорта и лини можно применять для получения простых гибридов F1 табака. Согласно таким вариантам осуществления растения родительских сортов можно выращивать в виде практически однородных смежных популяций для облегчения естественного перекрестного опыления мужских родительских растений с женскими родительскими растениями. Сформировавшиеся на женских родительских растениях семена F1 избирательно собирают с помощью традиционных средств. Также два родительских сорта растений можно вырастить на общей площади и собрать гибридные семена F1, сформировавшиеся на женском родителе, и семена, сформировавшиеся на мужском родителе в результате самоопыления. Альтернативно, можно осуществить тройные скрещивания, при которых простого гибрида F1 используют в качестве женского родителя и скрещивают с другим мужским родителем. В качестве другой альтернативы можно создать двойных гибридов, в этом случае потомство F1 двух различных простых скрещиваний скрещивают между собой.

Популяцию мутантных, не встречающихся в природе или трансгенных растений можно подвергнуть скринингу или отбору в отношении таких членов популяции, которые имеют необходимый признак или фенотип. Например, популяцию потомства отдельного полученного в результате трансформации объекта можно подвергнуть скринингу в отношении таких растений, которые обладают необходимым уровнем экспрессии или активности NtABA4, или NtNeSy, или NtNCED2 или кодируемого ими полипептида. Для выявления уровней активности или экспрессии можно применять физические или биохимические способы. Такие способы включают анализ по Саузерну или ПЦР-амплификацию для определения полинуклеотида, нозерн-блоттинг, анализ с защитой от действия Sin РНКазы, анализ способом удлинения праймера или RT-PCR-амплификация для определения РНК-транскриптов, ферментативные анализы для определения ферментной или рибозимной активности полипептидов и полинуклеотидов и белковый гель-электрофорез, вестерн-блоттинг, иммунопреципитацию и иммуноферментные анализы для определения полипептидов.

Для определения наличия или экспрессии или активности полипептидов или полинуклеотидов также можно применять другие методики, такие как гибридизация in situ, ферментативное окрашивание и иммуноокрашивание, а также ферментные анализы.

В настоящем документе описаны мутантные, не встречающиеся в природе или трансгенные растительные клетки и растения, содержащие один или несколько рекомбинантных полинуклеотидов, таких как один или несколько выделенных полинуклеотидов NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них), один или несколько полинуклеотидных конструктов, одну или несколько двухцепочечных РНК, один или несколько конъюгатов или один или несколько векторов/векторов экспрессии.

Без ограничения, описанные в настоящем документе растения могут быть модифицированы для иных целей до или после изменения экспрессии или активности согласно настоящему изобретению. У мутантных, не встречающихся в природе или трансгенных растений может присутствовать одна или несколько из приведенных далее генетических модификаций. В соответствии с одним вариантом осуществления модифицируют один или несколько генов, которые вовлечены в поглощение тяжелых металлов или транспорт тяжелых металлов, что в результате дает растения или части растений (такие как листья) с более низким содержанием тяжелых металлов, чем у контрольных растений или их частей без модификации(модификаций). Неограничивающие примеры включают гены семейства белков, связанных с множественной лекарственной устойчивостью, семейства белков, участвующих в диффузии катионов (CDF), семейства Zrt-, Irt-подобных белков (ZIP), семейства катионных обменников (САХ), семейства транспортеров меди (СОРТ), семейства участвующих в транспорте тяжелых металлов АТФаз Р-типа (НМА, которые описаны в WO2009074325), семейства гомологов связанных с естественной устойчивостью макрофагальных белков (NRAMP) и семейства кассетных АТФ-связывающих (ABC) транспортеров, которые принимают участи в транспорте тяжелых металлов, таких как кадмий. Применяемый в настоящем документе термин "тяжелый металл" включает переходные металлы. В соответствии с другим вариантом осуществления модифицируют один или несколько генов, которые вовлечены в превращение азотсодержащих промежуточных продуктов метаболизма, что в результате дает растения или части растений (такие как листья), которые при нагревании дают более низкие уровни по меньшей мере одного специфичного для табака нитрозамина (например, 4-(метилнитрозамино)-1-(3-пиридил)-1-бутанона, N-нитрозонорникотина, N-нитрозоанатабина и N-нитрозоанабазина), чем контрольные растения или их части. Неограничивающие примеры генов, которые могут быть модифицированы, включают гены, кодирующие никотиндеметилазу, такую как CYP82E4, CYP82E5 и CYP82E10, которые принимают участие в превращении никотина в норникотин и описаны в WO2006091194, WO2008070274, WO2009064771 и PCT/US2011/021088.

Примеры других модификаций включают переносимость к гербицидам, например, глифосат является активным ингредиентом многих гербицидов широкого спектра действия. Устойчивые к глифосату трансгенные растения были выведены путем переноса гена аrоА (устойчивой к глифосату EPSP-синтетазы из Salmonella typhimurium и E.coli). Устойчивые к сульфонилмочевинам растения были получены путем трансформации мутантного гена ALS (ацетолактатсинтетазы) из Arabidopsis. ОВ-белок фотосистемы II из мутантной Amaranthus hybridus был перенесен в растения с получением устойчивых к атразину трансгенных растений, а устойчивые к бромоксинилу трансгенные растения были получены путем встраивания гена bхn из бактерии Klebsiella pneumoniae. Другая иллюстративная модификация дает растения, которые устойчивы к насекомым. Токсины Bacillus thuringiensis (Bt) могут обеспечить эффективный способ задержки выхода Bt-устойчивых вредителей, как недавно было показано для брокколи, у которой многоуровневые гены Bt crylAc и crylC обеспечивали защиту от устойчивой к любому отдельному белку капустной моли и значительно задерживали развитие устойчивых насекомых. Другая иллюстративная модификация дает в результате растения, которые устойчивы к заболеваниям, вызванным патогенами (например, вирусами, бактериями, грибами). Были сконструированы растения, экспрессирующие ген Ха21 (устойчивости к бактериозу), причем растения экспрессируют как гибридный ген Bt, так и ген хитиназы (устойчивости к желтому стеблевому точильщику и переносимости к поражающим эпидермис патогенам). Другая иллюстративная модификация дает в результате измененную способность к воспроизведению, такую как мужская стерильность. Другая иллюстративная модификация дает растения, которые переносят абиотический стресс (например, засуху, температуру, засоленность), и выносливые трансгенные растения были получены путем переноса ацилглицеролфосфатного фермента из Arabidopsis; гены, кодирующие маннитдегидрогеназу и сорбитдегидрогеназу, которые участвуют в синтезе маннита и сорбита, повышают устойчивость к засухе. Другая иллюстративная модификация дает растения, которые вырабатывают белки, обладающие полезными для применения для людей иммуногенными свойствами. Например, могут быть полезны растения, способные вырабатывать белки, которые практически не содержат в своем N-гликане альфа-1,3-связанные фукозные остатки, бета-1,2-связанные ксилозные остатки или и те, и другие. Другие иллюстративные модификации могут дать растения с повышенным количеством запасных белков и масел, растения с повышенной эффективностью фотосинтеза, растения с продолжительным периодом хранения, растения с повышенным содержанием углеводов и устойчивые к грибам растения; при этом растения кодируют фермент, участвующий в биосинтезе алкалоидов. Также предусмотрены трансгенные растения, у которых была изменена экспрессия S-аденозил-L-метионина (SAM) и/или цистатионин гамма-синтазы (CGS).

Один или несколько таких признаков можно интрогрессировать в мутантные, не встречающиеся в природе или трансгенные табачные растения из другого культивара табака или можно непосредственно трансформировать в них. Интрогрессию признака(признаков) в мутантные, не встречающиеся в природе или трансгенные табачные растения по настоящему изобретению можно осуществить с помощью любого известного из уровня техники способа селекции растений, например, сортовой селекции, возвратного скрещивания, селекции двойных гаплоидов и т. п. (см. Wernsman, Ε. A, and Rufty, R. С. 1987. Chapter Seventeen. Tobacco. Pages 669-698 In: Cultivar Development. Crop Species. W. H. Fehr(ed.), MacMillan Publishing Co, Inc., New York, N.Y 761 pp.). Описанные выше методики на основе молекулярной биологии, в частности RFLP и микросаттелитные маркеры, можно применять в таких возвратных скрещиваниях для выявления потомков с наиболее высокой степенью генетической идентичности с рекуррентным родителем. Это позволяет ускорить получение сортов табака по меньшей мере с 90%, предпочтительно по меньшей мере с 95%, более предпочтительно по меньшей мере с 99% генетической идентичностью с рекуррентным родителем, еще более предпочтительно генетически идентичных с рекуррентным родителем, и дополнительно содержащих признак(и), интрогрессированный от родителя-донора. Такое определение генетической идентичности может быть основано на известных из уровня техники молекулярных маркерах.

Последнее поколение возвратного скрещивания можно скрестить с самим собой с получением потомства чистой линии по переносимой нуклеиновой кислоте(кислотам). Полученные растения помимо перенесенного признака(признаков) (например, один или несколько моногенных признаков) обычно имеют практически все морфологические и физиологические характеристики мутантных, не встречающихся в природе или трансгенных табачных растений по настоящему изобретению. Для определения подходящего протокола тестирования точный протокол возвратного скрещивания будет зависеть от изменяемого признака. Несмотря на то, что способы возвратного скрещивания упрощаются, если переносимый признак представляет собой доминантный аллель, также можно переносить и рецессивный аллель. В таком случае, может быть необходимо введение теста потомства для определения того, успешно ли был перенесен необходимый признак. Согласно различным вариантам осуществления настоящее изобретение относится к мутантным растениям, не встречающимся в природе растениям или трансгенным растениям, а также к биомассе, у которой уровень экспрессии полинуклеотида NtАВА4, или NtNeSy, или NtNCED2 (или любой их комбинации) изменен с целью изменения содержания каротиноидов или содержания бета-дамасценона в аэрозоле, образованном после нагревания высушенного табака, полученного из растений. Части таких растений, конкретно табачных растений и более конкретно листовой пластинки и центральной жилки табачных растений, можно включить в различные потребительские продукты или использовать при их производстве, включая без ограничения образующие аэрозоль материалы, образующие аэрозоль устройства, курительные изделия, табачные изделия, бездымные продукты и табачные продукты. Примеры образующих аэрозоль материалов включают без ограничения табачные композиции, разновидности табака, табачный экстракт, резанный табак, скрошенный табак, высушенный табак, экспандированный табак, гомогенизированный табак, восстановленный табак и трубочные разновидности табака. Курительные изделия и табачные изделия являются типами образующих аэрозоль устройств. Примеры курительных изделий или табачных изделий включают без ограничения сигареты, сигариллы и сигары. Примеры бездымных продуктов включают разновидности жевательного табака и разновидности нюхательного табака. В некоторых образующих аэрозоль устройствах вместо сжигания табачную композицию или другой образующий аэрозоль материал нагревают с помощью одного или нескольких электрических нагревательных элементов с целью получения аэрозоля. В другом типе образующего нагретый аэрозоль устройства аэрозоль получают в результате передачи тепла от элемента, выделяющего тепло в результате сгорания топлива, или источника тепла к физически отделенному образующему аэрозоль материалу, который может быть расположен внутри, вокруг или после источника тепла. Бездымные табачные продукты и различные табак-содержащие, образующие аэрозоль материалы могут содержать табак в любой форме, включая сухие частицы, куски, гранулы, порошки или взвесь, расположенные на, перемешанные в, окруженные или иначе скомбинированные с другими ингредиентами в любом формате, таком как чешуйки, пленки, пластинки, пенки или гранулки. Применяемый в настоящем документе термин 'дым' используют для описания типа аэрозоля, который получают с помощью курительных устройств, таких как сигареты, или в результате сжигания образующего аэрозоль материала. В соответствии с одним вариантом осуществления настоящее изобретение также относится к высушенному материалу из описываемых в настоящем документе мутантных, трансгенных и не встречающихся в природе табачных растений. Способы сушки зеленых табачных листьев известны специалистам в данной области и включают без ограничения теневую сушку, огневую сушку, дымовую сушку и солнечную сушку. Способ сушки зеленых табачных листьев зависит от типа собираемого табака. Например, табак Virginia flue (bright) обычно подвергают дымовой сушке, Burley и некоторые темные линии обычно подвергают теневой сушке, а трубочный табак, жевательных табак и нюхательный табак обычно подвергают огневой сушке.

В соответствии с другим вариантом осуществления настоящее изобретение относится к табачным продуктам, включающим табак-содержащие образующие аэрозоль материалы, содержащие листья, предпочтительно высушенные листья, описанных в настоящем документе мутантных табачных растений, трансгенных табачных растений или не встречающихся в природе табачных растений. Описанные в настоящем документе табачные продукты могут представлять собой смешанный табачный продукт, который может дополнительно содержать немодифицированный табак.

% каротиноида или бета-дамасценона или % каротиноида и бета-дамасценона в этих табачных изделиях и бездымных продуктах и аэрозолях из них могут быть по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% и 100% или более, к примеру 200% или 300% или более, выше по сравнению с немутантными, не встречающимися в природе или нетрансгенными аналогами.

% каротиноида, или % бета-дамасценона, или % каротиноида и бета-дамасценона в этих табачных изделиях и бездымных продуктах и аэрозолях из них могут быть по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% и 100% ниже по сравнению с немутантными, не встречающимися в природе или нетрансгенными аналогами.

Мутантные, не встречающиеся в природе или трансгенные растения могут находить иное применение, например, в сельском хозяйстве. Например, описанные в настоящем документе мутантные, не встречающиеся в природе или трансгенные растения можно применять для получения животных кормовых продуктов или продовольственных продуктов для людей.

Настоящее изобретение также относится к способам получения семян, включающим культивирование описанных в настоящем документе мутантного растения, не встречающегося в природе растения или трансгенного растения и сбор семян с культивируемых растений. Семена с описанных в настоящем документе растений можно кондиционировать и упаковать в упаковочный материал с помощью известных в данной области средств с получением готового изделия. Упаковочный материал, такой как бумага и ткань, хорошо известны из уровня техники. Упаковка семени может иметь этикетку, например, ярлык или этикетку, прикрепленные к упаковочному материалу, напечатанную на упаковке этикетку, на которой описана природа находящихся в ней семян.

В соответствии со следующим аспектом настоящее изобретение относится к способу получения бета-дамасценона, включающему следующие стадии: (а) получение части мутантного, не встречающегося в природе или трансгенного растения; биомассы, семени или листьев; или табачного продукта, которые описаны в настоящем документе; и (b) их нагрев.

Композиции, способы и наборы для генотипирования растений для выявления, отбора или селекции могут включать средства определения наличия полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них) в образце с полинуклеотидом. Соответственно, описана композиция, содержащая один или несколько праймеров (например, один или несколько праймеров или зондов, включающих, содержащих или фактически состоящих из последовательности, изложенной в SEQ ID NO: 3-5, 10-12 или 14-16) для специфичной амплификации по меньшей мере части одного или нескольких полинуклеотидов и необязательно один или несколько зондов и необязательно один или несколько реактивов для проведения амплификации или определения.

Соответственно, раскрыты геноспецифичные олигонуклеотидные праймеры или зонды, содержащие приблизительно 10 или более смежных полинуклеотидов, соответствующих полинуклеотиду NtABA4, или NtNeSy, или NtNCED2. Указанные праймеры или зонды могут содержать, или состоять из них, приблизительно 15, 20, 25, 30, 40, 45 или 50 или более смежных нуклеотидов, которые гибридизируются (например, специфично гибридизируются) с полинуклеотидом NtABA4, или NtNeSy, или NtNCED2. В соответствии с некоторыми вариантам осуществления праймеры или зонды могут содержать приблизительно 10-50 смежных нуклеотидов, приблизительно 10-40 смежных нуклеотидов, приблизительно 10-30 смежных нуклеотидов или приблизительно 15-30 смежных нуклеотидов, или состоять из них, которые можно применять в зависимых от последовательности способа выявления гена (например, гибридизация по Саузерну), или выделения (например, гибридизация in situ бактериальных колоний или бляшек бактериофага), или определения гена (например, в качестве одного или нескольких праймеров для амплификации при амплификации или определении нуклеиновой кислоты). Один или несколько специфических праймеров или зондов можно сконструировать и применять для амплификации или определения части или всего полинуклеотида NtABA4, или NtNeSy, или NtNCED2. К примеру, два праймера можно применять согласно протоколу полимеразной цепной реакции для амплификации фрагмента нуклеиновой кислоты, кодирующего нуклеиновую кислоту NtABA4, или NtNeSy, или MNCED2, такую как ДНК или РНК. Полимеразную цепную реакцию также можно проводить с применением одного праймера, который получен из последовательности нуклеиновой кислоты NtABA4, или NtNeSy, или NtNCED2, и второго праймера, который гибридизируется с последовательностью, лежащей выше или ниже последовательности нуклеиновой кислоты NtABA4, или NtNeSy, или NtNCED2, такой как промоторная последовательность NtABA4, или NtNeSy, или NtNCED2, находящаяся на З'-конце мРНК-предшественника или последовательности, полученной с вектора. Примеры тепловых и изотермических методик, пригодных для амплификации in vitro полинуклеотидов, хорошо известны из уровня техники. Образец может представлять собой растение, растительную клетку или растительный материал, или может быть получен из них, или табачный продукт, созданный или полученный из описанного в настоящем документе растения, растительной клетки или растительного материала.

Согласно следующему аспекту настоящее изобретение также относится к способу определения полинуклеотида NtABA4, или NtNeSy, или NtNCED2 (или комбинации из двух или более или трех или более из них) в образце, включающему следующие стадии: (а) получение образца, содержащего полинуклеотид, или с подозрением на содержание полинуклеотида; (b) осуществление контакта указанного образца с одним или несколькими праймерами или одним или несколькими зондами для специфичного определения по меньшей мере части полинуклеотида(полинуклеотидов); и (с) определение наличия продукта амплификации, причем наличие продукта амплификации указывает на наличие в образце полинуклеотида(полинуклеотидов). Согласно следующему аспекту настоящее изобретение относится к применению одного из нескольких праймеров или зондов для специфического определения по меньшей мере части полинуклеотида(полинуклеотидов). Также настоящее изобретение относится к наборам для определения по меньшей мере части полинуклеотида(полинуклеотидов), которые содержат один из нескольких праймеров или зондов для специфического определения по меньшей мере части полинуклеотида(полинуклеотидов). Набор может содержать реактивы для амплификации полинуклеотида, такой как ПЦР, или реактивы для методики определения по гибридизации зонда, такой как саузерн-блоттинг, нозерн-блоттинг, гибридизация или анализ с использованием микрочипа. Набор может содержать реактивы для методики определения по связыванию антител, такой как вестерн-блоттинг, разновидности ELISA, SELDI- масс-спектрометрия или тестовые полоски. Набор может содержать реактивы для секвенирования ДНК. Набор может содержать реактивы и инструкции для определения содержания каротиноидов (например, лютеина или бета-каротина или лютеина и бета-каротина) и бета-дамасценона или содержания бета-дамасценона. Набор может содержать реактивы и инструкции для определения содержания каротиноидов (например, лютеина или бета-каротина или лютеина и бета-каротина) и бета-дамасценона или содержания бета-дамасценона.

Согласно некоторым вариантам осуществления набор может содержать инструкции для одного или нескольких описанных способов. Описанные наборы могут быть пригодны для определения генетической идентичности, филогенетических исследований, генотипирования, гаплотипирования, анализа генеалогии или селекции растений, в частности, с кодоминантной оценкой. Настоящее изобретение также относится к способу генотипирования растения, растительной клетки или растительного материала, содержащих описанных в настоящем документе полинуклеотид. Генотипирование обеспечивает средства определения различия гомологов хромосомной пары и его можно применять для установления различий среди сегрегантов в популяции растений. Способы молекулярных маркеров можно применять для филогенетических исследований, характеристики генетических связей среди сортов культурных растений, выявления результатов скрещиваний или соматических гибридов, локализации хромосомных сегментов, затрагивающих моногенные признаки, клонирования по данным карты и исследования наследственности количественных признаков. Конкретный способ генотипирования может включать любое число аналитических методик с молекулярными маркерами, в том числе полиморфизмы длин амплифицированных фрагментов (AFLP). AFLP являются продуктом аллельных различий среди амплифицированных фрагментов, обусловленных вариабельностью нуклеотидной последовательности. Таким образом, настоящее изобретение дополнительно относится к средствам отслеживания сегрегации одного или нескольких генов или нуклеиновых кислот, а также хромосомных последовательностей, генетически связанных с этими генами или нуклеиновыми кислотами, с применением таких методик как анализ AFLP.

В соответствии с одним вариантом осуществления настоящее изобретение также относится к высушенному материалу из описываемых в настоящем документе мутантных, трансгенных и не встречающихся в природе растений. Например, способы сушки зеленых табачных листьев известны специалистам в данной области и включают без ограничения теневую сушку, огневую сушку, дымовую сушку и солнечную сушку. Способ сушки зеленых табачных листьев зависит от типа собираемого табака. Например, табак Virginia flue (bright) обычно подвергают дымовой сушке, Burley и некоторые темные линии обычно подвергают теневой сушке, а трубочный табак, жевательных табак и нюхательный табак обычно подвергают огневой сушке.

В соответствии с другим вариантом осуществления настоящее изобретение относится к табачным продуктам, в том числе табачным продуктам, содержащим листья, предпочтительно высушенные листья, от описанных в настоящем документе мутантных, трансгенных и не встречающихся в природе растений, или которые получены с помощью описанных в настоящем документе способов. Описанные в настоящем документе табачные продукты могут дополнительно содержать немодифицированный табак. В соответствии с другим вариантом осуществления настоящее изобретение относится к табачным продуктам, содержащим растительный материал, предпочтительно листья, такие как высушенные листья, от описанных в настоящем документе мутантных, трансгенных и не встречающихся в природе растений. Например, растительный материал можно добавить внутрь или снаружи табачного продукта, и таким образом при сжигании будет высвобождаться необходимый аромат. Табачный продукт согласно такому варианту осуществления может даже быть немодифицированным табаком или модифицированным табаком. Табачный продукт согласно такому варианту осуществления можно даже получить от мутантного, трансгенного или не встречающегося в природе растения, которое имеет модификации в одном или нескольких генах, отличных от раскрываемых в настоящем документе генов.

Следующий аспект относится к выделенному полинуклеотиду, содержащему, последовательность, кодирующую ликопин-бета-циклазу и имеющую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 8, или состоящему или фактически состоящему из нее. Следующий аспект относится к выделенному полипептиду, кодируемому таким полинуклеотидом. Следующий аспект относится к выделенному полипептиду по меньшей мере с 87% идентичности последовательности с SEQ ID NO: 9. Следующий аспект относится к конструкту, вектору или вектору экспрессии, содержащему выделенный полинуклеотид. Следующий аспект относится к мутантной, не встречающейся в природе или трансгенной растительной клетке, содержащей выделенный полинуклеотид, полипептид или конструкт, вектор или вектор экспрессии, и у которой экспрессия или активность ликопин-бета-циклазы изменена по сравнению с контрольным растением или растением дикого типа, предпочтительно, у которого также изменена экспрессия или активность неоксантин-синтазы или 9-цис-эпоксикаротиноиддиоксигеназы или неоксантин-синтазы и 9-цис-эпоксикаротиноиддиоксигеназы. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению, содержащему указанную растительную клетку. Следующий аспект относится к способу изменения содержания каротиноидов у растения, включающему следующие стадии: (i) изменение экспрессии или активности ликопин-бета-циклазы у растения, предпочтительно, причем ликопин-бета-циклаза охватывает описанную в настоящем документе полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания каротиноидов по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было модфицировано по сравнению с контрольным растением, у которого не была изменена экспрессия или активность ликопин-бета-циклазы. В соответствии с одним вариантом осуществления также изменяют экспрессию или активность ликопин-бета-циклазы или 9-цис-эпоксикаротиноиддиоксигеназы; и ликопин-бета-циклазы и 9-цис-эпоксикаротиноиддиоксигеназы. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению или растительному материалу, который происходит или может происходить от них и который получен или можно получить с помощью такого способа. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению, у которого экспрессия ликопин-бета-циклазы или активность кодируемого в нем белка была повышена; причем содержание лютеина в зеленом листе или содержание бета-каротина или объединенное содержание у растения выше, чему у контрольного растения, у которого не была повышена экспрессия или активность ликопин-бета-циклазы, предпочтительно, причем: (i) содержание лютеина в зеленом листе растения составляет по меньшей мере приблизительно 17 мг / 100 г (например, по меньшей мере приблизительно 17,5 мг / 100 г; по меньшей мере приблизительно 18 мг / 100 г, по меньшей мере приблизительно 18,5 мг / 100 г или по меньшей мере приблизительно 19 мг / 100 г) и (ii) содержание бета-каротина у растения составляет по меньшей мере приблизительно 10 мг / 100 г (например, по меньшей мере приблизительно 10,5 мг / 100 г; по меньшей мере приблизительно 11 мг / 100 г, по меньшей мере приблизительно 11,5 мг / 100 г или по меньшей мере приблизительно 12 мг / 100 г). Следующий аспект относится к растительному материалу, в том числе биомассе, семени или листьям, содержащим клетки или ткань растения. Следующий аспект относится к табачному продукту, содержащему растительные клетки, по меньшей мере часть растения или растительного материала. Следующий аспект относится к выделенному полинуклеотиду, содержащему последовательность, кодирующую 9-цис-эпоксикаротиноиддиоксигеназу и обладающую по меньшей мере 60% идентичности последовательности с SEQ ID NO: 13, или состоящему или фактически состоящему из нее. Следующий аспект относится к выделенному полипептиду, кодируемому таким полинуклеотидом. Следующий аспект относится к конструкту, вектору или вектору экспрессии, содержащему выделенный полинуклеотид. Следующий аспект относится к мутантной, не встречающейся в природе или трансгенной растительной клетке, содержащей выделенный полинуклеотид, полипептид или конструкт, вектор или вектор экспрессии, и у которой экспрессия или активность 9-цис-эпоксикаротиноиддиоксигеназы изменена по сравнению с контрольным растением или растением дикого типа, предпочтительно, у которой также изменена экспрессия или активность неоксантин-синтазы или ликопин-бета-циклазы; или неоксантин-синтазы и ликопин-бета-циклазы. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению, содержащему указанную растительную клетку. Следующий аспект относится к способу изменения содержания каротиноидов у растения, включающему следующие стадии: (i) изменение экспрессии или активности 9-цис-эпоксикаротиноиддиоксигеназы у растения, предпочтительно, причем 9-цис-эпоксикаротиноиддиоксигеназа охватывает описанную в настоящем документе полинуклеотидную последовательность или полипептидную последовательность; (ii) измерение содержания каротиноидов по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (i); и (iii) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого содержание каротиноидов в нем было модфицировано по сравнению с контрольным растением, у которого не была изменена экспрессия или активность 9-цис-эпоксикаротиноиддиоксигеназы. В соответствии с одним вариантом осуществления также изменяют экспрессию или активность неоксантин-синтазы или ликопин-бета-циклазы; и неоксантин-синтазы и ликопин-бета-циклазы. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению или растительному материалу, который происходит или может происходить от них и который получен или можно получить с помощью такого способа. Следующий аспект относится к мутантному, не встречающемуся в природе или трансгенному растению, у которого экспрессия 9-цис-эпоксикаротиноиддиоксигеназы или активность кодируемого в нем белка была повышена; причем содержание лютеина в зеленом листе или содержание бета-каротина или объединенное содержание у растения выше, чему у контрольного растения, у которого не была повышена экспрессия или активность 9-цис-эпоксикаротиноиддиоксигеназы, предпочтительно, причем: (i) содержание лютеина в зеленом листе растения составляет по меньшей мере приблизительно 15 мг / 100 г (например, по меньшей мере приблизительно 15,5 мг / 100 г; по меньшей мере приблизительно 16 мг / 100 г, по меньшей мере приблизительно 16,5 мг / 100 г или по меньшей мере приблизительно 17 мг / 100 г); и (ii) содержание бета-каротина у растения составляет по меньшей мере приблизительно 11 мг / 100 г (например, по меньшей мере приблизительно 11,5 мг /100 г; по меньшей мере приблизительно 12 мг / 100 г, по меньшей мере приблизительно 12,5 мг / 100 г или по меньшей мере приблизительно 13 мг / 100 г). Следующий аспект относится к растительному материалу, в том числе биомассе, семени или листьям, содержащим клетки или ткань растения. Следующий аспект относится к табачному продукту, содержащему растительные клетки, по меньшей мере часть растения или растительного материала.

Настоящее изобретение дополнительно описано в Примерах ниже, которые приведены для более подробного описания настоящего изобретения. Эти примеры, в которых изложен предпочтительный способ, рассматриваемый в настоящий момент для осуществления настоящего изобретения, предназначены для иллюстрации, а не ограничения настоящего изобретения.

Примеры

Пример 1: клонирование АВА4 из Nicotinia tabacum

Эктопически клонировали кодирующую последовательность Nicotinia tabacum, гомологичную АВА4. Ген называли Nicotinia tabacum АВА4 (NtABA4), исходя из гомологий последовательности с A. thaliana АВА4. NtABA4 представляет собой ген, принадлежащий к обширному "семейству" неоксантин-синтаз, которые катализируют образование транс-неоксантина из виолаксантина. Очень вероятно, что генный продукт будет локализироваться в пластидах по аналогии с AtABA4 и согласно анализам WoLFPSORT. Кодирующую последовательность полной длины из 663 т.о. выявляли и амплифицировали с помощью кДНК К326 листа в качестве ПЦР-матрицы, клонировали в вектор pENTR Gateway (Invitrogen), секвенировали и переносили в pK2WG7 (вектор Gateway, полученный от Межуниверситетсткого института биотехнологии Фландрии (Flanders Interuniversity Institute for Biotechnology), Гент, Бельгия) для конститутивной экспрессии в Nicotinia tabacum. Нуклеотидная и аминокислотная последовательности NtАВА4 изложены в SEQ ID NO: 1 и SEQ ID NO: 2, соответственно, и на фигуре 2. У NtАВА4 наблюдали 65% идентичности на аминокислотном уровне с белком Arabidopsis AtABA4, Atlg67080. ПЦР-амплификация, начинавшаяся от гДНК из Hicks Broadleaf в качестве матрицы, позволяла нам выявить гомолог NtABA4 с 1808 п.о. Путем сравнения последовательностей кДНК и гДНК был сделан вывод о генной структуре, демонстрирующей, что NtАВА4 обладал 4 нитронами и 5 экзонами (фигура 3А). Существуют различия между изоформами К326 и Hicks BL NtАВА4 (Фигура 3В). Аминокислотная последовательность NtABA4 из Hicks Broadleaf обладала 97% идентичности с последовательностью К326, что было результатом отличия по 6 аминокислотам и одного пропущенного серина в положении 9 (фигура 3С). Согласно результатам сравнения маркерных экспрессируемых последовательностей геномная последовательность NtАВА4 не была псевдогеном, поскольку экспрессируемая маркерная последовательность (АМ824569) с идентичными признаками на N-конце была выявлена в библиотеке связанных с Холодовым стрессом последовательностей в NCBI у табака SNN. Для конструирования табака использовали цДНК-последовательность К326 NtАВА4 и конститутивно экспрессировали в TN90 под контролем сильного вирусного промотора CaMV35S.

Пример 2: клонирование неоксантин-синтазы (NeSy) из Nicotinia tabacum

NeSy (ликопин-бета-циклаза), как и АВА4, катализирует образование неоксантина (цис-неоксантина) из виолаксантина (см. фигуру 1). Вероятно, что такой фермент локализируется в пластидах (исходя из гомологии с NeSy Arabadopsis thaliana). Начиная с последовательности, доступной в базе данных TGI, кодирующую последовательность полной длины из 1482 т. о. (см. фигуру 4) амплифицировали из РНК К326, клонировали в вектор pENTR Gateway (Invitrogen), секвенировали и субклонировали в вектор pK2WG7 Gateway (полученный от Межуниверситетсткого института биотехнологии Фландрии, Гент, Бельгия) для сверхэкспрессии. Выявляли ВАС-клон. Из геномной последовательности, присутствовавшей на этом ВАС-клоне, было видно, что NtNeSy не имел интрона в геномной структуре и очень вероятно, что представлял собой однокопийный ген табака. КДНК К326 NtNeSy конститутивно экспрессировали в TN90 под контролем промотора CaMV35S для сравнения с растениями 35S::NtАВA4.

Пример 3: клонирование 9-цис-эпоксикаротиноиддиоксигеназы (CED2) из Nicotinia tabacum

CED2 (9-цис-эпоксикаротиноиддиоксигеназа) катализирует расщепление цис-неоксантина до С25-алленового-апо-альдегида и ксантоксина (см. фигуру 1). NtCED2 имеет высокую гомологию с AtNCED4, Arabidopsis, который присутствует в пластоглобулах и, по-видимому, расщепляет неоксантин в хлоропласте листа. Фрагмент кДНК табака выявляли в базе данных TGI. Исходя из этого, частичную последовательность (407 п.о.) клонировали в вектор pENTR Gateway (Invitrogen), секвенировали и субклонировали в вектор pK7GWIWG2(II) Gateway, полученный от Межуниверситетсткого института биотехнологии Фландрии, Гент, Бельгия. В этом случае, фрагмент NtCED2 экспрессировался в виде РНК-шпильки в табачных растениях, индуцируя генный сайленсинг соответствующего эндогенного транскрипта NtCED2 (фигура 5).

Пример 4: конструирование табака TN90 Burley с кДНК NtABA4

Бинарную плазмиду pK2WG7, несущую кодирующую последовательность NtABA4, (фигура 2) получали для сверхэкспрессии такого гена у Nicotinia tabacum. Такой вектор включал промотор CaMV 35S вируса мозаики цветной капусты выше трансгена, управляющего его конститутивной экспрессией во всех тканях растения и гена kan/nptll, для отбора с помощью канамицина (антибиотика) трансгенных линий Nicotinia tabacumm. агаровых пластинках (100 мг/мл). Табак TN90 Burley трансформировали таким конструктом с помощью Agrobacterium tumefaciens с применением классической процедуры с листовыми дисками. Из каллусов получали отдельные линии и проводили отбор на канамицине. ТО сверхэкспрессирующие линии затем отслеживали с помощью ПЦР по геномной ДНК с применением одного праймера в промоторе 35 S (5'- GAG CATC GTG G A AAA AG A AG AC) и одного праймера в кодирующей последовательности NtABA4, специфически определяющего трансгенную копию NtABA4, с помощью RT-PCR с применением специфических праймеров NtABA4. TI семена собирали, повторно проращивали на содержащих канамицин агаровых пластинках и отслеживали так же как и для ТО ростков. ПЦР на гДНК показывала, что Т-ДНК, несущая кДНК NtABA4, была вставлена в геном отобранных линий, a RT-PCR анализ позволял выявить три линии, в которых ген сверхэкспрессировался. Устойчивые к канамицину растения затем выращивали в плавучих лотках перед культивированием в поле. Двадцать растений из трех линий NtABA4 (NtABA4-l, NtABA-2 и NtABA-3), векторный контроль (VC, пустой pK7GWIWG2(II)) и табак с фоном TN90 US культивировали в четырех повторностях по 20 растений. Через три месяца после пересадки в поле (36 дней после прищипывания верхушек) один лист в среднем по стеблю положении забирали у 10 идентичных растений из 20 растений в части делянки, представляющей собой одну экспериментальную повторность. Эти листья ("зеленые листья") сразу помещали на хранение в сухой лед и лиофилизировали. У растений 35S::NtABA4 не наблюдали какое-либо визуальное отличие фенотипов от растений TN90 и VC спустя два месяца в поле. Наряду с теми же линиями, анализ высоты растения и содержания хлорофилла показывал, что трансгенные линии 35S::NtABA4 были похожи на контроли TN90 и VC, что позволяло сделать вывод, что сверхэкспрессия NtABA4 не оказывала видимое влияние на фенотипические свойства. Оставшийся листовой материал 10 отобранных растений на часть делянки и линию отбирали и сушили согласно практическим сельскохозяйственным методам для Burley.

После сушки забирали три листа в среднем по стеблю положении. Для отслеживания влияния повышенной экспрессии NtABA4 у трех трансгенных линий (NtABA4-l, NtABA4-2 и NtABA4-3) "зеленые листья" и "высушенные листья" измельчали и подвергали анализу на каротиноиды.

Пример 5: анализы на каротиноиды у зеленых и высушенных листьев трансгенных линий 35S::NtABA4

У "зеленых листьев" количественные анализы каротиноидов не были возможны для всех ксантофиллов по причине технических ограничений, особенно для количественного определения неоксантина (низких концентраций у Nicotinia tabacum и плохого аналитического разделения). Полагали, что пул неоксантина (исходя из результатов полуколичественных анализов, данные не показаны) имел схожую тенденцию с содержанием лютеина (а также бета-каротина с меньшей степенью) у TN90, VC, NtABA4-l, NtABA4-2 и Nt-ABA4-3. Два последних пигмента использовали в качестве репрезентативных показателей концентраций других каротиноидов (ксантофиллов) в зеленых листьях. В отличии от этого, в увядших и высушенных листьях такие допущения на рассматривали, поскольку известно, что пул неоксантина быстро и полностью распадается. Анализ каротиноидов проводили с применением классического способа HPLC и видимого определения, у сверхэкспрессирующих линий NtABA4 было показано, что лютеин был значимо повышен у линий NtABA4-2 и NtABA4-3 по сравнению с диким типом и векторным контролем. Сверхэкспрессия NtABA4 приводила к повышению лютеина в листе на 30% и 26% у линий NtABA4-2 и NtABA4-3, соответственно, по сравнению с линиями TN90 и векторными контрольными фоновыми линиями. В дополнение к этому, бета-каротин также был значимо выше у линий NtABA4 (приблизительно на 15% ) по сравнению с TN90 дикого типа. Из этих данных видно, что сверхэкспрессия NtABA4 оказывала общий повышающий эффект на содержание каротиноидов. Повышение каротиноидов в линиях трансгенных растений было значимым (Р<0,05; Т-критерий).

Анализ каротиноидов высушенных листьев в целом показывал снижение пулов лютеина и бета-каротина по сравнению с зелеными листьями. 87-95% присутствовавших в образцах зеленых листьев лютеина и бета-каротин распадались при сушке у всех линий дикого типа, векторного контроля и трансгенной линии 35S::NtABA4. Это позволяло предположить, что эти каротиноиды подвергались активным ферментативным или химическим модификациям в ходе сушки. Наличие больших отклонений у каждого набора высушенных образцов указывало, что катаболизм каротиноидов в ходе сушки является менее "контролируемым" и однородным процессом в отличии от синтеза каротиноидов в зеленых листьях. Анализ с Т-критерием показывал, что содержание лютеина значимо отличается при сравнении со следующими линиями: NtABA4-2 выше, чем TN90 (Р<0,0011) и векторного контроля (Р<0,05); векторный контроль выше, чем TN90 (Р<0,05), и NtABA4-l выше, чем TN90 (Р<0,05). Содержание бета-каротина выше у векторного контроля (Р<0,05) и NtABA4-l (ΡΟ,ΟΙ I) по сравнению с TN90.

Пример 6: анализ каротиноидов отобранных линий 35S::NeSy и с NtCED2-интерферирующей РНК

Как описано для 35S::NtABA4, трансформированные 35S::NtNeSy и с NtNCED2-интерферирующей РНК линии отбирали по результатам генотипирования и RT-PCR. В результате, две линии 35S::NtNeSy- и три с NtNCED2-интерферирующей РНК выявляли и высаживали в четырех повторностях в одно время и в одном поле. Содержание основных каротиноидов (лютеина и бета-каротина) определяли у линий с NCED2-интерферирующей РНК и 35S::NtNeSy линий. Как у линий с NCED2-интерферирующей РНК, так и у линий 35S::NtNeSy наблюдали повышение основных каротиноидов в зеленых листьях, что подтверждало, что такие два гена-кандидата для трансформации растений затрагивали метаболизм каротиноидов в листе табака. Однако, при сравнении всех отобранных трансгенных линий, сверхэкспрессия NtABA4 оказывалась наиболее эффективной для достижения общего повышения каротиноидов в зеленых листьях.

Собранный листовой материал подвергали теневой сушке с целью подтверждения, что наблюдаемые модификации содержания каротиноидов приводят к измененным количествам бета-дамасценона, получаемым в соответствующем аэрозоле. Для отбора наиболее перспективных высушенных образцов выбирали образцы/линии с наиболее сильными модификациями содержания лютеина, бета-каротина и неоксантина (полуколичественные данные) в зеленых листьях. Этими образцами/линиями были NtNeSy-1_2, NtABA4-2_2 и с NtNCED2-интерферирующей PHK-I 4, соответственно (фигура 6). В этом случае делали предположение, что неоксантин или возможно другие каротиноиды, которые накапливались в зеленых листья, превращались в высушенных листьях в бета-дамасценон-глюкозид или другие предшественники бета-дамасценона, которые затем высвобождались при нагревании.

Пример 7: анализ бета-дамасценона в отобранных трансгенных линиях

Для анализа содержания бета-дамасценона в аэрозоле, образованном после нагревания высушенного табака линий-образцов TN90-4 (контроль), NtNeSy-1_2, NtABA4-2_2 и с NtNCED2-интерферирующей PHK-I 4, создавали аэрозоли из пропитанного скрошенного табака. Используемой платформой для курения был симулятор курения с источником тепла NHS (54 Вт), включающий режим 12 коротких дуновений по 2 секунды каждое. Перед курением высушенный лист табака разрезали и пропитывали 20% глицерином. Аэрозоли, получаемые в результате нагревания разновидностей пропитанного высушенного табака (100 мг, 3 полные повторности) отлавливали в набивку фильтра Cambridge. Набивки вносили в сосуд, содержавший 10 мл воды/ЕtOН (9/1, объем/объем). Бета-дамасценон экстрагировали с помощью сорбционного способа экстракции с магнитной мешалкой (который описан в работе Lanças et al. (2009) J. Sep. Sci. 32, 813-824). Этот способ позволяет экстрагировать химические соединения, которые характеризуются аффинностью к адсорбционой фазе. Содержимое магнитной мешалки термически десорбировали в GC-MS инжекторе и анализировали в отношении бета-дамасценона. По сравнению с TN90 (контроль) у образца NtABA4-2_2 наблюдали 68% повышение бета-дамасценона в аэрозоле (фигура 7). Разница была статистически релевантной (Р<0,01, Т-критерий). Эти результаты позволяли предположить, что пул предшественника(предшественников) бета-дамасценона в высушенных листьях повышался в результате эктопической экспрессии NtABA4, в то время как влияние двух других целевых генов, NtNeSy (сверхэкспрессия) и NtNCED2 (сайленсинг с помощью интерферирующей РНК) было сходным с TN90 контролем. Таким образом, сверхэкспрессия NtABA4, а не инженерия с NtNeSy или NtNCED, в табачных листьях, по-видимому приводила к повышенной выработке предшественника(предшественников) бета-дамасценона.

В любой процитированной или описанной в настоящем документе публикации приведена релевантная информация, раскрытая до дня подачи настоящей заявки. Приведенные в настоящем документе утверждения не следует истолковывать как признание того, что авторы имеют право противопоставлять такие раскрытия. Все упомянутые в приведенном выше описании публикации включены в настоящий документ с помощью ссылки. Специалистам в данной области будут очевидны различные модификации и варианты настоящего изобретения без отступления от объема и идеи настоящего изобретения. Несмотря на то, что настоящее изобретение было описано в связи с конкретными предпочтительными вариантами осуществления, следует понимать, что заявляемое настоящее изобретение не следует излишне ограничивать такими конкретными вариантами осуществления. Фактически, различные модификации описанных способов осуществления настоящего изобретения, которые очевидны для специалистов в области клеточной, молекулярной биологии и биологии растений или смежных областей, предусмотрены в объеме приведенной далее формулы изобретения.

Последовательности

SEQ ID NO: 1 (нуклеотидная последовательность АВА4 из Nicotiana tabacum К326)

atgtcactttcttttaattcttcttgtttttgttcccctcttaataagtcaagtatggactt ctcttcttcttgctt

ctgctactctcacatctcactcaagatgaactgcagggcacctgccttgatgtccaggagaa accagcctacctctt

atacttttctagaaaagaattctgacattgtaaatcaacaagtagtggaattcggaaccaag tttagaagtggagcg

aatttcctgggaggatcaagagtcattattcaacttaatcttcaaacaactcttgctcaaag aaaaagctccagggt

gactgcttgtttgccaagttctgaaattgcttctactgttttcacactgggaacagcagcag ttcttccgttttata

ctctcatggttgtggctcctaaaactgaacttaccagaaaagtgatgaaaagcagcataccc aatattggctttgga

cttctgtacacatatctagtatacctctcttggacaccagatacagttcggctgatgtttgc tagtaaatactggct

tccggagctgcccggcataactaagatgttctccaacgagatgacattagcttctgcatgga ttcacttgttggctg

tagatctttttgctgcaaggcaggtttatcatgatggattgcaaaatgatattgaaacccgc cattctgtgtctctg

tgcttgctgttttgccccgtcggaattgttactcacttcatcaccaaagctctagccagtag cccagaaaagagaca gcataggactcattaa

SEQ ID NO: 2 (аминокислотная последовательность ABA4 из Nicotiana tabacum K326)

MSLSFNSSCFCSPLNKSSMDFSSSCFCYSHISLKMNCRAPALMSRRNQPTSYTFLEKNSDIV NQQWE FGTKFR

SGANFLGGSRVIIQLNLQTTLAQRKSSRVTACLPSSEIASTVFTLGTAAVLPFYTLMWAPKT ELTRKVMKSSI

PNIGFGLLYTYLVYLSWTPDTVRLMFASKYWLPELPGITKMFSNEMTLASAWIHLLA^LFA ARQVYHDGLQND IETRHSVSLCLLFCPVGIVTHFITKALASSPEKRQHRTH

SEQ ID NO: 3 (нуклеотидная последовательность прямого праймера, используемого для амплификации NtABA4 из К326 Nicotiana tabacum, с последовательностью сасс в праймере для клонирования)

caccatgtcactttcttttaattcttcttgt

SEQ ID NO: 4 (нуклеотидная последовательность прямого праймера, используемого для амплификации NtABA4 из К326 Nicotiana tabacum, без последовательности сасс в праймере для клонирования) atgtcactttcttttaattcttcttgt

SEQ ID NO: 5 (нуклеотидная последовательность обратного праймера, используемого для амплификации NtABA4 из К326 Nicotiana tabacum) ttaatgagtcctatgctgtctcttttc

SEQ ID NO: 6 (нуклеотидная последовательность ABA4 из Nicotiana tabacum, Hicks Broadleaf)

atgtcactttcttttaattcttcttcttgtttttgttcccctcttaataagtcaagtatgga cttctcttcttcttg

cttctgctactctcacatctcactcaagatgaactgcagggcacctgccttgatgtccagga gaaaccagcctacct

cttatacttttctagaaaagaattctgacattgtaaatcaacgagtagtggaattcagaacc aagtttagaagtgga

gcgaatttcctgggaggatcaagagtcattattcaacttaatcttcaaacaactcttgctca aagaaaaagctccag

ggtgactgcttgtttgccaagttctgaaattgcttctactgttttcacactgggaacagcag cggttcttccgtttt

atacactcatggtagtggctcctaaagctgaacttaccagaaaagtgatgaaaagcagcata ccctatattggcttt

ggacttctgtacacatatctagtatacctctcttggacaccagatacagttcggctgatgtt tgctagtaaatactg

gcttccggagctgcccggcataactaagatgttctccaacgagatgacattagcttctgcat ggattcacttgttgg

ccgtagatctttttgctgcaaggcaggtttatcatgatggattgcaaaatgatattgaaacc cgccattctgtgtct

ctgtgcttgctgttttgccccttcggaattgttactcacttcatcaccaaagctctaaccag tagcccagaaaagag acagcataggactcattaa

SEQ ID NO: 7 (аминокислотная последовательность ABA4 из Nicotiana tabacum, Hicks Broadleaf)

MSLSFNSSSCFCSPLNKSSMDFSSSCFCYSHISLKMNCRAPALMSRRNQPTSYTFLEKNSDI VNQRWEFRTKFRSG

ANFLGGSRVIIQLNLQTTLAQRKSSRVTACLPSSEIASTVFTLGTAAVLPFYTLMWAPKAEL TRKVMKS SIPYIGF

GLLYTYLVYLSWTPDTVRLMFASKYWLPELPGITKMFSNEMTLASAWIHLLAVDLFAARQVY HDGLQNDIETRHSVS

LCLLFCPFGIVTHFITKALTSSPEKRQHRTH

SEQ ID NO: 8 (нуклеотидная последовательность NeSy из Nicotiana tabacum, K326)

atggaaactcttctcaaaccttttccatctcctttacttttcactcctacacctcacaggtc tatttttcaactgaa

ttctacttttctgaatccaaccacccagaacttttcaagaaaagttcatcgcagaaacaaaa gtagtagtaacaaat

tttgtagctttcttgacttagcacccacatcaaaaccagagtctttagatgttgacatctca tgggttgatcctaat

tcgggccgggctctattcgacgtgatcatcatcggagctggtcctgcgggcctccggctagc tgagcaagtatcaag

atatggtattaaggtatgttgtgttgacccttcaccactttccatgtggccaaataattatg gtgtttgggttgatg

agtttgagaagttaggattggaagattgtttagatcataagtggcctatgacttgtgttcat ataaatgataacaag

actaagtatttgggaagaccatatggtagagtcagtagaaaaaagttgaagttgaaattgtt gaatagttgtgttga

taatggagggaagttttataaagccaaggtttggaaagtggagcatgaagaatttgagtctt cagttgtttgtgatg

atggtaggaagataaggggtagtttgattgtagatgcaagtggttttgctagtccttttata gaatatgacaagcca

agaaaccatggttatcaaatagctcatgggattttagcacaagtggataatcatccatttga tttggataaaatggt

gcttatggattggagggattctcatctgggaaatgagccatatttgagggtgaacaatacta aagaaccaacattct

tgtatgtgatgccatttgataggaatttggtattcttggaagagacttctttggtgagtcgg cctgtgctatcgtat

agggaagtgaaaaataggatggtggcaaggttaaggcatttggggatcaaagtgacaagtgt tattgaggatgagaa

atgtgtgatccccatgggaggaccacttccgcggatccctcaaaatgttatggcaattggtg

gaaattcagggatag

ttcatccatcgacagggtacatggtggctcggagcatggcattggcaccagttttggctgag gccattgctgagagc

ctcggcacaaccagaatgataagaggatctccactttaccataaagtttggaatggtttgtg gcctctagagagaag

aagtgtgagagaatgttactcttttgggatggagactttgttgaagcttgatttgaaaggga ctaggagattgtttg

atgctttctttgatcttgatcccaaatactggcaagggttcctttcctcaaggttgtctgtc aaagaacttgctatg

cttagcttgtacctttttgggcatgcctcaaatttggctaggttggatattgttacaaaatg

cccggtgcccttggt

taaaatgatggaaatctag

SEQ ID NO: 9 (аминокислотная последовательность NeSy из Nicotiana tabacum, K326)

METLLKPFPSPLLFTPTPHRSIFQLNSTFLNPTTQNFSRKVHRRNKSSSNKFCSFLDLAPTS KPESLDVDISWVDPN

SGRALFDVIIIGAGPAGLRLAEQVSRYGIKVCCVDPSPLSMWPNNYGVWVDEFEKLGLEDCL DHKWPMTCVHINDNK

TKYLGRPYGRVSRKKLKLKLLNSCVDNGGKFYKAKVWKVEHEEFESSWCDDGRKIRGSLIVD ASGFASPFIEYDKP

RNHGYQIAHGIIAQVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNTKEPTFLYVMPFDRNLV FLEETSLVSRPVLSY

REVKNRMVARLRHLGIKVTSVIEDEKCVIPMGGPLPRIPQNVMAIGGNSGIVHPSTGYMVAR SMALAPVLAEAIAES

LGTTRMIRGSPLYHKVWNGLWPLERRSVRECYSFGMETLLKLDLKGTRRLFDAFFDLDPKYW QGFLSSRLSVKELAM LSLYLFGHASNLARLDIVTKCPVPLVKMMEI

SEQ ID NO: 10 (нуклеотидная последовательность прямого праймера, используемого для амплификации NeSy из К326 Nicotiana tabacum, с последовательностью сасс в праймере для клонирования) caccatggaaactcttctcaaaccttttc

SEQ ID NO: 11 (нуклеотидная последовательность прямого праймера, используемого для амплификации NeSy из К326 Nicotiana tabacum, без последовательности сасс в праймере для клонирования) atggaaactсttсtсааассttttс

SEQ ID NO: 12 (нуклеотидная последовательность обратного праймера, используемого для амплификации NeSy из К326 Nicotiana tabacum) ctagatttccatcattttaaccaag

SEQ ID NO: 13 (нуклеотидная последовательность NCED2 из Nicotiana tabacum) acacaagcttggctttattcggaggcaaactattcgctcttggtgaatctgatttaccgtat gcagtaaaattagcc

ccagatggtgatattattaccctcggccgttacgatttcgacggaaaacttttcatgagcat gacggcacatcccaa

aattgacccagatactaacgaggcttttgctttccgttacggtccaatgcctccttttttaa cttactttagaatcg

aaccaaatggtacaaaaacaccagacgtgccaatattttctatgacacgtccgtcatttctt catgactttgcaatt

acaaataaatttgcgatattctcggacatacaaataggaatgaacccacttgagttcatcac cggtggttcaccggt gagttcagactcggggaaaatc

SEQ ID NO: 14 (нуклеотидная последовательность прямого праймера, используемого для амплификации NCED2 из Nicotiana tabacum, с последовательностью сасс в праймере для клонирования) caccacacaagcttggctttattcg

SEQ ID NO: 15 (нуклеотидная последовательность прямого праймера, используемого для амплификации NCED2 из Nicotiana tabacum, без последовательности сасс в праймере для клонирования) acacaagcttggctttattcg

SEQ ID NO: 16 (нуклеотидная последовательность обратного праймера, используемого для амплификации NCED2 из Nicotiana tabacum) gattttccccgagtctgaact

1. Трансгенная растительная клетка табака, обладающая повышенной экспрессией или активностью неоксантин-синтазы по сравнению с клеткой растения табака дикого типа, содержащая:

(i) полинуклеотид, содержащий последовательность, кодирующую неоксантин-синтазу и имеющую по меньшей мере 90% идентичности последовательности с SEQ ID NO: 1 или SEQ ID NO: 6;

(ii) полипептид, кодируемый полинуклеотидом, изложенным в (i);

(iii) полипептид, обладающий по меньшей мере 90% идентичности последовательности с SEQ ID NO: 2 или по меньшей мере 90% идентичности последовательности с SEQ ID NO: 7 и имеющий активность неоксантин-синтазы; или

(iv) конструкт, вектор или вектор экспрессии, содержащий выделенный полинуклеотид, изложенный в (i),

и причем экспрессия или активность неоксантин-синтазы повышена по сравнению с растением дикого типа.

2. Трансгенное растение табака, обладающее повышенной экспрессией или активностью неоксантин-синтазы по сравнению с растением табака дикого типа, содержащее растительную клетку по п. 1.

3. Способ повышения содержания каротиноидов у растения табака, включающий следующие стадии:

(a) повышение экспрессии или активности неоксантин-синтазы у растения, предпочтительно, причем неоксантин-синтаза охватывает:

(i) полинуклеотид, содержащий последовательность, кодирующую неоксантин-синтазу и имеющую по меньшей мере 90% идентичности последовательности с SEQ ID NO: 1 или SEQ ID NO: 6;

(ii) полипептид, кодируемый полинуклеотидом, изложенным в (i); или

(iii) полипептид, обладающий по меньшей мере 90% идентичности последовательности с SEQ ID NO: 2 или по меньшей мере 90% идентичности последовательности с SEQ ID NO: 7 и имеющий активность неоксантин-синтазы;

(b) измерение содержания каротиноидов по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (а); и

(c) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого было повышено содержание каротиноидов в нем по сравнению с растением табака дикого типа, у которого экспрессия или активность неоксантин-синтазы не была повышена.

4. Способ по п. 3, где у растения также повышают экспрессию или активность ликопин-бета-циклазы или 9-цис-эпоксикаротиноиддиоксигеназы или их комбинации.

5. Способ по п. 4, где ликопин-бета-циклаза охватывает полинуклеотидную последовательность, изложенную в SEQ ID NO: 8, или обладает с ней по меньшей мере 90% идентичности последовательности, или полипептидная последовательность охватывает изложенную в SEQ ID NO: 9 или обладает с ней по меньшей мере 90% идентичности последовательности, и причем 9-цис-эпоксикаротиноиддиоксигеназа охватывает полинуклеотидную последовательность, изложенную в SEQ ID NO: 13, или обладает с ней по меньшей мере 90% идентичности последовательности.

6. Способ получения растения табака с повышенным содержанием бета-дамасценона по сравнению с растением табака дикого типа, у которого экспрессия или активность неоксантин-синтазы не была повышена, включающий следующие стадии:

(а) повышение экспрессии или активности неоксантин-синтазы у растения, предпочтительно, причем неоксантин-синтаза охватывает:

(i) полинуклеотид, содержащий последовательность, кодирующую неоксантин-синтазу и имеющую по меньшей мере 90% идентичности последовательности с SEQ ID NO: 1 или SEQ ID NO: 6;

(ii) полипептид, кодируемый полинуклеотидом, изложенным в (i), и имеющий активность неоксантин-синтазы; или

(iii) полипептид, обладающий по меньшей мере 90% идентичности последовательности с SEQ ID NO: 2 или по меньшей мере 90% идентичности последовательности с SEQ ID NO: 7;

(b) измерение содержания бета-дамасценона по меньшей мере в части мутантного, не встречающегося в природе или трансгенного растения, полученного на стадии (а), или его аэрозоле, полученном путем нагревания растения до 100°С или выше; и

(c) выявление мутантного, не встречающегося в природе или трансгенного растения, у которого было повышено содержание бета-дамасценона по сравнению с растением табака дикого типа, у которого экспрессия или активность неоксантин-синтазы не была повышена.

7. Трансгенное растение табака по п. 2, у которого экспрессия неоксантин-синтазы или активность кодируемого таким образом белка была повышена; причем содержание лютеина в зеленом листе или содержание бета-каротина или комбинированное содержание лютеина и бета-каротина растения является более высоким, чем в растении табака дикого типа, у которого экспрессия или активность неоксантин-синтазы не была повышена; и причем содержание бета-дамасценона в аэрозоле, полученном путем нагрева высушенного растительного материала до 100°С или выше, по меньшей мере на 10% выше, чем в аэрозоле, полученном путем нагрева растения дикого типа до 100°С или выше, предпочтительно, причем: (i) содержание лютеина в зеленом листе растения составляет по меньшей мере приблизительно 18 мг/100 г; (ii) содержание бета-каротина у растения составляет по меньшей мере приблизительно 12 мг/100 г и (iii) содержание бета-дамасценона в аэрозоле, полученном путем нагрева растения до 100°С или выше, составляет по меньшей мере приблизительно 1 нг/мг.

8. Растительный материал табака, обладающий повышенной экспрессией или активностью неоксантин-синтазы по сравнению с клеткой растения табака дикого типа, включающий биомассу, семя или листья растения по любому из пп. 2 или 7.

9. Табачная композиция, содержащая растительную клетку по п. 1, по меньшей мере часть растения по любому из пп. 2 или 7 или растительный материал по п. 8.



 

Похожие патенты:

Изобретение относится к области биотехнологии и биохимии, в частности к L-арабинозоизомеразе, обладающей увеличенной активностью превращения D-галактозы в D-тагатозу по сравнению с арабинозоизомеразой, содержащей замещение лейцина в положении 469 пролином, или арабинозоизомеразой дикого типа.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к рекомбинантной плазмидной ДНК pET31b-pHLIP. Указанная плазмидная ДНК кодирует аминокислотную последовательность рекомбинантного рН-зависимого встраивающегося пептида и обеспечивает его синтез в составе белка-слияния с кетостероидизомеразой.

Группа изобретений относится к области биотехнологии. Предложена клетка-хозяин для получения рекомбинантного полипептида, содержащая гетерологичную последовательность нуклеиновой кислоты, кодирующую протеазу Killer Expression (Kех2р), гетерологичную последовательность нуклеиновой кислоты, кодирующую протеин-дисульфидизомеразу (Pdi1), и нуклеиновую кислоту, кодирующую рекомбинантный полипептид.

Группа изобретений относится к вариантам дрожжевой клетки рода сахаромицетов, способной к размножению в аэробных условиях на субстрате, содержащем по меньшей мере один C5-сахар, и применению такой клетки.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к штамму Escherichia coli BL21(DE3)GoldpETCYPopti. Настоящий штамм является продуцентом рекомбинантного циклофилина А человека.

Изобретение относится к области биотехнологии и касается штамма Escherichia coli BL21(DE3)Gold/pETmin-CypA - продуцента рекомбинантного циклофилина А человека. Охарактеризованный штамм получен путем трансформации клеток штамма BL21(DE3)Gold плазмидой pETmin-CypA.

Изобретение относится к области биотехнологии. Представлен трансформированный микроорганизм - дрожжи Saccharomyces для получения этанола, где упомянутый микроорганизм трансформирован нуклеотидной последовательностью, кодирующей ксилозоизомеразу, и указанный микроорганизм трансформирован нуклеотидной последовательностью, кодирующей ксилулокиназу, или указанный микроорганизм трансформирован промотором, способным повышать экспрессию эндогенной ксилулокиназы.

Изобретение относится к области биохимии и биотехнологии и может быть использовано в растениеводстве. .

Изобретение относится к области биохимии, в частности к белку, придающему растению устойчивость к фенокси-ауксину, гену, кодирующему вышеуказанный белок, а также к экспрессионной кассете и вектору, содержащим вышеуказанный ген.

Изобретение относится к области биологии и медицины и предназначено для экспресс-выделения ДНК из размороженной крови. Проводят забор 2 мл цельной венозной крови в пробирки, содержащие ЭДТА-К3.

Изобретение относится к области биотехнологии. Раскрывается заполняющий компонент аденоассоциированного вируса, состоящий из нуклеиновой кислоты длиной от 3300 до 4200 нуклеотидов.

Изобретение относится к области биотехнологии, в частности к способу получения растения из популяции клеток, включающему выделение при помощи активируемой флуоресценцией сортировки клеток (FACS) инкапсулированного в альгинат натрия протопласта растения, содержащего представляющий интерес полинуклеотид; регенерацию растения из выделенного растительного протопласта и культивирование данного растения.

Изобретение относится к области биохимии и молекулярной биологии. Предложено применение молекулы нуклеиновой кислоты, способной к связыванию с SDF-1 и блокированию взаимодействия между SDF-1 и рецептором SDF-1 CXCR7.

Группа изобретений относится к области биотехнологии. Предложены способ извлечения нуклеиновых кислот из являющегося пластичным в живом организме полимера, способ обнаружения микроорганизма, прикрепленного или закрепленного в пластичном в живом организме полимере, способ идентификации резистентных к адгезии микроорганизма пластичных полимеров в живом организме, способ создания микробного профиля полости рта субъекта–млекопитающего и in vitro способ диагностики инфекции в полости рта млекопитающего или определения восприимчивости млекопитающего к развитию инфекции в полости рта.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, в клетках яичника китайского хомячка (СНО).

Изобретение относится к биохимии. Описано двухцепочечное средство для РНКи для ингибирования экспрессии транстиретина (TTR), содержащее смысловую цепь, комплементарную антисмысловой цепи, где указанная антисмысловая цепь содержит последовательность, комплементарный нуклеотидам 504-526 гена транстиретина (TTR) (SEQ ID NO:1), где смысловая цепь имеет длину 21 нуклеотид, а антисмысловая цепь имеет длину 23 нуклеотида.

Изобретение относится к генной инженерии и биотехнологии, в частности к генотерапевтическому ДНК-вектору VTvaf17 размером 3165 п.н. и способу его получения.

Изобретение относится к области биотехнологии, конкретно к способам для идентификации связывающих полипептидов (например, антител или их антигенсвязывающих фрагментов), которые специфически связываются с антигеном клеточной поверхности, что может быть использовано в медицине.

Изобретение относится к области биохимии, в частности к белку, придающему растению устойчивость к фенокси-ауксину, гену, кодирующему вышеуказанный белок, а также к экспрессионной кассете и вектору, содержащим вышеуказанный ген.

Изобретение относится к области биохимии, в частности к трансгенной растительной клетке табака, обладающей повышенной экспрессией или активностью неоксантин-синтазы по сравнению с клеткой растения табака дикого типа, к растению, растительному материалу табака и табачной композиции, содержащим вышеуказанную клетку. Также раскрыт способ повышения содержания каротиноидов у растения табака, предусматривающий повышение экспрессии или активности неоксантин-синтазы у растения. Изобретение также относится к способу получения растения табака с повышенным содержанием бета-дамасценона по сравнению с растением табака дикого типа, предусматривающему повышение экспрессии или активности неоксантин-синтазы у растения. Изобретение позволяет эффективно получать растение табака с повышенным содержанием каротиноидов. 6 н. и 3 з.п. ф-лы, 7 ил., 7 пр.

Наверх