Антитела против kit и их применения

Изобретение относится к области биохимии, в частности к выделенному антителу или его антигенсвязывающему фрагменту, которое иммуноспецифически связывается с KIT человека, способу его получения, а также к слитому белку и конъюгату, содержащим вышеуказанное антитело или его антигенсвязывающий фрагмент. Также раскрыт полинуклеотид, кодирующий VH и/или VL вышеуказанного антитела или его фрагмента, а также вектор и клетка, содержащие вышеуказанный полинуклеотид. Изобретение также относится к способу лечения связанного с KIT нарушения, к способу диагностики связанного с KIT нарушения, а также к способу индукции апоптоза в клетке, экспрессирующей KIT с использованием вышеуказанного антитела или его фрагмента. Изобретение позволяет эффективно осуществлять лечение связанного с KIT нарушения, характеризующегося увеличением активности KIT или сверхэкспрессией KIT. 22 н. и 27 з.п. ф-лы, 23 табл., 7 ил., 9 пр.

 

По настоящей заявке испрашивается приоритет по временной заявке США № 61/675751, поданной 25 июля 2012 года, и временной заявке США № 61/675762, поданной 25 июля 2012 года, каждая из которых включена в настоящее описание в качестве ссылки в полном объеме.

Настоящая заявка содержит список последовательностей, который предоставлен вместе с ней в качестве текстового файла ASCII под названием "Sequence_Listing_12638-059-228.txt", созданного 18 июля 2013 года, и имеющего размер 152576 байт. Список последовательностей включен в настоящее описание в качестве ссылки в полном объеме.

1. ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам, которые специфически связываются с полипептидом KIT, их антигенсвязывающим фрагментам, конъюгатам таких антител, полинуклеотидам, кодирующим такие антитела, векторам и клеткам-хозяевам для продуцирования таких антител, наборам и фармацевтическим композициям, содержащим антитела, которые иммуноспецифически связываются с антигеном KIT, применению и способам лечения или контроля связанного с KIT нарушения, и способам диагностики.

2. УРОВЕНЬ ТЕХНИКИ

KIT (или c-Kit) представляет собой рецепторную тирозинкиназу типа III, кодируемую геном c-kit. KIT содержит пять внеклеточных иммуноглобулин (Ig)-подобных доменов, одну трансмембранную область, ингибиторный цитоплазматический околомембранный домен и разделенный цитоплазматический киназный домен, который разделен сегментом киназной вставки (см., например, Yarden et al., Nature, 1986, 323:226-232; Ullrich and Schlessinger, Cell, 1990, 61:203-212; Clifford et al., J. Biol. Chem., 2003, 278:31461-31464). Ген c-kit человека, кодирующий рецептор KIT, был клонирован, как описано Yarden et al., EMBO J., 1987, 6:3341-3351. Kit также известен как CD117 или рецептор фактора стволовых клеток ("SCFR"), поскольку он является лигандом рецептора для фактора стволовых клеток ("SCF") (также известен как стальной фактор или Kit-лиганд). Связывание лиганда SCF с первыми тремя внеклеточными Ig-подобными доменами KIT индуцирует димеризацию рецептора и, тем самым, активирует внутреннюю тирозинкиназную активность посредством фосфорилирования определенных остатков тирозина в околомембранных и киназных доменах (см., например, Weiss and Schlessinger, Cell, 1998, 94:277-280; Clifford et al., J. Biol. Chem., 2003, 278:31461-31464). Показано, что при передаче сигнала KIT представители каскадов передачи сигнала Stat, Src, ERK и AKT являются нижеследующими передатчиками сигнала.

Полагают, что димеризацию рецептора опосредуют четвертый (D4) и пятый (D5) внеклеточные Ig-подобные домены KIT (см., например, публикацию международной патентной заявки № WO 2008/153926; Yuzawa et al., Cell, 2007, 130:323-334).

Экспрессия KIT была выявлена в различных типах клеток, таких как тучные клетки, стволовые клетки, клетки головного мозга, меланобласты, клетки яичника и злокачественные клетки (например, лейкозные клетки). Исследования с мутациями KIT с потерей функции указывают на то, что KIT является важным для нормального роста гемопоэтических клеток-предшественников, тучных клеток, меланоцитов, примордиальных клеток и интерстициальных клеток Кахаля (см., например, Besmer, P., Curr. Opin. Cell Biol., 1991, 3:939-946; Lyman et al., Blood, 1998, 91:1101-1134; Ashman, L. K., Int. J. Biochem. Cell Biol., 1999, 31:1037-1051; Kitamura et al., Mutat. Res., 2001, 477:165-171; Mol et al., J. Biol. Chem., 2003, 278:31461-31464). Более того, KIT играет важную роль в гемопоэзе, меланогенезе и гаметогенезе (см. Ueda et al., Blood, 2002, 99:3342-3349).

Аномальную активность KIT связывают с рядом злокачественных опухолей. Например, мутации KIT с приобретением функции, приводящие к независимой от SCF конститутивной активации KIT, выявлены в определенных злокачественных клетках и связаны с определенными злокачественными опухолями, такими как лейкоз (например, хронический миелогенный лейкоз) и желудочно-кишечные стромальные опухоли (см., например, Mol et al., J. Biol. Chem., 2003, 278:31461-31464).

3. СУЩНОСТЬ ИЗОБРЕТЕНИЯ

В одном из аспектов настоящее изобретение относится к антителам, их антигенсвязывающим фрагментам и их конъюгатам, которые иммуноспецифически связываются с доменом 4 (D4) (или областью D4) внеклеточного домена KIT (например, KIT человека) и ингибируют активность KIT, а также соответствующим композициям, реагентам и способам.

В одном из аспектов настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, которые иммуноспецифически связываются с D4 KIT человека, содержащим:

(i) вариабельную область легкой цепи ("VL"), содержащую CDR1 VL, CDR2 VL и CDR3 VL с аминокислотными последовательностями SEQ ID NO:19, SEQ ID NO:20 и SEQ ID NO:21, соответственно; и

(ii) вариабельную область тяжелой цепи ("VH"), содержащую CDR1 VH, CDR2 VH и CDR3 VH с аминокислотными последовательностями SEQ ID NO:16, SEQ ID NO:17 и SEQ ID NO:18, соответственно.

В одном из вариантов осуществления VL и VH антитела, описанного в настоящем описании, или его антигенсвязывающего фрагмента, являются неиммуногенными у человека. В конкретном варианте осуществления, антитело может экспрессироваться в клетках яичника китайского хомячка (CHO) с титром по меньшей мере 0,45 мкг/мл. В конкретном варианте осуществления антитело может экспрессироватсья в клетках яичника китайского хомячка (CHO) с титром по меньшей мере 0,3 мкг/мл, по меньшей мере 0,6 мкг/мл, по меньшей мере 0,75 мкг/мл или по меньшей мере 1 мкг/мл.

В определенном аспекте настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, или их конъюгату, которые иммуноспецифически связываются с D4 KIT человека, содержащим:

вариабельную область легкой цепи ("VL"), содержащую аминокислотную последовательность: DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO: 12), где XK1 представляет собой аминокислоту с ароматической или алифатической гидроксилсодержащей боковой цепью, ХK2 представляет собой аминокислоту с алифатической или алифатической гидроксилсодержащей боковой цепью, ХK3 представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, ХK4 представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью или представляет собой Р, ХK5 представляет собой аминокислоту с заряженной или кислотной боковой цепью, и Х6 представляет собой аминокислоту с ароматической боковой цепью; и

вариабельную область тяжелой цепи ("VH"), содержащую CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO: 16, SEQ ID NO: 17 и SEQ ID NO: 18, соответственно.

В конкретном аспекте настоящее изобретение относится к антителу (или его фрагменту или их конъюгату), которые иммуноспецифически связываются с D4 KIT человека, содержащее:

(i) VL, содержащую CDR1 VL, CDR2 VL и CDR3 VL с аминокислотными последовательностями SEQ ID NO: 19, SEQ ID NO: 20 и SEQ ID NO: 21, соответственно; и

(ii) VH, содержащую аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO: 11), где XH1 представляет собой аминокислоту с алифатической боковой цепью, ХH2 представляет собой аминокислоту с алифатической боковой цепью, ХH3 представляет собой аминокислоту с полярной или основной боковой цепью, ХН4 представляет собой аминокислоту с алифатической боковой цепью, ХH5 представляет собой аминокислоту с алифатической боковой цепью, ХH6 представляет собой аминокислоту с кислотной боковой цепью, ХH7 представляет собой аминокислоту с кислотной боковой цепью или ее амидное производное, и ХH8 представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью.

В конкретном варианте осуществления, XK1 представляет собой аминокислоту F или S, ХK2 представляет собой аминокислоту А или

S, XK3 представляет собой аминокислоту T или S, XK4 представляет собой аминокислоту S или P, XK5 представляет собой аминокислоту D или T, и XK6 представляет собой аминокислоту F или Y.

В определенном варианте осуществления XK1 представляет собой аминокислоту S, XK2 представляет собой аминокислоту A, XK3 представляет собой аминокислоту T, XK4 представляет собой аминокислоту P, XK5 представляет собой аминокислоту D и XK6 представляет собой аминокислоту F.

В конкретном варианте осуществления XK1 представляет собой аминокислоту F, XK2 представляет собой аминокислоту A, XK3 представляет собой аминокислоту T, XK4 представляет собой аминокислоту S, XK5 представляет собой аминокислоту D и XK6 представляет собой аминокислоту F.

В конкретном варианте осуществления XK1 представляет собой аминокислоту F или S, XK2 представляет собой аминокислоту A, XK3 представляет собой аминокислоту T, XK4 представляет собой аминокислоту S или P, XK5 представляет собой аминокислоту D и XK6 представляет собой аминокислоту F.

В конкретном варианте осуществления XK1 представляет собой аминокислоту S, XK2 представляет собой аминокислоту A, XK3 представляет собой аминокислоту T, XK4 представляет собой аминокислоту P, XK5 представляет собой аминокислоту D, и XK6 представляет собой аминокислоту F.

В конкретном варианте осуществления XK1 представляет собой аминокислоту S, XK2 представляет собой аминокислоту S, XK3 представляет собой аминокислоту S, XK4 представляет собой аминокислоту P, XK5 представляет собой аминокислоту T и XK6 представляет собой аминокислоту Y.

В одном из вариантов осуществления XH1 представляет собой аминокислоту L или V, XH2 представляет собой аминокислоту L или V, XH3 представляет собой аминокислоту K или R, XH4 представляет собой аминокислоту V или A, XH5 представляет собой аминокислоту L или I, XH6 представляет собой аминокислоту E или D, XH7 представляет собой аминокислоту Q или E и XH8 представляет собой аминокислоту S или T.

В конкретном варианте осуществления XH1 представляет собой аминокислоту V, XH2 представляет собой аминокислоту L или V, XH3 представляет собой аминокислоту R или Q, XH4 представляет собой аминокислоту A, XH5 представляет собой аминокислоту L или I, XH6 представляет собой аминокислоту D, XH7 представляет собой аминокислоту Q или E и XH8 представляет собой аминокислоту T.

В конкретном варианте осуществления XH1 представляет собой аминокислоту V, XH2 представляет собой аминокислоту L, XH3 представляет собой аминокислоту R, XH4 представляет собой аминокислоту A, XH5 представляет собой аминокислоту L, XH6 представляет собой аминокислоту D, XH7 представляет собой аминокислоту Q и XH8 представляет собой аминокислоту T.

В определенном варианте осуществления XH1 представляет собой аминокислоту V, XH2 представляет собой аминокислоту V, XH3 представляет собой аминокислоту R, XH4 представляет собой аминокислоту A, XH5 представляет собой аминокислоту I, XH6 представляет собой аминокислоту D, XH7 представляет собой аминокислоту E и XH8 представляет собой аминокислоту T.

В определенном варианте осуществления XH1 представляет собой аминокислоту L, XH2 представляет собой аминокислоту L, XH3 представляет собой аминокислоту K, XH4 представляет собой аминокислоту A, XH5 представляет собой аминокислоту L, XH6 представляет собой аминокислоту E, XH7 представляет собой аминокислоту Q и XH8 представляет собой аминокислоту S.

В определенном варианте осуществления XH1 представляет собой аминокислоту V, XH2 представляет собой аминокислоту L, XH3 представляет собой аминокислоту K, XH4 представляет собой аминокислоту A, XH5 представляет собой аминокислоту L, XH6 представляет собой аминокислоту E, XH7 представляет собой аминокислоту Q и XH8 представляет собой аминокислоту T.

В определенном варианте осуществления XH1 представляет собой аминокислоту V, XH2 представляет собой аминокислоту V, XH3 представляет собой аминокислоту R, XH4 представляет собой аминокислоту V, XH5 представляет собой аминокислоту I, XH6 представляет собой аминокислоту D, XH7 представляет собой аминокислоту E и XH8 представляет собой аминокислоту T.

В конкретном варианте осуществления XK1-XK6 представляют собой аминокислоту, указанную в таблице 6А, и/или XH1H8 представляют собой аминокислоту, указанную в таблице 6В.

В конкретном аспекте настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, или их конъюгату, которые иммуноспецифически связываются с D4 KIT человека, содержащим:

i) VL, содержащую аминокислотную последовательность, которая: по меньшей мере на 90% идентична SEQ ID NO: 7, по меньшей мере на 88% идентична SEQ ID NO: 8, по меньшей мере на 87% идентична SEQ ID NO: 9, или по меньшей мере на 84% идентична SEQ ID NO: 10; и

ii) VH, содержащую аминокислотную последовательность, которая: по меньшей мере на 93% идентична SEQ ID NO: 2, по меньшей мере на 92% идентична SEQ ID NO: 3, по меньшей мере на 90% идентична SEQ ID NO: 4, по меньшей мере на 87% идентична SEQ ID NO: 5 или по меньшей мере на 86% идентична SEQ ID NO: 6.

В определенном аспекте настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, или их конъюгату, которые иммуноспецифически связываются с областью D4 KIT человека, содержащим:

i) вариабельную область легкой цепи ("VL"), содержащую аминокислотную последовательность: DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO: 12), где XK1 представляет собой аминокислоту с ароматической или алифатической гидроксилсодержащей боковой цепью, ХK2 представляет собой аминокислоту с алифатической или алифатической гидроксилсодержащей боковой цепью, ХK3 представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, ХK4 представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью или представляет собой Р, XK5 представляет собой аминокислоту с заряженной или кислотной боковой цепью, и ХK6 представляет собой аминокислоту с ароматической боковой цепью; и ii) VH, содержащую аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYQVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO: 11), где XH1 представляет собой аминокислоту с алифатической боковой цепью, ХH2 представляет собой аминокислоту с алифатической боковой цепью, ХH3 представляет собой аминокислоту с полярной или основной боковой цепью, ХH4 представляет собой аминокислоту с алифатической боковой цепью, XH5 представляет собой аминокислоту с алифатической боковой цепью, ХH6 представляет собой аминокислоту с кислотной боковой цепью, ХH7 представляет собой аминокислоту с кислотной боковой цепью или ее амидное производное, и Хне представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью.

В конкретном варианте осуществления XK1-XK6 представляют собой аминокислоту, указанную в таблице 6А, и/или XH1H8 представляют собой аминокислоту, указанную в таблице 6В.

В конкретном варианте осуществления антитело, описанное в настоящем описании, специфически связывается с клетками СНО, рекомбинантно экспрессирующей KIT дикого типа, с ЕС50 приблизительно 150 пМ или менее при определении проточной цитометрией. В конкретном варианте осуществления антитело, описанное в настоящем описании специфически связывается с рекомбинантной областью D4/D5 KIT человека с ЕС50 приблизительно 600 пМ или менее, или от приблизительно 250 пМ до приблизительно 600 пМ, при определении проточной цитометрией. В определенном варианте осуществления антитело, описанное в настоящем описании, ингибирует фосфорилирование тирозина KIT с IC50 приблизительно 600 пМ или менее при определении с помощью ELISA.

В конкретном варианте осуществления антитело, описанное в настоящем описании, может экспрессироваться в клетках СНО с титром по меньшей мере 1,0 мкг/мл, или по меньшей мере 1,1 мкг/мл, или по меньшей мере 1,2 мкг/мл.

В конкретном варианте осуществления антитело, описанное в настоящем описании, дополнительно содержит константную область легкой цепи человека и константную область тяжелой цепи человека. В одном из вариантов осуществления константная область легкой цепи человека в антителе, описанном в настоящем описании, представляет собой константную область легкой цепи каппа человека. В конкретном варианте осуществления константная область тяжелой цепи человека в антителе, описанном в настоящем описании, представляет собой константную область тяжелой цепи гамма человека.

В определенном варианте осуществления антитело, описанное в настоящем описании, представляет собой IgG1- или IgG4-антитело человека. В определенном варианте осуществления антитело, описанное в настоящем описании, представляет собой антигенсвязывающий фрагмент или Fab-фрагмент. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой антигенсвязывающий фрагмент или Fab-фрагмент. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой биспецифическое антитело. В определенном варианте осуществления антитело, описанное в настоящем описании, интернализуется клеткой.

В конкретном аспекте настоящее изобретение относится к конъюгату, содержащему антитело, описанное в настоящем описании, или его связывающий KIT фрагмент, связанный со средством. В конкретном варианте осуществления средство представляет собой токсин. В определенном варианте осуществления токсин представляет собой абрин, рицин A, экзотоксин pseudomonas, холерный токсин или дифтерийный токсин. В одном из вариантов осуществления конъюгат интернализуется клеткой.

В определенном аспекте настоящее изобретение относится к фармацевтической композиции, содержащей конъюгат, описанный в настоящем описании, и фармацевтически приемлемый носитель.

В другом аспекте настоящее изобретение относится к фармацевтической композициия, содержащей антитело, описанное в настоящем описании, и фармацевтически приемлемый носитель.

В конкретном аспекте настоящее изобретение относится к полинуклеотиду, содержащему нуклеотидные последовательности, кодирующие область VH-цепи, область VL-цепи или как область VL-цепи, так и область VH-цепи, антитела, описанного в настоящем описании.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид), описанный в настоящем описании, содержит SEQ ID NO:22, 23, 24, 25 или 26, кодирующие VH. В определенном варианте осуществления полинуклеотид (например, выделенный полинуклеотид), описанный в настоящем описании, содержит SEQ ID NO:27, 28, 29 или 30, кодирующие VL. В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:22, 23, 24, 25 или 26, кодирующие VH, и SEQ ID NO:27, 28, 29 или 30, кодирующие VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:22, кодирующую VH, и SEQ ID NO:27, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:22, кодирующую VH, и SEQ ID NO:28, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:22, кодирующую VH, и SEQ ID NO:29, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:22, кодирующую VH, и SEQ ID NO:30, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:23, кодирующую VH, и SEQ ID NO:27, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:23, кодирующую VH, и SEQ ID NO:28, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:23, кодирующую VH, и SEQ ID NO:29, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:23, кодирующую VH, и SEQ ID NO:30, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:24, кодирующую VH, и SEQ ID NO:27, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:24, кодирующую VH, и SEQ ID NO:28, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:24, кодирующую VH, и SEQ ID NO:29, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:24, кодирующую VH, и SEQ ID NO:30, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:25, кодирующую VH, и SEQ ID NO:27, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:25, кодирующую VH, и SEQ ID NO:28, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:25, кодирующую VH, и SEQ ID NO:29, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:25, кодирующую VH, и SEQ ID NO:30, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:26, кодирующую VH, и SEQ ID NO:27, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:26, кодирующую VH, и SEQ ID NO:28, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:26, кодирующую VH, и SEQ ID NO:29, кодирующую VL.

В конкретном варианте осуществления полинуклеотид (например, выделенный полинуклеотид) или группа полинуклеотидов (например, группа выделенных полинуклеотидов), описанных в настоящем описании, содержат SEQ ID NO:26, кодирующую VH, и SEQ ID NO:30, кодирующую VL.

В одном из аспектов настоящее изобретение относится к вектору, содержащему полинуклеотид, описанный в настоящем описании, для экспрессии антитела против KIT или его фрагмента. В определенном варианте осуществления настоящее изобретение относится к вектору экспрессии млекопитающих.

В определенном аспекте настоящее изобретение относится к клетке-хозяину, содержащей вектор, описанный в настоящем описании, или один или несколько полинуклеотидов, описанных в настоящем описании, для экспрессии антитела против KIT или его фрагмента.

В конкретном аспекте настоящее изобретение относится к клетке, продуцирующей антитело, описанное в настоящем описании. В одном из вариантов осуществления клетка, описанная в настоящем описании, содержит один или несколько полинуклеотидов, описанных в настоящем описании, где клетка может экспрессировать антитело, которое специфически связывается с D4 KIT человека. В определенном варианте осуществления клетка содержит вектор, описанный в настоящем описании.

В конкретном аспекте настоящее изобретение относится к набору, содержащему антитело (или его антигенсвязывающий фрагмент или их конъюгат), описанное в настоящем описании. В конкретном варианте осуществления набор содержит конъюгат, описанный в настоящем описании.

В определенном аспекте настоящее изобретение относится к способу лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли), включающему введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании, или его антигенсвязывающего фрагмента или их конъюгата.

В одном из аспектов настоящее изобретение относится к способу лечения или контроля связанного с KIT нарушения, включающему введение индивидууму терапевтически эффективного количества конъюгата, описанного в настоящем описании.

В конкретном варианте осуществления связанное с KIT нарушение представляет собой злокачественную опухоль, воспалительное состояние или фиброз. В конкретном варианте осуществления злокачественная опухоль представляет собой лейкоз, хронический миелогенный лейкоз, рак легкого, мелкоклеточный рак легкого или желудочно-кишечные стромальные опухоли. В одном из вариантов осуществления злокачественная опухоль является рефрактерной к лечению ингибитором тирозинкиназы. В следующем варианте осуществления ингибитором тирозинкиназы является иматиниба мезилат или SU11248.

В определенном варианте осуществления способ, описанный в настоящем описании, дополнительно включает введение второго средства. В конкретном варианте осуществления второе средство представляет собой химиотерапевтическое средство, ингибитор тирозинкиназы, ингибитор деацетилазы гистонов, антитело или цитокин. В конкретном варианте осуществления ингибитор тирозинкиназы представляет собой иматиниба мезилат или SU11248.

В конкретном аспекте настоящее изобретение относится к способу диагностики индивидуума со связанным с KIT нарушением, включающему приведение клеток или образца, полученных от индивидуума, в контакт с антителом, описанным в настоящем описании (или его антигенсвязывающим фрагментом или их конъюгатом) и определение уровня экспрессии KIT в клетках или в образце. Например, обнаруженное связывание антитела, описанного в настоящем описании, с антигеном KIT, присутствующим в клетке или образце, может коррелировать с уровнем экспрессии KIT в клетке или образце. В конкретном варианте осуществления антитело конъюгировано с поддающейся обнаружению молекулой. В определенном варианте осуществления поддающаяся обнаружению молекула представляет собой фермент, флуоресцентную молекулу, люминесцентную молекулу или радиоактивную молекулу.

В конкретном аспекте настоящее изобретение относится к способу ингибирования активности KIT в клетке, экспрессирующей KIT, включающему приведение клетки в контакт с эффективным количеством антитела, описанного в настоящем описании (или его антигенсвязывающим фрагментом или конъюгатом).

В конкретном аспекте настоящее изобретение относится к способу индукции или усиления апоптоза в клетке, экспрессирующей KIT, включающему приведение клетки в контакт с эффективным количеством антитела, описанного в настоящем описании (или его антигенсвязывающего фрагмента или их конъюгата).

В конкретном аспекте настоящее изобретение относится к способу индукции дифференцировки клеток, включающему приведение клетки, экспрессирующей KIT, в контакт с эффективным количеством антитела, описанного в настоящем описании (или его антигенсвязывающиго фрагмента или их конъюгата). В конкретном варианте осуществления клетка представляет собой стволовую клетку.

В определенном аспекте настоящее изобретение относится к способу получения антитела, которое иммуноспецифически связывается с областью D4 KIT, включающему культивирование клетки или клетки-хозяина, описанных в настоящем описании. В определенном аспекте настоящее изобретение относится к способу получения антитела, которое иммуноспецифически связывается с областью D4 KIT, включающему экспрессию антитела с использованием клетки или клеток-хозяев, описанных в настоящем описании. В конкретном варианте осуществления клетка представляет собой выделенную клетку. В конкретном варианте осуществления способ дополнительно включает стадию очистки антитела, полученного из клетки или клетки-хозяина.

В одном из аспектов настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, которые иммуноспецифически связываются с областью D4 KIT человека, где указанное антитело или его антигенсвязывающий фрагмент содержат:

(i) вариабельную область легкой цепи ("VL"), содержащую CDR1 VL, CDR2 VL и CDR3 VL, выбранные из группы, приведенной в таблицах 10-12; и

(ii) вариабельную область тяжелой цепи ("VH"), содержащую CDR1 VH, CDR2 VH и CDR3 VH, выбранные из группы, приведенной в таблицах 13-15.

В определенном аспекте настоящее изобретение относится к антителу, или его антигенсвязывающему фрагменту, где указанное антитело или его антигенсвязывающий фрагмент содержат:

(i) VL, содержащую FR1 VL, FR2 VL, FR3 VL и FR4 VL, выбранные из группы, приведенной в таблицах 20-23; и

(ii) VH, содержащую FR1 VH, FR2 VH, FR3 VH и FR4 VH, выбранные из группы, приведенной в таблицах 16-19.

В конкретном аспекте антитело, или антигенсвязывающий фрагмент, описанные в настоящем описании, содержат Fc-область с модификацией аминокислот. В определенном аспекте антитело, или антигенсвязывающий фрагмент, описанные в настоящем описании, содержат Fc-область, которая имеет изотип IgG1 или изотип IgG4. В одном из аспектов антитело, или антигенсвязывающий фрагмент, описанные в настоящем описании, представляют собой гуманизированное антитело. В конкретном аспекте антитело, или его антигенсвязывающий фрагмент, описанные в настоящем описании, представляют собой биспецифическое антитело.

В определенном аспекте в настоящем описании описано антитело, или его антигенсвязывающий фрагмент, которые конъюгированы с другим средством.

В одном из аспектов настоящее изобретение относится к композиции, содержащей антитело или его антигенсвязывающий фрагмент, описанные в настоящем описании.

В конкретном аспекте настоящее изобретение относится к полинуклеотиду, содержащему нуклеотидные последовательности, кодирующие область цепи VH, область цепи VL или как область цепи VL, так и область цепи VH, антитела или его антигенсвязывающего фрагмента, описанных в настоящем описании (например, антитело или его антигенсвязывающий фрагмент, содержащие последовательности, приведенные в таблицах 10-15). Также предусматривается вектор, содержащий полинуклеотид, описанный в настоящем описании. В одном из аспектов вектор представляет собой вектор экспрессии млекопитающих.

В определенном аспекте настоящее изобретение относится к клетке-хозяину, содержащей вектор или один или несколько полинуклеотидов, описанных в настоящем описании. В одном из аспектов настоящее изобретение относится к клетке, продуцирующей антитело, или его антигенсвязывающий фрагмент, описанные в настоящем описании (например, антитело или его антигенсвязывающий фрагмент, содержащие последовательности, приведенные в таблицах 10-15).

В конкретном аспекте настоящее изобретение относится к набору, содержащему антитело или его антигенсвязывающий фрагмент, описанные в настоящем описании (например, антитело или его антигенсвязывающий фрагмент, содержащие последовательности, приведенные в таблицах 10-15).

В определенном аспекте настоящее изобретение относится к способу лечения или контроля связанного с KIT нарушения, включающему введение индивидууму терапевтически эффективного количества антитела или его антигенсвязывающего фрагмента, описанных в настоящем описании (например, антитело или его антигенсвязывающий фрагмент, содержащие последовательности, приведенные в таблицах 10-15). В одном из вариантов осуществления связанное с KIT нарушение представляет собой злокачественную опухоль, воспалительное состояние или фиброз. В конкретном варианте осуществления злокачественная опухоль представляет собой лейкоз, хронический миелогенный лейкоз, рак легкого, мелкоклеточный рак легкого или желудочно-кишечные стромальные опухоли.

В конкретном аспекте способ лечения или контроля связанного с KIT нарушения, описанного в настоящем описании, дополнительно включает введение второго средства. В конкретном варианте осуществления второе средство представляет собой химиотерапевтическое средство, ингибитор тирозинкиназы, ингибитор деацетилазы гистонов, антитело, цитокин, ингибитор HSP90, ингибитор PGP или ингибитор протеасом.

В одном из аспектов настоящее изобретение относится к способу диагностики индивидуума со связанным с KIT нарушением, включающему приведение клеток или образца, полученных от индивидуума, в контакт с антителом или его антигенсвязывающим фрагментом, описанными в настоящем описании (например, антитело или его антигенсвязывающий фрагмент, содержащие последовательности, приведенные в таблицах 10-15) и определения уровня экспрессии KIT в клетках или в образце. В определенном варианте осуществления антитело конъюгировано с поддающейся обнаружению молекулой.

В определенном аспекте настоящее изобретение относится к способу ингибирования активности KIT в клетке, экспрессирующей KIT, включающему приведение клетки в контакт с эффективным количеством антитела или его антигенсвязывающего фрагмента, описанных в настоящем описании (например, антитела или его антигенсвязывающего фрагмента, содержащих последовательности, приведенные в таблицах 10-15).

Способ индукции или усиления апоптоза в клетке, экспрессирующей KIT, включающий приведение клетки в контакт с эффективным количеством антитела, или его антигенсвязывающего фрагмента, описанных в настоящем описании (например, антитела или его антигенсвязывающего фрагмента, содержащих последовательности, указанные в таблицах 10-15).

Способ получения антитела, которое иммуноспецифически связывается с областью D4 KIT человека, включающий культивирование и/или экспрессию антитела с использованием клетки, описанной в настоящем описании.

4. КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фиг. 1 представлена аминокислотная последовательность полноразмерного KIT человека (SEQ ID NO:1), номер доступа GenBank™ AAC50969. Указаны с первого по пятый внеклеточные Ig-подобные домены (т.е. D1, D2, D3, D4 и D5); "{" обозначает N-концевой остаток каждого домена и "}" обозначает С-концевой остаток каждого домена. Домен D1 представлен с P34 по R112, домен D2 представлен с D113 по P206, домен D3 представлен с A207 по D309, домен D4 представлен с K310 по N410 (SEQ ID NO:15), шарнирная область между D4 и D5 располагается с V409 по N410, и домен D5 домен представлен с T411 по K509. Также шарнирная область D1/D2 расположена с D113 по L117; шарнирная область D2/D3 расположена с P206 по A210; и шарнирная область D3/D4 расположена с D309 по G311. Область D4/D5 содержит с K310 по K509. Трансмембранный домен содержит остатки с F525 по Q545, и киназный домен содержит остатки с K589 по S933.

На фиг. 2 представлена аминокислотная последовательность рекомбинантного D4/D5 KIT. Аминокислоты KIT человека с V308 по H515 (SEQ ID NO:73) представлены полужирным шрифтом. Представленный полипептид (SEQ ID NO:14) содержит (i) первые 33 аминокислоты (т.е. с M1 по E33) N-конца KIT человека (включая сигнальный пептид, подчеркнутый, не выделенный полужирным шрифтом), (ii) область D4/D5 KIT человека (полужирный шрифт), и (iii) 5×His-метку (курсив) на C-конце.

На фиг. 3A представлена аминокислотная последовательность (SEQ ID NO:2) домена H1 VH, и последовательность ДНК (SEQ ID NO:22), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3B представлена аминокислотная последовательность (SEQ ID NO:3) домена H2 VH и последовательность ДНК (SEQ ID NO:23), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3C представлена аминокислотная последовательность (SEQ ID NO:4) домена H3 VH и последовательность ДНК (SEQ ID NO:24), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3D представлена аминокислотная последовательность (SEQ ID NO:5) домена H4 VH и последовательность ДНК (SEQ ID NO:25), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3E представлена аминокислотная последовательность (SEQ ID NO:6) домена H5 VH и последовательность ДНК (SEQ ID NO:26), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3F представлена аминокислотная последовательность (SEQ ID NO: 7) домена L1 VL и последовательность ДНК (SEQ ID NO: 27), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3G представлена аминокислотная последовательность (SEQ ID NO: 8) домена L2 VL и последовательность ДНК (SEQ ID NO: 28), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3Н представлена аминокислотная последовательность (SEQ ID NO: 9) домена L3 VL и последовательность ДНК (SEQ ID NO: 29), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 3I представлена аминокислотная последовательность (SEQ ID NO: 10) домена L4 VL и последовательность ДНК (SEQ ID NO: 30), кодирующей эту аминокислотную последовательность. Указаны каркасные области (FR1, FR2, FR3 и FR4) и CDR (CDR1, CDR2 и CDR3). Указана как нумерация Kabat, так и числовая нумерация аминокислотных остатков.

На фиг. 4А представлена консенсусная последовательность(SEQ ID NO: 11) домена VH. XH1-H8 обозначают аминокислоты, которые могут представлять собой любую аминокислоту.

На фиг. 4В представлена консенсусная последовательность(SEQ ID NO: 12) VL-домена. XK1-K6 обозначают аминокислоты, которые могут представлять собой любую аминокислоту.

На фиг. 5 представлена активность связывания антител Hum17, Hum8, Hum4 и Hum10, а также химеры антитела 37М ("химера"), с рекомбинантным полипептидом области D4/D5 KIT человека при определении с помощью твердофазного ELISA. Указана величина ЕС50 для каждого антитела.

На фиг. 6 представлен график с результатами анализов связывания, проведенных с помощью проточной цитометрии с клетками CHO, рекомбинантно экспрессирующими KIT человека дикого типа, для охарактеризации активности связывания KIT у антител Hum17, Hum8, Hum4 и Hum10, по сравнению с химерой антитела 37M ("химера"). Указана величина EC50 для каждого антитела.

На фиг. 7 представлен график результатов анализов ингибирования фосфорилирования KIT, проведенных с помощью ELISA с клетками CHO, рекомбинантно экспрессирующими KIT дикого типа, для охарактеризации активности блокирования фосфорилирования антителами Hum17, Hum8, Hum4 и Hum10 по сравнению с химерной антитела 37M ("химера"). Указаны величины IC50 для каждого антитела.

5. ПОДРОБНОЕ ОПИСАНИЕ

Если не определено иначе, все технические и научные термины, используемые в настоящем описании, имеют такое же значение, которое обычно подразумевает специалист в данной области.

Как используется в настоящем изобретении, термины "приблизительно" или "примерно" означают величину или диапазон, находящиеся в пределах плюс или минус 10% от данной величины или диапазона.

В рамках настоящего изобретения предусматриваются антитела и их антигенсвязывающие фрагменты, которые иммуноспецифически связываются с полипептидом KIT (например, полипептид KIT, содержащий домен D4 KIT человека), и их конъюгаты. Также предусматриваются выделенные нуклеиновые кислоты (полинуклеотиды), кодирующие такие антитела и их антигенсвязывающие фрагменты. Кроме того, предусматриваются векторы (например, экспрессирующие векторы) и клетки (например, клетки-хозяева), содержащие нуклеиновые кислоты, кодирующие такие антитела или их антигенсвязывающие фрагменты. Также предусматривается способ получения таких антител, клеток, например, клеток-хозяев. Также настоящее изобретение относится к способам и применению для лечения или контроля связанного с KIT нарушения или заболевания (например, злокачественной опухоли, воспалительного состояния или фиброза) или одного или нескольких эффектов такого связанного с KIT нарушения или заболевания, включающим введение одного или нескольких антител, описанных в настоящем описании, или их антигенсвязывающего фрагмента, или их конъюгата. Также в рамках настоящего изобретения предусматривается способы диагностики связанного с KIT нарушения или заболевания (например, злокачественная опухоль, воспалительное состояние или фиброз), включающие приведение образца в контакт с одним или несколькими антителами (или их антигенсвязывающими фрагментами), описанными в настоящем описании, и определение уровня экспрессии KIT в образце относительно эталонного образца (например, контрольного образца). Кроме того, в рамках настоящего изобретения предусматриваются способы и применения для ингибирования активности KIT в клетке, экспрессирующей KIT, включающие приведение клетки в контакт с эффективным количеством антитела или его антигенсвязывающего фрагмента. Кроме того, также в рамках настоящего изобретения предусматриваются способы индукции или усиления дифференцировки или апоптоза в клетке, экспрессирующей KIT, включающие приведение клетки в контакт с эффективным количеством антитела или антител, описанных в настоящем описании.

Как используется в рамках изобретения, термины "область D4/D5" или "домен D4/D5" относятся к области в полипептиде KIT, охватывающей четвертый Ig-подобный внеклеточный ("D4") домен, пятый Ig-подобный внеклеточный ("D5") домен и шарнирную область между доменами D4 и D5 ("шарнирная область D4-D5") в KIT, в следующем порядке от N-конца к С-концу: D4, шарнирная область D4-D5 и D5. Как используется в рамках изобретения, аминокислоты с V308 по H515 на фиг.1 и полипептид, представленный на фиг.2 настоящего описания, считаются примерами области или домена D4/D5.

Как используется в рамках изобретения, термины "KIT" или "рецептор KIT" или "полипептид KIT" относятся к любой форме полноразмерного KIT, включая, но ими не ограничиваясь, нативный KIT, изоформу KIT, межвидовой гомолог KIT или вариант KIT, например, природный (например, аллельный вариант или вариант по сплайсингу, или мутант, например, соматический мутант) или искусственно сконструированный вариант (например, рекомбинантный или химически модифицированный вариант). KIT представляет собой рецепторную тирозинкиназу типа III, кодируемую геном c-kit (см., например, Yarden et al., Nature, 1986, 323:226-232; Ullrich and Schlessinger, Cell, 1990, 61:203-212; Clifford et al., J. Biol. Chem., 2003, 278:31461-31464; Yarden et al., EMBO J., 1987, 6:3341-3351; Mol et al., J. Biol. Chem., 2003, 278:31461-31464). В записи с номером доступа GenBank™ NM_000222 предоставлена иллюстративная последовательность нуклеиновой кислоты KIT человека. В записях с номером доступа GenBank™ NP_001087241, P10721 и AAC50969 предоставлены иллюстративные аминокислотные последовательности KIT человека. В записи с номером доступа GenBank™ AAH75716 предоставлена иллюстративная аминокислотная последовательность KIT мыши. Нативный KIT содержит пять внеклеточных иммуноглобулин (Ig)-подобных доменов (D1, D2, D3, D4, D5), одну трансмембранную область, ингибиторный цитоплазматический околомембранный домен и разделенный цитоплазматический киназный домен, который разделен сегментом киназной вставки (см., например, Yarden et al., Nature, 1986, 323:226-232; Ullrich and Schlessinger, Cell, 1990, 61:203-212; Clifford et al., J. Biol. Chem., 2003, 278:31461-31464). Иллюстративная аминокислотная последовательность области D4/D5 KIT человека представлена на фиг.1 в аминокислотных остатках с V308 по H515. В конкретном варианте осуществления KIT представляет собой KIT человека. В конкретном варианте осуществления KIT может существовать в качестве мономера, димера, мультимера, нативной формы или денатурированной формы.

В контексте пептида или полипептида термин "фрагмент", как используют в рамках изобретения, относится к пептиду или полипептиду, которые содержат менее чем полноразмерную аминокислотную последовательность. Такой фрагмент может появляться, например, в результате укорочения на N-конце, укорочения на С-конце и/или внутренней делеции остатка(ов) из аминокислотной последовательности. Фрагменты, например, могут быть результатом альтернативного сплайсинга РНК или протеазной активности in vivo. В определенных вариантах осуществления фрагменты KIT или фрагменты антитела (например, фрагменты антитела, которые иммуноспецифически связываются с полипептидом KIT) включают полипептиды, содержащие аминокислотную последовательность из по меньшей мере 5 последовательно расположенных аминокислотных остатков, по меньшей мере 10 последовательно расположенных аминокислотных остатков, по меньшей мере 15 последовательно расположенных аминокислотных остатков, по меньшей мере 20 последовательно расположенных аминокислотных остатков, по меньшей мере 25 последовательно расположенных аминокислотных остатков, по меньшей мере 40 последовательно расположенных аминокислотных остатков, по меньшей мере 50 последовательно расположенных аминокислотных остатков, по меньшей мере 60 последовательно расположенных аминокислотных остатков, по меньшей мере 70 последовательно расположенных аминокислотных остатков, по меньшей мере 80 последовательно расположенных аминокислотных остатков, по меньшей мере 90 последовательно расположенных аминокислотных остатков, по меньшей мере 100 последовательно расположенных аминокислотных остатков, по меньшей мере 125 последовательно расположенных аминокислотных остатков, по меньшей мере 150 последовательно расположенных аминокислотных остатков, по меньшей мере 175 последовательно расположенных аминокислотных остатков, по меньшей мере 200 последовательно расположенных аминокислотных остатков, или по меньшей мере 250 последовательно расположенных аминокислотных остатков аминокислотной последовательности полипептида KIT или антитела (например, антитело, которое иммуноспецифически связывается с полипептидом KIT), соответственно. В конкретном варианте осуществления фрагмент полипептида KIT или антитела (например, антитело, которое иммуноспецифически связывается с полипептидом KIT) сохраняет по меньшей мере 1, по меньшей мере 2 или по меньшей мере 3 функции полипептида или антитела.

Как используется в рамках изобретения, термин "клетка-хозяин" относится к конкретной клетке, которая содержит экзогенную молекулу нуклеиновой кислоты, например, к клетке, которая трансфицирована или трансформирована молекулой нуклеиновой кислоты, и к потомству или потенциальному потомству такой родительской клетки. Потомство такой клетки может не быть идентичным родительской клетке вследствие мутаций или влияний окружающей среды, которые могут происходить в последующих поколениях, или встраивания молекулы нуклеиновой кислоты в геном клетки-хозяина.

5.1 Антитела

Как используется в рамках изобретения, термины "антитело" и "иммуноглобулин" и "Ig" являются терминами данной области, которые могут использоваться в настоящем описании взаимозаменяемо, и они относятся к молекуле с антигенсвязывающим центром, которая иммуноспецифически связывает антиген.

Как используется в рамках изобретения, "антиген" представляет собой часть или молекулу, которая содержит эпитоп, и по существу также специфически связывается антителом. В конкретном варианте осуществления антиген, с которым связывается антитело, описанное в настоящем описании, представляет собой KIT (например, KIT человека) или его фрагмент, например, внеклеточный домен KIT (например, KIT человека) или область D4 KIT (например, KIT человека).

Как используется в рамках изобретения, "эпитоп" представляет собой термин данной области, и он относится к локализованной области антигена, с которой антитело может специфически связываться. Область или полипептид составляющие эпитоп, могут представлять собой последовательно расположенные аминокислоты полипептида, или эпитоп может образовываться из двух или более несоседних областей полипептида.

Как используется в рамках изобретения, термины "антигенсвязывающий домен", "антигенсвязывающая область", "антигенсвязывающий фрагмент" и сходные термины относятся к части молекулы антитела, которая содержит аминокислотные остатки, которые взаимодействуют с антигеном и сообщают молекуле антитела ее специфичность в отношении антигена (например, определяющие комплементарность области (CDR)). Антигенсвязывающая область может происходить из любого вида животных, такого как грызуны (например, мышь, крыса или хомяк) и люди. CDR молекулы антитела можно определять любым способом, хорошо известным специалисту в данной области. В частности, CDR можно определять в соответствии со схемой нумерации Kabat (см. Kabat et al. (1991) Sequences of Proteins of Immunological Interest. (U.S. Department of Health and Human Services, Washington, D.C.) 5th ed.). В некоторых аспектах CDR антитела можно определять по (i) схеме нумерации Chothia, и их обозначают в настоящем описании как "CDR Chothia" (см., например, Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948; и патент США № 7709226); или (ii) с помощью системы нумерации IMGT, например, как описано в Lefranc, M.-P., 1999, The Immunologist, 7:132-136 и Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212.

Как используется в рамках изобретения, "конформационный эпитоп", или "нелинейный эпитоп", или "прерывающийся эпитоп" относятся к эпитопу, состоящему по меньшей мере из двух аминокислот, которые не являются последовательно расположенными аминокислотами в одной белковой цепи. Например, конформационный эпитоп может состоять из двух или более аминокислот, которые разделены участком встроенных аминокислот, но которые находятся достаточно близко, чтобы распознаваться антителом (например, антитело против KIT), описанным в настоящем описании, в качестве одного эпитопа. В качестве следующего примера, аминокислоты, которые разделены встроенными аминокислотами на одной белковой цепи, или аминокислоты, которые существуют на отдельных белковых цепях, могут находиться близко друг к другу благодаря конформационной форме белковой структуры или комплекса, становясь конформационным эпитопом, который может связываться антителом против KIT, описанным в настоящем описании. Специалисту в данной области будет понятно, что, как правило, линейный эпитоп, связываемый антителом против KIT, описанным в настоящем описании, может зависеть или может не зависеть от вторичной, третичной или четвертичной структуры рецептора KIT. Например, в некоторых вариантах осуществления антитело против KIT, описанное в настоящем описании, связывается с группой аминокислот независимо от того, укладываются ли они в природную трехмерную белковую структуру. В других вариантах осуществления антитело против KIT, описанное в настоящем описании, не распознает индивидуальные аминокислотные остатки, составляющие эпитоп и требует конкретной конформации (изгиб, завиток, поворот или складка) для распознавания и связывания эпитопа.

Как используется в рамках изобретения, термины "константная область" или "константный домен" относятся к части антитела, например, карбоксильной части легкой и/или тяжелой цепи, которая не вовлечена прямо в связывание антитела с антигеном, но которая проявляет различные эффекторные функции, такие как взаимодействие с Fc-рецептором. Термины относятся к части молекулы иммуноглобулина, в основном имеющей более консервативную аминокислотную последовательность относительно вариабельного домена иммуноглобулина.

Как используется в рамках изобретения, термин "тяжелая цепь" при использовании в отношении антитела относится к любым отдельным типам, например, альфа (α), дельта (δ), эпсилон (ε), гамма (γ) и мю (μ), исходя из аминокислотной последовательности константного домена, которые дают начало классам антитела IgA, IgD, IgE, IgG и IgM, соответственно, включая подкласс IgG, например, IgG1, IgG2, IgG3 и IgG4. В конкретном варианте осуществления тяжелая цепь представляет собой тяжелую цепь человека.

Как используется в рамках изобретения, термины "иммуноспецифически связывает", "иммуноспецифически распознает", "специфически связывает" и "специфически распознает" являются аналогичными терминами в контексте антител, и они относятся к молекулам, которые связываются с антигеном (например, эпитоп или иммунный комплекс), как такое связывание подразумевает специалист в данной области. Например, молекула, которая специфически связывается с антигеном, может связываться с другими пептидами или полипептидами, обычно с более низкой аффинностью, при определении, например, с помощью иммуноанализов, Biacore™, устройства KinExA 3000 (Sapidyne Instruments, Boise, ID) или других анализов, известных в данной области. В конкретном варианте осуществления молекулы, которые иммуноспецифически связываются с антигеном, связываются с антигеном с Ka, которая по меньшей мере на 2 log, 2,5 log, 3 log, 4 log или больше, чем Ka, когда молекулы связываются с другим антигеном. В другом конкретном варианте осуществления молекулы, которые иммуноспецифически связываются с антигеном, не реагируют перекрестно с другими белками. В другом конкретном варианте осуществления молекулы, которые иммуноспецифически связываются с антигеном, не реагируют перекрестно с другими не являющимися KIT белками.

Как используется в рамках изобретения, "выделенное" или "очищенное" антитело по существу свободно от клеточного материала или других загрязняющих белков из клеточного или тканевого источника, из которого происходит антитело, или по существу свободно от химических предшественников или других химических веществ, когда оно химически синтезировано.

Термины "нумерация Kabat" и подобные термины являются общепризнаными в данной области и относятся к системе нумерации аминокислотных остатков в вариабельных областях тяжелой и легкой цепей антитела или его антигенсвязывающей части (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391, и Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). При использовании системы нумерации Kabat CDR в молекуле тяжелой цепи антитела, как правило, присутствуют в положениях аминокислот с 31 по 35 ("CDR1"), в положениях аминокислот с 50 по 65 ("CDR2") и в положениях аминокислот с 95 по 102 ("CDR3"). С использованием системы нумерации Kabat CDR в молекуле легкой цепи антитела, как правило, присутствуют в положениях аминокислот с 24 по 34 (CDR1), в положениях аминокислот с 50 по 56 (CDR2) и в положениях аминокислот с 89 по 97 (CDR3).

Как используется в рамках изобретения, термин "легкая цепь", когда его используют в отношении антитела, относится к любым отдельным типам, например, каппа (κ) или лямбда (λ), исходя из аминокислотной последовательности константных доменов. Аминокислотные последовательности легкой цепи хорошо известны в данной области. В конкретных вариантах осуществления легкая цепь представляет собой легкую цепь человека.

Как используется в рамках изобретения, термин "моноклональное антитело" относится к антителу, полученному из совокупности однородных или по существу однородных антител, и каждое моноклональное антитело, как правило, распознает один эпитоп на антигене. Термин "моноклональный" не ограничивается каким-либо конкретным способом получения антитела. Как правило, популяция моноклональных антител может продуцироваться клетками, популяцией клеток или клеточной линией. В конкретных вариантах осуществления "моноклональное антитело", как используют в рамках изобретения, представляет собой антитело, продуцируемое единичной гибридомой или другой клеткой (например, клетка-хозяин, продуцирующая рекомбинантное антитело), где антитело иммуноспецифически связывается с эпитопом KIT (например, эпитоп D4 KIT человека) при определении, например, с помощью ELISA или другого анализа связывания антигена или конкурентного анализа связывания, известного в данной области или описанного в примерах настоящего описания. Моноклональные антитела, описанные в настоящем описании, можно получать, например, способом гибридом, как описано Kohler et al.; Nature, 256:495 (1975), или их можно выделять из библиотек фагового дисплея, например, с использованием способов, описанных в настоящем описании. Другие способы получения клональных клеточных линий и моноклональных антител, экспрессируемых ими, хорошо известны в данной области (см., например, Chapter 11 in: Short Protocols in Molecular Biology, (2002) 5th Ed., Ausubel et al., eds., John Wiley and Sons, New York).

Как используется в рамках изобретения, термин "поликлональные антитела" относится к популяции антител, которая включает множество различных антител, направленных на один и тот же или на различные эпитопы в антигене или антигенах. Способы получения поликлональных антител известны в данной области (см., например, Chapter 11 in: Short Protocols in Molecular Biology, (2002) 5th Ed., Ausubel et al., eds., John Wiley and Sons, New York).

Как используется в рамках изобретения, термин "рекомбинантное антитело человека" включает антитела человека, которые выделены, получены, экспрессированы или созданы рекомбинантными способами, такие как антитела, экспрессированные использованием рекомбинантного экспрессирующего вектора, трансфицированного в клетку-хозяина, антитела, выделенные из рекомбинантной комбинаторной библиотеки антител человека, выделенные антитела из животного (например, мыши, кролика, козы или коровы), которое является трансгенным и/или трансхромосомным по генам иммуноглобулинов человека (см. например, Taylor, L. D. et al. (1992) Nucl. Acids Res. 20:6287-6295) или антитела, полученные, экспрессированные, созданные или выделенные любыми другими способами, которые вовлекают создание, например, путем синтеза, генной инженерии, последовательностей ДНК, которые кодируют последовательности иммуноглобулинов человека, или сплайсинга последовательностей, которые кодируют иммуноглобулины человека, например, последовательностей генов иммуноглобулинов человека, с другими такими последовательностями. Такие рекомбинантные антитела человека могут иметь вариабельные и константные области, происходящие из последовательностей иммуноглобулинов человека эмбрионального типа. В определенных вариантах осуществления аминокислотные последовательности таких рекомбинантных антител человека модифицированы таким образом, чтобы аминокислотные последовательности областей VH и/или VL рекомбинантных антител представляли собой последовательности, которые, хотя и происходят из и являются родственными последовательностям VH и VL человека эмбрионального типа, в природе не существуют в репертуаре антител человека эмбрионального типа in vivo. В качестве неограничивающего примера, рекомбинантное антитело человека можно получать путем сборки нескольких фрагментов последовательностей человека в составную последовательность рекомбинантного антитела человека.

Как используется в рамках изобретения, термины "вариабельная область" или "вариабельный домен" относятся к части антитела, как правило, части легкой или тяжелой цепи, как правило, приблизительно N-концевым 110-120 аминокислотам в зрелой тяжелой цепи и приблизительно 90-100 аминокислотам в зрелой легкой цепи, которые значительно отличаются по последовательности среди антител и используются в связывании и специфичности конкретного антитела в отношении его конкретного антигена. Вариабельность последовательности концентрируется в областях, называемых определяющими комплементарность областями (CDR), в то время как более высококонсервативные области в вариабельном домене называют каркасными областями (FR). Без связи с каким-либо конкретным механизмом или теорией, полагают, что CDR легкой и тяжелой цепей в основном ответственны за взаимодействие антитела с антигеном. В конкретном варианте осуществления нумерация положений аминокислот антител, описанных в настоящем описании, представляет собой нумерацию в соответствии с индексом EU, как описано в Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242 ("Kabat et al."). В некоторых аспектах CDR антитела можно определять в соответствии со (i) схемой нумерации, и их обозначают в настоящем описании как "CDR Chothia " (см., например, Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948; и патент США № 7709226); или (ii) системой нумерации IMGT, например, как описано в Lefranc, M.-P., 1999, The Immunologist, 7:132-136 и Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212. В определенных вариантах осуществления вариабельная область представляет собой вариабельную область человека. В определенных вариантах осуществления вариабельная область содержит CDR грызунов и мышей и каркасные области (FR) человека. В конкретных вариантах осуществления вариабельная область представляет собой вариабельную область примата (например, не являющегося человеком примата). В определенных вариантах осуществления вариабельная область содержит CDR грызуна и мыши и каркасные области (FR) примата (например, не являющегося человеком примата). В качестве неограничивающего примера вариабельную область, описанную в настоящем описании, получают путем сборки двух или более фрагментов последовательностей человека в составную последовательность человека.

В конкретных аспектах настоящее изобретение относится к антителам (включая их антигенсвязывающие фрагменты), таким как гуманизированные антитела, которые иммуноспецифически связываются с D4 KIT человека и областью D4/D5 KIT, например, KIT человека. Аминокислотные остатки с V308 по H515 (SEQ ID NO:73) на фиг. 1 и 2 представляют собой иллюстративную область D4/D5 KIT человека, и аминокислоты с K310 по N410 (SEQ ID NO:15), как представлено на фиг. 1 и 2, представляют собой иллюстративную область D4 KIT. В другом конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с доменом D5 KIT, например, KIT человека, с более низкой аффинностью, чем с доменом D4 KIT, например, KIT человека. В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связываются с доменом D4 KIT, например, KIT человека, с более высокой аффинностью, чем с доменом D5 KIT, например, KIT человека; например, более высокая аффинность является более высокой по меньшей мере в 10 раз, 20 раз, 50 раз, 100 раз, 500 раз или 1000 раз при определении способами, известными в данной области, например, с помощью анализов ELISA или Biacore.

В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с областью D4 или D4/D5 KIT, например, KIT человека, и имеет более высокую аффинность в отношении антигена KIT, состоящего по существу только из домена D4, чем антиген KIT, по существу состоящий только из домена D5. В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с областью D4 или D4/D5 KIT, например, KIT человека, и имеет по меньшей мере в 1 раз, 2 раза, 3 раза, 4 раза, 5 раз или 10 раз более высокую аффинность в отношении антигена KIT, по существу состоящего только из домена D4, чем антиген KIT, по существу состоящий только из домена D5. В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с областью D4 или D4/D5 KIT, например, KIT человека, и обладает более высокой аффинностью (например, приблизительно в 2-3 раза более высокой аффинностью) в отношении антигена KIT, по существу состоящего только из домена D4 или только области D4/D5, чем в отношении антигена KIT, по существу состоящего только из домена D5.

В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с антигеном KIT, содержащим или по существу состоящим из аминокислотной последовательности SEQ ID NO:15. В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с доменом D4 KIT, например, KIT человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, иммуноспецифически связывается с антигеном KIT, содержащим или по существу состоящим из D4 KIT человека. В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), иммуноспецифически связывается с антигеном KIT, содержащим или по существу состоящим из аминокислотной последовательности SEQ ID NO:14 или 73.

В конкретных аспектах настоящее изобретение относится к антителам или их антигенсвязывающим фрагментам, которые иммуноспецифически связываются с полипептидом KIT (например, область D4 KIT, например, KIT человека, например, SEQ ID NO:15 [последовательность D4 человека]) и содержат аминокислотную последовательность, как описано в настоящем описании.

В конкретных аспектах настоящее изобретение относится к антителам (например, антитела человека или гуманизированные антитела), включая их антигенсвязывающие фрагменты, содержащим:

(i) CDR VH из VH-домена, содержащего аминокислотную последовательность SEQ ID NO:31 (QVQLKQSGAELVRPGASVKLSCKASGYTFTDYYINWVKQRPGQGLEWIARI

YPGSGNTYYNEKFKGKATLTAEKSSSTAYMQLSSLTSEDSAVYFCARGVYYFDYWGQGTTLTVSS) или SEQ ID NO:69 (QVQLKQSGAELVRPGASVKLSCKASGYTFTDYYINWVKQRPGQGL

EWIARIYPGSGNTYYNEKFKGKATLTAEKSSSTAYMQLSSLTSEDSAVYFCARGV

YYFDYWGQGTTLTVSA), и

(ii) CDR VL из VL-домена, содержащего аминокислотную последовательность SEQ ID NO:32 (DIVMTQSQKFMSTSVGDRVS VTCKASQNVRTNVAWYQQKPGQSPKALIYS

ASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYNSYPRTFGGGTKLEIKR).

В конкретном варианте осуществления антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, область D4 KIT человека), содержит CDR VH (SEQ ID NO:16-18) и CDR VL (SEQ ID NO:19-21), описанные в таблице 1. В конкретном варианте осуществления антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит CDR VH и CDR VL, описанные в таблице 2 (например, набор 1 или набор 2). В определенном варианте осуществления антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, область D4 KIT человека), содержит CDR VH и CDR VL, описанные в таблице 3 (CDR AbM или контактные CDR).

Таблица 1
Аминокислотные последовательности CDR
Аминокислотная последовательность SEQ ID NO:
CDR1 VL KASQNVRTNVA 19
CDR2 VL SASYRYS 20
CDR3 VL QQYNSYPRT 21
CDR1 VH DYYIN 16
CDR2 VH RIYPGSGNTYYNEKFKG 17

CDR3 VH GVYYFDY 18

Таблица 2
Аминокислотные последовательности CDR
Набор 1 Набор 2
аминокислотная последовательность SEQ ID NO: аминокислотная последовательность SEQ ID NO:
CDR1 VL KASQNVRTNVA 19 SQNVRTN 59
CDR2 VL SASYRYS 20 SAS 60
CDR3 VL QQYNSYPRT 21 YNSYPR 61
CDR1 VH GYTFTDY 56 GYTFTDY 56
CDR2 VH YPGSGN 57 PGSG 62
CDR3 VH GVYYFDYW 58 VYYFDY 63

Таблица 3
Аминокислотные последовательности CDR
AbM контактные
аминокислотная последовательность SEQ ID NO: аминокислотная последовательность SEQ ID NO:
VL CDR1 KASQNVRTNVA 19 RTNVAWY 66
VL CDR2 SASYRYS 20 ALIYSASYRY 67
VL CDR3 QQYNSYPRT 21 QQYNSYPR 68
VH CDR1 GYTFTDYYIN 64 TDYYIN 70
VH CDR2 RIYPGSGNTY 65 WIARIYPGSGNTY 71
VH CDR3 GVYYFDYW 58 ARGVYYFDY 72

В некоторых аспектах в рамках настоящего изобретения предусматриваются VH-домены (например, H1, H2, H3, H4 и H5, содержащие SEQ ID NO:2-6, соответственно) и VL-домены (например, L1, L2, L3 и L4, содержащие SEQ ID NO:7-10, соответственно). В определенных вариантах осуществления в рамках настоящего изобретения предусматриваются антитела, содержащие такие VH- и VL-домены, как указано, например, в таблице 4 (т.е. антитела Hum1-Hum20). В конкретных вариантах осуществления эти антитела содержат CDR1-3 VH и CDR1-3 VL, содержащие SEQ ID NO:16-18 и 19-21, соответственно.

В определенных вариантах осуществления антитело, описанное в настоящем описании или его антигенсвязывающий фрагмент, содержит вариабельную область легкой (VL) цепи, содержащую аминокислотную последовательность, описанную в настоящем описании, например, любую из SEQ ID NO:7-10 (например, см. фиг. 3F-3I) или SEQ ID NO:12.

В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, содержат вариабельную область тяжелой (VH) цепи, содержащую аминокислотную последовательность, описанную в настоящем описании, например, любую из SEQ ID NO:2-6 (например, см. фиг. 3A-3E) или SEQ ID NO:11.

Например, в настоящем описании описано антитело, которое иммуноспецифически связывается с полипептидом KIT (например, область D4 KIT человека) и содержит (i) VH-домен H1 (SEQ ID NO:2), H2 (SEQ ID NO:3), H3 (SEQ ID NO:4), H4 (SEQ ID NO:5) или H5 (SEQ ID NO:6) и/или (ii) VL-домен L1 (SEQ ID NO:7), L2 (SEQ ID NO:8), L3 (SEQ ID NO:9) или L4 (SEQ ID NO:10). В конкретном примере антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, могут иммуноспецифически связываться с полипептидом KIT (например, область D4 KIT человека) и содержат VH-домен и/или VL-домен любого из антител Hum1-Hum20 (см. таблицу 4). В конкретном примере антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, содержат VH-домен и/или VL-домен любого из антител Hum4, Hum8, Hum10 или Hum17.

В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H1 (SEQ ID NO:2) и L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H1 (SEQ ID NO:2) и L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H1 (SEQ ID NO:2) и L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H1 (SEQ ID NO:2) и L4 (SEQ ID NO:10). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H2 (SEQ ID NO:3) и L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H2 (SEQ ID NO:3) и L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H2 (SEQ ID NO:3) и L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H2 (SEQ ID NO:3) и L4 (SEQ ID NO:10). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H3 (SEQ ID NO:4) и L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H3 (SEQ ID NO:4) и L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H3 (SEQ ID NO:4) и L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H3 (SEQ ID NO:4) и L4 (SEQ ID NO:10). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H4 (SEQ ID NO:5) и L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H4 (SEQ ID NO:5) и L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H4 (SEQ ID NO:5) и L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H4 (SEQ ID NO:5) и L4 (SEQ ID NO:10). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H5 (SEQ ID NO:6) и L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H5 (SEQ ID NO:6) и L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H5 (SEQ ID NO:6) и L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит H5 (SEQ ID NO:6) и L4 (SEQ ID NO:10).

В некоторых аспектах антитело или его антигенсвязывающий фрагмент являются неиммуногенными у человека. В конкретном варианте осуществления неиммуногенная аминокислотная последовательность лишена эпитопов, идентифицированных как участки связывания с MHC класса II человека, например, эпитопов, которые представляют собой не являющиеся человеческими участки связывания с MHC класса II человека. В конкретном варианте осуществления аминокислотные последовательности по существу лишены эпитопов, идентифицированных как участки связывания с MHC класса II человека, например, эпитопов, которые представляют собой не являющиеся человеческими участки связывания с MHC класса II человека. Например, были разработаны инструменты in silico для идентификации положения как B-клеточных, так и T-клеточных эпитопов и для оценки потенциала в отношении иммуногенности, и такие инструменты обеспечивают альтернативу анализам иммуногенности in vitro или in vivo. Например, были разработаны компьютерные способы прогнозирования эпитопов и контролируемые вручную базы данных, содержащие экспериментально полученные данные об эпитопах (См. Bryson et al., Biodrugs, 2010, 24(1): 1-8). Неограничивающие примеры баз данных эпитопов включают Immune Epitope Database (IEDB) и запатентованную T Cell Epitope Database™ (TCED™). Такие базы данных эпитопов можно использовать отдельно или в комбинации с анализами in vitro, описанными в данной области, например, анализами связывания MHC класса II и анализами активации или пролиферации T-клеток. Альтернативно такие анализы in vitro можно использовать независимо от таких баз данных эпитопов. Способы определения иммуногенности средства, такого как антитела, или устранения или снижения иммуногенности средства, такого как антитело, описаны в данной области, см., например, Altschul et al., Nucleic Acids Res., 1997, 25:3389-3402; Baker et al., Curr. Opin. Drug Discov. Devel., 2007, 10:219; Hill et al., Arthritis Res. Ther., 2003, 1:R40-R48; Jones et al., J. Thromb. Haemost., 2005, 3:991-1000; Holgate et al., IDrugs, 2009, 12:233-237; Jones et al., Methods Mol. Biol., 2009, 525:405-423; и Baker et al., Curr. Drug Saf., 2010, 5:308-313. В конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с областью D4 KIT человека, содержит VH-домен и VL-домен, которые являются неиммуногенными при определении с помощью T Cell Epitope Database™ (TCED™). В определенном варианте осуществления антитело, описанное в настоящем описании, иммуноспецифически связывается с областью D4 KIT человека и содержит VH-домен и VL-домен, которые являются неиммуногенными при определении в анализе in vitro, описанном в данной области, см., например, Wang et al., 2008, PLoS Coomputational Biology, 2008, 4(4):e1000048; и Arnold et al., 2002, J. Immunol., 169:739-749.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VH-домен, который обладает по меньшей мере 93% идентичностью последовательности с H1 (SEQ ID NO:2). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, который обладает по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с H1 (SEQ ID NO:2). В конкретном варианте осуществления VH-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержат VH-домен, содержащий CDR1 VH, CDR2 VH, и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VH-домен, который обладает по меньшей мере 92% идентичностью последовательности с H2 (SEQ ID NO:3). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), или его антигенсвязывающий фрагмент, содержат VH-домен, который обладает по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с H2 (SEQ ID NO:3). В конкретном варианте осуществления VH-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержат VH-домен, содержащий CDR1 VH, CDR2 VH, и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VH-домен, который обладает по меньшей мере 90% идентичностью последовательности с H3 (SEQ ID NO:4). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VH-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с H3 (SEQ ID NO:4). В конкретном варианте осуществления VH-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержат VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VH-домен, который обладает по меньшей мере 87% идентичностью последовательности с H4 (SEQ ID NO:5). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VH-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с H4 (SEQ ID NO:5). В конкретном варианте осуществления VH-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VH-домен, который обладает по меньшей мере 86% идентичностью последовательности с H5 (SEQ ID NO:6). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VH-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с H5 (SEQ ID NO:6). В конкретном варианте осуществления VH-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержат VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VL-домен, который обладает по меньшей мере 90% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VL-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело, или его антигенсвязывающий фрагмент, содержат VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VL-домен, который обладает по меньшей мере 88% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления антитело, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержат VL-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VL-домен, который обладает по меньшей мере 87% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VL-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие VL-домен, который обладает по меньшей мере 84% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат VL-домен, который обладает по меньшей мере 92%, по меньшей мере 93%, по меньшей мере 94%, или по меньшей мере 95%, или по меньшей мере 96%, или по меньшей мере 97%, или по меньшей мере 98%, или по меньшей мере 99% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 93% или по меньшей мере 95% идентичностью последовательности с H1 (SEQ ID NO:2); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 92% или по меньшей мере 94% идентичностью последовательности с H2 (SEQ ID NO:3); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с H3 (SEQ ID NO:4); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с H4 (SEQ ID NO:5); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 86% или по меньшей мере 88% идентичностью последовательности с H5 (SEQ ID NO:6); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с L1 (SEQ ID NO:7). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 93% или по меньшей мере 95% идентичностью последовательности с H1 (SEQ ID NO:2); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 88% или по меньшей мере 90% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 92% или по меньшей мере 94% идентичностью последовательности с H2 (SEQ ID NO:3); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 88% или по меньшей мере 90% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с H3 (SEQ ID NO:4); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 88% или по меньшей мере 90% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с H4 (SEQ ID NO:5); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 88% или по меньшей мере 90% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 86% или по меньшей мере 88% идентичностью последовательности с H5 (SEQ ID NO:6); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 88% или по меньшей мере 90% идентичностью последовательности с L2 (SEQ ID NO:8). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 93% или по меньшей мере 95% идентичностью последовательности с H1 (SEQ ID NO:2); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 92% или по меньшей мере 94% идентичностью последовательности с H2 (SEQ ID NO:3); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с H3 (SEQ ID NO:4); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с H4 (SEQ ID NO:5); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 86% или по меньшей мере 88% идентичностью последовательности с H5 (SEQ ID NO:6); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с L3 (SEQ ID NO:9). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 93% или по меньшей мере 95% идентичностью последовательности с H1 (SEQ ID NO:2); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 84% или по меньшей мере 86% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 92% или по меньшей мере 94% идентичностью последовательности с H2 (SEQ ID NO:3); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 84% или по меньшей мере 86% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 90% или по меньшей мере 92% идентичностью последовательности с H3 (SEQ ID NO:4); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 84% или по меньшей мере 86% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 87% или по меньшей мере 90% идентичностью последовательности с H4 (SEQ ID NO:5); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 84% или по меньшей мере 86% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие (i) VH-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 86% или по меньшей мере 88% идентичностью последовательности с H5 (SEQ ID NO:6); и (ii) VL-домен, содержащий аминокислотную последовательность, которая обладает по меньшей мере 84% или по меньшей мере 86% идентичностью последовательности с L4 (SEQ ID NO:10). В конкретном варианте осуществления VL- и VH-домены являются неиммуногенными, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II. В определенном варианте осуществления такое антитело или его антигенсвязывающий фрагмент содержат CDR1-3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и CDR1-3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно.

Для определения процентной идентичности двух аминокислотных последовательностей или двух последовательностей нуклеиновой кислоты, последовательности выравнивают в целях оптимального сравнения (например, в последовательность первой аминокислотной последовательности или последовательности нуклеиновой кислоты можно вносить пропуски для оптимального выравнивания со второй аминокислотной последовательностью или последовательностью нуклеиновой кислоты). Затем сравнивают аминокислотные остатки или нуклеотиды в соответствующих положениях аминокислот или нуклеотидных положениях. Когда положение в первой последовательности занимает тот же аминокислотный остаток или нуклеотид, что и соответствующее положение во второй последовательности, тогда молекулы являются идентичными в этом положении. Процентная идентичность между двумя последовательностями является функцией количества идентичных положений, которые имеют последовательности (т.е. % идентичность = количество идентичных перекрывающихся положений/общее количество положений×100%). В одном из вариантов осуществления две последовательности имеют одинаковую длину. В определенном варианте осуществления процентную идентичность определяют по всей длине аминокислотной последовательности или нуклеотидной последовательности.

Определение процентной идентичности между двумя последовательностями (например, аминокислотные последовательности или последовательности нуклеиновых кислот) также можно проводить с использованием математического алгоритма. Предпочтительным неограничивающим примером математического алгоритма, используемого для сравнения двух последовательностей, является алгоритм Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2264 2268, модифицированный согласно Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873 5877. Такой алгоритм включен в программы NBLAST и XBLAST, Altschul et al., 1990, J. Mol. Biol. 215:403. Нуклеотидный поиск в BLAST можно проводить с помощью параметров программы для нуклеотидов NBLAST, например, показатель score=100, длина слова=12, для получения нуклеотидных последовательностей, гомологичных молекулам нуклеиновой кислоты, описанным в настоящем описании. Поиск белков в BLAST можно проводить с помощью параметров программы XBLAST, установленных, например, как показатель score=50, длина слова=3 для получения аминокислотных последовательностей, гомологичных молекуле белка, описанной в настоящем описании. Для проведения выравнивания с пропусками для целей сравнения, можно использовать Gapped BLAST, как описано в Altschul et al., 1997, Nucleic Acids Res. 25:3389 3402. Альтернативно можно использовать PSI BLAST для проведения итеративного поиска, который выявляет отдаленные взаимосвязи между молекулами (там же). При использовании программ BLAST, Gapped BLAST и PSI Blast можно использовать параметры по умолчанию для соответствующих программ (например, XBLAST и NBLAST) (см., например, National Center for Biotechnology Information (NCBI) во всемирной сети, ncbi.nlm.nih.gov). Другим неограничивающим примером математического алгоритма, используемого для сравнения последовательностей, является алгоритм Myers and Miller, 1988, CABIOS 4:11 17. Такой алгоритм включен в программу ALIGN (версия 2.0), которая является частью пакета программ по выравниванию последовательностей GCG. При использовании программы ALIGN для сравнения аминокислотных последовательностей можно использовать таблицу веса остатков PAM120, штраф за продолжение пропуска 12, и штраф за пропуск 4.

Процентную идентичность между двумя последовательностями можно определять с использованием способов, сходных со способами, описанными выше, допускающих или не допускающих пропуски. При вычислении процентной идентичности, как правило, подсчитывают только точные совпадения.

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и одну, две, три или четыре каркасных области H1, H2, H3, H4 или H5 (см. таблицу 5A); и/или (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и одну, две, три или четыре каркасных области L1, L2, L3 или L4 (см. таблицу 5B).

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасную область FR1 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасную область FR2 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасную область FR3 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасную область FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1 и FR2 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1, FR2 и FR3 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1, FR2, FR3 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1 и FR3 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1, FR3 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1, FR2 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело человека или гуманизированное антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR2 и FR3 из H1, H2, H3, H4 или H5. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR2, FR3 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR3 и FR4 из H1, H2, H3, H4 или H5.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасную область FR1 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасную область FR2 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасную область FR3 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасную область FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1 и FR2 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1, FR2 и FR3 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1, FR2, FR3 и FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1 и FR3 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1, FR3 и FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1 и FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR1, FR2 и FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR2 и FR3 из L1, L2, L3 или L4. В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR2, FR3 и FR4 из L1, L2, L3 или L4.

В одном из вариантов осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT человека), содержит VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и каркасные области FR3 и FR4 из L1, L2, L3 или L4.

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно, и каркасные области FR1-FR4 любого из VH-доменов HH257-HH281 (см. таблицу 5C); и (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно, и FR1-FR4 любого из доменов VL LL65-LL76 (см. таблицу 5D).

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие комбинацию аминокислотных последовательностей, указанных в таблице 2 или 3, и каркасные области FR1-FR4 любого из VH-доменов H1-H5 (таблица 5A) и HH257-HH281 (см. таблицу 5C); и (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие комбинацию аминокислотных последовательностей, указанных либо в таблице 2 (набор 1 или набор 2), либо в таблице 3 (CDR AbM или контактные CDR), соответственно, и FR1-FR4 любого из VL-доменов L1-L4 (таблица 5B) и LL65-LL76 (см. таблицу 5D).

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие комбинацию аминокислотных последовательностей, указанных в таблице 2 или 3, и соответствующие каркасные области FR1-FR4, содержащие последовательности, фланкирующие CDR VH, например, как представлено на любой из фиг. 3A-3I; и (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие комбинацию аминокислотных последовательностей, указанных либо в таблице 2 (набор 1 или набор 2), либо в таблице 3 (CDR AbM или контактные CDR), соответственно, и соответствующие каркасные области FR1-FR4, содержащие последовательности, фланкирующие CDR VL, например, как представлено на любой из фиг. 3A-3I.

Таблица 5A
Каркасные области (FR) VH-домена
VH FR1 VH FR2 VH FR3 VH FR4
H1 QVQLVQSGAELKKPGASVKLSCKASGYTFT
(SEQ ID NO:33)
WVKQAPGKGLEWIA
(SEQ ID NO:34)
RATLTAEKSTSTAYMQLSSLRSEDSAVYFCAR
(SEQ ID NO:35)
WGQGTTVTVSS
(SEQ ID NO:36)
H2 QVQLVQSGAEVKKPGASVKLSCKASGYTFT
(SEQ ID NO:37)
WVKQAPGKGLEWIA
(SEQ ID NO:34)
RATLTAEKSTSTAYMQLSSLRSEDTAVYFCAR
(SEQ ID NO:38)
WGQGTTVTVSS
(SEQ ID NO:36)
H3 QVQLVQSGAEVKKPGASVKLSCKASGYTFT
(SEQ ID NO:37)
WVRQAPGKGLEWIA
(SEQ ID NO:39)
RATLTADKSTSTAYMQLSSLRSEDTAVYFCAR
(SEQ ID NO:40)
WGQGTTVTVSS
(SEQ ID NO:36)
H4 QVQLVQSGAEVKKPGASVKVSCKASGYTFT
(SEQ ID NO:41)
WVRQAPGKGLEWIA
(SEQ ID NO:39)
RATITADKSTSTAYMELSSLRSEDTAVYFCAR
(SEQ ID NO:42)
WGQGTTVTVSS
(SEQ ID NO:36)
H5 QVQLVQSGAEVKKPGASVKVSCKASGYTFT
(SEQ ID NO:41)
WVRQAPGKGLEWIA
(SEQ ID NO:39)
RVTITADKSTSTAYMELSSLRSEDTAVYFCAR
(SEQ ID NO:43)
WGQGTTVTVSS
(SEQ ID NO:36)

Таблица 5B
Каркасные области VL-домена (FR)
VL FR1 VL FR2 VL FR3 VL FR4
L1 DIVMTQSPSFLSASVGDRVTITC
(SEQ ID NO:44)
WYQQKPGKAPKALIY
(SEQ ID NO:45)
GVPDRFTGSGSGTDFTLTISSLQSEDFADYFC
(SEQ ID NO:46)
FGGGTKVEIK
(SEQ ID NO:47)
L2 DIVMTQSPSSLSASVGDRVTITC
(SEQ ID NO:48)
WYQQKPGKAPKALIY
(SEQ ID NO:45)
GVPDRFTGSGSGTDFTLTISSLQPEDFADYFC
(SEQ ID NO:49)
FGGGTKVEIK
(SEQ ID NO:47)
L3 DIVMTQSPSSLSASVGDRVTITC
(SEQ ID NO:48)
WYQQKPGKAPKALIY
(SEQ ID NO:45)
GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC
(SEQ ID NO:50)
FGGGTKVEIK
(SEQ ID NO:47)
L4 DIVMTQSPSSLSASVGDRVTITC
(SEQ ID NO:48)
WYQQKPGKAPKSLIY
(SEQ ID NO:51)
GVPDRFSGSGSGTDFTLTISSLQPEDFATYYC
(SEQ ID NO:52)
FGGGTKVEIK
(SEQ ID NO:47)

Таблица 5C
Последовательности каркасной области VH-доменов с HH257 по HH281
VH-домен VH FR1 VH FR2 VH FR3 VH FR4
НН257 SEQ ID NO:33 SEQ ID NO:39 SEQ ID NO:35 SEQ ID NO:36
НН258 SEQ ID NO:33 SEQ ID NO:34 SEQ ID NO:38 SEQ ID NO:36
НН259 SEQ ID NO:33 SEQ ID NO:39 SEQ ID NO:38 SEQ ID NO:36
НН260 SEQ ID NO:33 SEQ ID NO:34 SEQ ID NO:40 SEQ ID NO:36
НН261 SEQ ID NO:33 SEQ ID NO:39 SEQ ID NO:40 SEQ ID NO:36
НН262 SEQ ID NO:33 SEQ ID NO:34 SEQ ID NO:42 SEQ ID NO:36
НН263 SEQ ID NO:33 SEQ ID NO:39 SEQ ID NO:42 SEQ ID NO:36
НН264 SEQ ID NO:33 SEQ ID NO:34 SEQ ID NO:43 SEQ ID NO:36
НН265 SEQ ID NO:33 SEQ ID NO:39 SEQ ID NO:43 SEQ ID NO:36
НН266 SEQ ID NO:37 SEQ ID NO:34 SEQ ID NO:35 SEQ ID NO:36
НН267 SEQ ID NO:37 SEQ ID NO:39 SEQ ID NO:35 SEQ ID NO:36
НН268 SEQ ID NO:37 SEQ ID NO:39 SEQ ID NO:38 SEQ ID NO:36
НН269 SEQ ID NO:37 SEQ ID NO:34 SEQ ID NO:40 SEQ ID NO:36
НН270 SEQ ID NO:37 SEQ ID NO:34 SEQ ID NO:42 SEQ ID NO:36
НН271 SEQ ID NO:37 SEQ ID NO:39 SEQ ID NO:42 SEQ ID NO:36

НН272 SEQ ID NO:37 SEQ ID NO:34 SEQ ID NO:43 SEQ ID NO:36
НН273 SEQ ID NO:37 SEQ ID NO:39 SEQ ID NO:43 SEQ ID NO:36
НН274 SEQ ID NO:41 SEQ ID NO:34 SEQ ID NO:35 SEQ ID NO:36
НН275 SEQ ID NO:41 SEQ ID NO:39 SEQ ID NO:35 SEQ ID NO:36
НН276 SEQ ID NO:41 SEQ ID NO:34 SEQ ID NO:38 SEQ ID NO:36
НН277 SEQ ID NO:41 SEQ ID NO:39 SEQ ID NO:38 SEQ ID NO:36
НН278 SEQ ID NO:41 SEQ ID NO:34 SEQ ID NO:40 SEQ ID NO:36
НН279 SEQ ID NO:41 SEQ ID NO:39 SEQ ID NO:40 SEQ ID NO:36
НН280 SEQ ID NO:41 SEQ ID NO:34 SEQ ID NO:42 SEQ ID NO:36
НН281 SEQ ID NO:41 SEQ ID NO:34 SEQ ID NO:43 SEQ ID NO:36

Таблица 5D
Последовательности каркасной области VL-доменов с LL65 по LL76
VL-домен VL FR1 VL FR2 VL FR3 VL FR4
LL65 SEQ ID NO:44 SEQ ID NO:51 SEQ ID NO:46 SEQ ID NO:47
LL66 SEQ ID NO:44 SEQ ID NO:45 SEQ ID NO:49 SEQ ID NO:47
LL67 SEQ ID NO:44 SEQ ID NO:51 SEQ ID NO:49 SEQ ID NO:47
LL68 SEQ ID NO:44 SEQ ID NO:45 SEQ ID NO:50 SEQ ID NO:47
LL69 SEQ ID NO:44 SEQ ID NO:51 SEQ ID NO:50 SEQ ID NO:47
LL70 SEQ ID NO:44 SEQ ID NO:45 SEQ ID NO:52 SEQ ID NO:47
LL71 SEQ ID NO:44 SEQ ID NO:51 SEQ ID NO:52 SEQ ID NO:47
LL72 SEQ ID NO:48 SEQ ID NO:45 SEQ ID NO:46 SEQ ID NO:47
LL73 SEQ ID NO:48 SEQ ID NO:51 SEQ ID NO:46 SEQ ID NO:47
LL74 SEQ ID NO:48 SEQ ID NO:51 SEQ ID NO:49 SEQ ID NO:47
LL75 SEQ ID NO:48 SEQ ID NO:51 SEQ ID NO:50 SEQ ID NO:47
LL76 SEQ ID NO:48 SEQ ID NO:45 SEQ ID NO:52 SEQ ID NO:47

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело (например, антитело человека или гуманизированное антитело), или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO:11), где XH1 в положении 11 в соответствии с Kabat, XH2 в положении 20 в соответствии с Kabat, XH3 в положении 38 в соответствии с Kabat, XH4 в положении 67 в соответствии с Kabat, XH5 в положении 69 в соответствии с Kabat, XH6 в положении 72 в соответствии с Kabat, XH7 в положении 81 в соответствии с Kabat и XH8 в положении 87 в соответствии с Kabat независимо выбраны из любой аминокислоты; и/или (ii) VL-домен, содержащий аминокислотную последовательность DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO:12), где XK1 в положении 10 в соответствии с Kabat, XK2 в положении 46 в соответствии с Kabat, XK3 в положении 63 в соответствии с Kabat, XK4 в положении 80 в соответствии с Kabat, XK5 в положении 85 в соответствии с Kabat, и XK6 в положении 87 в соответствии с Kabat независимо выбраны из любой аминокислоты. В конкретном варианте осуществления VH- и/или VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II.

В конкретном аспекте в рамках настоящего изобретения предусматриваются антитело, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержащие: (i) VH-домен, содержащий аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO:11), где XH1 в положении 11 в соответствии с Kabat, XH2 в положении 20 в соответствии с Kabat, XH3 в положении 38 в соответствии с Kabat, XH4 в положении 67 в соответствии с Kabat, XH5 в положении 69 в соответствии с Kabat, XH6 в положении 72 в соответствии с Kabat, XH7 в положении 81 в соответствии с Kabat, и XH8 в положении 87 в соответствии с Kabat выбраны из комбинации аминокислот, приведенной в таблице 6B; и/или (ii) VL-домен, содержащий аминокислотную последовательность: DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO:12), где XK1 в положении 10 в соответствии с Kabat, XK2 в положении 46 в соответствии с Kabat, XK3 в положении 63 в соответствии с Kabat, XK4 в положении 80 в соответствии с Kabat, XK5 в положении 85 в соответствии с Kabat, и XK6 в положении 87 в соответствии с Kabat выбраны из комбинации аминокислот, представленной в таблице 6A. В конкретном варианте осуществления VH- и/или VL-домен является неиммуногенным, например, как определяют по отсутствию эпитопов, которые связываются с MHC класса II, например, не являющихся человеческими участков эмбрионального типа, связывающихся с MHC класса II.

В одном из вариантов осуществления XH1 в положении 11 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, аминокислота с разветвленной цепью (BCAA) с гидрофобной боковой цепью или неполярной боковой цепью), такую как L или V. В одном из вариантов осуществления XH2 в положении 20 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, аминокислота с разветвленной цепью (BCAA) с гидрофобной боковой цепью или неполярной боковой цепью), такую как L или V. В одном из вариантов осуществления XH3 в положении 38 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью (например, аминокислота с разветвленной цепью (BCAA) с гидрофильной боковой цепью, основной боковой цепью или заряженной боковой цепью, например, положительно заряженной боковой цепью или отрицательно заряженной боковой цепью), такую как K или R. В одном из вариантов осуществления XH4 в положении 67 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, аминокислота с разветвленной цепью (BCAA) с гидрофобной боковой цепью или неполярной боковой цепью), такую как V или A. В одном из вариантов осуществления XH5 в положении 69 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, аминокислота с разветвленной цепью (BCAA) с гидрофобной боковой цепью или неполярной боковой цепью), такую как L или I. В одном из вариантов осуществления XH6 в положении 72 в соответствии с Kabat представляет собой аминокислоту с кислотной боковой цепью, такую как E или D. В одном из вариантов осуществления XH7 в положении 81 в соответствии с Kabat представляет собой аминокислоту с кислотной боковой цепью или ее амидное производное, такие как Q (незаряженная/амидное производное E) или E. В одном из вариантов осуществления XH8 в положении 87 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксильной группой или гидрофильной боковой цепью, такую как S или T.

В одном из вариантов осуществления XH1 в положении 11 в соответствии с Kabat представляет собой алифатическую аминокислоту, такую как аминокислота с разветвленной цепью (BCAA), например, V; XH2 в положении 20 в соответствии с Kabat представляет собой алифатическую аминокислоту, такую как аминокислота с разветвленной цепью (BCAA), например, L; XH3 в положении 38 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как R; XH4 в положении 67 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A; XH5 в положении 69 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как L; XH6 в положении 72 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как D; XH7 в положении 81 в соответствии с Kabat представляет собой аминокислоту, являющуюся амидным производным кислотной аминокислоты, таким как Q; и XH8 в положении 87 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T.

В одном из вариантов осуществления XH1 в положении 11 в соответствии с Kabat представляет собой алифатическую аминокислоту, такую как аминокислота с разветвленной цепью (BCAA), например, V; XH2 в положении 20 в соответствии с Kabat представляет собой алифатическую аминокислоту, такую как аминокислота с разветвленной цепью (BCAA), например, V; XH3 в положении 38 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как R; XH4 в положении 67 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A; XH5 в положении 69 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как I; XH6 в положении 72 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как D; XH7 в положении 81 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как E; и XH8 в положении 87 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T.

В конкретном варианте осуществления XK1 в положении 10 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F, или аминокислоту с алифатической гидроксильной боковой цепью, такую как S. В определенном варианте осуществления XK2 в положении 46 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, гидрофобную аминокислоту), такую как A или аминокислоту с алифатической гидроксильной боковой цепью, такую как S. В одном из вариантов осуществления XK3 в положении 63 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T или S. В конкретном варианте осуществления XK4 в положении 80 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как S, или ароматическую аминокислоту, такую как P. В определенном варианте осуществления XK5 в положении 85 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D или аминокислоту с алифатической гидроксильной боковой цепью, такую как T. В одном из вариантов осуществления XK6 в положении 87 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F или Y.

В конкретном варианте осуществления XK1 в положении 10 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как S; XK2 в положении 46 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, гидрофобную аминокислоту), такую как A; XK3 в положении 63 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T; XK4 в положении 80 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как P; XK5 в положении 85 в соответствии с Kabat представляет собой кислотную аминокислоту, такую D; и XK6 в положении 87 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F.

В конкретном варианте осуществления XK1 в положении 10 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F; XK2 в положении 46 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью (например, гидрофобную аминокислоту), такую как A; XK3 в положении 63 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T; XK4 в положении 80 в соответствии с Kabat представляет собой алифатическую гидроксильную боковую цепь, такую как S; XK5 в положении 85 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D; и XK6 в положении 87 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат: (i) VH-домен, содержащий аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO:11), где XH1 в положении 11 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как V, XH2 в положении 20 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как L, XH3 в положении 38 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как K, XH4 в положении 67 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A, XH5 в положении 69 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как L, XH6 в положении 72 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D, XH7 в положении 81 в соответствии с Kabat представляет собой кислотную аминокислоту или ее амидное производное, такую как Q, и XH8 в положении 87 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T; и (ii) VL-домен, содержащий аминокислотную последовательность DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO:12), где XK1 в положении 10 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как S, XK2 в положении 46 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A, XK3 в положении 63 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T, XK4 в положении 80 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как P, XK5 в положении 85 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D, и XK6 в положении 87 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат: (i) VH-домен, содержащий аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO:11), где XH1 в положении 11 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как V, XH2 в положении 20 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью такую как V, XH3 в положении 38 в соответствии с Kabat представляет собой аминокислоту с полярной боковой цепью, такую как R, XH4 в положении 67 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A, XH5 в положении 69 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как I, XH6 в положении 72 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D, XH7 в положении 81 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как E, и XH8 в положении 87 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T; и (ii) VL-домен, содержащий аминокислотную последовательность DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO:12), где XK1 в положении 10 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F, XK2 в положении 46 в соответствии с Kabat представляет собой аминокислоту с алифатической боковой цепью, такую как A, XK3 в положении 63 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как T, XK4 в положении 80 в соответствии с Kabat представляет собой аминокислоту с алифатической гидроксилсодержащей боковой цепью, такую как S, XK5 в положении 85 в соответствии с Kabat представляет собой кислотную аминокислоту, такую как D, и XK6 в положении 87 в соответствии с Kabat представляет собой ароматическую аминокислоту, такую как F.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно; и (ii) VL-домен, содержащий SEQ ID NO:7, 8, 9 или 10.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат (i) VH-домен, содержащий CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, соответственно; и (ii) VL-домен, содержащий аминокислотную последовательность DIVMTQSPSXK1LSASVGDRVTITCKASQNVRTNVAWYQQKPGKAPKXK2LIYSASYRYSGVPDRFXK3GSGSGTDFTLTISSLQXK4EDFAXK5YXK6CQQYNSYPRTFGGGTKVEIK (SEQ ID NO:12), где XK1 в положении 10 в соответствии с Kabat, XK2 в положении 46 в соответствии с Kabat, XK3 в положении 63 в соответствии с Kabat, XK4 в положении 80 в соответствии с Kabat, XK5 в положении 85 в соответствии с Kabat, и XK6 в положении 87 в соответствии с Kabat выбраны из комбинации аминокислот, приведенной в таблице 6A.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат (i) VH-домен, содержащий аминокислотную последовательность SEQ ID NO:2, 3, 4 или 5; и (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT человека), содержат (i) VH-домен, содержащий аминокислотную последовательность: QVQLVQSGAEXH1KKPGASVKXH2SCKASGYTFTDYYINWVXH3QAPGKGLEWIARIYPGSGNTYYNEKFKGRXH4TXH5TAXH6KSTSTAYMXH7LSSLRSEDXH8AVYFCARGVYYFDYWGQGTTVTVSS (SEQ ID NO:11), где XH1 в положении 11 в соответствии с Kabat, XH2 в положении 20 в соответствии с Kabat, XH3 в положении 38 в соответствии с Kabat, XH4 в положении 67 в соответствии с Kabat, XH5 в положении 69 в соответствии с Kabat, XH6 в положении 72 в соответствии с Kabat, XH7 в положении 81 в соответствии с Kabat, и XH8 в положении 87 в соответствии с Kabat выбраны из комбинации аминокислот, приведенных в таблице 6B; и (ii) VL-домен, содержащий CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, соответственно.

Таблица 6A
Аминокислотные замены домена VK
XK1 XK2 XK3 XK4 XK5 XK6
Положение по Kabat 10 46 63 80 85 87
Числовое положение SEQ ID NO:12 10 46 63 80 85 87
Боковая цепь аминокислоты Ароматическая или алифатическая гидроксил-содержащая Алифатическая или алифатическая гидроксил-содержащая алифатическая гидроксил-содержащая Пролин или алифатическая гидроксил-
содержащая
Заряженная или кислотная ароматическая
L1 F A T S D F
L2 S A T P D F
L3 S A T P D F
L4 S S S P T Y
LL1 S A T S D F

LL2 F S T S D F
LL3 S S T S D F
LL4 F A S S D F
LL5 S A S S D F
LL6 F S S S D F
LL7 S S S S D F
LL8 F A T P D F
LL9 S A T P D F
LL10 F S T P D F
LL11 S S T P D F
LL12 F A S P D F
LL13 S A S P D F
LL14 F S S P D F
LL15 S S S P D F
LL16 F A T S T F
LL17 S A T S T F
LL18 F S T S T F
LL19 S S T S T F
LL20 F A S S T F
LL21 S A S S T F
LL22 F S S S T F
LL23 S S S S T F

LL24 F A T P T F
LL25 S A T P T F
LL26 F S T P T F
LL27 S S T P T F
LL28 F A S P T F
LL29 S A S P T F
LL30 F S S P T F
LL31 S S S P T F
LL32 S A T S D Y
LL33 F S T S D Y
LL34 S S T S D Y
LL35 F A S S D Y
LL36 S A S S D Y
LL37 F S S S D Y
LL38 S S S S D Y
LL39 F A T P D Y
LL40 S A T P D Y
LL41 F S T P D Y
LL42 S S T P D Y
LL43 F A S P D Y
LL44 S A S P D Y
LL45 F S S P D Y

LL46 S S S P D Y
LL47 F A T S T Y
LL48 S A T S T Y
LL49 F S T S T Y
LL50 S S T S T Y
LL51 F A S S T Y
LL52 S A S S T Y
LL53 F S S S T Y
LL54 S S S S T Y
LL55 F A T P T Y
LL56 S A T P T Y
LL57 F S T P T Y
LL58 S S T P T Y
LL59 F A S P T Y
LL60 S A S P T Y
LL61 F S S P T Y
LL62 S S S P T Y

Таблица 6B
Аминокислотные замены VH-домена
XH1 XH2 XH3 XH4 XH5 XH6 XH7 XH8
Положение по Kabat 11 20 38 67 69 72 81 87
Числовое положение в SEQ ID NO:11 11 20 38 68 70 73 82 91
Боковая цепь аминокислоты Алифатическая Алифатическия Полярная или основная Алифатическая Алифатическая Кислотная Кислотная или амидное производное алифатическая гидроксил-содержащая
H1 L L K A L E Q S
H2 V L K A L E Q T
H3 V L R A L D Q T
H4 V V R A I D E T
H5 V V R V I D E T
HH1 L L K A L E Q S
HH2 V L K A L E Q S
HH3 L V K A L E Q S

HH4 V V K A L E Q S
HH5 L L R A L E Q S
HH6 V L R A L E Q S
HH7 L V R A L E Q S
HH8 V V R A L E Q S
HH9 L L K V L E Q S
HH10 V L K V L E Q S
HH11 L V K V L E Q S
HH12 V V K V L E Q S
HH13 L L R V L E Q S
HH14 V L R V L E Q S
HH15 L V R V L E Q S
HH16 V V R V L E Q S
HH17 L L K A I E Q S
HH18 V L K A I E Q S
HH19 L V K A I E Q S
HH20 V V K A I E Q S
HH21 L L R A I E Q S
HH22 V L R A I E Q S
HH23 L V R A I E Q S
HH24 V V R A I E Q S
HH25 L L K V I E Q S

HH26 V L K V I E Q S
HH27 L V K V I E Q S
HH28 V V K V I E Q S
HH29 L L R V I E Q S
HH30 V L R V I E Q S
HH31 L V R V I E Q S
HH32 V V R V I E Q S
HH33 L L K A L D Q S
HH34 V L K A L D Q S
HH35 L V K A L D Q S
HH36 V V K A L D Q S
HH37 L L R A L D Q S
HH38 V L R A L D Q S
HH39 L V R A L D Q S
HH40 V V R A L D Q S
HH41 L L K V L D Q S
HH42 V L K V L D Q S
HH43 L V K V L D Q S
HH44 V V K V L D Q S
HH45 L L R V L D Q S
HH46 V L R V L D Q S
HH47 L V R V L D Q S

HH48 V V R V L D Q S
HH49 L L K A I D Q S
HH50 V L K A I D Q S
HH51 L V K A I D Q S
HH52 V V K A I D Q S
HH53 L L R A I D Q S
HH54 V L R A I D Q S
HH55 L V R A I D Q S
HH56 V V R A I D Q S
HH57 L L K V I D Q S
HH58 V L K V I D Q S
HH59 L V K V I D Q S
HH60 V V K V I D Q S
HH61 L L R V I D Q S
HH62 V L R V I D Q S
HH63 L V R V I D Q S
HH64 V V R V I D Q S
HH65 L L K A L E E S
HH66 V L K A L E E S
HH67 L V K A L E E S
HH68 V V K A L E E S
HH69 L L R A L E E S

HH70 V L R A L E E S
HH71 L V R A L E E S
HH72 V V R A L E E S
HH73 L L K V L E E S
HH74 V L K V L E E S
HH75 L V K V L E E S
HH76 V V K V L E E S
HH77 L L R V L E E S
HH78 V L R V L E E S
HH79 L V R V L E E S
HH80 V V R V L E E S
HH81 L L K A I E E S
HH82 V L K A I E E S
HH83 L V K A I E E S
HH84 V V K A I E E S
HH85 L L R A I E E S
HH86 V L R A I E E S
HH87 L V R A I E E S
HH88 V V R A I E E S
HH89 L L K V I E E S
HH90 V L K V I E E S
HH91 L V K V I E E S

HH92 V V K V I E E S
HH93 L L R V I E E S
HH94 V L R V I E E S
HH95 L V R V I E E S
HH96 V V R V I E E S
HH97 L L K A L D E S
HH98 V L K A L D E S
HH99 L V K A L D E S
HH100 V V K A L D E S
HH101 L L R A L D E S
HH102 V L R A L D E S
HH103 L V R A L D E S
HH104 V V R A L D E S
HH105 L L K V L D E S
HH106 V L K V L D E S
HH107 L V K V L D E S
HH108 V V K V L D E S
HH109 L L R V L D E S
HH110 V L R V L D E S
HH111 L V R V L D E S
HH112 V V R V L D E S
HH113 L L K A I D E S

HH114 V L K A I D E S
HH115 L V K A I D E S
HH116 V V K A I D E S
HH117 L L R A I D E S
HH118 V L R A I D E S
HH119 L V R A I D E S
HH120 V V R A I D E S
HH121 L L K V I D E S
HH122 V L K V I D E S
HH123 L V K V I D E S
HH124 V V K V I D E S
HH125 L L R V I D E S
HH126 V L R V I D E S
HH127 L V R V I D E S
HH128 V V R V I D E S
HH129 L L K A L E Q T
HH130 V L K A L E Q T
HH131 L V K A L E Q T
HH132 V V K A L E Q T
HH133 L L R A L E Q T
HH134 V L R A L E Q T
HH135 L V R A L E Q T

HH136 V V R A L E Q T
HH137 L L K V L E Q T
HH138 V L K V L E Q T
HH139 L V K V L E Q T
HH140 V V K V L E Q T
HH141 L L R V L E Q T
HH142 V L R V L E Q T
HH143 L V R V L E Q T
HH144 V V R V L E Q T
HH145 L L K A I E Q T
HH146 V L K A I E Q T
HH147 L V K A I E Q T
HH148 V V K A I E Q T
HH149 L L R A I E Q T
HH150 V L R A I E Q T
HH151 L V R A I E Q T
HH152 V V R A I E Q T
HH153 L L K V I E Q T
HH154 V L K V I E Q T
HH155 L V K V I E Q T
HH156 V V K V I E Q T
HH157 L L R V I E Q T

HH158 V L R V I E Q T
HH159 L V R V I E Q T
HH160 V V R V I E Q T
HH161 L L K A L D Q T
HH162 V L K A L D Q T
HH163 L V K A L D Q T
HH164 V V K A L D Q T
HH165 L L R A L D Q T
HH166 V L R A L D Q T
HH167 L V R A L D Q T
HH168 V V R A L D Q T
HH169 L L K V L D Q T
HH170 V L K V L D Q T
HH171 L V K V L D Q T
HH172 V V K V L D Q T
HH173 L L R V L D Q T
HH174 V L R V L D Q T
HH175 L V R V L D Q T
HH176 V V R V L D Q T
HH177 L L K A I D Q T
HH178 V L K A I D Q T
HH179 L V K A I D Q T

HH180 V V K A I D Q T
HH181 L L R A I D Q T
HH182 V L R A I D Q T
HH183 L V R A I D Q T
HH184 V V R A I D Q T
HH185 L L K V I D Q T
HH186 V L K V I D Q T
HH187 L V K V I D Q T
HH188 V V K V I D Q T
HH189 L L R V I D Q T
HH190 V L R V I D Q T
HH191 L V R V I D Q T
HH192 V V R V I D Q T
HH193 L L K A L E E T
HH194 V L K A L E E T
HH195 L V K A L E E T
HH196 V V K A L E E T
HH197 L L R A L E E T
HH198 V L R A L E E T
HH199 L V R A L E E T
HH200 V V R A L E E T
HH201 L L K V L E E T

HH202 V L K V L E E T
HH203 L V K V L E E T
HH204 V V K V L E E T
HH205 L L R V L E E T
HH206 V L R V L E E T
HH207 L V R V L E E T
HH208 V V R V L E E T
HH209 L L K A I E E T
HH210 V L K A I E E T
HH211 L V K A I E E T
HH212 V V K A I E E T
HH213 L L R A I E E T
HH214 V L R A I E E T
HH215 L V R A I E E T
HH216 V V R A I E E T
HH217 L L K V I E E T
HH218 V L K V I E E T
HH219 L V K V I E E T
HH220 V V K V I E E T
HH221 L L R V I E E T
HH222 V L R V I E E T
HH223 L V R V I E E T

HH224 V V R V I E E T
HH225 L L K A L D E T
HH226 V L K A L D E T
HH227 L V K A L D E T
HH228 V V K A L D E T
HH229 L L R A L D E T
HH230 V L R A L D E T
HH231 L V R A L D E T
HH232 V V R A L D E T
HH233 L L K V L D E T
HH234 V L K V L D E T
HH235 L V K V L D E T
HH236 V V K V L D E T
HH237 L L R V L D E T
HH238 V L R V L D E T
HH239 L V R V L D E T
HH240 V V R V L D E T
HH241 L L K A I D E T
HH242 V L K A I D E T
HH243 L V K A I D E T
HH244 V V K A I D E T
HH245 L L R A I D E T

HH246 V L R A I D E T
HH247 L V R A I D E T
HH248 V V R A I D E T
HH249 L L K V I D E T
HH250 V L K V I D E T
HH251 L V K V I D E T
HH252 V V K V I D E T
HH253 L L R V I D E T
HH254 V L R V I D E T
HH255 L V R V I D E T
HH256 V V R V I D E T

В конкретном варианте осуществления положение (т.е. границы) области VL-цепи, описанной в настоящем описании, относительно константной области может изменяться на одно, два, три или четыре положения аминокислот при условии, что сохраняется (например, по существу сохраняется, например, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 95%) иммуноспецифическое связывание с KIT (например, область D4 KIT человека). В конкретном варианте осуществления положение (т.е. границы) области VH-цепи, описанной в настоящем описании, может изменяться на одно, два, три или четыре положения аминокислот при условии, что сохраняется (например, по существу сохраняется, например, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 95%) иммуноспецифическое связывание с KIT (например, область D4 KIT человека).

В конкретных аспектах в рамках настоящего изобретения предусматривается часть, содержащая CDR VH и/или CDR VL, описанные в настоящем описании, например, как указано в таблицах 1-3 и 10-15, где CDR VH и CDR VL располагаются в пространственной ориентации, которая обеспечивает специфическое связывание с областью D4 KIT человека.

В конкретных аспектах в рамках настоящего изобретения предусматривается часть, содержащая CDR VH, содержащие аминокислотные последовательности SEQ ID NO:16-18, и CDR VL, содержащие аминокислотные последовательности SEQ ID NO:19-21, CDR VH, содержащие аминокислотные последовательности SEQ ID NO:56, 62 и 63, и CDR VL, содержащие аминокислотные последовательности SEQ ID NO:59-61, CDR VH, содержащие аминокислотные последовательности SEQ ID NO:70-72, и CDR VL, содержащие аминокислотные последовательности SEQ ID NO:66-68, где CDR VH и CDR VL расположены в пространственной ориентации, которая обеспечивает специфическое связывание с областью D4 KIT человека. В определенных вариантах осуществления часть представляет собой антитело или его антигенсвязывающий фрагмент. В конкретном варианте осуществления часть представляет собой белок, такой как слитый белок, содержащий Fc-область.

В конкретных аспектах в рамках настоящего изобретения предусматривается часть, содержащая CDR VH, выбранные из таблиц 13-15, и/или CDR VL, выбранные из таблиц 10-12, где CDR VH и CDR VL расположены в пространственной ориентации, которая обеспечивает специфическое связывание области D4 KIT человека. В определенных вариантах осуществления часть представляет собой антитело или его антигенсвязывающий фрагмент. В конкретном варианте осуществления часть представляет собой белок, такой как слитый белок, содержащий Fc-область.

В конкретных аспектах в рамках настоящего изобретения предусматривается часть, такая как антитело, или его антигенсвязывающий фрагмент, содержащие CDR1-3 VH и CDR1-3 VL, выбранные из CDR, представленных в таблицах 10-15, где CDR VH и CDR VL располагаются в пространственной ориентации, которая сообщает специфическое связывание области D4 KIT человека. В конкретных аспектах, часть, описанная в настоящем описании, содержит линкеры, такие как пептидные линкеры, которые связывают CDR1-3 VH и/или CDR1-3 VL в пространственной ориентации, которая обеспечивает специфическое связывание с областью D4 KIT человека.

В конкретных аспектах часть, описанная в настоящем описании, содержит линкеры, такие как пептидные линкеры, которые связывают CDR VH и/или CDR VL в пространственной ориентации, которая обеспечивает специфическое связывание области D4 KIT человека.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, содержащие CDR1-3 VL и CDR1-3 VH, выбранные из CDR, представленных в таблицах 10-15, где антитело или его антигенсвязывающий фрагмент иммуноспецифически связывают область D4 KIT, такого как KIT человека.

В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 10-15 представляет собой любую природную аминокислоту, которая сохраняет аффинность специфического связывания с областью D4 KIT человека. В конкретном варианте осуществления аминокислота "X" в CDR любой из таблиц 10-15 представляет собой неприродную аминокислоту, которая сохраняет аффинность специфического связывания с областью D4 KIT человека. В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 10-15 представляет собой консервативную замену соответствующей аминокислоты CDR, имеющих аминокислотные последовательности SEQ ID NO:16-21, где сохраняется аффинность специфического связывания с областью D4 KIT человека.

В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 10-15, независимо, представляет собой аминокислоту A, G, T, K или L. В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 10-15 представляет собой аминокислоту A, G, T, Y, C или S. В некоторых аспектах этих вариантов осуществления сохраняется аффинность специфического связывания с областью D4 KIT человека.

В определенном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент содержат CDR VH и/или CDR VL, выбранные из CDR, представленных в таблицах 10-15.

В конкретном варианте осуществления CDR, такая как любая из CDR1-3 VL и CDR1-3 VH, представленных в таблицах 10-15, содержит одну или несколько (например, две, три, четыре или пять) аминокислот "X", где каждая аминокислота "X" может представлять собой любую аминокислоту, которая может сохранять специфическое связывание антитела или его фрагмента с областью D4 KIT человека.

В некоторых аспектах в рамках настоящего изобретения предусматриваются антитело, или его антигенсвязывающий фрагмент, содержащие FR 1-4 VL, выбранные из FR, представленных в таблицах 20-23, и/или FR 1-4 VH, выбранные из FR, представленных в таблицах 16-19, где антитело или его антигенсвязывающий фрагмент иммуноспецифически связываются с областью D4 KIT, такого как KIT человека.

В конкретном варианте осуществления аминокислота "X" в FR в любой из таблиц 16-23 представляет собой любую природную аминокислоту, которая сохраняет аффинность специфического связывания с областью D4 KIT человека. В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 16-23 представляет собой неприродную аминокислоту, которая сохраняет аффинность специфического связывания с областью D4 KIT человека. В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 16-23 представляет собой консервативную замену соответствующей аминокислоты в CDR, имеющих аминокислотные последовательности SEQ ID NO:16-21, где сохраняется аффинность специфического связывания с областью D4 KIT человека.

В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 16-23 представляет собой аминокислоту A, G, T, K или L. В конкретном варианте осуществления аминокислота "X" в CDR в любой из таблиц 16-23 представляет собой аминокислоту A, G, T, Y, C или S. В некоторых аспектах этих вариантов осуществления сохраняется аффинность специфического связывания с областью D4 KIT человека.

В определенном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, содержат CDR VH и/или CDR VL, выбранные из CDR, представленных в таблицах 16-23.

В конкретном варианте осуществления FR, такая как любая из FR 1-4 VL и FR 1-4 VH, представленных в таблицах 16-23, содержит одну или несколько (например, две, три, четыре или пять) аминокислот "X", где каждая аминокислота "X" может представлять собой любую аминокислоту, которая может сохранять специфическое связывание антитела, или его фрагмента, с областью D4 KIT человека.

Таблица 16
FR1 VH
FR1 VH SEQ ID NO:
H1 QVQLVQSGAELKKPGASVKLSCKASGYTFT 33
H2/H3 QVQLVQSGAEVKKPGASVKLSCKASGYTFT 37
H4/H5 QVQLVQSGAEVKKPGASVKVSCKASGYTFT 41
XVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 167
QXQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 168
QVXLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 169
QVQXVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 170
QVQLXQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 171
QVQLVXSGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 172
QVQLVQXGAE(L/V)KKPGASVK(L/V)SCKASGYTFT 173
QVQLVQSXAE(L/V)KKPGASVK(L/V)SCKASGYTFT 174
QVQLVQSGXE(L/V)KKPGASVK(L/V)SCKASGYTFT 175
QVQLVQSGAX(L/V)KKPGASVK(L/V)SCKASGYTFT 176
QVQLVQSGAEXKKPGASVK(L/V)SCKASGYTFT 177
QVQLVQSGAE(L/V)XKPGASVK(L/V)SCKASGYTFT 178
QVQLVQSGAE(L/V)KXPGASVK(L/V)SCKASGYTFT 179
QVQLVQSGAE(L/V)KKXGASVK(L/V)SCKASGYTFT 180
QVQLVQSGAE(L/V)KKPXASVK(L/V)SCKASGYTFT 181
QVQLVQSGAE(L/V)KKPGXSVK(L/V)SCKASGYTFT 182
QVQLVQSGAE(L/V)KKPGAXVK(L/V)SCKASGYTFT 183
QVQLVQSGAE(L/V)KKPGASXK(L/V)SCKASGYTFT 184
QVQLVQSGAE(L/V)KKPGASVX(L/V)SCKASGYTFT 185
QVQLVQSGAE(L/V)KKPGASVKXSCKASGYTFT 186
QVQLVQSGAE(L/V)KKPGASVK(L/V)XCKASGYTFT 187
QVQLVQSGAE(L/V)KKPGASVK(L/V)SXKASGYTFT 188
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCXASGYTFT 189
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKXSGYTFT 190
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKAXGYTFT 191
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASXYTFT 192
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGXTFT 193
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYXFT 194

QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTXT 195
QVQLVQSGAE(L/V)KKPGASVK(L/V)SCKASGYTFX 196

Таблица 17
FR2 VH
FR2 VH SEQ ID NO:
H1/H2 WVKQAPGKGLEWIA 34
H3/H4/H5 WVRQAPGKGLEWIA 39
XV(R/K)QAPGKGLEWIA 197
WX(R/K)QAPGKGLEWIA 198
WVXQAPGKGLEWIA 199
WV(R/K)XAPGKGLEWIA 200
WV(R/K)QXPGKGLEWIA 201
WV(R/K)QAXGKGLEWIA 202
WV(R/K)QAPXKGLEWIA 203
WV(R/K)QAPGXGLEWIA 204
WV(R/K)QAPGKXLEWIA 205
WV(R/K)QAPGKGXEWIA 206
WV(R/K)QAPGKGLXWIA 207
WV(R/K)QAPGKGLEXIA 208
WV(R/K)QAPGKGLEWXA 209
WV(R/K)QAPGKGLEWIX 210

Таблица 18
FR3 VH
FR3 VH SEQ ID NO:
H1 RATLTAEKSTSTAYMQLSSLRSEDSAVYFCAR 35
H2 RATLTAEKSTSTAYMQLSSLRSEDTAVYFCAR 38
H3 RATLTADKSTSTAYMQLSSLRSEDTAVYFCAR 40
H4 RATITADKSTSTAYMELSSLRSEDTAVYFCAR 42
H5 RVTITADKSTSTAYMELSSLRSEDTAVYFCAR 43
X(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 211
RXT(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 212

R(A/V)X(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 213
R(A/V)TXTADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 214
R(A/V)T(I/L)XADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 215
R(A/V)T(I/L)TXDKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 216
R(A/V)T(I/L)TAXKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 217
R(A/V)T(I/L)TADXSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 218
R(A/V)T(I/L)TADKXTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 219
R(A/V)T(I/L)TADKSXSTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 220
R(A/V)T(I/L)TADKSTXTAYM(E/Q)LSSLRSED(S/T)AVYFCAR 221
R(A/V)T(I/L)TADKSTSXAYM(E/Q)LSSLRSED(S/T)AVYFCAR 222
R(A/V)T(I/L)TADKSTSTXYM(E/Q)LSSLRSED(S/T)AVYFCAR 223
R(A/V)T(I/L)TADKSTSTAXM(E/Q)LSSLRSED(S/T)AVYFCAR 224
R(A/V)T(I/L)TADKSTSTAYX(E/Q)LSSLRSED(S/T)AVYFCAR 225
R(A/V)T(I/L)TADKSTSTAYMXLSSLRSED(S/T)AVYFCAR 226
R(A/V)T(I/L)TADKSTSTAYM(E/Q)XSSLRSED(S/T)AVYFCAR 227
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LXSLRSED(S/T)AVYFCAR 228
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSXLRSED(S/T)AVYFCAR 229
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSXRSED(S/T)AVYFCAR 230
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLXSED(S/T)AVYFCAR 231
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRXED(S/T)AVYFCAR 232
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSXD(S/T)AVYFCAR 233
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSEX(S/T)AVYFCAR 234
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSEDXAVYFCAR 235
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)XVYFCAR 236
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AXYFCAR 237
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVXFCAR 238
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYXCAR 239
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFXAR 240
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCXR 241
R(A/V)T(I/L)TADKSTSTAYM(E/Q)LSSLRSED(S/T)AVYFCAX 242

Таблица 19
FR4 VH
FR4 VH SEQ ID NO:
H1-H5 WGQGTTVTVSS 36
XGQGTTVTVSS 243
WXQGTTVTVSS 244
WGXGTTVTVSS 245
WGQXTTVTVSS 246
WGQGXTVTVSS 247
WGQGTXVTVSS 248
WGQGTTXTVSS 249
WGQGTTVXVSS 250
WGQGTTVTXSS 251
WGQGTTVTVXS 252
WGQGTTVTVSX 253

Таблица 20
FR1 VL
FR1 VL SEQ ID NO:
L1 DIVMTQSPSFLSASVGDRVTITC 44
L2/L3/L4 DIVMTQSPSSLSASVGDRVTITC 48
XIVMTQSPS(F/S)LSASVGDRVTITC 254
DXVMTQSPS(F/S)LSASVGDRVTITC 255
DIXMTQSPS(F/S)LSASVGDRVTITC 256
DIVXTQSPS(F/S)LSASVGDRVTITC 257
DIVMXQSPS(F/S)LSASVGDRVTITC 258
DIVMTXSPS(F/S)LSASVGDRVTITC 259
DIVMTQXPS(F/S)LSASVGDRVTITC 260
DIVMTQSXS(F/S)LSASVGDRVTITC 261
DIVMTQSPX(F/S)LSASVGDRVTITC 262
DIVMTQSPSXLSASVGDRVTITC 263
DIVMTQSPS(F/S)XSASVGDRVTITC 264
DIVMTQSPS(F/S)LXASVGDRVTITC 265
DIVMTQSPS(F/S)LSXSVGDRVTITC 266

DIVMTQSPS(F/S)LSAXVGDRVTITC 267
DIVMTQSPS(F/S)LSASXGDRVTITC 268
DIVMTQSPS(F/S)LSASVXDRVTITC 269
DIVMTQSPS(F/S)LSASVGXRVTITC 270
DIVMTQSPS(F/S)LSASVGDXVTITC 271
DIVMTQSPS(F/S)LSASVGDRXTITC 272
DIVMTQSPS(F/S)LSASVGDRVXITC 273
DIVMTQSPS(F/S)LSASVGDRVTXTC 274
DIVMTQSPS(F/S)LSASVGDRVTIXC 275
DIVMTQSPS(F/S)LSASVGDRVTITX 276

Таблица 21
FR2 VL
FR2 VL SEQ ID NO:
L1/L2/L3 WYQQKPGKAPKALIY 45
L4 WYQQKPGKAPKSLIY 51
XYQQKPGKAPK(S/A)LIY 277
WXQQKPGKAPK(S/A)LIY 278
WYXQKPGKAPK(S/A)LIY 279
WYQXKPGKAPK(S/A)LIY 280
WYQQXPGKAPK(S/A)LIY 281
WYQQKXGKAPK(S/A)LIY 282
WYQQKPXKAPK(S/A)LIY 283
WYQQKPGXAPK(S/A)LIY 284
WYQQKPGKXPK(S/A)LIY 285
WYQQKPGKAXK(S/A)LIY 286
WYQQKPGKAPX(S/A)LIY 287
WYQQKPGKAPKXLIY 288
WYQQKPGKAPK(S/A)XIY 289
WYQQKPGKAPK(S/A)LXY 290
WYQQKPGKAPK(S/A)LIX 291

Таблица 22
FR3 VL
FR3 VL SEQ ID NO:
L1 GVPDRFTGSGSGTDFTLTISSLQSEDFADYFC 46
L2 GVPDRFTGSGSGTDFTLTISSLQPEDFADYFC 49
L3 GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC 50
L4 GVPDRFSGSGSGTDFTLTISSLQPEDFATYYC 52
XVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 292
GXPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 293
GVXDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 294
GVPXRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 295
GVPDXF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 296
GVPDRX(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 297
GVPDRFXGSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 298
GVPDRF(S/T)XSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 299
GVPDRF(S/T)GXGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 300
GVPDRF(S/T)GSXSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 301
GVPDRF(S/T)GSGXGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 302
GVPDRF(S/T)GSGSXTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 303
GVPDRF(S/T)GSGSGXDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 304
GVPDRF(S/T)GSGSGTXFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 305
GVPDRF(S/T)GSGSGTDXTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 306
GVPDRF(S/T)GSGSGTDFXLTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 307
GVPDRF(S/T)GSGSGTDFTXTISSLQ(P/S)EDFA(D/T)Y(F/Y)C 308
GVPDRF(S/T)GSGSGTDFTLXISSLQ(P/S)EDFA(D/T)Y(F/Y)C 309
GVPDRF(S/T)GSGSGTDFTLTXSSLQ(P/S)EDFA(D/T)Y(F/Y)C 310
GVPDRF(S/T)GSGSGTDFTLTIXSLQ(P/S)EDFA(D/T)Y(F/Y)C 311
GVPDRF(S/T)GSGSGTDFTLTISXLQ(P/S)EDFA(D/T)Y(F/Y)C 312
GVPDRF(S/T)GSGSGTDFTLTISSXQ(P/S)EDFA(D/T)Y(F/Y)C 313
GVPDRF(S/T)GSGSGTDFTLTISSLX(P/S)EDFA(D/T)Y(F/Y)C 314
GVPDRF(S/T)GSGSGTDFTLTISSLQXEDFA(D/T)Y(F/Y)C 315
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)XDFA(D/T)Y(F/Y)C 316
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EXFA(D/T)Y(F/Y)C 317

GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDXA(D/T)Y(F/Y)C 318
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFX(D/T)Y(F/Y)C 319
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFAXY(F/Y)C 320
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)X(F/Y)C 321
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)YXC 322
GVPDRF(S/T)GSGSGTDFTLTISSLQ(P/S)EDFA(D/T)Y(F/Y)X 323

Таблица 23
FR4 VL
FR4 VL SEQ ID NO:
L1-L4 FGGGTKVEIK 47
XGGGTKVEIK 324
FXGGTKVEIK 325
FGXGTKVEIK 326
FGGXTKVEIK 327
FGGGXKVEIK 328
FGGGTXVEIK 329
FGGGTKXEIK 330
FGGGTKVXIK 331
FGGGTKVEXK 332
FGGGTKVEIX 333

В одном из аспектов антитело, описанное в настоящем описании, содержит Fc-область, которая содержит одну или несколько делеций, вставок и/или модификаций аминокислот.

"Fc-область", как используют в рамках изобретения, включает полипептиды, содержащие константную область антитела за исключением первого домена константной области иммуноглобулинов, и, таким образом, относится к последним двум доменам константной области иммуноглобулинов IgA, IgD и IgG, последним трем доменам константной области иммуноглобулинов IgE и IgM, и гибкой шарнирной области, N-концевой для этих доменов. Для IgA и IgM Fc-область может включать J-цепь. Для IgG Fc-область может включать домены иммуноглобулина C-гамма 2 и C-гамма 3 (Cγ2 и Cγ3) и шарнирную область между C-гамма 1 (Cγ1) и C-гамма 2 (Cγ2). Хотя границы Fc-области могут варьировать, Fc-область тяжелой цепи IgG человека, как правило, содержит остатки с C226 или P230 до его С-конца, где нумерация осуществляется в соответствии с индексом EU, как описано в Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, VA). "Индекс EU, как указано в Kabat," относится к нумерации остатков в IgG1-антителе EU человека, как описано в Kabat et al., выше. В определенном варианте осуществления Fc-область включает не встречающуюся в природе Fc-область. В некоторых аспектах в одном или нескольких положениях Fc, включая, но ими не ограничиваясь, 270, 272, 312, 315, 356 и 358 в соответствии с Kabat, присутствуют один или несколько полиморфизмов.

В одном из аспектов в рамках настоящего изобретения предусматриваются антитело, как описано в настоящем описании, которое специфически связывается с областью D4 KIT, или его антигенсвязывающий фрагмент, содержащие Fc-область, которая имеет измененные свойства связывания в отношении Fc-лиганда (например, Fc-рецептор, такой как C1q) относительно сравнимого антитела (например, антитела, имеющего ту же аминокислотную последовательность, за исключением наличия Fc-области дикого типа).

Аффинность и свойства связывания Fc-области в отношении ее лиганда можно определять различными способами анализа in vitro (биохимические или иммунологические анализы), известными в данной области, для определения взаимодействий Fc-FcγR, т.е. специфического связывания Fc-области с FcγR, включая, но ими не ограничиваясь, равновесные способы (например, твердофазный иммуноферментный анализ (ELISA), или радиоиммунный анализ (RIA)), или анализ кинетики (например, анализ BIACORE®), и другие способы, такие как непрямые анализы связывания, конкурентные анализы ингибирования, резонансный перенос энергии флуоресценции (FRET), гель-электрофорез и хроматография (например, гель-фильтрация). В этих и других способах можно использовать метку на одном или нескольких исследуемых компонентах и/или можно использовать множество способов обнаружения, включая, но ими не ограничиваясь хромогенные, флуоресцентные, люминесцентные или изотопные метки.

В одном из вариантов осуществления Fc-область антитела, описанного в настоящем описании, имеет усиленное связывание с одним или несколько лигандов Fc относительно сравнимой молекулы. В конкретном варианте осуществления Fc-область антитела, описанного в настоящем описании, имеет усиленное связывание с Fc-рецептором. В другом конкретном варианте осуществления Fc-область антитела, описанного в настоящем описании, имеет усиленное связывание с Fc-рецептором FcγRIIIA. В одном конкретном варианте осуществления Fc-область антитела, описанного в настоящем описании, имеет усиленное связывание с Fc-рецептором FcRn. В другом конкретном варианте осуществления Fc-область антитела, описанного в настоящем описании, имеет усиленное связывание с C1q относительно сравнимой молекулы.

В определенном аспекте время полужизни в сыворотке белков, содержащих Fc-области, можно увеличивать путем увеличения аффинности связывания Fc-области с FcRn. В одном из вариантов осуществления Fc-область антитела, описанного в настоящем описании, имеет увеличенное время полужизни в сыворотке относительно сравнимой молекулы.

"Антителозависимая клеточно-опосредуемая цитотоксичность" или "ADCC" относится к форме цитотоксичности, при которой секретируемый Ig, связанный с Fc-рецепторами (FcR), присутствующими на определенных цитотоксических клетках (например, природные киллеры (NK), нейтрофилы и макрофаги) обеспечивает связывание этих цитотоксических клеток с несущей антиген клеткой-мишенью, а затем уничтожает клетку-мишень с помощью цитокинов. Конкретные высокоаффинные IgG-антитела, направленные на поверхность клеток-мишеней "вооружают" цитотоксические клетки для такого уничтожения. Лизис клетки-мишени вовлекает прямой контакт клетка-клетка и не вовлекает комплемент. Предусматривается, что в дополнение к антителам другие белки, содержащие Fc-области, в частности, слитые с Fc белки, обладающие способностью специфически связываться с несущей антиген клеткой-мишенью, будут способны осуществлять клеточно-опосредуемую цитотоксичность. Для простоты клеточно-опосредуемую цитотоксичность вследствие активности слитого с Fc белка также называют в настоящем описании активностью ADCC.

Способность какого-либо конкретного белка, например, антитела, содержащего Fc-область, опосредовать лизис клетки-мишени с помощью ADCC, можно оценивать. Для оценки активности ADCC Fc-области, связывающее клетку-мишень антитело, содержащее Fc-область, добавляют к клеткам-мишеням в комбинации с иммунными эффекторными клетками, которые могут активироваться комплексами антиген-антитело, что приводит к цитолизу клетки-мишени. Цитолиз обычно выявляют по высвобождению метки (например, радиоактивные субстраты, флуоресцентные красители или природные внутриклеточные белки) из лизированных клеток. Подходящие эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (PBMC) и природные киллеры (NK). Конкретные примеры анализов ADCC in vitro описаны в Wisecarver et al., 1985 79:277-282; Bruggemann et al., 1987, J Exp. Med. 166:1351-1361; Wilkinson et al., 2001, J Immunol. Methods 258:183-191; Patel et al., 1995 J Immunol. Methods 184:29-38. Альтернативно или дополнительно, активность ADCC белка, содержащего Fc-область, можно оценивать in vivo, например, в модели на животных, например, как описано в Clynes et al., 1998, Proc. Natl. Acad. Sci. USA 95:652-656.

В одном из вариантов осуществления белок, например, антитело, описанное в настоящем описании, содержащий Fc-область, обладает усиленной активностью ADCC относительно сравнимого белка, например, антитела. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, содержащее Fc-область, обладает увеличенным связыванием с Fc-рецептором FcγRIIIA и обладает увеличенной активностью ADCC относительно сравнимого антитела. В некоторых вариантах осуществления антитело, описанное в настоящем описании, содержащее Fc-область, обладает как усиленной активностью ADCC, так и увеличенным временем полужизни в сыворотке относительно сравнимого антитела.

"Комплементзависимая цитотоксичность" и "CDC" относятся к лизису клетки-мишени в присутствии комплемента. Каскад активации комплемента инициируется связыванием первого компонента системы комплемента (C1q) с молекулой, например, антителом, в комплексе с его антигеном. Для оценки активации комплемента можно проводить анализ CDC, как описано, например, в Gazzano-Santoro et al., 1996, J. Immunol. Methods, 202:163. В одном из вариантов осуществления антитело, описанное в настоящем описании, содержащее Fc-область, обладает усиленной активностью CDC относительно сравнимого антитела. В других вариантах осуществления антитело, описанное в настоящем описании, содержащее Fc-область, имеет как усиленную активность CDC, так и увеличенное время полужизни в сыворотке относительно сравнимого антитела.

В одном из вариантов осуществления антитело, описанное в настоящем описании, содержит Fc-область, которая содержит аминокислотную модификацию (например, замену, делецию или вставку, или не встречающийся в природе аминокислотный остаток) в одном или нескольких положениях (например, в одном, двух, трех или четырех положениях), выбранных из группы, состоящей из 234, 235, 236, 239, 240, 241, 243, 244, 245, 247, 252, 254, 256, 262, 263, 264, 265, 266, 267, 269, 296, 297, 298, 299, 313, 325, 326, 327, 328, 329, 330, 332, 333 и 334 при нумерации с помощью индекса EU, как указано в Kabat. Необязательно, Fc-область может содержать аминокислотную модификацию (например, замену, делецию или вставку) или не встречающийся в природе аминокислотный остаток в дополнительных и/или альтернативных положениях, известных специалисту в данной области (см., например, патенты США 5624821; 6277375; 6737056; публикации патентов PCT WO 01/58957; WO 04/016750; WO 04/029207; WO 04/035752 и WO 05/040217, каждый из которых включен в настоящее описание в качестве ссылки в полном объеме, но, в частности, для раскрытия таких модификаций). В следующем варианте осуществления одна или несколько функций Fc-области сохраняются (например, по существу сохраняются, например, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 95%) в Fc-области, содержащей аминокислотную модификацию (например, замену, делецию или вставку) или не встречающийся в природе аминокислотный остаток в одном или нескольких положениях. Например, такие функции Fc могут включать эффекторную функцию, такую как CDC или ADCC, или аффинность связывания с Fc-рецептором. В определенном варианте осуществления Fc-область, содержащая аминокислотную модификацию (например, замену, делецию или вставку) или не встречающийся в природе аминокислотный остаток в одном или нескольких положениях, проявляет по меньшей мере один или несколько усиленных видов активности Fc, например, увеличенное время полужизни или усиленная эффекторная функция, такая как ADCC или CDC. В конкретном варианте осуществления Fc-область, содержащая аминокислотную модификацию (например, замену, делецию или вставку) или не встречающийся в природе аминокислотный остаток в одном или нескольких положениях, проявляет сниженную активность Fc, например, сниженную стабильность/время полужизни, или сниженную эффекторную функцию, такую как ADCC или CDC.

В конкретном варианте осуществления антитело, описанное в настоящем описании, содержит Fc-область, где Fc-область содержит по меньшей мере одну (например, одну, две, три или четыре) аминокислотную модификацию (например, замену, делецию или вставку) или по меньшей мере один не встречающийся в природе аминокислотный остаток (например, один, два, три или четыре), выбранный из группы, состоящей из 234D, 234E, 234N, 234Q, 234T, 234H, 234Y, 234I, 234V, 234F, 235A, 235D, 235R, 235W, 235P, 235S, 235N, 235Q, 235T, 235H, 235Y, 235I, 235V, 235F, 236E, 239D, 239E, 239N, 239Q, 239F, 239T, 239H, 239Y, 240I, 240A, 240T, 240M, 241W, 241 L, 241Y, 241E, 241 R, 243W, 243L 243Y, 243R, 243Q, 244H, 245A, 247V, 247G, 252Y, 254T, 256E, 262I, 262A, 262T, 262E, 263I, 263A, 263T, 263M, 264L, 264I, 264W, 264T, 264R, 264F, 264M, 264Y, 264E, 265G, 265N, 265Q, 265Y, 265F, 265V, 265I, 265L, 265H, 265T, 266I, 266A, 266T, 266M, 267Q, 267L, 269H, 269Y, 269F, 269R, 296E, 296Q, 296D, 296N, 296S, 296T, 296L, 296I, 296H, 269G, 297S, 297D, 297E, 298H, 298I, 298T, 298F, 299I, 299L, 299A, 299S, 299V, 299H, 299F, 299E, 313F, 325Q, 325L, 325I, 325D, 325E, 325A, 325T, 325V, 325H, 327G, 327W, 327N, 327L, 328S, 328M, 328D, 328E, 328N, 328Q, 328F, 328I, 328V, 328T, 328H, 328A, 329F, 329H, 329Q, 330K, 330G, 330T, 330C, 330L, 330Y, 330V, 330I, 330F, 330R, 330H, 332D, 332S, 332W, 332F, 332E, 332N, 332Q, 332T, 332H, 332Y и 332A при нумерации с помощью индекса EU, как указано в Kabat. Необязательно, Fc-область может содержать дополнительные и/или альтернативные не встречающиеся в природе аминокислотные остатки, известные специалисту в данной области (см., например, патенты США 5624821; 6277375; 6737056; публикации патентов PCT WO 01/58957; WO 04/016750; WO 04/029207; WO 04/035752 и WO 05/040217).

В определенном аспекте в рамках настоящего изобретения предусматривается антитело, содержащее Fc-область, где Fc-область содержит по меньшей мере одну не встречающуюся в природе аминокислоту в одном или нескольких положениях, выбранных из группы, состоящей из 239, 330 и 332, при нумерации с помощью индекса EU, как указано в Kabat. В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело, содержащее Fc-область, где Fc-область содержит по меньшей мере одну не встречающуюся в природе аминокислоту, выбранную из группы, состоящей из 239D, 330L и 332E, при нумерации с помощью индекса EU, как указано в Kabat. Необязательно, Fc-область, кроме того, может содержать дополнительную не встречающуюся в природе аминокислоту в одном или нескольких положениях, выбранных из группы, состоящей из 252, 254 и 256, при нумерации с помощью индекса EU, как указано в Kabat. В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело, содержащее Fc-область, где Fc-область содержит по меньшей мере одну не встречающуюся в природе аминокислоту, выбранную из группы, состоящей из 239D, 330L и 332E, при нумерации с помощью индекса EU, как указано в Kabat, и по меньшей мере одну не встречающуюся в природе аминокислоту в одном или нескольких положениях, выбранных из группы, состоящей из 252Y, 254T и 256E, при нумерации с помощью индекса EU, как указано в Kabat. В одном из вариантов осуществления Fc-область, содержащая такую последовательность, проявляет один или несколько видов активности Fc, например, аффинность связывания с Fc-рецептором или эффекторную функцию, такую как ADCC или CDC. В конкретном варианте осуществления Fc-область, содержащая такую последовательность, проявляет сниженную Fc-активность, например, сниженную аффинность связывания с Fc-рецептором или сниженную эффекторную функцию, такую как ADCC или CDC. В конкретном варианте осуществления Fc-область, содержащая такую последовательность, проявляет усиленную активность Fc, например, увеличенное время полужизни, усиленную аффинность связывания с Fc-рецептором, или усиленную эффекторную функцию, такую как ADCC или CDC.

Неограничивающие примеры модификаций Fc-области представлены в Ghetie et al., 1997, Nat Biotech. 15:637-40; Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, Mol Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al., 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett. 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al, 1996, Immunol Lett 54:101-104; Lund et al, 1996, J Immunol 157:4963-4969; Armour et al., 1999, Eur J Immunol 29:2613-2624; Idusogie et al, 2000, J Immunol 164:4178-4184; Reddy et al, 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200:16-26; Idusogie et al, 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Jefferis et al, 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490); патентах США № 5624821; 5885573; 5677425; 6165745; 6277375; 5869046; 6121022; 5624821; 5648260; 6528624; 6194551; 6737056; 6821505; 6277375; 8163882; 7355008; 7960512; 8039592; 8039359; 8101720; 7214775; 7682610; 7741442; публикациях патентов США № 2004/0002587 и публикациях PCT WO 94/29351; WO 99/58572; WO 00/42072; WO 04/029207; WO 04/099249; WO 04/063351.

В конкретном варианте осуществления антитело, описанное в настоящем описании, содержит одну или несколько (например, одну, две, три или четыре) модификаций Fc-области IgG1, такую как Fc-область IgG1 человека. В определенном варианте осуществления антитело, описанное в настоящем описании, содержит одну или несколько (например, одну, две, три или четыре) модификаций Fc-области IgG2, такой как Fc-область IgG2 человека. В одном из вариантов осуществления антитело, описанное в настоящем описании, содержит одну или несколько (например, одну, две, три или четыре) модификаций Fc-области IgG4, такой как Fc-область IgG4 человека.

В некоторых аспектах, антитело, описанное в настоящем описании, содержит Fc-область, где Fc-область содержит одну или несколько (например, одну, две, три или четыре) модификаций гликоформ (например, удаление или замена одной или нескольких гликоформ), таких как модифицированные способами инженерии гликоформы, т.е углеводный состав, которые ковалентно связаны с молекулой, содержащей Fc-область. Модифицированные способами инженерии гликоформы могут подходить для различных целей, включая, но не ограничиваясь этим, усиление или снижение эффекторной функции. Модифицированные способами инженерии гликоформы можно получать любым способом, известным специалисту в данной области, например, с использованием модифицированных способами инженерии штаммов или штаммов с измененной экспрессией, путем коэкспрессии с одним или несколькими ферментами, например, DI N-ацетилглюкозаминилтрансферазой III (GnTI11), путем экспрессии молекулы, содержащей Fc-область, в различных организмах или клеточных линиях из различных организмов, или путем модификации углевода(ов) после экспрессии молекулы, содержащей Fc-область. Способы получения модифицированных способами инженерии гликоформ известны в данной области, и включают, но ими не ограничиваются, способы, описанные в Umana et al, 1999, Nat. Biotechnol 17:176-180; Davies et al., 20017 Biotechnol Bioeng 74:288-294; Shields et al, 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem 278:3466-3473), патенте США 6602684; заявке США 10/277370; заявке США 10/113929; PCT WO 00/61739A1; PCT WO 01/292246A1; PCT WO 02/311140A1; PCT WO 02/30954A1; WO 00061739; US 20030115614; и Okazaki et al., 2004, JMB, 336: 1239-49. Способы получения модифицированных гликоформ антитела, описанного в настоящем описании, описаны в данной области и включают, но ими не ограничиваются, способы, описанные в патенте США № 7517670; патенте США № 8021856; патенте США № 8080415; патенте США № 8084222; патенте США № 7700321; и патенте США № 8071336.

В конкретном варианте осуществления гликозилирование Fc-области можно модифицировать для увеличения или снижения эффекторной функции. Таким образом, в одном из вариантов осуществления Fc-область антитела, описанного в настоящем описании, имеет модифицированное гликозилирование аминокислотных остатков. В другом варианте осуществления модифицированное гликозилирование аминокислотных остатков приводит к сниженной эффекторной функции, такой как ADCC или CDC. В другом варианте осуществления модифицированное гликозилирование аминокислотных остатков приводит к увеличенной эффекторной функции. В некоторых вариантах осуществления профили гликозилирования антител, описанных в настоящем описании, модифицированы для усиления эффекторной функции ADCC и CDC (см., например, Shields et al., (2002) JBC. 277:26733; Shinkawa et al., (2003) JBC. 278:3466 и Okazaki et al., (2004) J. Mol. Biol., 336: 1239). В конкретном варианте осуществления такое модифицированное гликозилирование отличается от гликозилирования Fc-области, встречающегося в природе in vivo, или такое модифицированное гликозилирование представляет собой встречающееся в природе гликозилирование Fc-области. Например, модифицированного гликозилирования Fc-области можно достигать путем модификации аминокислот или путем экспрессии белка/антитела в клетке, модифицированной способами инженерии так, чтобы она содержала аппарат гликозилирования, отличный от аппарата гликозилирования родительской клетки, которая не была модифицирована. В этом отношении, такую клетку можно модифицировать способами инженерии так, чтобы она не экспрессировала определенный фермент гликозилирования или экспрессировала определенный фермент гликозилирования, который не присутствует в родительской клетке.

Способы получения не встречающихся в природе Fc-областей известны в данной области. Например, аминокислотные замены и/или делеции можно получать способами мутагенеза, включая, но ими не ограничиваясь, сайт-направленный мутагенез (Kunkel, Proc. Natl. Acad. Sci. USA 82:488-492 (1985)), мутагенез с помощью ПЦР (Higuchi, "PCR Protocols: A Guide to Methods and Applications", Academic Press, San Diego, pp. 177-183 (1990)), и кассетный мутагенез (Wells et al., Gene 34:315-323 (1985)). Сайт-направленный мутагенез можно проводить способом перекрывающейся ПЦР (Higuchi, "PCR Technology: Principles and Applications for DNA Amplification", Stockton Press, New York, pp. 61-70 (1989)). Альтернативно способ перекрывающейся ПЦР (Higuchi, там же) можно использовать для внесения любой желаемой мутации(ий) в последовательность-мишень (исходную ДНК). Другие способы, подходящие для получения модификаций Fc-области, известны в данной области (см., например, патенты США № 5624821; 5885573; 5677425; 6165745; 6277375; 5869046; 6121022; 5624821; 5648260; 6528624; 6194551; 6737056; 6821505; 6277375; публикации патентов США № 2004/0002587 и публикации PCT WO 94/29351; WO 99/58572; WO 00/42072; WO 02/060919; WO 04/029207; WO 04/099249; WO 04/063351).

В конкретном варианте осуществления Fc-область имеет сниженное фукозилирование. В другом варианте осуществления Fc-область является афукозилированной (см., например, публикацию патентной заявки США № 2005/0226867).

В определенном аспекте антитело, описанное в настоящем описании, представляет собой нефукозилированное антитело, например, Fc-область антитела не содержит цепей сахаров с фукозой, например, фукозы, связанной с N-ацетилглюкозамином (см., например, патенты США № 7214775; 7682610 и 7741442). Способы получения нефукозилированных антител известны в данной области, см., например, патент США № 7708992. Например, нефукозилированные антитела можно получать с использованием модифицированных способами инженерии клеток-хозяев, см., например, патент США № 6946292; 7425446; 8067232; 7846725 и 7393683. Также описаны животные с нокаутом для получения нефукозилированных антител, см., например, патент США № 7737325. В конкретном варианте осуществления нефукозилированное антитело, описанное в настоящем описании, которое специфически связывается с областью D4 KIT человека, проявляет увеличенную ADCC.

В конкретном аспекте антитело, описанное в настоящем описании, имеет содержание фукозы менее 100%, например, менее 65%, относительно содержания фукозы в эталонном антителе (см., например, патенты США № 7931895 и 7846434). В определенном варианте осуществления антитело, описанное в настоящем описании, характеризуется содержанием фукозы, где по меньшей мере приблизительно 60% N-связанных олигосахаридов, например, N-связанных олигосахаридов, в происходящих из CH2 доменах, не содержат фукозы. В конкретных вариантах осуществления процент N-связанных олигосахаридов, например, N-связанных олигосахаридов в происходящих из CH2 доменах, которые не содержат фукозы, составляет по меньшей мере приблизительно 65%, приблизительно 70%, приблизительно 75%, приблизительно 80%, приблизительно 85%, приблизительно 90%, приблизительно 95% или более, и антитело проявляет измененную эффекторную функцию, например, усиленную ADCC или сниженную ADCC. В конкретном варианте осуществления антитело, описанное в настоящем описании, специфически связывается с областью D4 KIT человека, имеет содержание фукозы менее 65% и проявляет увеличенную ADCC.

В конкретных аспектах антитело, описанное в настоящем описании, содержит Fc-область с измененной активностью связывания FcγR, проявляющую сниженное связывание с FcγR, и содержит аминокислотную модификацию в любом одном или нескольких (например, в одном, двух, трех или четырех) из положений аминокислот 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439 Fc-области, где нумерация остатков в Fc-области представляет собой нумерацию с помощью индекса EU согласно Kabat (см., например, патент США № 7183387). Например, антитело, описанное в настоящем описании, содержащее Fc-область, проявляет сниженное связывание с FcγRI и содержит аминокислотную модификацию в любом одном или нескольких (одном, двух, трех или четырех) из положений аминокислот 238, 265, 269, 270, 327 или 329 Fc-области, где нумерация остатков в Fc-области представляет собой нумерацию с помощью индекса EU согласно Kabat.

В конкретном варианте осуществления антитело, описанное в настоящем описании, содержащее Fc-область, проявляет сниженное связывание с FcγRII и содержит аминокислотную модификацию в любом одном или нескольких (например, одном, двух, трех или четырех) из положений аминокислот 238, 265, 269, 270, 292, 294, 295, 298, 303, 324, 327, 329, 333, 335, 338, 373, 376, 414, 416, 419, 435, 438 или 439 Fc-области, где нумерация остатков в Fc-области представляет собой нумерацию с помощью индекса EU в соответствии с Kabat.

В конкретном варианте осуществления антитело, описанное в настоящем описании, содержащее Fc-область, проявляет сниженное связывание с FcγRIII и содержит аминокислотную модификацию в одном или нескольких (например, в одном, двух, трех или четырех) из положений аминокислот 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 293, 294, 295, 296, 301, 303, 322, 327, 329, 338, 340, 373, 376, 382, 388, 389, 416, 434, 435 или 437 Fc-области, где нумерация остатков в Fc-области представляет собой нумерацию при помощи индекса EU в соответствии с Kabat.

В некоторых аспектах время полужизни в сыворотке белка, такого как антитело, описанное в настоящем описании, содержащее Fc-область, увеличивается вследствие увеличения аффинности связывания Fc-области с FcRn.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, специфически связываются с полипептидом KIT (например, областью D4 KIT человека) с величиной EC50 (полумаксимальная эффективная концентрация) приблизительно 50 нМ или менее при определении с помощью ELISA.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, специфически связываются с полипептидом KIT (например, область D4 KIT человека) с величиной EC50 приблизительно 150 пМ или менее при определении с помощью FACS с клетками CHO-WT-KIT (клетки CHO, модифицированные способами инженерии для рекомбинантной экспрессии KIT человека дикого типа).

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые специфически связываются с полипептидом KIT (например, область D4 KIT человека), способно блокировать фосфорилирование KIT с величиной IC50 (50% ингибиторная концентрация) приблизительно 600 пМ или менее.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые специфически связываются с полипептидом KIT (например, областью D4 KIT человека), могут рекомбинантно экспрессироваться в клетках CHO со средним титром по меньшей мере 0,5 мкг/мл. В конкретном варианте осуществления антитело, описанное в настоящем описании или его антигенсвязывающий фрагмент, которые специфически связываются с полипептидом KIT (например, областью D4 KIT человека), могут рекомбинантно экспрессироваться в клетках CHO со средним титром по меньшей мере 1,0 мкг/мл.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые специфически связываются с полипептидом KIT (например, областью D4 KIT человека), содержит VH-домен и VL-домен, которые являются неиммуногенными, например, VH-домен и VL-домен не содержат T-клеточных эпитопов.

В конкретных вариантах осуществления антитело, описанное в настоящем описании, (или его антигенсвязывающий фрагмент) не связывают внеклеточный участок связывания лиганда KIT, например, участок связывания SCF на KIT. В конкретных вариантах осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент) не ингибирует связывание лиганда с KIT, например, не ингибирует связывание лиганда KIT (например, SCF) с KIT.

В конкретных аспектах антитела (например, антитела человека или гуманизированные антитела), описанные в настоящем описании, представляют собой ингибиторные антитела, т.е. антитела, которые ингибируют (например, частично ингибируют) активность KIT, т.е. один или несколько видов активности KIT. В конкретном варианте осуществления частичное ингибирование активности KIT приводит, например, к от приблизительно 25% до приблизительно 65% или 75% ингибированию. В конкретном варианте осуществления частичное ингибирование активности KIT приводит, например, к от приблизительно 35% до приблизительно 85% или 95% ингибированию. Неограничивающие примеры видов активности KIT включают димеризацию KIT, фосфорилирование KIT (например, фосфорилирование тирозина), передачу сигнала ниже KIT (например, передачу сигнала Stat, AKT, MAPK или Ras), индукцию или усиление транскрипции генов (например, c-Myc), индукцию или усиление пролиферации или выживания клеток. В конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует фосфорилирование KIT (например, лиганд-индуцируемое фосфорилирование). В конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует фосфорилирование тирозина KIT в цитоплазматическом домене KIT. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует пролиферацию клеток. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует выживание клеток. В конкретном варианте осуществления антитело, описанное в настоящем описании, индуцирует апоптоз. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, индуцирует дифференцировку клеток, например, дифференцировку клетки, экспрессирующей KIT, например, KIT человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует активность KIT, но не ингибирует димеризацию KIT. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует активность KIT и не ингибирует связывание лиганда с KIT, например, не ингибирует связывание лиганда KIT (например, SCF) с KIT, но ингибирует димеризацию KIT.

В конкретном варианте осуществления антитело, описанное в настоящем описании, ингибирует активность KIT, такую как индуцируемое лигандом фосфорилирование тирозина цитоплазматического домена KIT, на от приблизительно 25% до приблизительно 65% или 75%, при определении с помощью клеточного анализа фосфорилирования, хорошо известного в данной области, например, клеточного анализа фосфорилирования, описанного в настоящем описании. В определенном варианте осуществления антитело, описанное в настоящем описании, ингибирует активность KIT, такую как индуцируемое лигандом фосфорилирование тирозина цитоплазматического домена KIT, на от приблизительно 35% до приблизительно 85% или 95%, при определении с помощью клеточного анализа фосфорилирования, хорошо известного в данной области, например, клеточного анализа фосфорилирования, описанного в настоящем описании. В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент или конъюгат, ингибируют активность KIT, такую как индуцируемое лигандом фосфорилирование тирозина цитоплазматического домена KIT, с 50% ингибиторной концентрацией (IC50) менее чем приблизительно 600 пМ или менее чем приблизительно 500 пМ, или менее чем приблизительно 250 пМ, при определении с помощью клеточного анализа фосфорилирования, хорошо известного данной области, например, клеточного анализа фосфорилирования, описанного в настоящем описании. В конкретном варианте осуществления IC50 составляет менее чем приблизительно 550 пМ или 200 пМ. В конкретном варианте осуществления IC50 находится в диапазоне от приблизительно 50 пМ до приблизительно 225 пМ, или в диапазоне от 100 пМ до приблизительно 600 пМ. В конкретном варианте осуществления IC50 находится в диапазоне от приблизительно 50 пМ до приблизительно 550 пМ, или от приблизительно 50 пМ до приблизительно 600 пМ, или от приблизительно 150 пМ до приблизительно 550 пМ.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент или конъюгат, (i) иммуноспецифически связываются с полипептидом KIT, содержащим область D4 KIT человека, (ii) ингибируют фосфорилирование KIT (например, фосфорилирование тирозина), и (iii) не влияют на связывание лиганда KIT (например, SCF) с KIT. В другом конкретном варианте осуществления такое антитело не ингибирует димеризацию KIT. В другом конкретном варианте осуществления такое антитело может рекомбинантно экспрессироваться клетками CHO со средним титром по меньшей мере 0,5 мкг/мл, например, по меньшей мере 1,0 мкг/мл. В следующем конкретном варианте осуществления такое антитело содержит VH-домен и VL-домен, которые являются неиммуногенными, например, VH-домен и VL-домен не содержат T-клеточных эпитопов.

В других конкретных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, или их конъюгат, иммуноспецифически связываются с мономерной формой KIT (например, KIT человека). В конкретных вариантах осуществления антитело, описанное в настоящем описании, не связывается иммуноспецифически с мономерной формой KIT (например, KIT человека). В конкретных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, или их конъюгат, иммуноспецифически связываются с димерной формой KIT (например, KIT человека). В конкретных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, или их конъюгат, не связываются с мономерной формой KIT и специфически связываются с димерной формой KIT или мультимерной формой KIT. В определенных вариантах осуществления антитело обладает более высокой аффиностью в отношении мономера KIT, чем в отношении димера KIT. В определенных вариантах осуществления антитело обладает более высокой аффинностью в отношении мономера KIT, чем в отношении мультимера KIT.

В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании (или его антигенсвязывающий фрагмент или их конъюгат) специфически связывается с нативной изоформой или нативным вариантом KIT (которые представляют собой природную изоформу или вариант KIT в животном (например, обезьяне, мыши, козе, осле, собаке, кошке, кролике, свинье, крысе, человеке, лягушке или птице), которые могут быть выделены из животного, предпочтительно, человека). В конкретных вариантах осуществления антитело, описанное в настоящем описании, иммуноспецифически связывается с KIT человека или его фрагментом. В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании (или его антигенсвязывающий фрагмент или его конъюгат), специфически связывается с KIT человека или его фрагментом и не связывается специфически с KIT не человека (например, обезьяны, мыши, козы, осла, собаки, кошки, кролика, свиньи, крысы или птицы) или его фрагментом. В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании (или его антигенсвязывающий фрагмент или их конъюгат), специфически связывается с KIT человека или его фрагментом и не связывается специфически с KIT мыши. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, специфически связывается с KIT человека или его фрагментом (например, областью D4 KIT человека) и с KIT животных семейства собачьи (собаки) и не являющегося человеком примата (например, обезьяны). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, специфически связывается с KIT человека или его фрагментом (например, областью D4 KIT человека) и с KIT животных семейства собачьи (собаки). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, специфически связывается с KIT человека или его фрагментом (например, областью D4 KIT человека) и с KIT не являющегося человеком примата (например, обезьяны). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, специфически связывается с KIT человека или его фрагментом (например, областью D4 KIT человека) и с KIT животного семейства собачьи (собаки) и не являющегося человеком примата (например, обезьяны), но не связывается специфически с KIT мыши или его фрагментом (например, областью D4 KIT мыши).

В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, связываются с внеклеточным доменом KIT человека, содержащим мутацию, например, соматическую мутацию, связанную со злокачественной опухолью (например, GIST), такую как мутацию в экзоне 9 KIT человека, где остатки Ala и Tyr в положениях 502 и 503 дуплицированы. В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, связываются с внеклеточным доменом KIT человека дикого типа и внеклеточным доменом KIT человека, содержащим мутацию, например, соматическую мутацию, связанную со злокачественной опухолью (например, GIST), такую как мутация в экзоне 9 KIT человека, где остатки Ala и Tyr в положениях 502 и 503 дуплицированы (см., например, Marcia et al., (2000) Am. J. Pathol. 156(3):791-795; и Debiec-Rychter et al., (2004) European Journal of Cancer. 40:689-695, описывающие мутации KIT, обе из которых включены в настоящее описание в полном объеме).

В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, связываются с внеклеточным доменом KIT человека, который является гликозилированным. В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, связываются с двумя различными гликозилированными формами внеклеточного домена KIT человека. Например, две формы KIT человека с различными молекулярными массами, указывающими на различные профили гликозилирования, были выявлены с помощью иммуноблоттинга. В определенных вариантах осуществления антитело, описанное в настоящем описании, может специфически связываться с обеими из этих форм KIT человека, которые имеют различные профили гликозилирования, например, одна форма является более гликолизированной, чем другая. В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, связываются с внеклеточным доменом KIT человека, который не является гликозилированным.

В конкретном варианте осуществления антитело, описанное в настоящем описании, не связывается иммуноспецифически с эпитопом KIT, описанным в международной патентной заявке № WO 2008/153926, например, эпитопом, по существу состоящим из аминокислотной последовательности SELHLTRLKGTEGGTYT (SEQ ID NO:38) или LTRLKGTEGG (SEQ ID NO:39).

В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не является антителом, выбранным из группы, состоящей из: антитела SR-1 (см. публикацию патентной заявки США № US 2007/0253951 A1; публикацию международной патентной заявки № WO 2007/127317); антитела против KIT, полученного из гибридомных клеточных линий DSM ACC 2007, DSM ACC 2008 или DSM ACC 2009, которые депонированы в Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, DSM, Mascheroder Weg 1 b, D-38124 Braumschweig, Германия (см. патент США № 5545533; публикацию международной патентной заявки № WO 92/021766); антитела, продуцируемого гибридомной клеточной линией DSM ACC 2247 (или A3C6E2; депозит № DSM ACC 2247, в Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, DSM, Mascheroder Weg 1 b, D-38124 Braumschweig, Германия) (см. патент США № 5808002); и антитела против KIT, обозначаемые как K27, K44, K45, K49, K57, K69 и K94 (см., например, Blechman et al., Stem Cells, 1993, 11:12-21; Blechman et al., Cell, 1995, 80:103-113; Lev et al., Mol. Cell. Biol., 1993, 13:2224-2234; и публикацию патентной заявки Европы № EP0548867 A2). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не содержит CDR антитела, выбранного из такой группы. В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании, не содержит одну или несколько (например, две, три, четыре, пять или шесть) CDR (например, 3 CDR VL и/или 3 CDR VH) антитела, выбранного из такой группы. В другом варианте осуществления антитело, описанное в настоящем описании, не блокируется конкурентно (например, не блокируется конкурентно дозозависимым образом) одним из этих антител, например, при определении с помощью конкурентных анализов связывания (например, ELISA). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не является антителом Ab1 или Ab21, которое описано во временной заявке США № 61/426387, поданной 22 декабря 2010 года. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не является антителом, выбранным из группы, состоящей из: Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, Ab10, Ab11, Ab12, Ab13, Ab14, Ab15, Ab16, Ab17, Ab18, Ab19, Ab20 и Ab21, как описано во временной заявке США № 61/426387, поданной 22 декабря 2010 года, и Ab24-Ab192, как описано в международной патентной заявке PCT № PCT/US2011/29980, поданной 25 марта 2011 года. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не содержит CDR, или одну или несколько CDR (например, 3 CDR VL и/или 3 CDR VH), антитела, выбранного из группы, состоящей из: Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, Ab10, Ab11, Ab12, Ab13, Ab14, Ab15, Ab16, Ab17, Ab18, Ab19, Ab20 и Ab21, как описано во временной заявке США № 61/426387, поданной 22 декабря 2010 года, и Ab24-Ab192, как описано в международной патентной заявке PCT № PCT/US2011/29980, поданной 25 марта 2011 года. В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании, не содержит CDR, или одну или несколько CDR (например, 3 CDR VL и/или 3 CDR VH), область VL-цепи или область VH-цепи антитела, выбранного из антител (например, антитела Ab1-Ab21 и Ab24-Ab192), описанных во временной заявке США № 61/426387, поданной 22 декабря 2010 года, или в международной патентной заявке PCT № PCT/US2011/29980, поданной 25 марта 2011 года. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не является антителом Ab1 или Ab21, или антителом, содержащим CDR (например, одну, две, три, четыре, пять или шесть CDR) антитела Ab1 или Ab21, как описано во временной заявке США № 61/426387, поданной 22 декабря 2010 года. В конкретном варианте осуществления антитело, описанное в настоящем описании, не является антителом 37M или 37C, как описано в международной патентной заявке PCT № PCT/US2012/022471, поданной 25 января 2012 года. В определенном варианте осуществления антитело, описанное в настоящем описании, не содержит VL-домен, содержащий SEQ ID NO:32, или VH-домен, содержащий SEQ ID NO:31.

В конкретном варианте осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, которые иммуноспецифически связываются с полипептидом KIT (например, область D4 KIT, например, KIT человека), не содержат одну или несколько (например, два, три, четыре, пять или шесть) CDR (например, CDR1 VL, CDR2 VL, CDR3 VL, CDR1 VH, CDR2 VH и CDR3 VH) антитела, описанного в публикации патентной заявки США № US 2008/0287309, например, антител 36C1, 84H7, 63C10 или 65A12.

В конкретном варианте осуществления антитело, описанное в настоящем описании, не является человеческой или гуманизированной версией антитела, продуцируемого гибридомой (BA7.3C.9), имеющей номер доступа в American Type Culture Collection (ATCC) HB10716, как описано, например, в патенте США № 5919911 или патенте США № 5489516. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит CDR (например, CDR1 VL, CDR2 VL, CDR3 VL, CDR1 VH, CDR2 VH и/или CDR3 VH) антитела, продуцируемого гибридомой (BA7.3C.9), имеющей номер доступа в American Type Culture Collection (ATCC) HB10716, как описано, например, в патенте США № 5919911 или в патенте США № 5489516. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит CDR антитела SR-1, описанного, например, в патенте США № 5919911 или в патенте США № 5489516 или в публикации патентной заявки США № US 2007/0253951 A1 (см., например, [0032] или [0023]). В следующем варианте осуществления антитело, описанное в настоящем описании, не является антителом, продуцируемым гибридомой (BA7.3C.9), имеющей номер доступа в American Type Culture Collection (ATCC) HB10716, как описано, например, в патенте США № 5919911 или в патенте США № 5489516.

В конкретном варианте осуществления антитело, описанное в настоящем описании, не является гуманизированным антителом SR-1, как описано в публикации патентной заявки США № US 2007/0253951 A1. В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит одну или несколько аминокислотных последовательностей, выбранных из группы, состоящей из: SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8 и SEQ ID NO:10, приведенных в публикации патентной заявки США № US 2007/0253951 A1. В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит аминокислотные последовательности SEQ ID NO:2 и 4 или SEQ ID NO:2 и 6, приведенные в публикации патентной заявки США № US 2007/0253951 A1. В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит одну или несколько аминокислотных последовательностей, которые по меньшей мере на 90% идентичны аминокислотной последовательности, выбранной из группы, состоящей из: SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8 и SEQ ID NO:10, приведенных в публикации патентной заявки США № US 2007/0253951 A1. В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит одну или несколько CDR, описанных в публикации патентной заявки США № US 2007/0253951 A1, например, аминокислоты 44-58 SEQ ID NO:8 (CDR1 VL антитела SR-1; RASESVDIYGNSFMH), аминокислоты 74-80 SEQ ID NO:8 (CDR2 VL антитела SR-1; LASNLES), аминокислоты 111-121 SEQ ID NO:8 (CDR3 VL антитела SR-1; QQNNEDPYT), аминокислоты 50-54 SEQ ID NO:10 (CDR1 VH антитела SR-1; SYNMH), аминокислоты 69-85 SEQ ID NO:10 (CDR2 VH антитела SR-1; VIYSGNGDTSYNQKFKG), и/или аминокислоты 118-125 SEQ ID NO:10 (CDR3 VH антитела SR-1; RDTRFGN), где SEQ ID NO:8 и 10 представляют собой последовательности, приведенные в публикации патентной заявки США № US 2007/0253951 A1 (см., например, [0032] или [0023]). В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит одну или несколько CDR, описанных в публикации патентной заявки США № US 2007/0253951 A1, например, аминокислоты 43-58 SEQ ID NO:2 (CDR1 VL), аминокислоты 74-80 SEQ ID NO:2 (CDR2 VL), аминокислоты 113-121 SEQ ID NO:2 (CDR3 VL), аминокислоты 50-54 SEQ ID NO:4 (CDR1 VH), аминокислоты 69-85 SEQ ID NO:4 (CDR2 VH), и/или аминокислоты 118-125 SEQ ID NO:4 (CDR3 VH), где SEQ ID NO:2 и 4 представляют собой последовательности, приведенные в публикации патентной заявки США № US 2007/0253951 A1. В конкретном варианте осуществления антитело, описанное в настоящем описании, не является антителом SR-1, как описано в публикации патентной заявки США № US 2007/0253951 A1.

В конкретном варианте осуществления антитело, описанное в настоящем описании, не является антителом, выбранным из группы, состоящей из: антител против S100, ACK2 и ACK4, как описано в патенте США № 6989248 или в патенте США № 7449309. В конкретном варианте осуществления антитело, описанное в настоящем описании, не является человеческой или гуманизированной версией антитела, выбранной из такой группы. В конкретном варианте осуществления антитело, описанное в настоящем описании, не является антителом, содержащим одну или несколько CDR (например, 3 CDR VL и/или 3 CDR VH) антитела, выбранного из группы, состоящей из: антител против S100, ACK2 и ACK4, как описано в патенте США № 6989248 или в патенте США № 7449309.

В некоторых аспектах можно использовать конкурентные анализы связывания для облегчения идентификации эпитопа-мишени антитела или определения того, блокируется ли антитело конкурентно, например, дозозависимым образом, другим антителом, например, антителом, которое связывает по существу тот же эпитоп или перекрывающиеся эпитопы, что и эталонное антитело, когда два антитела распознают идентичные или пространственно перекрывающиеся эпитопы в конкурентных анализах связывания, таких как конкурентные анализы ELISA, которые могут иметь конфигурацию всех различных форматов, с использованием либо меченного антигена, либо меченного антитела. Известны многочисленные типы конкурентных анализов связывания, например: твердофазный прямой или непрямой радиоиммунный анализ (RIA), твердофазный прямой или непрямой ферментный иммуноанализ (EIA), конкурентный сэндвич-анализ (см. Stahli et al., (1983) Methods in Enzymology 9:242); твердофазный прямой EIA с биотином-авидином (см. Kirkland et al., (1986) J. Immunol. 137:3614); твердофазный анализ с прямым мечением, твердофазный сэндвич-анализ с прямым мечением (см. Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Press); твердофазный RIA с прямым мечением с использованием метки I-125 (см. Morel et al., (1988) Mol. Immunol. 25(1):7); твердофазный прямой EIA с биотином-авидином (Cheung et al., (1990) Virology 176:546); и RIA с прямым мечением (Moldenhauer et al., (1990) Scand J. Immunol. 32:77). Как правило, такой анализ вовлекает использование очищенного антигена (например, KIT, такого как внеклеточный домен KIT или область D4 KIT), связанного с твердой поверхностью или клетками, несущими любой из этих антигенов, немеченый исследуемый иммуноглобулин и меченый эталонный иммуноглобулин. Конкурентное ингибирование можно измерять путем определения количества метки, связавшейся с твердой поверхностью или клетками, в присутствии исследуемого иммуноглобулина. Обычно исследуемый иммуноглобулин присутствует в избытке. В некоторых аспектах, когда конкурентное антитело присутствует в избытке, оно будет ингибировать специфическое связывание эталонного антитела с общим антигеном по меньшей мере на 50-55%, 55-60%, 60-65%, 65-70% 70-75% или более. В обычной версии этого анализа антиген иммобилизован на 96-луночном планшете. Затем измеряют способность немеченых антител блокировать связывание меченых антител с антигеном с использованием радиоактивных или ферментных меток. Для дальнейших деталей см., например, Wagener et al., J. Immunol., 1983, 130:2308-2315; Wagener et al., J. Immunol. Methods, 1984, 68:269-274; Kuroki et al., Cancer Res., 1990, 50:4872-4879; Kuroki et al., Immunol. Invest., 1992, 21:523-538; Kuroki et al., Hybridoma, 1992, 11:391-407, и Using Antibodies: A Laboratory Manual, Ed Harlow and David Lane editors (Cold Springs Harbor Laboratory Press, Cold Springs Harbor, N.Y., 1999), pp. 386-389.

В некоторых аспектах, антитело, описанное в настоящем описании, которое иммуноспецифически связывается с областью D4 полипептида KIT (например, полипептида KIT человека) может быть описано с помощью его области VL-цепи (например, любая из SEQ ID NO:7-10) или области VH-цепи (например, любая из SEQ ID NO:2-6), или с помощью его 3 CDR VL или его 3 CDR VH. См., например, Rader et al., 1998, Proc. Natl. Acad. Sci. USA, 95: 8910-8915, которая включена в настоящее описание в качестве ссылки в полном объеме, где описана гуманизация антитела мыши против αvβ3 путем идентификации комплементирующей легкой цепи или тяжелой цепи из библиотеки легких цепей или тяжелых цепей человека, соответственно, с получением вариантов гуманизированного антитела, имеющих аффинности, равные или превышающие аффинность исходного антитела. Также см., Clackson et al., 1991, Nature, 352:624-628, которая включена в настоящее описание в качестве ссылки в полном объеме, в которой описаны способы получения антител, которые связывают специфический антиген с использованием специфического домена VL (или VH), и скрининга библиотеки в отношении комплементарных вариабельных доменов. Скрининг обеспечил 14 новых партнеров для конкретных VH-доменов и 13 новых партнеров для конкретного VL-домена, которые были прочно связывающимися структурами при определении с помощью ELISA.

Таким образом, в некоторых аспектах в рамках настоящего изобретения предусматривается антитело, которое иммуноспецифически связывается с областью D4 полипептида KIT (например, полипептида KIT человека), содержащей VL-домен, содержащий аминокислотную последовательность SEQ ID NO:7 или 8. В некоторых вариантах осуществления в рамках настоящего изобретения предусматривается антитело, которое иммуноспецифически связывается с областью D4 полипептида KIT (например, полипептида KIT человека), содержащей VH-домен, содержащий аминокислотную последовательность SEQ ID NO:4 или 5.

В некоторых аспектах CDR антитела, описанного в настоящем описании, определят способом Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917, и их обозначают в настоящем описании как "CDR по Chothia" (также см., например, патент США № 7709226). При использовании системы нумерации Kabat для нумерации аминокислотных остатков в области VH-цепи и области VL-цепи, CDR по Chothia в молекуле тяжелой цепи антитела, как правило, присутствуют в положениях аминокислот 26-32 ("CDR1"), в положениях аминокислот 53-55 ("CDR2") и в положениях аминокислот 96-101 ("CDR3"). При использовании системы нумерации Kabat для нумерации аминокислотных остатков в области VH-цепи и области VL-цепи, CDR Chothia в молекуле легкой цепи антитела, как правило, присутствуют в положениях аминокислот 26-33 (CDR1), в положениях аминокислот 50-52 (CDR2) и в положениях аминокислот 91-96 (CDR3).

В конкретном варианте осуществления положение CDR в области VH и/или VL антитела, описанного в настоящем описании, может различаться на одно, два, три или четыре положений аминокислот при условии, что сохраняется иммуноспецифическое связывание с KIT (например, областью D4 KIT человека) (например, по существу сохраняется, например, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 95%). Например, в одном из вариантов осуществления положение, определяющее CDR антитела, описанного в настоящем описании, может варьировать вследствие сдвига N-концевой и/или C-концевой границы CDR на одну, две, три или четыре аминокислоты относительно положения CDR, представленного на фиг.3A-3I при условии, что сохраняется иммуноспецифическое связывание с KIT (например, областью D4) (например, по существу сохраняется, например, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, по меньшей мере на 95%).

В конкретных аспектах в рамках настоящего изобретения предусматривается антитело, содержащее легкую цепь и тяжелую цепь антитела, например, отдельную легкую цепь и тяжелую цепь. Что касается легкой цепи, в конкретном варианте осуществления легкая цепь антитела, описанного в настоящем описании, представляет собой легкую цепь каппа. В другом конкретном варианте осуществления легкая цепь антитела, описанного в настоящем описании, представляет собой легкую цепь лямбда. В другом конкретном варианте осуществления легкая цепь антитела, описанного в настоящем описании, представляет собой легкую цепь каппа человека или легкую цепь лямбда человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, полипептид KIT, содержащий область D4 KIT, например, KIT человека (например, SEQ ID NO:15)) содержит легкую цепь, где аминокислотная последовательность области VL-цепи содержит любую аминокислотную последовательность, описанную в настоящем описании (например, SEQ ID NO:7, 8, 9 или 10), и где константная область легкой цепи содержит аминокислотную последовательность константной области легкой цепи каппа человека. Неограничивающие примеры последовательностей константной области легкой цепи человека описаны в данной области, например, см. патент США № 5693780 и Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242.

Что касается тяжелой цепи, в конкретном варианте осуществления тяжелая цепь антитела, описанного в настоящем описании, может представлять собой тяжелую цепь альфа (α), дельта (δ), эпсилон (ε), гамма (γ) или мю (μ). В другом конкретном варианте осуществления тяжелая цепь описанного антитела может содержать тяжелую цепь альфа (α), дельта (δ), эпсилон (ε), гамма (γ) или мю (μ) человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, полипептидом KIT, содержащим область D4 KIT, например, KIT человека (например, SEQ ID NO:15)), содержит тяжелую цепь, где аминокислотная последовательность области VH-цепи содержит любую аминокислотную последовательность, описанную в настоящем описании (например, любую из SEQ ID NO:2-6), и где константная область тяжелой цепи содержит аминокислотную последовательность константной области тяжелой цепи гамма (γ) человека. Неограничивающие примеры последовательностей константной области тяжелой цепи человека описаны в данной области, например, см. патент США № 5693780 и Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242.

В конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT, например, KIT человека) содержит область VL-цепи и область VH-цепи, содержащую любые аминокислотные последовательности, описанные в настоящем описании, и где константные области содержат аминокислотные последовательности константных областей молекулы иммуноглобулина IgG, IgE, IgM, IgD, IgA или IgY или молекулы иммуноглобулина IgG, IgE, IgM, IgD, IgA или IgY человека. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT, например, KIT человека) содержит область VL-цепи и область VH-цепи, содержащие любые аминокислотные последовательности, описанные в настоящем описании, и где константные области содержат аминокислотные последовательности константных областей молекулы иммуноглобулина IgG, IgE, IgM, IgD, IgA или IgY, любого класса (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или любого подкласса (например, IgG2a и IgG2b) молекулы иммуноглобулина. В конкретном варианте осуществления константные области содержат аминокислотные последовательности константных областей молекулы иммуноглобулина IgG, IgE, IgM, IgD, IgA или IgY человека, любого класса (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или любого подкласса (например, IgG2a и IgG2b) молекулы иммуноглобулина.

В другом конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT, например, KIT человека), содержит область VL-цепи и область VH-цепи, содержащие любые аминокислотные последовательности, описанные в настоящем описании (например, любую из SEQ ID NO:2-6 и/или любую из SEQ ID NO:7-10), и где константные области содержат аминокислотные последовательности константных областей IgG1 человека или IgG4 человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT, например, KIT человека) содержит область VL-цепи и область VH-цепи, содержащие любые аминокислотные последовательности, описанные в настоящем описании, и где константные области содержат аминокислотные последовательности константной области IgG1 человека.

В конкретных вариантах осуществления антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека, например, SEQ ID NO:15), содержит каркасные области (например, каркасные области VL-домена и/или VH-домена), которые представляют собой каркасные области человека или происходят из каркасных областей человека. Неограничивающие примеры каркасных областей человека описаны в данной области, например, см. Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). В определенном варианте осуществления антитело, описанное в настоящем описании, содержит каркасные области (например, каркасные области VL-домена и/или VH-домена), которые представляют собой каркасные области примата (например, не являющегося человеком примата) или происходящие из примата (например, не являющегося человеком примата) каркасные области.

В определенных примерах антитело, описанное в настоящем описании, содержит каркасные области (например, каркасные области VL-домена и/или VH-домена), которые не являются каркасными областями примата (например, не являющегося человеком примата, например, обезьяны, такой как мартышка) или происходящими из примата (например, не являющегося человеком примата) каркасными областями.

В определенных примерах, в отношении любого из этих антител, описанных в настоящем описании, область VL-цепи не содержит каркасных областей не являющегося человеком примата (например, обезьяны, такой как мартышка) или не происходит из каркасных областей не являющегося человеком примата (например, обезьяны, такой как мартышка). В некоторых других вариантах осуществления область VH-цепи не содержит каркасных областей не являющегося человеком примата (например, обезьяны, такой как мартышка) или не происходит из каркасных областей не являющегося человеком примата (например, обезьяны, такой как мартышка).

Неограничивающие примеры каркасных областей не являющегося человеком примата включают каркасные области мартышки, например, Pan troglodytes, Pan paniscus или Gorilla gorilla; шимпанзе Pan troglodytes; мартышки, такой как мартышка рода Macaca; и яванского макака Macaca cynomolgus. Неограничивающие примеры не являющихся человеческими последовательностей каркасных областей приматов описаны в публикации патентной заявки США № US 2005/0208625.

В некоторых аспектах также в рамках настоящего изобретения предусматриваются антитела, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT, например, KIT человека), содержащим одну или несколько замен аминокислотных остатков, например, в области VL-цепи или в области VH-цепи, например, CDR или FR. В конкретных вариантах осуществления ни одна из замен аминокислотных остатков не расположена в CDR. В конкретных вариантах осуществления все из аминокислотных замен расположены в FR (см., например, таблицы 5A-6B). В определенном варианте осуществления аминокислотная замена представляет собой консервативную аминокислотную замену.

Как используется в рамках изобретения, "консервативная аминокислотная замена" представляет собой замену, в которой аминокислотный остаток заменен аминокислотным остатком, имеющим боковую цепь со сходным зарядом. Семейства аминокислотных остатков, имеющие боковые цепи со сходными зарядами, определены в данной области. Эти семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин).

В конкретных вариантах осуществления гликозилирование антител, описанных в настоящем описании, является модифицированным. Например, можно получать агликозилированное антитело (т.е. антитело лишено гликозилирования) или можно получать антитело, содержащее мутацию или замену в одном или нескольких участках гликозилирования, для устранения гликозилирования в одном или нескольких участках гликозилирования. Гликозилирование можно изменять, например, для увеличения аффинности антитела к антигену-мишени (например, KIT человека, например, области D4 KIT человека). Такие модификации углеводов можно проводить, например, путем изменения одного или нескольких участков гликозилирования в последовательности антитела. Например, можно вносить одну или несколько аминокислотных замен, которые приводят к устранению одного или нескольких участков гликозилирования вариабельных областей (например, CDR VL и/или VH или FR VL и/или VH), чтобы тем самым устранить гликозилирование в этом участке. Такое агликозилирование может увеличивать аффинность антитела в отношении антигена (например, KIT человека, например, область D4 KIT человека). Такой подход более подробно описан в патентах США № 5714350 и 6350861.

Гликозилирование может осуществляться путем N-связанного (или аспарагин-связанного) гликозилирования или O-связанного гликозилирования. N-связанное гликозилирование вовлекает модификацию углевода на NH2-группе боковой цепи аминокислоты аспарагина в полипептида. O-связанное гликозилирование вовлекает модификацию углевода на гидроксильной группе боковой цепи аминокислоты серина, треонина или гидроксилизина.

В конкретных вариантах осуществления остаток аспарагина (N) в области VH (например, SEQ ID NO:2, 3, 4, 5 или 6) или области VL (например, SEQ ID NO:7, 8, 9 или 10) антитела, описанного в настоящем описании, заменен серином (S) или другой аминокислотой (например, аланином, глицином, глутамином, треонином, тирозином, цистеином). В других конкретных вариантах осуществления остаток аспарагина (N) в CDR VH (например, CDR1 VH, CDR2 VH и/или CDR3 VH, содержащие последовательности SEQ ID NO:16-18, соответственно) и/или CDR VL (например, CDR1 VL, CDR2 VL и/или CDR3 VL, содержащие последовательности SEQ ID NO:19-21, соответственно) антитела, описанного в настоящем описании, заменен серином (S) или другой аминокислотой (например, аланином, глицином, глутамином, треонином, тирозином, цистеином). В других конкретных вариантах осуществления остаток аспарагина (N) в FR VH (например, FR1 VH, FR2 VH, FR3 VH и/или FR4 VH, как указано в таблицах 5A, 5C и 6B) и/или FR VL (например, FR1 VL, FR2 VL, FR3 VL и/или FR4 VL, как указано в таблице 5B, 5D и 6A) антитела, описанного в настоящем описании, заменен серином (S) или другой аминокислотой (например, аланином, глицином, глутамином, треонином, тирозином, цистеином).

В определенных вариантах осуществления агликозилированные антитела можно продуцировать в бактериальных клетках, которые лишены необходимого для гликозилирования аппарата. Клетки с измененным аппаратом гликозилирования описаны в данной области, и их можно использовать в качестве клеток-хозяев, в которых экспрессируют рекомбинантные антитела, описанные в настоящем описании, чтобы тем самым получить антитело с измененным гликозилированием. См., например, Shields, R.L. et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech. 17:176-1, а также патент Европы № EP 1176195; публикации PCT WO 03/035835; WO 99/54342.

В определенных вариантах осуществления одну или несколько модификаций можно вносить в Fc-область антитела, описанного в настоящем описании, главным образом, для изменения одного или нескольких функциональных свойств антитела, таких как время полужизни в сыворотке, фиксация комплемента, связывание с Fc-рецептором и/или антителозависимая клеточная цитотоксичность. Эти модификации описаны, например, в публикации международной патентной заявки № WO 2008/153926 A2.

В конкретных вариантах осуществления остаток аспарагина (N) в константной области тяжелой цепи и/или константной области легкой цепи антитела, описанного в настоящем описании, заменен серином (S) или другой аминокислотой (например, аланином, глицином, глутамином, треонином, тирозином, цистеином).

В конкретных вариантах осуществления остаток аспарагина (N) в тяжелой цепи и/или легкой цепи антитела, описанного в настоящем описании, заменен серином (S) или другой аминокислотой (например, аланином, глицином, глутамином, треонином, тирозином, цистеином).

В рамках настоящего изобретения предусматриваются антитела, которые иммуноспецифически связываются с антигеном KIT, и которые могут модулировать активность KIT. В определенных вариантах осуществления антитело, описанное в настоящем описании, иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, и ингибирует активность KIT. Активность KIT может относиться к любой активности KIT, известной или описанной в данной области, например, димеризации рецептора KIT, фосфорилированию рецептора KIT (фосфорилированию тирозина), передаче сигнала ниже рецептора KIT (например, передача сигнала AKT, MAPK/ERK, Ras, Stat1, Stat3 или Stat5), индуцируемой KIT-лигандом (например, SCF) регуляции транскрипции (например, индуцируемой SCF активации транскрипции c-Myc), индукции или усилению пролиферации клеток или выживания клеток. Активность KIT или функцию KIT используют в настоящем описании взаимозаменяемо. В некоторых аспектах, активность KIT индуцируется связыванием лиганда KIT (например, SCF) с KIT-рецептором. В конкретных аспектах активность KIT может индуцироваться или усиливаться мутациями с приобретением функции, которые могут приводить, например, к димеризации и конститутивно активной передаче сигнала KIT (см., например, Mol et al., J. Biol. Chem., 2003, 278:31461-31464; Hirota et al., J. Pathology, 2001, 193:505-510). Такое приобретение функции может позволить димеризацию рецептора KIT и передачу сигнала KIT в отсутствие связывания лиганда KIT (например, SCF) с KIT-рецептором. В определенных вариантах осуществления увеличение активности или передачи сигнала KIT может происходить в отсутствие связывания лиганда KIT (например, SCF) с KIT-рецептором вследствие высокой экспрессии (или сверхэкспрессии) рецепторов KIT. Высокая экспрессия или сверхэкспрессия KIT в клетке относится к уровню экспрессии, который по меньшей мере приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, или 100% более превышает уровень экспрессии эталонной клетки, о которой известно, что она имеет нормальную экспрессию KIT или активность KIT, или уровень экспрессии KIT, превышающий средний экспрессии KIT в популяции клеток или образцах, о которых известно, что они имеют нормальную экспрессию KIT или активность KIT. Уровни экспрессии KIT можно оценивать способами, описанными в настоящем описании или известными специалисту в данной области (например, вестерн-блоттинг или иммуногистохимия). В конкретных вариантах осуществления активность KIT, превышающая нормальную активность KIT, может приводить к трансформации клеток, неоплазии и образованию опухоли. В конкретных вариантах осуществления активность KIT, которая превышает нормальную активность KIT, может приводить к другим связанным с KIT нарушениям или заболеваниям.

В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не блокирует или не ингибирует связывание лиганда KIT (например, SCF) с рецептором KIT. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, практически не ингибирует или не снижает (например, менее чем приблизительно на 2% или 3%) связывание лиганда KIT (например, SCF) с KIT-рецептор. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не индуцирует или не усиливает диссоциацию лиганда KIT (например, SCF) от KIT-рецептора. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании только незначительно индуцирует или усиливает (например, менее чем приблизительно на 2% или 3%) диссоциацию лиганда KIT (например, SCF) от KIT-рецептора.

В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, не блокирует или не ингибирует димеризацию KIT-рецептора. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, только незначительно (например, менее чем приблизительно на 2% или 3% или в пределах стандартной ошибки или отклонения) ингибирует или снижает димеризацию KIT-рецептора. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании не индуцирует или не усиливает диссоциацию димера KIT-рецептора. В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании только незначительно (например, менее чем приблизительно на 2% или 3% или в пределах стандартной ошибки или отклонения) индуцирует или усиливает диссоциацию димера KIT-рецептора. В конкретном варианте осуществления антитело против KIT, описанное в настоящем описании, может специфически связываться с димером KIT-рецептора и не блокирует или не ингибирует димеризацию KIT-рецептора. В конкретном варианте осуществления антитело против KIT, описанное в настоящем описании, может специфически связываться с мономером KIT-рецептора и не блокирует или не ингибирует димеризацию KIT-рецептора.

В некоторых аспектах в качестве ингибитора активности KIT, антитело, описанное в настоящем описании, может блокировать или ингибировать (например, частично ингибировать) димеризацию KIT. Как правило, димеризация KIT-рецептора индуцируется, когда лиганд KIT связывается с KIT. Таким образом, в конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют (например, частично ингибируют) димеризацию KIT-рецепторов по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, с помощью анализа иммунопреципитации, относительно димеризации KIT-рецепторов в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антителом, которое не иммуноспецифически связывается с KIT). В конкретном варианте осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и частично ингибируют димеризацию KIT-рецепторов приблизительно на от 25% до 75%. Блокирование или ингибирование (например, частичное ингибирование) димеризации KIT-рецепторов антителами, описанными в настоящем описании, можно оценивать в присутствии стимуляции лигандом KIT. Например, клетки, экспрессирующие KIT, контактируют с лигандом KIT в присутствии или в отсутствие антител против KIT, описанных в настоящем описании, и определяют уровень димеризации KIT-рецептора. В определенных вариантах осуществления индуцируемая лигандом KIT димеризация KIT-рецептором в отсутствие антитела против KIT по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз превышает димеризацию KIT-рецептора в присутствии антитела против KIT при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализы иммунопреципитации). Фосфорилирование одного или нескольких остатков тирозина в цитоплазматическом домене KIT может быть индикатором димеризации KIT-рецептора.

В определенных вариантах осуществления антитело, описанное в настоящем описании, может ингибировать (например, частично ингибирует) активность KIT по меньшей мере приблизительно на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании и/или известными специалисту в данной области, относительно активности KIT в присутствии стимуляции лигандом KIT без какого-либо антитела или с неродственным антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В определенных вариантах осуществления антитело, описанное в настоящем описании, может ингибировать (например, частично ингибирует) активность KIT по меньшей мере на от приблизительно 25% до приблизительно 65% при оценке способами, описанными в настоящем описании и/или известными специалисту в данной области, относительно активности KIT в присутствии стимуляции лиганда KIT без какого-либо антитела или с неродственным антителом (например, антитело, которое не связывается иммуноспецифически с KIT). Неограничивающие примеры активности KIT могут включать фосфорилирование KIT-рецептора, передачу сигнала KIT-рецептора, опосредуемую лигандом KIT (например, SCF) пролиферацию клеток, опосредуемое лигандом KIT (например, SCF) выживание клеток и активацию транскрипции гена-мишени KIT (например, c-Myc).

В качестве ингибитора активности KIT, антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат), может блокировать (например, частично блокирует) или ингибировать (например, частично ингибирует) фосфорилирование KIT, в частности фосфорилирование одного или нескольких остатков тирозина в цитоплазматическом домене KIT. Как правило, димеризация и фосфорилирование KIT-рецептора индуцируются, когда лиганд KIT связывается с KIT. Однако в некоторых аспектах димеризация и/или фосфорилирование KIT-рецептора могут происходить независимо от связывания лиганда KIT с KIT-рецептором. Например, димеризация и/или фосфорилирование KIT-рецептора могут происходить вследствие мутаций с приобретением функции или сверхэкспрессии KIT.

Неограничивающие примеры остатков тирозина в цитоплазматическом домене KIT мыши, который может фосфорилироваться, например, при стимуляции лиганда, включают 544, 546, 552, 567, 569, 577, 608, 645, 671, 674, 702, 719, 728, 745, 772, 821, 844, 853, 868, 878, 898 и 934 (см. Ueda et al., Blood, 2002, 99:3342-3349). Соответствующие остатки тирозина в цитоплазматическом домене KIT человека можно без труда определить. Неограничивающие примеры остатков тирозина в цитоплазматическом домене KIT человека (например, с номером доступа GenBank № P10721), которые могут фосфорилироваться, например, при стимуляции лигандом, включают остатки 568, 570, 703, 721, 730, 747, 823, 900 и 936. В конкретном варианте осуществления антитело против KIT, описанное в настоящем описании, может ингибировать фосфорилирование рецептора в остатке тирозина 719 KIT мыши. В другом конкретном варианте осуществления антитело против KIT, описанное в настоящем описании, может ингибировать фосфорилирование рецептора в остатке тирозина 703 или 721 KIT человека.

Таким образом, в конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина в цитоплазматическом домене KIT по меньшей мере приблизительно на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, с помощью анализа ELISA, как описано в разделе 6, или с помощью анализа с использованием иммуноблоттинга относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с неродственным антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина в цитоплазматическом домене KIT по меньшей мере приблизительно на 25%, необязательно до приблизительно 65% или 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, с помощью анализа ELISA, как описано в разделе 6, или с помощью анализа с использованием иммуноблоттинга. В определенных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина цитоплазматического домена KIT по меньшей мере приблизительно на 25% до приблизительно 80% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, анализа ELISA, как описано в разделе 6, или анализа с использованием иммуноблоттинга. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина цитоплазматического домена KIT с IC50 менее чем приблизительно 600 пМ, или менее чем приблизительно 550 пМ, или менее чем приблизительно 500 пМ, или менее чем приблизительно 400 пМ или менее чем приблизительно 300 пМ при оценке способами, описанными в настоящем описании (например, анализ ингибирования фосфорилирования с клетками CHO, экспрессирующими KIT дикого типа, как описано в разделе 6 ниже) или известными специалисту в данной области. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина цитоплазматического домена KIT с IC50 менее чем приблизительно 600 пМ. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина цитоплазматического домена KIT с IC50 менее чем приблизительно 550 пМ. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование тирозина цитоплазматического домена KIT с IC50 в диапазоне от приблизительно 100 пМ до приблизительно 500 пМ, от приблизительно 25 пМ до приблизительно 550 пМ, или от приблизительно 40 пМ до приблизительно 600 пМ, или от приблизительно 50 пМ до приблизительно 350 пМ. Например, IC50 для ингибирования фосфорилирования тирозина можно определять путем оценки лизатов из клеток, например, клеток CHO, рекомбинантно экспрессирующих KIT, в ELISA, который обнаруживает фосфорилирование тирозина, например, как описано в разделе 6 ниже. В определенных вариантах осуществления клетки, например, клетки CHO, рекомбинантно экспрессирующие KIT, сортируют, например, сортируют для отбора клеток с высокой экспрессией KIT перед применением в анализах ингибирования фосфорилирования. В некоторых вариантах осуществления клетки не сортируют перед применением в анализах ингибирования фосфорилирования.

В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и снижают фосфорилирование тирозина цитоплазматического домена KIT по меньшей мере приблизительно на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, с помощью анализа ELISA, как описано в разделе 6, или анализа с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат), специфически связываются с KIT и снижают фосфорилирование тирозина цитоплазматического домена KIT по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, с помощью анализа ELISA, как описано в разделе 6, или анализа с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лиганда KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT).

В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и блокируют или ингибируют фосфорилирование одного или нескольких остатков тирозина в цитоплазматическом домене KIT по меньшей мере приблизительно на 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании, или известными специалисту в данной области, например, с помощью анализа с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления блокирование или ингибирование (например, частичное ингибирование) фосфорилирования одного или нескольких остатков тирозина цитоплазматического домена KIT антителами, описанными в настоящем описании, можно оценивать при стимуляции лигандом KIT. Например, клетки, экспрессирующие KIT, контактируют с лигандом KIT в присутствии или в отсутствие антител против KIT, описанных в настоящем описании, и можно определять уровень фосфорилирования одного или нескольких остатков тирозина в цитоплазматическом домене KIT. В определенных вариантах осуществления индуцируемое лигандом KIT фосфорилирование одного или нескольких остатков тирозина цитоплазматического домена KIT в отсутствие антитела против KIT по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз превышает индуцируемое лигандом KIT фосфорилирование одного или нескольких остатков тирозина цитоплазматического домена KIT в присутствии антитела против KIT при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализы с использованием иммуноблоттинга), относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT).

В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат), специфически связываются с KIT и индуцируют или усиливают интернализацию KIT-рецептора по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, относительно интернализации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и индуцируют или усиливают интернализацию KIT-рецептора по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области, относительно интернализации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают интернализацию KIT-рецептора по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области, относительно интернализации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). Способы количественного определения или визуализации рецепторов клеточной поверхности хорошо известны в данной области и включают множество флуоресцентных и радиоактивных способов. Например, один способ вовлекает инкубацию клеток с радиоактивно меченным антителом против рецептора. Альтернативно природный лиганд рецептора можно конъюгировать с флуоресцентной молекулой или радиоактивной меткой и инкубировать с клетками. Дополнительные анализы интернализации рецептора хорошо известны в данной области и описаны, например, в Jimenez et al., Biochemical Pharmacology, 1999, 57:1125-1131; Bernhagen et al., Nature Medicine, 2007, 13:587-596; и Conway et al., J. Cell Physiol., 2001, 189:341-55.

В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают обновление KIT-рецептора по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ вытеснения метки), относительно обновления в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и индуцируют или усиливают обновление KIT-рецептора по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ вытеснения метки), относительно обновления в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают обновление KIT-рецептора по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ вытеснения метки), относительно обновления в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). Способы определения обновления рецептора хорошо известны в данной области. Например, клетки, экспрессирующие KIT, можно метить импульсной меткой с использованием смеси 35S-EXPRESS Protein Labeling mix (NEG772, NEN Life Science Products), промывать и вытеснять немеченой средой в течение периода времени, а затем белковые лизаты из меченых клеток можно подвергать иммунопреципитации с использованием антитела против KIT и разделять с помощью SDS-PAGE и визуализировать (например, экспонировать на экран PhosphoImager screen (Molecular Dynamics), сканировать с использованием сканера Typhoon8600 (Amersham) и анализировать с использованием программного обеспечения ImageQuant (Molecular Dynamics)) (см., например, Chan et al., Development, 2004, 131:5551-5560).

В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают деградацию KIT-рецептора по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализы с вытеснением метки), относительно деградации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают деградацию KIT-рецептора по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализы вытеснения метки), относительно деградации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают деградацию KIT-рецептора по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными в данной области (например, анализы вытеснения метки), относительно деградации в присутствии постороннего антитела (например, антитело, которое не связывается иммуноспецифически с KIT). Способы количественного определения или мониторинга убиквитинилирования и/или деградации (например, кинетика или скорость деградации) рецепторов клеточной поверхности хорошо известны в данной области и вовлекают множество флуоресцентных и радиоактивных способов (см., например, публикацию международной патентной заявки № WO 2008/153926 A2). Например, можно проводить эксперименты с вытеснением метки или эксперименты с использованием радиоактивно меченных лигандов, таких как 125I-SCF, для количественного измерения деградации KIT.

Более того, индикаторами активности KIT могут служить события передачи сигнала ниже фосфорилирования KIT-рецептора. Например, связывание лиганда KIT (например, SCF) с его рецептором KIT стимулирует несколько различных каскадов передачи сигнала, включающих, например, представителей семейства киназ Src, фосфатидилинозитол (PI) 3-киназы и митоген-активируемую протеинкиназу Ras (MAPK) (см. Munugalavadla et al., Mol. Cell. Biol., 2005, 25:6747-6759). Фосфорилированные остатки тирозина в цитоплазматическом домене KIT могут обеспечить участки связывания для содержащих SH2-домен белков, которые включают, но ими не ограничиваются, белки каскада митоген-активируемой протеинкиназы p21Ras (MAPK), субъединицу p85 PI 3-киназы, фосфолипазу C-гамма1, белок-адаптер Grb2, киназы семейства Src (SFK), Cbl, CRKL, p62Dok-1, SHP1 и SHP2 (см. Ueda et al., Blood, 2002, 99:3342-3349).

Таким образом, в некоторых аспектах антитела против KIT, описанные в настоящем описании, которые действуют в качестве ингибиторов активности KIT, могут ингибировать передачу сигнала представителем киназ семейства Src, PI 3-киназой или Ras-MAPK. В конкретных вариантах осуществления антитела против KIT, описанные в настоящем описании, которые действуют в качестве ингибиторов активности KIT, могут ингибировать связывание (или ингибируют взаимодействие), с цитоплазматическим доменом KIT одного или нескольких содержащих SH2-домен белков, таких как белки каскада p21Ras-MAPK, субъединица p85 PI 3-киназы, фосфолипаза C-гамма1, белок-адаптер Grb2, представитель SFK, Cbl, CRKL, p62Dok-1, SHP1 и SHP2. В определенных вариантах осуществления антитела против KIT, описанные в настоящем описании, которые действуют в качестве ингибиторов активности KIT, могут ингибировать активацию посредством KIT одного или нескольких содержащих SH2-домен белков, таких как белки каскада p21Ras-MAPK, субъединица p85 PI 3-киназы, фосфолипаза C-гамма1, белок-адаптер Grb2, представитель SFK, Cbl, CRKL, p62Dok-1, SHP1 и SHP2.

В конкретных вариантах осуществления антитела против KIT, описанные в настоящем описании, которые действуют в качестве ингибиторов активности KIT, могут ингибировать последующую передачу сигнала, такую как фосфорилирование MAPK, фосфорилирование AKT или фосфорилирование Stat1, Stat3 или Stat5. Таким образом, в определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, может ингибировать или снижать фосфорилирование MAPK (например, индуцируемое лигандом KIT (например, SCF) фосфорилирование MAPK) по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, анализом с использованием вестерн-блоттинга или анализом ELISA, как описано в разделе 6, или анализом с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, может ингибировать или снижать фосфорилирование AKT (например, индуцируемое лигандом KIT (например, SCF) фосфорилирование AKT) по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, анализом с использованием вестерн-блоттинга или анализом ELISA, как описано в разделе 6, или анализом с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании, может ингибировать или снижать фосфорилирование Stat3 (например, индуцируемое лигандом KIT (например, SCF) фосфорилирование Stat3) по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, анализом с использованием вестерн-блоттинга или анализом ELISA, как описано в разделе 6, или анализом с использованием иммуноблоттинга, относительно фосфорилирование в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT). В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании, может ингибировать или снижать фосфорилирование Stat1 или Stat5 (например, индуцируемое лигандом KIT (например, SCF) фосфорилирование) по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области, например, анализом с использованием вестерн-блоттинга или анализом ELISA, как описано в разделе 6, или анализом с использованием иммуноблоттинга, относительно фосфорилирования в присутствии стимуляции лигандом KIT без какого-либо антитела или с посторонним антителом (например, антитело, которое не связывается иммуноспецифически с KIT).

В некоторых аспектах антитело против KIT, описанное в настоящем описании, которое может действовать в качестве ингибитора активности KIT может ингибировать пролиферацию клеток (например, злокачественных клеток, таких как клетки TF-1), которые экспрессируют KIT и которые отвечают на передачу сигнала KIT (например, клетки, которые пролиферируют в ответ на стимуляцию лигандом KIT и передачу сигнала KIT). Анализы пролиферации клеток описаны в данной области и их может без труда осуществить специалист в данной области. Например, пролиферацию клеток можно анализировать по включению бромдезоксиуридина (BrdU) (см., например, Hoshino et al., 1986, Int. J. Cancer 38, 369; Campana et al., 1988, J. Immunol. Meth. 107:79) или по включению (3H) тимидина (см., например, Blechman et al., Cell, 1995, 80:103-113; Chen, J., 1996, Oncogene 13:1395-403; Jeoung, J., 1995, J. Biol. Chem. 270:18367 73), путем прямого подсчета клеток в различные периоды времени (например, с интервалами в 12-часов или 24-часа), или путем выявления изменений транскрипции, трансляции или активности известных генов, таких как протоонкогены (например, fos, myc), или маркеров клеточного цикла (Rb, cdc2, циклин A, D1, D2, D3, E, и т.д.). Уровни такого белка и мРНК и активность можно определять любым способом, хорошо известным в данной области. Например, белок можно количественно определять известными иммунодиагностическими способами, такими как ELISA, вестерн-блоттинг или иммунопреципитация, с использованием антител, включая коммерчески доступные антитела. мРНК можно количественно определять с использованием способов, которые хорошо известны и являются общепринятыми в данной области, например, с использованием нозерн-анализа, защиты от РНКазы, или полимеразной цепной реакции с обратной транскрипцией.

В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют пролиферацию клеток по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ включения BrdU). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют пролиферацию клеток по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ включения BrdU).

В некоторых аспектах, антитело против KIT, описанное в настоящем описании, которое может действовать в качестве ингибитора активности KIT, может снижать или ингибировать выживаемость клеток, которые экспрессируют KIT и которые отвечают на передачу сигнала KIT (например, клетки, которые пролиферируют в ответ на стимуляцию лигандом KIT и передачу сигнала KIT). Анализы выживаемости клеток описаны в данной области и их может без труда выполнить специалист в данной области. Например, жизнеспособность клеток можно оценивать с использованием окрашивания трипановым синим или других маркеров смертности или жизнеспособности клеток. В конкретном варианте осуществления для определения жизнеспособности клеток измеряют уровень ATP в клетках. В конкретных вариантах осуществления жизнеспособность клеток измеряют с периодами трое суток и семь суток с использованием анализа, являющегося стандартным в данной области, такого как набор CellTiter-Glo Assay Kit (Promega), который определяет уровни внутриклеточного ATP. Снижение уровня ATP в клетках указывает на цитотоксический эффект. В другом конкретном варианте осуществления жизнеспособность можно определять в анализе поглощения нейтрального красного. В других вариантах осуществления визуально наблюдаемые морфологические изменения могут включать увеличение, гранулярность, клетки с рваными краями, пленчатый внешний вид, округление, открепление от поверхности лунки или другие изменения. Этим изменениям дают обозначение T (100% токсичное), PVH (частично токсичное-в высокой степени тяжелое-80%), PH (частично токсичное-тяжелое-60%), P (частично токсичное-40%), Ps (частично токсичное-небольшое-20%) или 0 (отсутствие токсичности-0%), что соответствует степени наблюдаемой цитотоксичности. 50% ингибиторную (цитотоксическую) концентрацию (IC50) для клеток определяют с помощью регрессионного анализа этих данных.

В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют (например, частично ингибируют) выживание клеток (например, злокачественных клеток) по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ исключения трипанового синего). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют выживание клеток (например, злокачественных клеток) по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ с трипановым синим).

В некоторых аспектах антитело против KIT, описанное в настоящем описании, которое может действовать в качестве ингибитора активности KIT, способно индуцировать апоптоз (т.е. запрограммированную гибель) клеток (например, злокачественных клеток, таких как клетки MO7E), которые экспрессируют KIT и которые отвечают на передачу сигнала KIT (например, клетки, которые пролиферируют в ответ на стимуляцию лигандом KIT и передачу сигнала KIT). Апоптоз описан в данной области и его может без труда определить специалист в данной области. Например, проточную цитометрию можно использовать для обнаружения активированной каспазы 3, являющейся опосредующим апоптоз ферментом, в клетках, претерпевающих апоптоз, или вестерн-блоттинг можно использовать для обнаружения расщепления поли(ADP-рибоза) полимеразы (PARP) (см., например, Smolich et al., Blood, 2001, 97:1413-1421). Расщепление PARP является индикатором апоптоза. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают апоптоз по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании, или известными специалисту в данной области (например, проточная цитометрия для обнаружения активированной каспазы 3). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и индуцируют или усиливают апоптоз по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, проточная цитометрия для обнаружения активированной каспазы 3).

В некоторых аспектах антитело против KIT, описанное в настоящем описании, которое может действовать в качестве ингибитора активности KIT, способно ингибировать или снижать независимый от прикрепления рост клеток (например, образование колоний) клетками (например, клетками H526 или клетками CHO, экспрессирущими экзогенный KIT), которые экспрессируют KIT и которые отвечают на передачу сигнала KIT (например, клетки, которые пролиферируют в ответ на стимуляцию лигандом KIT и передачу сигнала KIT), при измерении способами, общеизвестными известны в данной области, например, анализом в мягком агаре. В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и ингибируют или снижают независимый от прикрепления рост клеток по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ в мягком агаре). В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и ингибируют или снижают независимый от прикрепления рост клеток по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ в мягком агаре). В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют или снижают независимый от прикрепления рост клеток по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области (например, анализ в мягком агаре).

Клетки и клеточные линии, которые подходят для применения в анализах, описанных в настоящем описании, касающихся активности KIT, являются общедоступными (например, ATCC) или их можно без труда идентифицировать с использованием способов, известных в данной области. Например, клетки и/или клеточные линии, которые экспрессируют KIT эндогенно или которые обладают передачей сигнала или активностью KIT, известны специалисту в данной области. В определенных вариантах осуществления клетки или клеточные линии, которые подходят для применения в анализах, описанных в настоящем описании, могут экспрессировать KIT, либо эндогенно, либо рекомбинантно. В конкретных вариантах осуществления клетки или клеточные линии для применения в анализах пролиферации клеток могут экспрессировать KIT, эндогенно или рекомбинантно и могут пролиферировать или усиливать пролиферацию в ответ на стимуляцию KIT (например, SCF). Клетки или клеточные линии для применения в анализах жизнеспособности клеток могут экспрессировать KIT эндогенно или рекомбинантно и проявлять изменения жизнеспособности в ответ на стимуляцию лигандом KIT (например, SCF). Клетки и клеточные линии для применения в анализах апоптоза могут экспрессировать KIT эндогенно или рекомбинантно и могут проявлять изменения апоптоза в ответ на стимуляцию лигандом KIT (например, SCF).

Неограничивающие примеры клеток, которые можно использовать в способах и анализах, описанных в настоящем описании, включают первичные клетки, злокачественные клетки, трансформированные клетки, стволовые клетки, тучные клетки, примордиальные клетки, ооциты, сперматоциты, эмбриональные стволовые клетки, кроветворные клетки, клетки эритролейкоза (например, клеточные линии F36P и TF-1), клеточные линии миелоидного лейкоза человека, такие как клетки MO7E; клеточные линии желудочно-кишечной стромальной опухоли, такие как ST-882, GIST-T1, GIST48, GIST48B, GIST430 и GIST882; клеточные линии нейробластомы, такие как SK-N-SH, SK-SY5Y, H-EP1, SK-N-BE(2), SK-N-BE(ZkM17), SK-N-BE(2)C, LA-N-l или LA-N-1-5s; клеточные линии саркомы Юинга, такие как TC71, TC32, RD-ES, 5838, A4573, EWS-925, NCI-EWS-94 и NCI-EWS-95; и клеточные линии мелкоклеточного рака легкого, такие как H526, ECC12, TMK1, MKN7, GCIY и HGC27.

Альтернативно клетки и клеточные линии, которые экспрессируют KIT, например, KIT человека, можно получать стандартными рекомбинантными способами. Неограничивающие примеры клеток, которые можно модифицировать способами инженерии для рекомбинантной экспрессии KIT, включают клетки COS, клетки HEK 293, клетки CHO, фибробласты (например, фибробласты человека) такие как клетки NIH3T3 и MEFS. В конкретном варианте осуществления клетки для применения в способах, описанных в настоящем описании, представляют собой клетки CHO, например, клетки CHO от CHO GS System™ (Lonza). В конкретном варианте осуществления эти модифицированные способами инженерии клетки экзогенно экспрессируют полноразмерный KIT человека (например, SEQ ID NO:1).

В некоторых аспектах антитело против KIT, описанное в настоящем описании, которое может действовать в качестве ингибитора активности KIT, способно ингибировать рост опухоли или индуцировать регрессию опухоли в исследованиях в моделях на мышах. Например, опухолевые клеточные линии можно вводить мышам nude, и мышам можно вводить антитела против KIT, описанные в настоящем описании, один или несколько раз, и можно проводить мониторинг прогрессирования опухоли инъецированных опухолевых клеток в течение периода, составляющего недели и/или месяцы. В некоторых случаях введение антител против KIT мышам nude может происходить перед введением опухолевых клеточных линий. В моделях с ксенотрансплантатами на мышах, описанных в настоящем описании, можно использовать любую подходящую клеточную линию (например, опухолевая клеточная линия, экспрессирующая KIT). Неограничивающие примеры опухолевых клеточных линий для применения в моделях с ксенотрансплантатами на мышах включают клеточные линии мегакариобластного лейкоза, такие как MO7e; клеточные линии желудочно-кишечной стромальной опухоли, такие как ST-882, GIST-T1, GIST430, GIST48, GIST48B и GIST882; клеточные линии эритролейкоза человека, такие как HEL и TF-1; клеточную линию промиелоцитарного лейкоза человека, HL60; клеточные линии нейробластомы, такие как SK-N-SH, SK-SY5Y, H-EP1, SK-N-BE(2), SK-N-BE(ZkM17), SK-N-BE(2)C, LA-N-l или LA-N-1-5s; клеточные линии саркомы Юинга, такие как TC71, TC32, RD-ES, 5838, A4573, EWS-925, NCI-EWS-94 и NCI-EWS-95; и клеточные линии мелкоклеточного рака легкого, такие как H526, DMS153, DMS79, ECC12, TMK1, MKN7, GCIY и HGC27. В конкретных вариантах осуществления опухолевая клеточная линия для применения в модели с ксенотрансплантатом представляет собой клеточную линию GIST882, GIST430, GIST48, GIST48B, HEL, HL60, H526, DMS153 или DMS79. В определенных вариантах осуществления подходящие клеточные линии для применения в моделях с ксенотрансплантатом опухоли можно получать путем рекомбинантной экспрессии KIT в клетке. В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и ингибируют рост опухоли или индуцируют регрессию опухоли в модели на мышах по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области. В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и ингибируют рост опухоли или индуцируют регрессию опухоли в модели на мышах по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и ингибируют рост опухоли или индуцируют регрессию опухоли в модели на мышах по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области. Определение ингибирования роста опухоли или регрессиии опухоли можно оценивать путем мониторинга размера опухоли с течением времени, например, путем физического измерения пальпируемых опухолей или с помощью других способов визуального определения. Например, можно получать опухолевые клеточные линии для рекомбинантной экспрессии средства для визуализации, такого как зеленый флуоресцентный белок (GFP) или люцифераза, а затем можно проводить визуализацию GFP in vivo с помощью микроскопии, и визуализацию люциферазы in vivo можно проводить путем введения субстрата люциферазы мышам с ксенотрансплантатом и выявления люминесценции вследствие процессинга ферментом люциферазой субстрата люциферазы. Степень или уровень обнаружения GFP или люциферазы коррелируют с размером опухоли у мышей с ксенотрансплантатами.

В некоторых аспектах антитела против KIT, описанные в настоящем описании, специфически связываются с антигеном KIT и могут увеличивать выживаемость животных в моделях с ксенотрансплантатом опухоли. В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и увеличивают выживаемость мышей в моделях с ксенотрансплантатом опухоли по меньшей мере приблизительно на 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% или 99% при оценке способами, описанными в настоящем описании или известными специалисту в данной области. В конкретных вариантах осуществления антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент, или их конъюгат) специфически связываются с KIT и увеличивают выживаемость мышей в моделях с ксенотрансплантатами опухолей по меньшей мере приблизительно на 25% или 35%, необязательно до приблизительно 75%, при оценке способами, описанными в настоящем описании или известными специалисту в данной области. В конкретных вариантах осуществления антитела, описанные в настоящем описании, специфически связываются с KIT и увеличивают выживаемость мышей в моделях с ксенотрансплантатами опухолей по меньшей мере приблизительно в 1 раз, в 1,2 раза, в 1,3 раза, в 1,4 раза, в 1,5 раза, в 2 раза, в 2,5 раза, в 3 раза, в 3,5 раза, в 4 раза, в 4,5 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 15 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз при оценке способами, описанными в настоящем описании или известными специалисту в данной области. Выживаемость можно определять путем построения кривой выживаемости для количества выживших мышей против времени (например, сутки или недели) после инъекции опухолевой клеточной линии.

В рамках настоящего изобретения предусматриваются антитела, которые иммуноспецифически связывают полипептид KIT, например, полипептид KIT человека, например, область D4 KIT, например, KIT человека, с конкретной аффинностью.

"Аффинность" антитела, описанного в настоящем описании, в отношении эпитопа (например, эпитопа KIT) является термином, хорошо понятным в данной области и относится к степени или прочности связывания антитела с эпитопом. Аффинность можно измерять и/или выражать рядом способов, известных в данной области, включая, но ими не ограничиваясь, равновесную константу диссоциации (KD или Kd), кажущуюся равновесную константу диссоциации (KD' или Kd') и IC50 (количество, требуемое для обеспечения 50% ингибирования в конкурентном анализе). Понятно, что для целей, описанных в настоящем описании, аффинность представляет собой среднюю аффинность для данной популяции антител, которые связываются с эпитопом. Величины KD′, описанные в настоящем описании в значениях миллиграммов (мг) Ig на мл или мг/мл, указывают мг Ig на мл сыворотки, хотя можно использовать плазму. Когда аффинность антитела используют в качестве базиса для введения в способах лечения, описанных в настоящем описании, или выбора способов лечения, описанных в настоящем описании, аффинность антитела можно измерять до и/или во время введения, и полученные величины могут быть использованы клиницистами для оценки того, является ли пациент-человек кандидатом для лечения.

В конкретных аспектах в рамках настоящего изобретения предусматриваются антитела (или их антигенсвязывающие фрагменты, или их конъюгаты), которые обладают высокой аффинностью связывания (например, антитела, имеющие KD менее чем 250 нМ, 100 нМ, 50 нМ, 10 нМ, 1 нМ, 500 пМ, 200 пМ, 100 пМ или 50 пМ) в отношении антигена KIT, предпочтительно, антигена KIT человека, в частности, области D4/D5 KIT человека.

В конкретных вариантах осуществления антитело, описанное в настоящем описании, (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, областью D4/D5 KIT, например, KIT человека), и имеет константу диссоциации (KD) менее 500000 пМ (500 нМ), менее 100000 пМ (100 нМ), менее 50000 пМ (50 нМ), менее 10000 пМ (10 нМ), менее 3000 пМ (3 нМ), менее 2500 пМ (2,5 нМ), менее 2000 пМ, менее 1500 пМ, менее 1000 пМ, менее 750 пМ, менее 500 пМ, менее 250 пМ, менее 200 пМ, менее 150 пМ, менее 100 пМ, менее 75 пМ при оценке с использованием анализа, описанного в настоящем описании или известного специалисту в данной области (например, анализ Biacore™) (Biacore™ International AB, Uppsala, Швеция). В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, область D4/D5 KIT, например, KIT человека), и имеет KD в диапазоне от 25 до 100000 пМ, от 25 до 75000 пМ, от 25 до 50000 пМ, от 25 до 40000 пМ, от 25 до 30000 пМ, от 25 до 20000 пМ, от 25 до 10000 пМ, от 25 до 1000 пМ, от 25 до 500 пМ, от 25 до 250 пМ, от 25 до 100 пМ, или от 25 до 50 пМ при оценке с использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, анализ Biacore™, анализ с использованием устройства KinExA 3000). В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, область D4 KIT, например, KIT человека), и имеет KD от приблизительно 100 пМ до приблизительно 250 нМ, или любую величину между ними при оценке с использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, анализ Biacore™, анализ с использованием устройства KinExA 3000).

В конкретных вариантах осуществления антитело против KIT (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, область D4 KIT, например, KIT человека), и имеет концентрацию при 50% связывании с антигеном менее 3000 пМ (3 нМ), менее 2500 пМ (2,5 нМ), менее 2000 пМ, менее 1500 пМ, менее 1000 пМ, менее 750 пМ, менее 500 пМ, менее 250 пМ, менее 200 пМ, менее 150 пМ, менее 100 пМ, менее 75 пМ при оценке с использованием анализа, описанного в настоящем описании или известного специалисту в данной области (например, твердофазного ELISA, как описано в разделе 6). В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, областью D4 KIT, например, KIT человека), и имеет концентрацию при 50% связывании с антигеном в диапазоне от 25 до 500000 пМ (500 нМ), от 25 до 250000 пМ (250 нМ), от 25 до 100000 пМ (100 нМ), от 25 до 75000 пМ (75 нМ), от 25 до 50000 пМ (50 нМ), от 25 до 40000 пМ (40 нМ), от 25 до 30000 пМ (30 нМ), от 25 до 20000 пМ (20 нМ), от 25 до 10000 пМ (10 нМ), от 25 до 1000 пМ (1 нМ), от 25 до 500 пМ, от 25 до 250 пМ, от 25 до 100 пМ, или от 25 до 50 пМ при оценке с использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, твердофазный ELISA, как описано в разделе 6). В конкретном варианте осуществления антитело, описанное в настоящем описании, (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, область D4 KIT, например, KIT человека), и имеет концентрацию при 50% связывании с антигеном от приблизительно 1 нМ до приблизительно 25 нМ, или любую величину между ними, при оценке использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, твердофазный ELISA, как описано в разделе 6). В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат) иммуноспецифически связывается с антигеном KIT (например, областью D4 KIT, например, KIT челвоека), и имеет концентрацию при 50% связывании с антигеном от приблизительно 50 пМ до приблизительно 500 пМ, или любую величину между ними при оценке использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, твердофазный ELISA, как описано в разделе 6). В конкретном варианте осуществления антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент, или их конъюгат иммуноспецифически связывается с антигеном KIT (например, область D4 KIT, например, KIT человека), и имеет концентрацию при 50% связывании с антигеном приблизительно 0,5 нМ, 0,25 нМ, 0,1 нМ, 1 нМ, 1,5 нМ, 2 нМ, 2,5 нМ, 3 нМ, 3,5 нМ, 4 нМ, 4,5 нМ, 5 нМ, 5,5 нМ, 6 нМ, 6,5 нМ, 7 нМ, 8 нМ, 9 нМ, 10 нМ, 11 нМ, 12 нМ, 13 нМ, 14 нМ, 15 нМ, 16 нМ, 17 нМ, 18 нМ, 19 нМ, 20 нМ, 30 нМ, 40 нМ, 50 нМ, 60 нМ, 70 нМ, 80 нМ, 90 нМ, 100 нМ, 150 нМ, 200 нМ, 250 нМ, 300 нМ, 350 нМ, 400 нМ, или 500 нМ или менее, при оценке использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, твердофазный ELISA, как описано в разделе 6). В конкретном варианте осуществления антитела, описанные в настоящем описании, иммуноспецифически связываются с антигеном KIT (например, областью D4 KIT, например, KIT человека), и имеют концентрацию при 50% связывании с антигеном от приблизительно 100 пМ до приблизительно 10 нМ, при оценке с использованием способов, описанных в настоящем описании или известных специалисту в данной области (например, анализ ELISA с использованием устройства KinExA 3000, или анализ Biacore™).

Способы определения аффинности антитела в отношении его антигена являются свободно доступными и описаны в данной области. Например, аффинность и связывающие свойства антитела в отношении его антигена-мишени можно определять различными способами анализа in vitro (биохимические или иммунологические анализы), известными в данной области, такими как равновесные способы (например, твердофазный иммуноферментный анализ (ELISA) или радиоиммунный анализ (RIA)), или анализы кинетики (например, анализ Biacore™) и другие способы, такие как непрямые анализы связывания, конкурентные анализы ингибирования, резонансный перенос энергии флуоресценции (FRET), иммунопреципитация, гель-электрофорез и хроматография (например, гель-фильтрация). В этих и других способах может использоваться метка на одном или нескольких исследуемых компонентах и/или используется множество способов обнаружения, включая, но ими не ограничиваясь хромогенные, флуоресцентные, люминесцентные или изотопные метки. В определенных вариантах осуществления применение меток не является обязательным, например, в системах Biacore™ используется природное явление поверхностного плазмонного резонанса (SPR) для предоставления данных в реальном времени без использования меток. Подробное описание аффинности и кинетики связывания может быть найдено в Paul, W.E., ed., Fundamental Immunology, 4th Ed. (Lippincott-Raven, Philadelphia 1999), которая сфокусирована на взаимодействиях антитело-иммуноген.

В некоторых аспектах аффинность антитела, описанного в настоящем описании, в отношении антигена KIT, например, KIT человека, например, области D4 KIT (например, KIT человека), можно охарактеризовывать непрямо с использованием клеточных анализов. Например, клетки, экспрессирующие KIT на поверхности их клеточных мембран, можно контактировать с антителами против KIT, и можно определять клеточную активность ниже KIT с использованием анализов, известных в данной области. Например, фосфорилирование цитоплазматического домена KIT можно определять с помощью иммуноблоттинга (или вестерн-блоттинга) после контактирования клеток с антителом против KIT; клеточные экстракты можно получать и обрабатывать для иммуноблоттинга (например, проведение полиакриламидного гель-электрофореза клеточных экстрактов с додецилсульфатом натрия (SDS-PAGE) и перенос белков, разделенных в геле, на мембрану (например, нитроцеллюлозную или поливинилиденфторидную (PVDF)) с антителом, которое специфически связывается с фосфорилированным тирозином в цитоплазматическом домене KIT, но не связывает нефосфорилированный тирозин.

В определенных вариантах осуществления антитело против KIT, описанное в настоящем описании, специфически связывается с антигеном KIT, например, KIT человека, например, областью D4 KIT (например, KIT человека), и индуцирует или усиливает димеризацию и фосфорилирование KIT, в присутствии или в отсутствие лиганда KIT SCF. В некоторых вариантах осуществления антитело против KIT, описанное в настоящем описании, может ингибировать или снижать связывание лиганда KIT, например, SCF, с KIT (т.е. антитело против KIT может конкурировать с лигандом KIT, например, SCF, за связывание с KIT). В таком случае клетки можно контактировать с антителом против KIT и лигандом KIT, и степень ингибирования фосфорилирования KIT можно определять в качестве показателя степени конкуренции антитела против KIT с лигандом KIT за связывание с KIT.

Антитела включают, но ими не ограничиваются, моноклональные антитела, рекомбинантно продуцируемые антитела, полиспецифические антитела (включая биспецифические антитела), антитела человека, гуманизированные антитела, химерные антитела, синтетические антитела, тетрамерные антитела, содержащие две молекулы тяжелой цепи и две молекулы легкой цепи, мономер легкой цепи антитела, мономер тяжелой цепи антитела, димер легкой цепи антитела, димер тяжелой цепи антитела, пару легкая цепь антитела - тяжелая цепь антитела, интраантитела, гетероконъюгатные антитела, однодоменные антитела, одновалентные антитела, одноцепочечные антитела или одноцепочечные Fv (scFv) (например, включая моноспецифические, биспецифические и т.д.), камелизованные антитела, аффиантитела, Fab-фрагменты, F(ab’)-фрагменты, связанные дисульфидной связью Fv (sdFv), антиидиотипические (анти-Id) антитела (включая, например, анти-анти-Id антитела), и связывающие эпитоп фрагменты любого из указанных выше. В определенных вариантах осуществления антитела, описанные в настоящем описании, относятся к популяциям поликлональных антител. Антитела могут представлять собой антитела любого типа (например, IgG, IgE, IgM, IgD, IgA или IgY), любого класса (например, IgG1, IgG2, IgG3, IgG4, IgA1 или IgA2) или любого подкласса (например, IgG2a или IgG2b) молекулы иммуноглобулина. В определенных вариантах осуществления антитела, описанные в настоящем описании, представляют собой IgG-антитела, или их класс (например, IgG1 или IgG4 человека), или подкласс. В конкретных вариантах осуществления моноклональное антитело представляет собой антитело, продуцируемое единичной гибридомой или другой клеткой, где антитело иммуноспецифически связывается с эпитопом области D4 KIT человека при определении, например, с помощью ELISA или другого анализа связывания антигена или конкурентного анализа связывания, известного в данной области или описанного в примерах настоящего описания. Термин "моноклональный" не ограничивается каким-либо конкретным способом получения антитела.

В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой Fab-фрагмент, который иммуноспецифически связывается с полипептидом KIT, таким как область D4 KIT. В конкретном варианте осуществления антитела, описанные в настоящем описании, представляют собой моноклональные антитела или выделенные моноклональные антитела. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой гуманизированное моноклональное антитело. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой рекомбинантное антитело, например, рекомбинантное антитело человека, рекомбинантное гуманизированное антитело или рекомбинантное моноклональное антитело. В определенных вариантах осуществления антитело, описанное в настоящем описании, содержит не являющиеся человеческими аминокислотные последовательности, например, не являющиеся человеческими CDR или не являющиеся человеческими (например, не являющегося человеком примата) остатки каркасной области.

В конкретных вариантах осуществления, описанных в настоящем описании, рекомбинантные антитела можно выделять, получать, экспрессировать или создавать рекомбинантными способами, как например, антитела, экспрессированные с использованием рекомбинантного экспрессирующего вектора, трансфицированного в клетку-хозяина, антитела, выделенные из рекомбинантной комбинаторной библиотеки антител, или антитела, полученные, экспрессированные, созданные или выделенные любыми другими способами, которые вовлекают создание, например, посредством синтеза, модификацию способами генной инженерии последовательностей ДНК, которые кодируют последовательности иммуноглобулинов человека, или сплайсинг последовательностей, которые кодируют иммуноглобулины человека, например, последовательности генов иммуноглобулинов человека, с другими такими последовательностями. В определенных вариантах осуществления аминокислотные последовательности таких рекомбинантных антител модифицированы так, что аминокислотные последовательности таких антител, например, областей VH и/или VL, представляют собой последовательности, которые в природе не существуют в репертуаре антител эмбрионального типа организма in vivo, например, в репертуаре последовательностей эмбрионального типа мыши или человека. В конкретном варианте осуществления рекомбинантное антитело можно получать путем сборки нескольких фрагментов последовательностей, которые в природе существуют в организме (например, у примата, такого как человек) в составную последовательность рекомбинантного антитела, где составная последовательность не существует в природе в организме (например, у примата, такого как человек).

Антитела, описанные в настоящем описании, включают молекулы иммуноглобулинов любого типа (например, IgG, IgE, IgM, IgD, IgA и IgY), класса (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или подкласса молекул иммуноглобулинов. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой IgG-антитело (например, IgG-антитело человека) или класса (например, IgG1 или IgG4 человека) или их подкласса. В другом конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой IgG1-антитело (например, IgG1 человека (изотип a, z или f)) или IgG4-антитело. В определенных вариантах осуществления антитело, описанное в настоящем описании, представляет собой целое или полное антитело, например, целое или полное гуманизированное, человеческое или составное человеческое антитело.

Антитела, описанные в настоящем описании, могут включать фрагменты антител, которые сохранят способность специфически связываться с антигеном, например, эпитопом KIT (например, эпитоп KIT в полипептиде KIT, содержащем область D4 KIT человека). В конкретном варианте осуществления фрагменты включают Fab-фрагменты (фрагмент антитела, который содержит антигенсвязывающий домен и содержит легкую цепь и часть тяжелой цепи (т.е. домены VH и CH1 тяжелой цепи), соединенные мостиковой дисульфидной связью); Fab' (фрагмент антитела, содержащий один антигенсвязывающий домен, содержащий Fab и дополнительную часть тяжелой цепи до шарнирной области); F(ab')2 (две молекулы Fab', связанные межцепочечными дисульфидными связями в шарнирных областях тяжелых цепей; молекулы Fab' могут быть направлены на один или различные эпитопы); биспецифический Fab (молекула Fab, имеющая два антигенсвязывающих домена, каждый из которых может быть направлен на отдельный эпитоп); одноцепочечный Fab, содержащий вариабельную область, также известную как sFv (вариабельная антигенсвязывавщая детерминирующая область единичных легкой и тяжелой цепей антитела, связанных цепью из 10-25 аминокислот); связанный дисульфидной связью Fv, или dsFv (вариабельная антигенсвязывающая детерминирующая область единичных легкой и тяжелой цепей антитела, связанных вместе дисульфидной связью); камелизованную VH (вариабельная антигенсвязывающая детерминирующая область единичной тяжелой цепи антитела, в которой некоторые аминокислоты на поверхности контакта VH представляют собой аминокислоты, встречающиеся в тяжелой цепи природных антител верблюда); биспецифический sFv (молекула sFv или dsFv, имеющая два антигенсвязывающих домена, каждый из которых может быть направлен на отличающийся эпитоп); диатело (димеризованный sFv, образующийся, когда VH-домен первого sFv собирается с VL-доменом второго sFv, и VL-домен первого sFv собирается с VH-доменом второго sFv; две антигенсвязывающие области диатела могут быть направлены на один и тот же или на различные эпитопы); и триатело (тримеризованный sFv, сформированный аналогично диантителу, однако в котором три антигенсвязывающих домена сформированы в один комплекс; три антигенсвязывающих домена могут быть направлены на один и тот же или на различные эпитопы). Антитела, описанные в настоящем описании, также могут включать одну или несколько последовательностей CDR антитела. Последовательности CDR могут быть связаны вместе в одном каркасе, когда присутствует две или более последовательности CDR. В определенных вариантах осуществления антитело включает одноцепочечный Fv ("scFv"). scFv представляют собой фрагменты антител, содержащие VH- и VL-домены антитела, где эти домены присутствуют в одной полипептидной цепи. Как правило, полипептид scFv дополнительно содержит полипептидный линкер между доменами VH и VL, который позволяет scFv формировать желаемую структуру для связывания антигена. Для обзора scFv, см. Pluckthun, The Pharmacology of Monoclona lAntibodies, vol. 113, Rosenburg andMoore eds. Springer-Verlag, New York, pp. 269-315 (1994). Без связи с какой-либо конкретной теорией, молекулы Fv могут быть способны проникать в ткани вследствие их небольшого размера. Целое антитело можно ферментативно расщеплять пепсином с получением F(ab')2-фрагмента, или его можно ферментативно расщеплять папаином с получением двух Fab-фрагментов.

В определенных вариантах осуществления антитела, описанные в настоящем описании, представляют собой моноклональные антитела человека, составные моноклональные антитела человека или гуманизированные моноклональные антитела. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой сконструированное способами инженерии антитело, например, антитело, полученное рекомбинантными способами. В конкретном варианте осуществления антитело, описанное в настоящем описании, представляет собой гуманизированное антитело, содержащее одну или несколько не являющихся человеческими (например, грызуна или мыши) CDR, и одну или несколько каркасных областей (FR) человека, и необязательно константную область тяжелой цепи и/или константную область легкой цепи человека. В конкретном варианте осуществления антитело, описанное в настоящем описании, содержит одну или несколько каркасных областей примата (или не являющегося человеком примата). В конкретном варианте осуществления антитело, описанное в настоящем описании, не содержит каркасные области не являющегося человеком примата.

Антитела, описанные в настоящем описании, могут включать антитела, содержащие химические модификации, например, антитела, которые химически модифицированы, например, путем ковалентного связывания с антителом молекулы любого типа. Например, но не ограничиваясь этим, антитело против KIT можно гликозилировать, ацетилировать, пегилировать, фосфорилировать или амидировать, можно преобразовывать в производное с помощью защитных/блокирующих групп, или оно может дополнительно содержать клеточный лиганд и/или другой белок или пептид, и т.д. Например, антитело, описанное в настоящем описании, может быть химически модифицированным, например, путем гликозилирования, ацетилирования, пегилирования, фосфорилирования, амидирования, преобразования в производное с помощью известных защитных/блокирующих групп, протеолитического расщепления, связывания с клеточным лигандом или другим белком и т.д. Кроме того, антитело против KIT, описанное в настоящем описании, может содержать одну или несколько неклассических аминокислот.

В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело против KIT, модифицированное так, чтобы оно подходило для крупномасштабного производства, например, для производственной платформы Lonza (Basel, Швейцария). Например, технологическую платформу BI-HEX® (Boehringer Ingleheim, Германия) можно использовать для адаптации антител против KIT, описанных в настоящем описании, для подходящего крупномасштабного производства в рекомбинантных экспрессирующих системах клеток млекопитающих. Такая адаптация может вовлекать клонирование полинуклеотидных последовательностей, кодирующих необходимые домены антитела против KIT, такие как одна или несколько CDR или FR, в подходящий вектор экспрессии, который также содержит полинуклеотидные последовательности, кодирующие подходящие константные области, чтобы продуцировалось целое антитело. Полинуклеотидные последовательности, обеспечиваемые векторами экспрессии, представляют собой нуклеотидные последовательности, которые можно оптимизировать для условий получения клеточных культур и процессов очистки в целях максимизации выхода антител и стабильности.

5.1.1. Конъюгаты

В некоторых вариантах осуществления в рамках настоящего изобретения описаны антитела (например, антитела человека или гуманизированные антитела), или их антигенсвязывающие фрагменты, конъюгированные или слитые рекомбинантными способами с диагностическим, поддающимся обнаружению или терапевтическим средством или любой другой молекулой. Конъюгированные или рекомбинантно слитые антитела могут быть полезными, например, для мониторинга или прогнозирования возникновения, развития, прогрессирования и/или тяжести связанного с KIT нарушения или заболевания, например, в качестве части процедуры клинических испытаний, таких как определение эффективности конкретной терапии. Конъюгированные или рекомбинантно слитые антитела могут быть полезными, например, для лечения или контроля за связанным с KIT нарушением (например, злокачественной опухоли), или для лечения или контроля за течением эффектов связанного с KIT нарушения (например, злокачественной опухоли). Антитела, описанные в настоящем описании, также могут быть конъюгированы с молекулой (например, полиэтиленгликоль), которая может влиять на одно или несколько биологических и/или молекулярных свойства антител, например, стабильность (например, в сыворотке), время полужизни, растворимость и антигенность.

В конкретном аспекте в рамках настоящего изобретения предусматривается конъюгат, содержащий средство (например, лекарственное средство), связанное с антителом, описанным в настоящем описании (или его антигенсвязывающим фрагментом), причем это антитело иммуноспецифически связывается с областью D4 KIT человека (например, SEQ ID NO:15). В конкретном варианте осуществления конъюгированное антитело специфически связывает область D4 KIT (например, KIT человека) и содержит антитело, содержащее CDR, указанные в таблице 1, или таблице 2, или таблице 3. В конкретном варианте осуществления конъюгированное антитело специфически связывает область D4 KIT (например, KIT человека) и содержит область VL-цепи, содержащую CDR1 VL, CDR2 VL и CDR3 VL, имеющие аминокислотную последовательность SEQ ID NO:19, 20 и 21, соответственно, и/или область VH-цепи, содержащую CDR1 VH, CDR2 VH и CDR3 VH, имеющие аминокислотную последовательность SEQ ID NO:16, 17 и 18, соответственно. В конкретном варианте осуществления конъюгированное антитело специфически связывает область D4 KIT (например, KIT человека) и содержит любое из антител Hum1-Hum20. В конкретном варианте осуществления конъюгированное антитело, описанное в настоящем описании, специфически связывает область D4 KIT (например, KIT человека), и включает антитело, содержащее VL и/или VH, содержащие CDR, выбранные из таблицы 1, или таблицы 2, или таблицы 3, и FR, выбранные из таблиц 5A-5D. В конкретном варианте осуществления конъюгированное антитело, описанное в настоящем описании, связывает область D4 KIT (например, KIT человека) и содержит антитело, содержащее VL, содержащую SEQ ID NO:12, и/или VH, содержащую SEQ ID NO:11. В одном из вариантов осуществления антитело, которое конъюгировано, представляет собой антитело, которое связывает область D4 KIT человека с аффинностью, например, EC50 приблизительно 200 пМ или менее. В другом варианте осуществления антитело, которое конъюгировано, представляет собой антитело, которое ингибирует биологическую активность KIT. В конкретных вариантах осуществления конъюгат содержит антитело, описанное в настоящем описании, и молекулу (например, терапевтическую часть или часть в виде лекарственного средства), где антитело прямо связано с молекулой с помощью одного или нескольких линкеров. В определенных вариантах осуществления антитело ковалентно конъюгировано с молекулой. В конкретном варианте осуществления антитело нековалентно конъюгировано с молекулой. В конкретных вариантах осуществления антитело, описанное в настоящем описании, например, антитело, конъюгированное со средством, связывается с KIT человека дикого типа. В определенных вариантах осуществления антитело, описанное в настоящем описании, например, антитело, конъюгированное со средством, связывается с внеклеточным доменом KIT человека, содержащим мутацию, например, соматическую мутацию, связанную со злокачественной опухолью (например, GIST), такую как мутация в экзоне 9 KIT человека, где остатки Ala и Tyr в положениях 502 и 503 дуплицированы.

Такую диагностику и обнаружение можно проводить, например, путем связывания антитела с поддающимися обнаружению молекулами или веществами, включая, но ими не ограничиваясь, различные ферменты, такие как, но ими не ограничиваясь, пероксидаза хрена, щелочная фосфатаза, бета-галактозидаза или ацетилхолинэстераза; простетические группы, такие как, но ими не ограничиваясь, стрептавидин/биотин и авидин/биотин; флуоресцентные материалы, такие как, но ими не ограничиваясь, умбеллиферон, флуоресцеин, флуоресцеин изотиоцианат, родамин, дихлортриазиниламин флуоресцеин, дансилхлорид или фикоэритрин; люминесцентные материалы, такие как, но ими не ограничиваясь, люминол; биолюминесцентные материалы, такие как, но ими не ограничиваясь, люцифераза, люциферин и экворин; радиоактивные материалы, такие как, но ими не ограничиваясь, йод (131I, 125I, 123I и 121I,), углерод (14C), сера (35S), тритий (3H), индий (115In, 113In, 112In и 111In,), технеций (99Tc), таллий (201Ti), галлий (68Ga, 67Ga), палладий (103Pd), молибден (99Mo), ксенон (133Xe), фтор (18F), 153Sm, 177Lu, 159Gd, 149Pm, 140La, 175Yb, 166Ho, 90Y, 47Sc, 186Re, 188Re, 142Pr, 105Rh, 97Ru, 68Ge, 57Co, 65Zn, 85Sr, 32P, 153Gd, 169Yb, 51Cr, 54Mn, 75Se, 113Sn и 117Sn; и позитронно-активные материалы при использовании различных типов позитронно-эмиссионной томографии, и нерадиоактивные парамагнитные ионы металлов.

В рамках настоящего изобретения предусматриваются антитела, описанные в настоящем описании, или их антигенсвязывающие фрагменты, конъюгированные или рекомбинантно слитые с терапевтической частью (или одной или несколькими терапевтическими частями) и применение таких антител. Антитело может быть конъюгированным или рекомбинантно слитым с терапевтической частью, такой как цитотоксин, например, цитостатическое или цитоцидное средство, лекарственное средство или ион радиоактивного металла, например, альфа-излучатели. Цитотоксин или цитотоксическое средство включает любое средство, которое является вредоносным для клеток. Терапевтические части включают, но ими не ограничиваются, ауристатин или его производное, например, монометилауристатин E (MMAE), монометилауристатин F (MMAF), ауристатин PYE и ауристатин E (AE) (см., например, патент США № 7662387 и публикацию патентных заявок США № 2008/0300192 и 2008/0025989, каждая из которых включена в настоящее описание в качестве ссылки); разрушающее микротрубочки средство, например, майтанзин или его производное, например, майтанзиноид DM1 (см., например, патенты США № 7851432, 7575748 и 5416064, каждый из которых включен в настоящее описание в качестве ссылки); пролекарство, например, пролекарство аналога CC-1065 (рахелмицин); антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацилдекарбазин); алкилирующие средства (например, мехлорэтамин, тиотепа, хлорамбуцил, мелфалан, кармустин (BCNU) и ломустин (CCNU), циклофосфамид, бусульфан, дибромманнит, стрептозотоцин, митомицин C и цисдихлордиамин платина (II) (DDP), и цисплатин); связывающиеся с малой бороздкой алкилирующие средства; антрациклины (например, даунорубицин (ранее дауномицин) и доксорубицин); антибиотики (например, дактиномицин (ранее актиномицин), блеомицин, митрамицин и антрамицин (AMC)); молекулы ауристатинов (например, ауристатин PHE, бриостатин 1 и соластатин 10; см. Woyke et al., Antimicrob. Agents Chemother. 46:3802-8 (2002), Woyke et al., Antimicrob. Agents Chemother. 45:3580-4 (2001), Mohammad et al., Anticancer Drug 12:735-40 (2001), Wall et al., Biochem. Biophys. Res. Commun. 266:76-80 (1999), Mohammad et al., Int. J. Oncol. 15:367-72 (1999), все из которых включены в настоящее описание в качестве ссылок); гормоны (например, глюкокортикоиды, прогестины, андрогены и эстрогены), ингибиторы ферментов репарации ДНК (например, этопозид или топотекан), ингибиторы киназ (например, соединение ST1571, иматиниба мезилат (Kantarjian et al., Clin Cancer Res. 8(7):2167-76 (2002)); цитотоксические средства (например, паклитаксел, цитохалазин B, грамицидин D, бромид этидия, эметин, митомицин, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин, дигидроксиантрациндион, митоксантрон, митрамицин, актиномицин D, 1-дегидротестостерон, глюкокортикоиды, прокаин, татракаин, лидокаин, пропранолол и пуромицин и их аналоги или гомологи, и соединения, описанные в патентах США № 6245759, 6399633, 6383790, 6335156, 6271242, 6242196, 6218410, 6218372, 6057300, 6034053, 5985877, 5958769, 5925376, 5922844, 5911995, 5872223, 5863904, 5840745, 5728868, 5648239, 5587459, каждый из которых включен в настоящее описание в качестве ссылки для раскрытия таких соединений); ингибиторы фарнезилтрансферазы (например, R115777, BMS-214662 и соединения, описанные, например, в патентах США №: 6458935, 6451812, 6440974, 6436960, 6432959, 6420387, 6414145, 6410541, 6410539, 6403581, 6399615, 6387905, 6372747, 6369034, 6362188, 6342765, 6342487, 6300501, 6268363, 6265422, 6248756, 6239140, 6232338, 6228865, 6228856, 6225322, 6218406, 6211193, 6187786, 6169096, 6159984, 6143766, 6133303, 6127366, 6124465, 6124295, 6103723, 6093737, 6090948, 6080870, 6077853, 6071935, 6066738, 6063930, 6054466, 6051582, 6051574 и 6040305, каждый из которых включен в настоящее описание в качестве ссылки в отношении раскрытия таких ингибиторов); ингибиторы топоизомеразы (например, камптотецин; иринотекан; SN-38; топотекан; 9-аминокамптотецин; GG-211 (GI 147211); DX-8951f; IST-622; рубитекан; пиразолоакридин; XR-5000; саинтопин; UCE6; UCE1022; TAN-1518A; TAN 1518B; KT6006; KT6528; ED-110; NB-506; ED-110; NB-506 и ребеккамицин); булгареин; связывающиеся с малой бороздкой ДНК соединения, такие как краситель Хехста 33342 и краситель Хехста 33258; нитидин; фагаронин; эпиберберин; коралин; бета-лапахон; BC-4-1; бисфосфонаты (например, алендронат, цимадронт, клодронат, тилудронат, этидронат, ибандронат, неридронат, олпандронат, ризедронат, пиридронат, памидронат, золендронат), ингибиторы HMG-CoA редуктазы, (например, ловастатин, симвастатин, аторвастатин, правастатин, флувастатин, статин, церивастатин, лескол, лупитор, розувастатин и аторвастатин); антисмысловые олигонуклеотиды (например, антисмысловые олигонуклеотиды, описанные в патентах США № 6277832, 5998596, 5885834, 5734033 и 5618709, каждый из которых включен в настоящее описание в качестве ссылки касательно таких олигонуклеотидов); ингибиторы аденозиндезаминазы (например, флударабин фосфат и 2-хлордезоксиаденозин); ибритутомаб тиуксетан (Zevalin®); тозитумомаб (Bexxar®)) и их фармацевтически приемлемые соли, сольваты, клатраты и пролекарства. В одном из вариантов осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое связывает область D4 KIT человека с аффинностью менее чем приблизительно 200 пМ. В другом варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое ингибирует биологическую активность KIT. В конкретном варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит CDR, указанные в таблице 1 (например, CDR1 VL, CDR2 VL и CDR3 VL, имеющие аминокислотную последовательность SEQ ID NO:19, 20 и 21, соответственно, и/или область VH-цепи, содержащую CDR1 VH, CDR2 VH и CDR3 VH, имеющие аминокислотную последовательность SEQ ID NO:16, 17 и 18, соответственно) или в таблице 2 или таблице 3. В конкретном варианте осуществления антитело, которое конъгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит VL, содержащую SEQ ID NO:7, 8, 9, 10 или 12, или последовательность, указанную в таблицах 5B и 5D, и/или VH, содержащую SEQ ID NO:2, 3, 4, 5, 6 или 11, или последовательность, указанную в таблицах 5A и 5C.

В конкретных вариантах осуществления терапевтическая часть или часть лекарственного средства представляет собой лекарственное средство, направленное против тубулина, такое как ауристатин или его производное. Неограничивающие примеры ауристатинов включают монометилауристатин E (MMAE), монометилауристатин F (MMAF), ауристатин PYE и ауристатин E (AE) (см., например, патент США № 7662387 и публикации патентных заявок США № 2008/0300192 и 2008/0025989, каждая из которых включена в настоящее описание в качестве ссылки). В определенных вариантах осуществления терапевтическая часть или часть лекарственного средства представляет собой разрушающее микротрубочки средство, такое как майтанзин или его производное, например, майтанзиноид DM1 или DM4 (см., например, патенты США № 7851432, 7575748 и 5416064, каждый из которых включен в настоящее описание в качестве ссылки). В определенных вариантах осуществления терапевтическая часть или часть лекарственного средства представляет собой пролекарство, например, пролекарство аналога CC-1065 (рахелмицин) (см., например, публикацию патентной заявки США № 2008/0279868, и публикации международных патентных заявок PCT № WO 2009/017394, WO 2010/062171 и WO 2007/089149, каждая из которых включена в настоящее описание в качестве ссылки). В одном из вариантов осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое связывает область D4 KIT человека с аффинностью менее 200 пМ. В другом варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое ингибирует биологическую активность KIT. В конкретном варианте осуществления антитело (например, антитело человека или гуманизированное антитело), которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства представляет собой антитело, которое содержит CDR, указанные в таблице 1 (например, CDR1 VL, CDR2 VL и CDR3 VL, имеющие аминокислотную последовательность SEQ ID NO:19, 20 и 21, соответственно, и/или область VH-цепи, содержащая CDR1 VH, CDR2 VH и CDR3 VH, имеющие аминокислотную последовательность SEQ ID NO:16, 17 и 18, соответственно) или в таблице 2 или в таблице 3. В конкретном варианте осуществления антитело (например, антитело человека или гуманизированное антитело), которое конъюгировано с такой терапевтической частью/частью лекарственного средства, представляет собой антитело, которое содержит VL, содержащую SEQ ID NO:7, 8, 9, 10 или 12, или последовательность, указанную в таблицах 5B и 5D, и/или VH, содержащую SEQ ID NO:2, 3, 4, 5, 6 или 11, или последовательность, указанную в таблицах 5A и 5C.

В конкретном варианте осуществления антитело и терапевтическое/лекарственное средство конъюгированы с помощью одного или нескольких линкеров. В другом конкретном варианте осуществления антитело и терапевтическое/лекарственное средство конъюгированы прямо.

В конкретных вариантах осуществления неограничивающие примеры терапевтических частей или частей в виде лекарственного средства для конъюгации с антителом, описанным в настоящем описании, включают калихеамицины (например, комплекс LL-E33288, например, гамма-калихеамицин, см., например, патент США № 4970198) и их производные (например, гидразидные производные гамма-калихеамицина), озогамицины, дуокармицины и их производные (например, CC-1065 (NSC 298223) или ахиральный аналог дуокармицина (например, AS-1-145 или центанамицин)), таксаны и их производные, и энедиины и их производные (см., например, публикации международных патентных заявок PCT № WO 2009/017394, WO 2010/062171, WO 2007/089149, WO 2011/021146, WO 2008/150261, WO 2006/031653, WO 2005/089809, WO 2005/089807 и WO 2005/089808, все из которых включены в настоящее описание в качестве ссылки в полном объеме). В конкретном варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит CDR, указанные в таблице 1 (например, CDR1 VL, CDR2 VL и CDR3 VL, имеющие аминокислотную последовательность SEQ ID NO:20, 21 и 22, соответственно, и/или область VH-цепи, содержащую CDR1 VH, CDR2 VH и CDR3 VH, имеющие аминокислотную последовательность SEQ ID NO:23, 24 и 25, соответственно). В конкретном варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит VL, содержащую SEQ ID NO:7, 8, 9, 10 или 12, или последовательность, указанную в таблицах 5B и 5D, и/или VH, содержащую SEQ ID NO:2, 3, 4, 5, 6 или 11, или последовательность, указанную в таблицах 5A и 5C. В конкретном варианте осуществления антитело и лекарственное средство конъюгированы с помощью одного или нескольких линкеров. В другом конкретном варианте осуществления антитело и лекарственное средство конъюгированы прямо.

Неограничивающие примеры калихеамицинов, подходящих для конъюгации с антителом, описанным в настоящем описании, описаны, например, в патентах США № 4671958; 5053394; 5037651; 5079233 и 5108912; и в публикациях международных заявок PCT № WO 2011/021146, WO 2008/150261, WO 2006/031653, WO 2005/089809, WO 2005/089807 и WO 2005/089808; каждая из которых включена в настоящее описание в качестве ссылки для раскрытия таких калихеамицинов. В конкретных вариантах осуществления эти соединения могут содержать метилтрисульфид, который реагирует с соответствующими тиолами с образованием дисульфидов, и в то же время вносит функциональную группу, такую как гидразид или другая функциональная группа, которая может быть пригодной для конъюгации калихеамицина с антителом, описанным в настоящем описании. В определенных вариантах осуществления стабилизация дисульфидной связи, которая присутствует в конъюгатах калихеамицина вследствие добавления диметильных заместителей, может обеспечить усовершенствованный конъюгат антитело/лекарственное средство. В конкретных вариантах осуществления производное калихеамицина представляет собой N-ацетил-гамма-калихеамицин диметилгидразид, или NAc-гамма DMH (CL-184.538), в качестве одного из оптимизированных производных для конъюгации. Дисульфидные аналоги калихеамицина, которые могут быть конъюгированы с антителом, описанным в настоящем описании, описаны, например, в патентах США № 5606040 и 5770710, каждый из которых включен в настоящее описание в качестве ссылки для раскрытия таких соединений. В определенном варианте осуществления часть (например, калихеамицин или его производное) конъюгирована с антителом с помощью линкера. В конкретном варианте осуществления часть (например, часть в виде калихеамицина или его производного) отщепляется путем гидролиза от конъюгата антитело-лекарственное средство в области линкера. В одном из вариантов осуществления часть (например, калихеамицин или его производное) отщепляется путем гидролиза от конъюгата антитела в области линкера при pH от pH 3,0 до pH 4,0 в течение 1-24 часов при температуре от 20 до 50°C, предпочтительно, 37°C.

В конкретных вариантах осуществления неограничивающие примеры терапевтических частей или частей в виде лекарственного средства для конъюгации с антителом, описанным в настоящем описании, включают пирролобензодиазепины (PBD) и их производные, например, димеры PBD (например, SJG-136 или SG2000), C2-ненасыщенные димеры PBD, димеры пирролобензодиазепина, имеющие замены в C2-ариле (например, SG2285), димерное пролекарство PBD, которое активируется при гидролизе (например, SG2285) и полипиррол-PBD (например, SG2274) (см., например, публикации международных патентных заявок PCT № WO 2000/012507, WO 2007/039752, WO 2005/110423, WO 2005/085251 и WO 2005/040170, и патент США № 7612062, каждый из которых включен в настоящее описание в качестве ссылки для раскрытия таких соединений). В конкретном варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит CDR, указанные в таблице 1 (например, CDR1 VL, CDR2 VL и CDR3 VL, имеющие аминокислотную последовательность SEQ ID NO:19, 20 и 21, соответственно, и/или область VH-цепи, содержащую CDR1 VH, CDR2 VH и CDR3 VH, имеющую аминокислотную последовательность SEQ ID NO:16, 17 и 18, соответственно), или в таблице 2, или в таблице 3. В конкретном варианте осуществления антитело, которое конъюгировано с такой терапевтической частью/частью в виде лекарственного средства, представляет собой антитело, которое содержит VL, содержащую SEQ ID NO:7, 8, 9, 10 или 12 или последовательность указанную в таблицах 5B и 5D, и/или VH, содержащую SEQ ID NO:2, 3, 4, 5, 6 или 11 или последовательность, указанную в таблицах 5A и 5C. В конкретном варианте осуществления антитело и лекарственное средство конъюгированы с помощью одного или нескольких линкеров.

Кроме того, антитело, описанное в настоящем описании, можно конъюгировать или подвергать рекомбинантному слиянию с терапевтической частью или частью в виде лекарственного средства, которая модифицирует данный биологический ответ. Терапевтические части или части в виде лекарственного средства не следует истолковывать как ограниченные классическими лекарственными средствами. Например, часть в виде лекарственного средства может представлять собой белок, пептид или полипептид, обладающие желаемой биологической активностью. Такие белки могут включать, например, токсин, такой как абрин, рицин A, экзотоксин pseudomonas, холерный токсин или дифтерийный токсин; белок, такой как фактор некроза опухоли, γ-интерферон, α-интерферон, фактор роста нервов, тромбоцитарный фактор роста, тканевой активатор плазминогена, апоптотическое средство, например, TNF-γ, TNF-γ, AIM I (см. международную публикацию № WO 97/33899), AIM II (см. международную публикацию № WO 97/34911), Fas-лиганд (Takahashi et al., 1994, J. Immunol., 6:1567-1574) и VEGF (см., международную публикацию № WO 99/23105), антиангиогенное средство, например, ангиостатин, эндостатин или компонент каскада свертывания крови (например, тканевой фактор); или модификатор биологического ответа, например, такой как лимфокин (например, интерферон-гамма, интерлейкин-1 ("IL-1"), интерлейкин-2 ("IL-2"), интерлейкин-5 ("IL-5"), интерлейкин-6 ("IL-6"), интерлейкин-7 ("IL-7"), интерлейкин 9 ("IL-9"), интерлейкин-10 ("IL-10"), интерлейкин-12 ("IL-12"), интерлейкин-15 ("IL-15"), интерлейкин-23 ("IL-23"), гранулоцитарно-макрофагальный колониестимулирующий фактор ("GM-CSF") и гранулоцитарный колониестимулирующий фактор ("G-CSF")), или фактор роста (например, гормон роста ("GH")) или свертывающее средство (например, кальций, витамин K, тканевые факторы, такие как, но ими не ограничиваясь, фактор Хагемана (фактор XII), высокомолекулярный кининоген (HMWK), прекалликреин (PK), белки-факторы свертывания II (протромбин), фактор V, XIIa, VIII, XIIIa, XI, XIa, IX, IXa, X, фосфолипид и мономер фибрина).

В рамках настоящего изобретения предусматриваются антитела, рекомбинантно слитые или химически конъюгированные (ковалентная или нековалентная конъюгация) с гетерологичным белком или полипептидом (или его фрагментом, предпочтительно, с полипептидом из приблизительно 10, приблизительно 20, приблизительно 30, приблизительно 40, приблизительно 50, приблизительно 60, приблизительно 70, приблизительно 80, приблизительно 90 или приблизительно 100 аминокислот), с образованием слитых белков. В частности, в рамках настоящего изобретения предусматриваются слитые белки, содержащие антигенсвязывающий фрагмент антитела, описанного в настоящем описании, (например, Fab-фрагмент, Fd-фрагмент, Fv-фрагмент, F(ab)2-фрагмент, VH-домен, CDR VH, VL-домен или CDR VL) и гетерологичный белок, полипептид или пептид. В одном из вариантов осуществления гетерологичный белок, полипептид или пептид, слитый с антителом, подходит для нацеливания антитела на конкретный тип клеток, такой как клетка, которая экспрессирует KIT. Например, антитело, которое иммуноспецифически связывается с рецептором клеточной поверхности, экспрессируемым конкретным типом клеток (например, иммунная клетка) может быть слитым или конъюгированным с модифицированным антителом, описанным в настоящем описании. В конкретных вариантах осуществления гетерологичный белок или полипептид (или их фрагмент) связываются со второй мишенью (например, мишенью, отличной от KIT) (см., например, публикацию международной патентной заявки PCT № WO 2009/088805 и публикацию патентной заявки США № US 2009/0148905).

В рамках настоящего изобретения предусматривается конъюгированный или слитый белок, содержащий любое антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, и гетерологичный полипептид (например, полипептид, отличный от KIT). В одном из вариантов осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит антитело против KIT, описанное в настоящем описании, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит антигенсвязывающий фрагмент антитела против KIT, описанного в настоящем описании, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит VH-домен, имеющий аминокислотную последовательность любого из VH-доменов антитела против KIT, описанного в настоящем описании, и/или VL-домен, имеющий аминокислотную последовательность любого из VL доменов антитела против KIT, описанного в настоящем описании, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит одну или несколько CDR VH, имеющих аминокислотную последовательность любой из SEQ ID NO:16, 17 и 18 (см., например, таблицу 1), или аминокислотную последовательность любой из CDR, указанных в таблице 2 или 3, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок содержит одну или несколько CDR VL, имеющих аминокислотную последовательность любой из CDR VL антитела против KIT, описанного в настоящем описании (например, CDR VL, указанную в таблице 1, SEQ ID NO:19, 20 и 21, или CDR VL, указанные в таблице 2 или в таблице 3), и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит по меньшей мере один VH-домен и по меньшей мере один VL-домен антитела против KIT, описанного в настоящем описании, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит по меньшей мере один VH-домен и по меньшей мере VL-домен, содержащий SEQ ID NO:7, 8, 9, 10 или 12 или последовательность, указанную в таблицах 5B и 5D, и/или VH домен, содержащий SEQ ID NO:2, 3, 4, 5, 6 или 11 или последовательность, указанную в таблицах 5A и 5C, и гетерологичный полипептид. В другом варианте осуществления конъюгированный или слитый белок, описанный в настоящем описании, содержит по меньшей мере одну CDR VH и по меньшей мере одну CDR VL антитела против KIT, описанного в настоящем описании (например, CDR VL и CDR VH в таблице 1, или в таблице 2 или в таблице 3) и гетерологичный полипептид.

Кроме того, антитело, описанное в настоящем описании, может быть конъюгировано с терапевтическими частями, такими как ион радиоактивного металла, такой как альфа-излучатели, такие как 213Bi или макроциклические хелаторы, подходящие для конъюгации ионов радиоактивных металлов, включая, но ими не ограничиваясь, 131In, 131LU, 131Y, 131Ho, 131Sm, с полипептидами. В определенных вариантах осуществления макроциклическим хелатором является 1,4,7,10-тетраазациклододекан-N,N',N'',N'''-тетрауксусная кислота (DOTA), которая может быть связана с антителом через молекулу линкера. Такие линкерные молекулы широко известны в данной области и описаны в Denardo et al., 1998, Clin Cancer Res. 4(10):2483-90; Peterson et al., 1999, Bioconjug. Chem. 10(4):553-7; и Zimmerman et al., 1999, Nucl. Med. Biol. 26(8):943-50, каждая из которых включена в настоящее описание в качестве ссылки в полном объеме.

В определенных вариантах осуществления антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент, конъюгировано с одной или несколькими молекулами (например, терапевтическая часть или часть в виде лекарственного средства) прямо или непрямо через одну или несколько линкерных молекул. В конкретных вариантах осуществления линкер представляет собой расщепляемый ферментом линкер или дисульфидный линкер. В конкретном варианте осуществления расщепляемый линкер расщепляется ферментом, таким как аминопептидаза, аминоэстераза, дипептидилкарбоксипептидаза или протеаза каскада свертывания крови. В конкретных вариантах осуществления линкер содержит 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или 20 аминокислотных остатков. В определенных вариантах осуществления линкер состоит из 1-10 аминокислотных остатков, от 1 до 15 аминокислотных остатков, от 5 до 20 аминокислотных остатков, от 10 до 25 аминокислотных остатков, от 10 до 30 аминокислотных остатков, или от 10 до 50 аминокислотных остатков.

В определенных вариантах осуществления часть конъюгирована с антителом посредством одного или нескольких линкеров. В конкретном варианте осуществления часть отщепляется путем гидролиза от конъюгата антитело-лекарственное средство в области линкера. В одном из вариантов осуществления часть гидролизуется от конъюгата антитела в области линкера при pH приблизительно от pH 3,0 до pH 4,0 в течение 1-24 часов при температуре от 20 до 50°C, предпочтительно, 37°C. В конкретном варианте осуществления линкер является стабильным в кровотоке, но высвобождает конъюгированную часть после попадания внутрь клеток-мишеней. В определенных вариантах осуществления часть конъюгирована с антителом, описанным в настоящем описании, через один или несколько триазолсодержащих линкеров (см., например, публикацию международной патентной заявки № WO 2007/018431, которая включена в настоящее описание в качестве ссылки). Неограничивающие примеры линкеров и спейсеров для включения в конъюгаты антитело-лекарственное средство, описанные в настоящем описании, описаны в публикациях международных патентных заявок PCT № WO 2007/018431, WO 2004/043493 и WO 2002/083180.

Более того, антитела, описанные в настоящем описании, можно подвергать слиянию с маркерными последовательностями, такими как пептид, чтобы упростить очистку. В предпочтительных вариантах осуществления маркерная аминокислотная последовательность представляет собой гексагистидиновый пептид, такой как метка, предоставленная в векторе pQE (QIAGEN, Inc.), среди прочих, многие из которых являются коммерчески доступными. Как описано в Gentz et al., 1989, Proc. Natl. Acad. Sci. USA 86:821-824, например, гексагистидин обеспечивает удобную очистку слитого белка. Другие пептидные метки, пригодные для очистки, включают, но ими не ограничиваются, гемагглютининовую ("HA") метку, которая представляет собой эпитоп, происходящий из белка гемагглютинина вируса гриппа (Wilson et al., 1984, Cell 37:767) и "FLAG"-метку.

Способы слияния или конъюгации терапевтических частей (включая полипептиды) с антителами хорошо известны, см., например, Arnon et al., "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", в Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp.243-56 (Alan R. Liss, Inc. 1985); Hellstrom et al., "Antibodies For Drug Delivery", в Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", в Monoclonal Antibodies 84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", в Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), Thorpe et al., 1982, Immunol. Rev. 62:119-58; патенты США № 5336603, 5622929, 5359046, 5349053, 5447851, 5723125, 5783181, 5908626, 5844095 и 5112946; EP 307434; EP 367166; EP 394827; публикации PCT WO 91/06570, WO 96/04388, WO 96/22024, WO 97/34631 и WO 99/04813; Ashkenazi et al., Proc. Natl. Acad. Sci. USA, 88: 10535-10539, 1991; Traunecker et al., Nature, 331:84-86, 1988; Zheng et al., J. Immunol., 154:5590-5600, 1995; Vil et al., Proc. Natl. Acad. Sci. USA, 89:11337-11341, 1992, которые включены в настоящее описание в качестве ссылок в полном объеме.

Слитые белки можно получать, например, способами шаффлинга генов, шаффлинга мотивов, шаффлинга экзонов и/или шаффлинга кодонов (в совокупности называемые "шаффлингом ДНК"). Шаффлинг ДНК можно использовать для изменения активности антител, описанных в настоящем описании (например, антитела с более высокой аффинностью и более низкими скоростями диссоциации). См., главным образом, патенты США № 5605793, 5811238, 5830721, 5834252 и 5837458; Patten et al., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol. 16(2):76-82; Hansson et al., 1999, J. Mol. Biol. 287:265-76; и Lorenzo and Blasco, 1998, Biotechniques 24(2):308- 313 (каждый из этих патентов и публикаций включен в настоящее описание в качестве ссылки). Антитела или кодируемые антитела перед рекомбинацией можно изменять, подвергая их случайному мутагенезу с помощью ПЦР с пониженной точностью, случайному встраиванию нуклеотидов и другим способам. Полинуклеотид, кодирующий антитело, описанное в настоящем описании, можно рекомбинировать с одним или несколькими компонентами, мотивами, сегментами, частями, доменами, фрагментами и т.д. одной или нескольких гетерологичных молекул.

Антитело, описанное в настоящем описании, также можно конъюгировать со вторым антителом с получением гетероконъюгата антитела, как описано в патенте США № 4676980, который включен в настоящее описание в качестве ссылки.

Терапевтическая часть или лекарственное средство, конъюгированные или рекомбинантно слитые с антителом, описанным в настоящем описании, которое иммуноспецифически связывается с антигеном KIT, могут быть выбраны для достижения желаемого профилактического или терапевтического эффекта(ов), например, уменьшения размера опухоли или опухолевой нагрузки, уменьшения роста или пролиферации злокачественных клеток или индукции гибели злокачественных клеток. В определенных вариантах осуществления антитело представляет собой модифицированное антитело. Клиницист или другой медицинский специалист должен учитывать следующее при принятии решения о том, какую терапевтическую часть или лекарственное средство конъюгировать или подвергать рекомбинантному слиянию с антителом, описанным в настоящем описании: природа заболевания, тяжесть заболевания и состояние индивидуума.

Антитела, описанные в настоящем описании, также можно связывать с твердыми подложками, которые, в частности, являются пригодными для иммуноанализов или очистки антигена-мишени. Такие твердые подложки включают, но ими не ограничиваются, стекло, целлюлозу, полиакриламид, нейлон, полистирол, поливинилхлорид или полипропилен.

В определенном аспекте антитело, описанное в настоящем описании, или его антигенсвязывающий фрагмент представляет собой конъюгат внеклеточного лекарственного средства (ECD), содержащий антитело, связанное с лекарственным средством, необязательно линкером (см., например, публикацию международной патентной заявки PCT № WO 2011/031870). Лекарственное средство может действовать снаружи клетки, и, таким образом, интернализация конъюгата не требуется. После связывания ECD с клеткой-мишенью лекарственное средство посылает сигнал в клетку.

В одном из вариантов осуществления линкер ECD представляет собой нерасщепляемый линкер. Примеры нерасщепляемых линкеров включают линкеры, которые содержат цепи полиэтиленгликоля или цепи полиэтилена, которые не являются чувствительными к кислотам или основаниям (такие как гидразонсодержащие линкеры), не являются чувствительными к восстановителям или окислителям (такие как линкеры, содержащие дисульфидные связи), и не являются чувствительными к ферментам, которые могут встречаться в клетках или кровотоке. Конкретные примеры нерасщепляемых линкеров включают линкер SMCC (патентная заявка США 20090202536). Для иллюстративных целей примеры расщепляемых линкеров включают линкеры, которые содержат не сокрытые пространственно чувствительные к глутатиону дисульфиды, сложные эфиры, пептидные последовательности, чувствительные к пептидазам, таким как катепсин или плазмин, чувствительные к pH гидразоны (см. Bioconjugate Chem., 2010, 21 (1), pp 5-13) и не линкер SPP с не сокрытым пространственно дисульфидом (патентная заявка США 20090202536).

В некоторых аспектах ECD содержит лекарственное средство или средство, которое является сердечным гликозидом, например, просцилларидин или усиленный сахаром просцилларидин. В одном из вариантов осуществления средство состоит из сердечного гликозида, которое лишено сахара. В различных вариантах осуществления сердечный гликозид представляет собой соединение, идентифицированное в публикации PCT № WO 2010/017480 (PCT/US2009/053159).

5.2 Полинуклеотиды

В некоторых аспектах в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, или его фрагмент (например, вариабельную область легкой цепи и/или вариабельную область тяжелой цепи), которые иммуноспецифически связываются с антигеном KIT, и векторы, например, векторы, содержащие такие полинуклеотиды, для рекомбинантной экспрессии в клетках-хозяевах (например, E. coli и клетки млекопитающих). В рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидные последовательности, кодирующие любые из антител, описанные в настоящем описании, а также векторы, содержащие такие полинуклеотидные последовательности, например, векторы экспрессии, для их эффективной экспрессии в клетках-хозяевах, например, клетках млекопитающих. Также в рамках настоящего изобретения предусматриваются полинуклеотиды, кодирующие антигены KIT (например, SEQ ID NO:14 или 15), для получения антител против KIT, описанных в настоящем описании.

Как используется в рамках изобретения, "выделенный" полинуклеотид или молекула нуклеиновой кислоты представляют собой полинуклеотид или молекулу нуклеиновой кислоты, которые отделены от других молекул нуклеиновой кислоты, присутствующих в природном источнике (например, у человека) молекулы нуклеиновой кислоты. Более того, "выделенная" молекула нуклеиновой кислоты, такая как молекула кДНК, может быть по существу свободной от другого клеточного материала или культуральной среды при получении рекомбинантными способами, или по существу свободной от химических предшественников или других химических веществ в случае химического синтеза. Например, формулировка "по существу свободна" включает препараты полинуклеотида или молекулы нуклеиновой кислоты, имеющие менее чем приблизительно 15%, 10%, 5%, 2%, 1%, 0,5% или 0,1% (в частности, менее чем приблизительно 10%) другого материала, например, клеточного материала, клеточной среды, других молекул нуклеиновой кислоты, химических предшественников и/или других химических веществ. В конкретном варианте осуществления молекула(ы) нуклеиновой кислоты, кодирующая антитело, описанное в настоящем описании, является выделенной или очищенной.

В конкретных аспектах в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидные последовательности, кодирующие антитела (например, гуманизированное антитело) или их антигенсвязывающие фрагменты, которые иммуноспецифически связываются с полипептидом KIT (например, областью D4 KIT, например, KIT человека) и содержат аминокислотную последовательность, как описано в настоящем описании, а также антитела, которые конкурируют с такими антителами за связывание с полипептидом KIT (например, дозозависимым образом), или которые связываются с тем же эпитопом, что и такие антитела.

В некоторых аспектах в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую легкую цепь или тяжелую цепь антитела, описанного в настоящем описании. Полинуклеотиды могут содержать нуклеотидные последовательности, кодирующие легкую цепь, содержащую FR и CDR VL антител, описанных в настоящем описании (см., например, таблицы 1 и 5B). Полинуклеотиды могут содержать нуклеотидные последовательности, кодирующие тяжелую цепь, содержащую FR и CDR VH антител, описанных в настоящем описании (см., например, таблицы 1 и 5A). В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VL-цепи, содержащую аминокислотную последовательность SEQ ID NO: 7, 8, 9 или 10. В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VH-цепи, содержащую аминокислотную последовательность согласно любой из SEQ ID NO:2-6.

В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VL-цепи, где полинуклеотид содержит последовательность нуклеиновой кислоты SEQ ID NO:27, 28, 29 или 30. В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VH-цепи, где полинуклеотид содержит последовательность нуклеиновой кислоты SEQ ID NO:22, 23, 24, 25 или 26. В конкретных вариантах осуществления полинуклеотид кодирует антитело, описанное в настоящем описании, где полинуклеотид содержит последовательность нуклеиновой кислоты SEQ ID NO:28, кодирующую область VL-цепи L2, и последовательность нуклеиновой кислоты SEQ ID NO:24, кодирующую область VH-цепи H3. В конкретных вариантах осуществления один или несколько полинуклеотидов содержат последовательность нуклеиновой кислоты SEQ ID NO:28, кодирующую область VL-цепи и последовательность нуклеиновой кислоты SEQ ID NO:24, кодирующую область VH-цепи. В конкретных вариантах осуществления полинуклеотид кодирует антитело, описанное в настоящем описании, где полинуклеотид содержит последовательность нуклеиновой кислоты SEQ ID NO:27, кодирующую область VL-цепи L1 и последовательность нуклеиновой кислоты SEQ ID NO:25, кодирующую область VH-цепи H4. В конкретных вариантах осуществления один или несколько полинуклеотидов содержат последовательность нуклеиновой кислоты SEQ ID NO:27, кодирующую область VL-цепи, и последовательность нуклеиновой кислоты SEQ ID NO:25, кодирующую область VH-цепи. В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VL-цепи, где полинуклеотид содержит последовательность нуклеиновой кислоты, которая по меньшей мере 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, или по меньшей мере на 98% идентична последовательности нуклеиновой кислоты SEQ ID NO:27, 28, 29 или 30. В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, кодирует область VH-цепи, где полинуклеотид содержит последовательность нуклеиновой кислоты, которая по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, или по меньшей мере на 98% идентична последовательности нуклеиновой кислоты SEQ ID NO:22, 23, 24, 25 или 26.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую антитело против KIT, содержащее область VL-цепи, например, содержащую FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, включающую аминокислотные последовательности, описанные в настоящем описании (например, см. таблицы 1, 5A-5B и 6A-6B). В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую антитело против KIT, содержащее область VH-цепи, например, содержащую FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, включающую аминокислотные последовательности, описанные в настоящем описании (например, см. таблицы 1, 5A-5B и 6A-6B).

В определенных вариантах осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, содержащее вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность, описанную в настоящем описании (например, см. фиг.3A-3I), где антитело иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека), например, SEQ ID NO:15.

В определенных вариантах осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, содержащее вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность, описанную в настоящем описании (например, см. фиг.3A-3I), где антитело иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека), например, SEQ ID NO:15.

В некоторых аспектах полинуклеотид содержит нуклеотидную последовательность, кодирующую антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, содержащее область VL-цепи, содержащую одну или несколько FR VL, имеющих аминокислотную последовательность, описанную в настоящем описании (например, см. таблицы 5B и 5D), где антитело иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека), например, SEQ ID NO:15. В некоторых аспектах полинуклеотид содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, содержащее область VH-цепи, содержащую одну или несколько FR VH, имеющих аминокислотную последовательность, описанную в настоящем описании (например, см. таблицы 5A и 5C), где антитело иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека), например, SEQ ID NO:15.

В конкретных вариантах осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело (например, антитело человека или гуманизированное антитело), описанное в настоящем описании, содержащее: каркасные области (например, каркасные области VL-домена и VH-домена), которые представляют собой каркасные области человека, где антитело иммуноспецифически связывается с полипептидом KIT, например, полипептидом KIT человека, например, областью D4 KIT (например, KIT человека, например, SEQ ID NO:15).

В конкретных аспектах в рамках настоящего изобретения предусматривается полинуклеотид, содержащий нуклеотидную последовательность, кодирующую антитело, содержащее легкую цепь и тяжелую цепь, например, отдельные легкую цепь и тяжелую цепь. Что касается легкой цепи, в конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую легкую цепь каппа. В другом конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую легкую цепь лямбда. В другом конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, содержащее легкую цепь каппа человека или легкую цепь лямбда человека. В конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, полипептид KIT, содержащий область D4 KIT, например, KIT человека (например, SEQ ID NO:15)), где антитело содержит легкую цепь и где аминокислотная последовательность область VL-цепи может содержать любую аминокислотную последовательность, описанную в настоящем описании (например, SEQ ID NO:7, 8, 9 или 10 или 12), и где константная область легкой цепи содержит аминокислотную последовательность константной области легкой цепи каппа человека. В конкретном варианте осуществления легкая цепь содержит аминокислотную последовательность SEQ ID NO:12. В другом конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, полипептид KIT, содержащий область D4 KIT, например, KIT человека (например, SEQ ID NO:15)), и содержит легкую цепь, где аминокислотная последовательность области VL-цепи может содержать любу аминокислотную последовательность, описанную в настоящем описании (например, SEQ ID NO:7, 8, 9, или 10, или 12), и где константная область легкой цепи содержит аминокислотную последовательность константной области легкой цепи лямбда человека. Например, последовательности константной области человека могут представлять собой последовательности, описанные в патенте США № 5693780.

В конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании, которое иммуноспецифически связывается с полипептидом KIT (например, полипептид KIT, содержащий область D4 KIT, например, KIT человека (например, SEQ ID NO:15)), где антитело содержит тяжелую цепь, где аминокислотная последовательность области VH-цепи может содержать любую аминокислотную последовательность, описанную в настоящем описании (например, SEQ ID NO:2, 3, 4, 5, или 6, или 11), и где константная область тяжелой цепи содержит аминокислотную последовательность константной области тяжелой цепи гамма (γ) человека.

В другом конкретном варианте осуществления полинуклеотид, описанный в настоящем описании, содержит нуклеотидную последовательность, кодирующую антитело, описанное в настоящем описании (или его антигенсвязывающий фрагмент), которое иммуноспецифически связывается с полипептидом KIT (например, областью D4 KIT, например, KIT человека), где антитело содержит область VL-цепи и область VH-цепи, содержащую любые аминокислотные последовательности, описанные в настоящем описании, и где константные области содержит аминокислотные последовательности константных областей IgG1 человека (например, изотипа a, z или f) или IgG4 человека.

В конкретном варианте осуществления в рамках настоящего изобретения предусматриваются полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую антитело против KIT, или его антигенсвязывающий фрагмент или домен, описанные в настоящем описании, см., например, таблицы 1-6B и фиг. 3A-3I, например, антитело Hum1-Hum20.

Также в рамках настоящего изобретения предусматриваются полинуклеотиды, кодирующие антитело против KIT или его фрагмент, которые оптимизированы, например, посредством оптимизации кодонов/РНК, замены на гетерологичные сигнальные последовательности и устранения элементов нестабильности мРНК. Способы получения оптимизированных нуклеиновых кислот, кодирующих антитело против KIT или его фрагмент (например, легкая цепь, тяжелая цепь, VH-домен или VL-домен) для рекомбинантной экспрессии путем внесения изменений кодонов и/или устранения ингибиторных областей в мРНК можно проводить путем адаптации способов оптимизации, описанных, например, в патентах США № 5965726; 6174666; 6291664; 6414132 и 6794498, соответственно. Например, в потенциальные участки сплайсинга и элементы нестабильности (например, элементы, богатые A/T или A/U) в РНК можно вносить мутации без изменения аминокислот, кодируемых последовательностями нуклеиновой кислоты, для увеличения стабильности РНК для рекомбинантной экспрессии. В изменениях используется вырожденность генетического кода, например, с использованием альтернативного кодона для идентичной аминокислоты. В некоторых вариантах осуществления может быть желательным изменение одного или нескольких кодонов для кодирования консервативной мутации, например, сходной аминокислоты со сходной химической структурой и свойствами и/или функцией с исходной аминокислотой. Такие способы могут увеличивать экспрессию антитела против KIT или его фрагмента по меньшей мере в 1 раз, в 2 раза, в 3 раза, в 4 раза, в 5 раз, в 10 раз, в 20 раз, в 30 раз, в 40 раз, в 50 раз, в 60 раз, в 70 раз, в 80 раз, в 90 раз или в 100 раз или более относительно экспрессии антитела против KIT, кодируемого полинуклеотидами, которые не были оптимизированы.

В определенных вариантах осуществления оптимизированная полинуклеотидная последовательность, кодирующая антитело против KIT, описанное в настоящем описании, или его фрагмент (например, VL-домен и/или VH-домен) может гибридизоваться с антисмысловым (например, комплементарным) полинуклеотидом неоптимизированной полинуклеотидной последовательности, кодирующей антитело против KIT, описанное в настоящем описании, или его фрагмент (например, VL-домен и/или VH-домен). В конкретных вариантах осуществления оптимизированная нуклеотидная последовательность, кодирующая антитело против KIT, описанное в настоящем описании, или его фрагмент гибридизуются в условиях высокой жесткости с антисмысловым полинуклеотидом с неоптимизированной полинуклеотидной последовательностью, кодирующей антитело против KIT, описанное в настоящем описании, или его фрагмент. В конкретном варианте осуществления оптимизированная нуклеотидная последовательность, кодирующая антитело против KIT, описанное в настоящем описании, или его фрагмент гибридизуются в условиях гибридизации высокой жесткости, условиях промежуточной жесткости или в условиях более низкой жесткости с антисмысловым полинуклеотидом с неоптимизированной нуклеотидной последовательностью, кодирующим антитело против KIT, описанное в настоящем описании, или его фрагмент. Информация, касающаяся условий гибридизации, описана, см., например, публикацию патентной заявки США № US 2005/0048549 (например, абзацы 72-73), которая включена в настоящее описание в качестве ссылки.

В определенных вариантах осуществления оптимизированная полинуклеотидная последовательность, кодирующая область VL антитела, описанного в настоящем описании, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 98% идентична нуклеотидной последовательности SEQ ID NO:27, 28, 29 или 30. В определенных вариантах осуществления оптимизированная полинуклеотидная последовательность, кодирующая VH-область антитела, описанного в настоящем описании, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 98% идентична нуклеотидной последовательности SEQ ID NO:22, 23, 24, 25 или 26.

Полинуклеотиды можно получать, и нуклеотидную последовательность полинуклеотидов можно определять, любым способом, известным в данной области. Нуклеотидные последовательности, кодирующие антитела, описанные в настоящем описании, например, антитела, описанные в таблицах 1-6B и на фиг. 3A-3I, и модифицированные версии этих антител, можно определять с использованием способов, хорошо известных в данной области, т.е. нуклеотидные кодоны, о которых известно, что они кодируют конкретные аминокислоты, объединяют таким образом, чтобы получить нуклеиновую кислоту, которая кодирует антитело. Такой полинуклеотид, кодирующий антитело, можно собирать из химически синтезированных олигонуклеотидов (например, как описано в Kutmeier et al., 1994, BioTechniques 17:242), что, в кратком изложении, вовлекает синтез перекрывающихся олигонуклеотидов, содержащих части последовательности, кодирующей антитело, отжиг и лигирование этих олигонуклеотидов, а затем амплификацию лигированных олигонуклеотидов способом ПЦР.

Альтернативно полинуклеотид, кодирующий антитело, описанное в настоящем описании, можно получать из нуклеиновой кислоты из подходящего источника (например, гибридомы) с использованием способов, хорошо известных в данной области (например, ПЦР и другие способы молекулярного клонирования). Например, можно проводить амплификацию способом ПЦР с использованием синтетических праймеров, гибридизующихся с 3'- и 5'-концами известной последовательности, с использованием геномной ДНК, полученной из гибридомных клеток, продуцирующих представляющее интерес антитело. Такие способы амплификации с помощью ПЦР можно использовать для получения нуклеиновых кислот, содержащих последовательность, кодирующую легкую цепь и/или тяжелую цепь антитела. Такие способы амплификации с помощью ПЦР можно использовать для получения нуклеиновых кислот, содержащих последовательность, кодирующую вариабельную область легкой цепи и/или вариабельную область тяжелой цепи антитела. Амплифицированные нуклеиновые кислоты можно клонировать в векторы для экспрессии в клетках-хозяевах и для дальнейшего клонирования, например, для получения химерных и гуманизированных антител.

Если клон, содержащий нуклеиновую кислоту, кодирующую конкретное антитело, недоступен, однако последовательность молекулы антитела известна, нуклеиновую кислоту, кодирующую иммуноглобулин, можно химически синтезировать или получать из подходящего источника (например, библиотека кДНК антител или библиотека кДНК, полученная из, или нуклеиновая кислота, предпочтительно, поли A+ РНК, выделенная из, любой ткани или клеток, экспрессирующих антитело, таких как гибридомные клетки, выбранные для экспрессии антитела, описанного в настоящем описании) путем амплификации способом ПЦР с использованием синтетических праймеров, гибридизующихся с 3'- и 5'-концами последовательности, или путем клонирования с использованием олигонуклеотидного зонда, специфичного к последовательности конкретного гена, для идентификации, например, клона кДНК из библиотеки кДНК, который кодирует антитело. Затем амплифицированные нуклеиновые кислоты, полученные с помощью ПЦР, можно клонировать в реплицирующиеся клонирующие векторы с использованием любого способа, хорошо известного в данной области.

ДНК, кодирующую антитела против KIT, можно без труда выделять и секвенировать с использованием общепринятых методик (например, с использованием олигонуклеотидных зондов, которые способны специфически связываться с генами, кодирующими тяжелую и легкую цепи антител против KIT). В качестве источника такой ДНК могут выступать гибридомные клетки. После выделения ДНК можно помещать в векторы экспрессии, которые затем трансфицируют в клетки-хозяева, такие как клетки E. coli, клетки COS обезьяны, клетки яичника китайского хомячка (CHO) (например, клетки CHO от CHO GS System™ (Lonza)) или клетки миеломы, которые в ином случае не продуцируют белок иммуноглобулина, для обеспечения синтеза антител против KIT в рекомбинантных клетках-хозяевах.

Для получения целых антител можно использовать праймеры для ПЦР, включающие нуклеотидные последовательности VH или VL, участок рестрикции и фланкирующую последовательность для защиты участка рестрикции, чтобы амплифицировать последовательности VH или VL в клонах scFv. С использованием способов клонирования, известных специалистам в данной области, амплифицированные способом ПЦР VH-домены можно клонировать в векторы, экспрессирующие константную область тяжелой цепи, например, константную область гамма 4 человека, и амплифицированные способом ПЦР VL-домены можно клонировать в векторы, экспрессирующие константную область легкой цепи, например, константные области каппа или лямбда человека. В определенных вариантах осуществления векторы для экспрессии VH- или VL-доменов содержат промотор EF-1α, сигнал для секреции, участок для клонирования вариабельного домена, константные домены и селективный маркер, такой как неомицин. VH- и VL-домены также можно клонировать в один вектор, экспрессирующий необходимые константные области. Затем векторы для конверсии тяжелой цепи и векторы для конверсии легкой цепи котрансфицируют в клеточные линии для получения стабильных или временных клеточных линий, которые экспрессируют полноразмерные антитела, например, IgG, с использованием способов, известных специалистам в данной области.

ДНК также можно модифицировать, например, путем замены кодирующей последовательностью константных доменов тяжелой и легкой цепей человека последовательностей мыши, или путем ковалентного связывания с кодирующей последовательностью иммуноглобулина всей или части кодирующей последовательности не являющегося иммуноглобулином полипептида.

Также предусматриваются полинуклеотиды, которые гибридизуются в условиях гибридизации высокой жесткости, условиях промежуточной жесткости или в условиях более низкой жесткости с полинуклеотидами, которые кодируют антитело, описанное в настоящем описании. В конкретных вариантах осуществления полинуклеотиды, описанные в настоящем описании, гибридизуются в условиях гибридизации высокой жесткости, условиях промежуточной жесткости или в условиях более низкой жесткости с полинуклеотидами, кодирующими область VH-цепи (например, SEQ ID NO:2, 3, 4, 5 или 6) и/или область VL-цепи (например, SEQ ID NO:7, 8, 9 или 10), описанными в настоящем описании. В конкретных вариантах осуществления полинуклеотиды, описанные в настоящем описании, гибридизуются в условиях гибридизации высокой жесткости или в условиях промежуточной жесткости с полинуклеотидами, которые комплементарны полинуклеотидам, кодирующим область VH-цепи (например, SEQ ID NO:3 или 5) и/или область VL-цепи (например, SEQ ID NO:2), описанные в настоящем описании.

В конкретных вариантах осуществления полинуклеотиды, описанные в настоящем описании, гибридизуются в условиях гибридизации высокой жесткости, промежуточных условиях или в условиях более низкой жесткости с полинуклеотидами, которые комплементарны полинуклеотиду, содержащему SEQ ID NO:27, 28, 29 или 30, кодирующему VL-домен. В конкретных вариантах осуществления полинуклеотиды, описанные в настоящем описании, гибридизуются в условиях гибридизации высокой жесткости или промежуточных условиях с полинуклеотидами, которые комплементарны полинуклеотиду, содержащему SEQ ID NO:22, 23, 24, 25 или 26, кодирующему VH-домен.

Условия гибридизации описаны в данной области и известны специалисту в данной области. Например, гибридизация в жестких условиях может вовлекать гибридизацию со связанной с фильтром ДНК в 6× хлориде натрия/цитрате натрия (SSC) при приблизительно 45°C, а затем одно или несколько промываний в 0,2×SSC/0,1% SDS при приблизительно 50-65°C; гибридизация в условиях высокой жесткости может вовлекать гибридизацию со связанной с фильтром нуклеиновой кислотой в 6×SSC при приблизительно 45°C, а затем одно или несколько промываний в 0,1×SSC/0,2% SDS при приблизительно 68°C. Гибридизация в других жестких условиях гибридизации известна специалистам в данной области и описана, см., например, Ausubel, F.M. et al., eds., 1989, Current Protocols in Molecular Biology, Vol. I, Green Publishing Associates, Inc. and John Wiley & Sons, Inc., New York at pages 6.3.1-6.3.6 и 2.10.3.

5.3 Клетки-хозяева и рекомбинантная экспрессия антител

В некоторых аспектах, в рамках настоящего изобретения предусматриваются клетки-хозяева, рекомбинантно экспрессирующие антитела, описанные в настоящем описании (или их антигенсвязывающий фрагмент), и соответствующие векторы экспрессии. В рамках настоящего изобретения предусматриваются векторы (например, векторы экспрессии), содержащие полинуклеотиды, содержащие нуклеотидные последовательности, кодирующие антитела против KIT или их фрагмент, для рекомбинантной экспрессии в клетках-хозяевах, предпочтительно, в клетках млекопитающих. Также в рамках настоящего изобретения предусматриваются клетки-хозяева, содержащие такие векторы, для рекомбинантной экспрессии антител против KIT, описанных в настоящем описании (например, антитело человека или гуманизированное антитело). В конкретном аспекте в рамках настоящего изобретения предусматриваются способы получения антитела, описанного в настоящем описании, включающие экспрессию такого антитела в клетке-хозяине.

Рекомбинантная экспрессия антитела, описанного в настоящем описании (например, полноразмерное антитело, тяжелая и/или легкая цепь антитела или одноцепочечное антитело, описанное в настоящем описании), которое иммуноспецифически связывается с антигеном KIT, вовлекает конструирование вектора экспрессии, содержащего полинуклеотид, который кодирует антитело. После получения полинуклеотида, кодирующего молекулу антитела, тяжелую и/или легкую цепь антитела, или их фрагмент (предпочтительно, но не обязательно, содержащие вариабельный домен тяжелой и/или легкой цепи), описанные в настоящем описании, можно получать вектор для продуцирования молекулы антитела с помощью технологии рекомбинантных ДНК с использованием методик, хорошо известных в данной области. Таким образом, в настоящем описании описаны способы получения белка путем экспрессии полинуклеотида, содержащего кодирующую антитело нуклеотидную последовательность. Способы, которые хорошо известны специалистам в данной области, можно использовать для конструирования векторов экспрессии, содержащих кодирующие антитело последовательности и соответствующие сигналы контроля транскрипции и трансляции. Эти способы включают, например, способы рекомбинантных ДНК in vitro, способы синтеза и генетическую рекомбинацию in vivo. Также предусматриваются реплицирующиеся векторы, содержащие нуклеотидную последовательность, кодирующую молекулу антитела, описанную в настоящем описании, тяжелую и легкую цепь антитела, вариабельный домен тяжелой или легкой цепи антитела или его фрагмента, или CDR тяжелой или легкой цепи, функционально связанные с промотором. Такие векторы могут включать, например, нуклеотидную последовательность, кодирующую константную область молекулы антитела (см., например, международные публикации № WO 86/05807 и WO 89/01036; и патент США № 5122464), и в такой вектор можно клонировать вариабельный домен антитела для экспрессии полной тяжелой цепи, полной легкой цепи или как полной тяжелой, так и полной легкой цепей.

Вектор экспрессии можно переносить в клетку (например, клетку-хозяина) общепринятыми способами, а затем полученную клетку можно культивировать общепринятыми способами для получения антитела, описанного в настоящем описании, или его фрагмента. Таким образом, в рамках настоящего изобретения предусматриваются клетки-хозяева, содержащие полинуклеотид, кодирующий антитело, описанное в настоящем описании, или его фрагменты, или его тяжелую или легкую цепь, или его фрагмент, или одноцепочечное антитело, описанное в настоящем описании, функционально связанные с промотором для экспрессии таких последовательностей в клетке-хозяине. В определенных вариантах осуществления для экспрессии двухцепочечных антител, векторы, кодирующие как тяжелые, так и легкие цепи, можно коэкспрессировать в клетке-хозяине, чтобы экспрессировалась вся молекула иммуноглобулина, как подробно описано ниже. В определенных вариантах осуществления клетка-хозяин содержит вектор, содержащий полинуклеотид, кодирующий как тяжелую цепь, так и легкую цепь антитела, описанного в настоящем описании, или его фрагмента. В конкретных вариантах осуществления клетка-хозяин содержит два различных вектора: первый вектор, содержащий полинуклеотид, кодирующий тяжелую цепь антитела, описанного в настоящем описании, или его фрагмента, и второй вектор, содержащий полинуклеотид, кодирующий легкую цепь антитела, описанного в настоящем описании, или его фрагмента. В других вариантах осуществления первая клетка-хозяин содержит первый вектор, содержащий полинуклеотид, кодирующий тяжелую цепь антитела, описанного в настоящем описании, или его фрагмента, и вторая клетка-хозяин содержит второй вектор, содержащий полинуклеотид, кодирующий легкую цепь антитела, описанного в настоящем описании.

Для экспрессии молекул антител, описанных в настоящем описании, можно использовать множество систем хозяин-вектор экспрессии (см., например, патент США № 5807715). Такие системы хозяин-вектор экспрессии представляют собой носители, посредством которых представляющие интерес кодирующие последовательности можно получать, а затем очищать, а также представляют собой клетки, которые, когда они трансформированы или трансфицированы соответствующими нуклеотидными кодирующими последовательностями, экспрессируют молекулу антитела, описанную в настоящем описании, in situ. Они включают, но ими не ограничиваются, микроорганизмы, такие как бактерии (например, E. coli и B. subtilis), трансформированные векторами экспрессии с рекомбинантной ДНК бактериофага, плазмидной ДНК или космидной ДНК, содержащими кодирующие антитело последовательности; дрожжи (например, Saccharomyces Pichia), трансформированные рекомбинантными векторами экспрессии дрожжей, содержащими кодирующие антитело последовательности; клеточные системы насекомых, инфицированные рекомбинантными вирусными векторами экспрессии (например, бакуловирус), содержащими кодирующие антитело последовательности; системы клеток растений (например, зеленые водоросли, такие как Chlamydomonas reinhardtii), инфицированные рекомбинантными вирусными векторами экспрессии (например, вирус мозаики цветной капусты, CaMV; вирус табачной мозаики, TMV) или трансформированные рекомбинантными плазмидными векторами экспрессии (например, плазмида Ti), содержащими кодирующие антитело последовательности; или клеточные системы млекопитающих (например, клетки COS, CHO, BHK, MDCK, HEK 293, NS0, PER.C6, VERO, CRL7O3O, HsS78Bst, HeLa и NIH 3T3), содержащие рекомбинантные экспрессирующие конструкции, содержащие промоторы, происходящие из генома клеток млекопитающих (например, промотор металлотеонеина) или из вирусов млекопитающих (например, поздний промотор аденовируса; промотор вируса осповакцины 7.5K). В конкретном варианте осуществления клетки для экспрессии антител, описанных в настоящем описании (например, Hum1-Hum20), или их антигенсвязывающего фрагмента представляют собой клетки CHO, например, клетки CHO из CHO GS System™ (Lonza). В конкретном варианте осуществления вектор экспрессии млекопитающих представляет собой pOptiVEC™ или pcDNA3.3. Предпочтительно, для экспрессии рекомбинантной молекулы антитела используют бактериальные клетки, такие как Escherichia coli, и более предпочтительно, эукариотические клетки, особенно для экспрессии целой рекомбинантной молекулы антитела. Например, клетки млекопитающих, такие как клетки яичника китайского хомячка (CHO), вместе с вектором, таким как основной предранний промоторный элемент гена из цитомегаловируса человека, являются эффективной экспрессирующей системой для антител (Foecking et al., 1986, Gene 45:101; и Cockett et al., 1990, Bio/Technology 8:2). В определенных вариантах осуществления антитела, описанные в настоящем описании, продуцируются клетками CHO или клетками NS0. В конкретном варианте осуществления экспрессия нуклеотидных последовательностей, кодирующих антитела, описанные в настоящем описании, которые иммуноспецифически связываются с антигеном KIT, регулируется конститутивным промотором, индуцибельным промотором или тканеспецифическим промотором.

В бактериальных системах ряд векторов экспрессии можно преимущественно выбирать в зависимости от предполагаемого применения экспрессируемой молекулы антитела. Например, когда намереваются получить большое количество такого антитела, для получения фармацевтических композиций молекулы антитела могут быть желательными векторы, которые обеспечивают экспрессию высоких уровней слитых белковых продуктов, которые легко очищать. Такие векторы включают, но ими не ограничиваются, вектор экспрессии pUR278 E. coli (Ruther et al., 1983, EMBO 12:1791), в котором кодирующая последовательность антитела может быть индивидуально лигирована в вектор в рамке считывания с кодирующей областью lac Z, чтобы продуцировался слитый белок; векторы pIN (Inouye & Inouye, 1985, Nucleic Acids Res. 13:3101-3109; Van Heeke & Schuster, 1989, J. Biol. Chem. 24:5503-5509) и т.п. Также можно использовать векторы pGEX для экспрессии чужеродных полипептидов в качестве слитых белков с глутатион-5-трансферазой (GST). Как правило, такие слитые белки являются растворимыми и их можно без труда очищать из лизированных клеток путем адсорбции и связывания с гранулами матрикса из глутатион-агарозы с последующим элюированием в присутствии свободного глутатиона. Векторы pGEX конструируют так, чтобы они включали участки расщепления тромбином или фактором Xa, чтобы клонированный продукт гена-мишени мог освобождаться от GST-части.

В системе насекомых вирус ядерного полиэдроза Autographa californica (AcNPV) используют в качестве вектора для экспрессии чужеродных генов. Вирус растет в клетках Spodoptera frugiperda. Кодирующую антитело последовательность можно клонировать отдельно в не являющимися необходимыми области (например, ген полиэдрина) вируса и помещать под контроль промотора AcNPV (например, промотор полиэдрина).

В клетках-хозяевах млекопитающих можно использовать ряд вирусных экспрессирующих систем. В случаях, когда в качестве вектора экспрессии используют аденовирус, представляющую интерес кодирующую антитело последовательность можно лигировать с комплексом контроля транскрипции/трансляции аденовируса, например, поздним промотором и трехчленной лидерной последовательностью. Затем этот химерный ген можно встраивать в геном аденовируса посредством рекомбинации in vitro или in vivo. Встраивание в не являющуюся необходимой область вирусного генома (например, область El или E3) приводит к рекомбинантному вирусу, который является жизнеспособным и способен экспрессировать молекулу антитела в инфицированных хозяевах (например, см. Logan & Shenk, 1984, Proc. Natl. Acad. Sci. USA 8 1:355-359). Также для эффективной трансляции встроенных кодирующих последовательностей антител могут потребоваться конкретные сигналы инициации. Эти сигналы включают кодон инициации ATG и соседние последовательности. Более того, кодон инициации должен находиться в рамке считывания с рамкой считывания желаемой кодирующей последовательностью для обеспечения трансляции всей вставки. Эти экзогенные сигналы контроля трансляции и кодоны инициации могут иметь различное происхождение, как природное, так и синтетическое. Эффективность экспрессии можно усиливать путем включения соответствующих энхансерных элементов транскрипции, терминаторов транскрипции и т.д. (см., например, Bittner et al., 1987, Methods in Enzymol. 153:51-544).

Кроме того, можно выбирать штамм клетки-хозяина, который модулирует экспрессию встроенных последовательностей или модифицирует и процессирует продукт гена конкретным желаемым образом. Такие модификации (например, гликозилирование) и процессинг (например, расщепление) белковых продуктов могут быть важными для функционирования белка. Различные клетки-хозяева имеют характерные и специфические механизмы посттрансляционного процессинга и модификации белков и продуктов генов. Для обеспечения правильной модификации и процессинга чужеродного экспрессируемого белка можно выбирать подходящие клеточные линии или системы хозяев. Для этого можно использовать эукариотические клетки-хозяева, которые обладают клеточным аппаратом для надлежащего процессинга первичного транскрипта, гликозилирования и фосфорилирования продукта гена. Такие клетки-хозяева млекопитающих включают, но ими не ограничиваются, клетки CHO, VERO, BHK, Hela, COS, MDCK, HEK 293, NIH 3T3, W138, BT483, Hs578T, HTB2, BT2O и T47D, NS0 (клеточная линия миеломы мыши, которая не продуцирует эндогенно каких-либо цепей иммуноглобулинов), CRL7O3O и HsS78Bst. В определенных вариантах осуществления гуманизированные моноклональные антитела против KIT, описанные в настоящем описании, продуцируются в клетках млекопитающих, таких как клетки CHO.

Для длительной продукции рекомбинантных белков с высоким выходом является предпочтительной стабильная экспрессия. Например, можно способами инженерии создавать клеточные линии, которые стабильно экспрессируют молекулу антитела. Вместо использования векторов экспрессии, которые содержат вирусные ориджины репликации, клетки-хозяева можно трансформировать ДНК, контролируемой соответствующими элементами контроля экспрессии (например, промоторные, энхансерные последовательности, терминаторы транскрипции, участки полиаденилирования и т.д.) и селективным маркером. После введения чужеродной ДНК модифицированным способами инженерии клеткам позволяют расти в течение 1-2 суток в обогащенной среде, а затем переключают на селективную среду. Селективный маркер в рекомбинантной плазмиде сообщает устойчивость к средству селекции и позволяет клеткам стабильно встраивать плазмиду в их хромосомы и расти с образованием очагов, которые в свою очередь можно клонировать и увеличивать в количестве в клеточные линии. Такой способ можно преимущественно использовать для получения способами инженерии клеточных линий, которые экспрессируют молекулу антитела. Такие модифицированные способами инженерии клеточные линии могут быть особенно пригодными для скрининга и оценки композиций, которые взаимодействуют прямо или непрямо с молекулой антитела.

Можно использовать ряд селекционных систем, включая, но ими не ограничиваясь, гены тимидинкиназы вируса простого герпеса (Wigler et al., 1977, Cell 11:223), гипоксантингуанинфосфорибозилтрансферазы (Szybalska & Szybalski, 1992, Proc. Natl. Acad. Sci. USA 48:202) и аденинфосфорибозилтрансферазы (Lowy et al., 1980, Cell 22:8-17), которые можно использовать в клетках tk-, hgprt- или aprt-, соответственно. Также можно использовать устойчивость к антиметаболитам в качестве основы для селекции по следующим генам: dhfr, который сообщает устойчивость к метотрексату (Wigler et al., 1980, Natl. Acad. Sci. USA 77:357; O’Hare et al., 1981, Proc. Natl. Acad. Sci. USA 78:1527); gpt, который сообщает устойчивость к микофеноловой кислоте (Mulligan & Berg, 1981, Proc. Natl. Acad. Sci. USA 78:2072); neo, который сообщает устойчивость к аминогликозиду G-418 (Wu и Wu, 1991, Biotherapy 3:87-95; Tolstoshev, 1993, Ann. Rev. Pharmacol. Toxicol. 32:573-596; Mulligan, 1993, Science 260:926-932; и Morgan and Anderson, 1993, Ann. Rev. Biochem. 62:191-217; May, 1993, TIB TECH 11(5):l55-2 15); и hygro, который сообщает устойчивость к гигромицину (Santerre et al., 1984, Gene 30:147). Для селекции желаемого рекомбинантного клона можно обычным путем использовать способы, широко известные в области технологии рекомбинантных ДНК, и такие способы описаны, например, в Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990); и Chapters 12 and 13, Dracopoli et al. (eds.), Current Protocols in Human Genetics, John Wiley & Sons, NY (1994); Colberre-Garapin et al., 1981, J. Mol. Biol. 150:1, которые включены в настоящее описание в качестве ссылок в полном объеме.

Уровни экспрессии молекулы антитела можно увеличивать посредством амплификации вектора (для обзора см. Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987)). Когда маркер в векторной системе, экспрессирующей антитела, является амплифицируемым, увеличение уровня ингибитора, присутствующего в культуре клетки-хозяина, будет увеличивать количество копий маркерного гена. Поскольку амплифицированная область связана с геном антитела, продукция антитела также будет возрастать (Crouse et al., 1983, Mol. Cell. Biol. 3:257).

Клетку-хозяина также можно котрансфицировать двумя или более векторами экспрессии, описанными в настоящем описании: первый вектор, кодирующий происходящий из тяжелой цепи полипептид, и второй вектор, кодирующий происходящий из легкой цепи полипептид. Эти два вектора могут содержать идентичные селективные маркеры, которые обеспечивают равную экспрессию полипептидов тяжелой и легкой цепей. Клетки-хозяева также можно котрансфицировать различными количествами двух или более векторов экспрессии. Например, клетки-хозяева можно трансфицировать любым из следующих соотношений первого вектора экспрессии и второго вектора экспрессии: 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:12, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45 или 1:50.

Альтернативно можно использовать один вектор, который кодирует и способен экспрессировать как полипептиды тяжелой цепи, так и полипептиды легкой цепи. В таких ситуациях легкую цепь необходимо помещать перед тяжелой цепью, чтобы избежать избытка токсичной свободной тяжелой цепи (Proudfoot, 1986, Nature 322:52; и Kohler, 1980, Proc. Natl. Acad. Sci. USA 77:2197-2199). Кодирующие последовательности для тяжелой и легкой цепей могут содержать кДНК или геномную ДНК. Вектор экспрессии может быть моноцистронным или полицистронным. Полицистронная конструкция нуклеиновой кислоты может кодировать 2, 3, 4, 5, 6, 7, 8, 9, 10 или более, или в диапазоне 2-5, 5-10 или 10-20 генов/нуклеотидных последовательностей. Например, бицистроная конструкция нуклеиновой кислоты может содержать в указанном порядке промотор, первый ген (например, тяжелая цепь антитела, описанного в настоящем описании) и второй ген (например, легкая цепь антитела, описанного в настоящем описании). В таком векторе экспрессии транскрипция обоих генов может запускаться промотором, в то время как трансляция мРНК с первого гена может осуществляться по механизму кэп-зависимого сканирования, и трансляция мРНК со второго гена может осуществляться по кэп-независимому механизму, например, посредством IRES.

После продуцирования молекулы антитела, описанной в настоящем описании, способом рекомбинантной экспрессии, ее можно очищать любым способом, известным в данной области для очистки молекулы иммуноглобулина, например, хроматографией (например, ионообменная, аффинная, в частности, по аффинности к специфическому антигену после белка A и эксклюзионная колоночная хроматография), центрифугированием, способом дифференциальной растворимости или любым другим стандартным способом очистки белков. Кроме того, антитела, описанные в настоящем описании, можно подвергать слиянию с гетерологичными полипептидными последовательностями, описанными в настоящем описании или в ином случае известными в данной области, для облегчения очистки.

В конкретных вариантах осуществления антитело, описанное в настоящем описании, является выделенным или очищенным. Как правило, выделенное антитело представляет собой антитело, которое по существу свободно от других антител с антигенной специфичностью, отличной от антигенной специфичности выделенного антитела. Например, в конкретном варианте осуществления препарат антитела, описанного в настоящем описании, по существу свободен от клеточного материала и/или химических предшественников. Формулировка "по существу свободен от клеточного материала" включает препараты антитела, в которых антитело отделено от компонентов клеток, из которых оно выделено или в которых оно рекомбинантно продуцировано. Таким образом, антитело, которое по существу свободно от клеточного материала, включает препараты антитела, имеющие менее чем приблизительно 30%, 20%, 10%, 5%, 2%, 1%, 0,5% или 0,1% (по массе сухого вещества) гетерологичного белка (также обозначаемого в настоящем описании как "контаминирующий белок") и/или вариантов антитела, например, различных посттрансляционно модифицированных форм антитела или других отличающихся версий антитела (например, фрагментов антитела). Когда антитело получают рекомбинантными способами, оно также обычно по существу свободно от культуральной среды, т.е. культуральная среда составляет менее чем приблизительно 20%, 10%, 2%, 1%, 0,5% или 0,1% от объема препарата белка. Когда антитело получают химическим синтезом, оно обычно по существу свободно от химических предшественников или других химических веществ, т.е. отделено от химических предшественников или других химических веществ, которые вовлечены в синтез белка. Таким образом, такие препараты антитела имеют менее чем приблизительно 30%, 20%, 10% или 5% (по массе сухого вещества) химических предшественников или соединений, отличных от представляющего интерес антитела. В конкретном варианте осуществления антитела, описанные в настоящем описании, являются выделенными или очищенными.

5.4. Способы получения антител

Антитела (например, антитела человека или гуманизированные антитела), описанные в настоящем описании (или их антигенсвязывающий фрагмент), которые иммуноспецифически связываются с антигеном KIT, можно получать любым способом синтеза антител, известным в данной области, например, способами химического синтеза или рекомбинантной экспрессии. В способах, описанных в настоящем описании, используются, если нет иных указаний, общепринятые способы молекулярной биологии, микробиологии, генетического анализа, рекомбинантных ДНК, органической химии, биохимии, ПЦР, синтеза и модификации олигонуклеотидов, гибридизации нуклеиновых кислот и сходных областей в данной области. Эти способы описаны в ссылках, цитированных в настоящем описании, и полностью объяснены в литературе. См., например, Maniatis et al. (1982) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; Sambrook et al. (1989), Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press; Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons (1987 and annual updates); Current Protocols in Immunology, John Wiley & Sons (1987 and annual updates) Gait (ed.) (1984) Oligonucleotide Synthesis: A Practical Approach, IRL Press; Eckstein (ed.) (1991) Oligonucleotides and Analogues: A Practical Approach, IRL Press; Birren et al. (eds.) (1999) Genome Analysis: A Laboratory Manual, Cold Spring Harbor Laboratory Press.

Например, гуманизированные антитела можно получать с использованием различных способов, известных в данной области, включая, но ими не ограничиваясь, пересадку CDR (патент Европы № EP 239400; международная публикация № WO 91/09967; и патенты США No. 5225539, 5530101 и 5585089), гиперхимеризацию или восстановление поверхности (патенты Европы № EP 592106 и EP 519596; Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7(6):805-814; и Roguska et al., 1994, PNAS 91:969-973), шаффлинг цепей (патент США № 5565332), и способы, описанные, например, в патенте США № 6407213, патенте США № 5766886, WO 9317105, Tan et al., J. Immunol. 169:1119 25 (2002), Caldas et al., Protein Eng. 13(5):353-60 (2000), Morea et al., Methods 20(3):267 79 (2000), Baca et al., J. Biol. Chem. 272(16):10678-84 (1997), Roguska et al., Protein Eng. 9(10):895 904 (1996), Couto et al., Cancer Res. 55 (23 Supp):5973s- 5977s (1995), Couto et al., Cancer Res. 55(8):1717-22 (1995), Sandhu JS, Gene 150(2):409-10 (1994), и Pedersen et al., J. Mol. Biol. 235(3):959-73 (1994). Также см публикацию патента США № US 2005/0042664 A1 (Feb. 24, 2005), которая включена в настоящее описание в качестве ссылки.

В конкретных аспектах гуманизированное антитело способно связываться с заданным антигеном и содержит каркасную область, по существу имеющую аминокислотную последовательность иммуноглобулина человека и CDR, по существу имеющих аминокислотную последовательность не являющегося человеческим иммуноглобулина (например, иммуноглобулина мыши). В конкретных вариантах осуществления гуманизированное антитело также содержит по меньшей мере часть константной области иммуноглобулина (Fc), как правило, часть константной области иммуноглобулина человека. Антитело также может включать CH1, шарнирную область, области CH2, CH3 и CH4 тяжелой цепи. Гуманизированное антитело можно выбирать из любого класса иммуноглобулинов, включая IgM, IgG, IgD, IgA и IgE, и любого изотипа, включая IgG1, IgG2, IgG3 и IgG4.

Моноклональные антитела можно получать с использованием широкого множества способов, известных в данной области, включая использование гибридом, рекомбинантные технологии и технологии фагового дисплея, или их комбинацию. Например, моноклональные антитела можно получать с использованием способов гибридом, включающих способы, известные в данной области и описанные, например, в Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al.: Monoclonal Antibodies and T-Cell Hybridomas, 563 681 (Elsevier, N.Y., 1981). Термин "моноклональное антитело", как используют в рамках изобретения, не ограничивается антителами, продуцируемыми с помощью технологии гибридом. Например, моноклональные антитела можно получать с помощью рекомбинантной технологии, например, рекомбинантных моноклональных антител, экспрессируемых клеткой-хозяином, такой как клетка-хозяин млекопитающих.

Способы получения и скрининга конкретных антител с использованием технологии гибридом являются общепринятыми и хорошо известны в данной области. Например, в способе гибридом мышь или другого подходящего животного-хозяина, такого как овцу, козу, кролика, крысу, хомяка или макака, иммунизируют для индукции лимфоцитов, которые продуцируют или способны продуцировать антитела, которые специфически связываются с белком (например, областью D4 KIT человека), используемым для иммунизации. Альтернативно лимфоциты можно иммунизировать in vitro. Затем лимфоциты подвергают слиянию с клетками миеломы с использованием подходящего средства для слияния, такого как полиэтиленгликоль, для формирования гибридомной клетки (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986)). Кроме того, для иммунизации можно использовать способ RIMMS (повторяющая иммунизация множества областей) (Kilptrack et al., 1997, Hybridoma, 16:381-9, которая включена в настоящее описание в качестве ссылки).

Неограничивающие примеры клеточных линий миеломы включают линии миеломы мыши, такие как линии, происходящие из опухолей мыши MOPC-21 и MPC-11, доступные от Salk Institute Cell Distribution Center, San Diego, CA, USA, и клетки SP-2 или X63-Ag8.653, доступные от American Type Culture Collection, Rockville, MD, USA. Также для продукции моноклональных антител человека описаны миеломные клеточные линии и линии гетеромиеломы мыши-человека Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).

Антитела, описанные в настоящем описании, включают фрагменты антител, которые распознают специфические антигены KIT, и их можно получать любым способом, известным специалистам в данной области. Например, фрагменты Fab и F(ab')2, описанные в настоящем описании, можно получать путем протеолитического расщепления молекул иммуноглобулинов с использованием ферментов, таких как папаин (для получения Fab-фрагментов) или пепсин (для получения F(ab')2-фрагментов). Fab-фрагмент соответствует одному из двух идентичных плеч молекулы антитела и содержит полную легкую цепь в паре с доменами VH и CH1 тяжелой цепи. Фрагмент F(ab')2 содержит два антигенсвязывающих плеча молекулы антитела, связанных дисульфидными связями в шарнирной области.

В одном из аспектов для получения целых антител можно использовать праймеры для ПЦР, включающие нуклеотидные последовательности VH или VL, участок рестрикции и фланкирующую последовательность для защиты участка рестрикции, чтобы амплифицировать последовательности VH или VL с матрицы, например, клонов scFv. C использованием способов клонирования, известных специалистам в данной области, амплифицированные способом ПЦР VH-домены можно клонировать в векторы, экспрессирующие константную область VH, и амплифицированные способом ПЦР VL-домены можно клонировать в векторы, экспрессирующие константную область VL, например, константные области каппа или лямбда человека. VH- и VL-домены также можно клонировать в один вектор, экспрессирующий необходимые константные области. Затем клеточные линии котрансфицируют векторами для конверсии тяжелой цепи и векторами для конверсии легкой цепи, чтобы получить стабильные или временные клеточные линии, которые экспрессируют полноразмерные антитела, например, IgG, с использованием способов, известных специалистам в данной области.

Однодоменные антитела, например, антитела, лишенные легких цепей, можно получать способами, хорошо известными в данной области. См. Riechmann et al., 1999, J. Immunol. 231:25-38; Nuttall et al., 2000, Curr. Pharm. Biotechnol. 1(3):253-263; Muylderman, 2001, J. Biotechnol. 74(4):277302; патент США № 6005079; и международные публикации № WO 94/04678, WO 94/25591 и WO 01/44301.

В некоторых аспектах антитела, описанные в настоящем описании, такие как гетероконъюгатные антитела, одноцепочечные антитела и биспецифические антитела, можно получать с помощью рекомбинантной технологии, известной в данной области. Например, клетки-хозяева млекопитающих, содержащие векторы, экспрессирующие антитело, описанное в настоящем описании, культивируют в условиях, пригодных для продукции антитела.

Кроме того, антитела, которые иммуноспецифически связываются с антигеном KIT, можно в свою очередь использовать для получения антиидиотипических антител, которые "имитируют" антиген, с использованием способов, хорошо известных специалистам в данной области. (См., например, Greenspan & Bona, 1989, FASEB J. 7(5):437-444; и Nissinoff, 1991, J. Immunol. 147(8):2429-2438).

5.5 Фармацевтические композиции и наборы

В рамках настоящего изобретения предусматриваются композиции, фармацевтические композиции и наборы, содержащие одно или несколько антител (например, гуманизированных антител), описанных в настоящем описании, или их антигенсвязывающие фрагменты, или их конъюгаты. В конкретных аспектах композиции, описанные в настоящем описании, могут быть предназначены для применений in vitro, in vivo или ex vivo. В конкретных вариантах осуществления в рамках настоящего изобретения предусматривается фармацевтическая композиция, содержащая антитело (например, гуманизированное антитело), описанное в настоящем описании (или его антигенсвязывающий фрагмент), и фармацевтически приемлемый носитель или эксципиент.

Как используется в рамках изобретения, термин "фармацевтически приемлемый" означает одобренный регуляторным органом федерального правительства или правительства штата или приведенный в фармакопее США, фармакопее Европы или других общепризнанных фармакопеях для применения у животных, и более конкретно у человека.

Терапевтические составы, содержащие одно или несколько антител (например, гуманизированных антител), описанных в настоящем описании, можно получать для хранения путем смешения антитела, имеющего желаемого степень чистоты, с необязательными физиологически приемлемыми носителями, эксципиентами или стабилизаторами (Remington’s Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA; Remington: The Science and Practice of Pharmacy, 21st ed. (2006) Lippincott Williams & Wilkins, Baltimore, MD), в форме лиофилизированных составов или водных растворов. Приемлемые носители, эксципиенты или стабилизаторы являются нетоксичными для реципиентов в используемых дозировках и концентрациях и включают буферы, такие как фосфат, цитрат и другие органические кислоты; и/или неионные поверхностно-активные вещества, такие как TWEEN™, PLURONICS™ или полиэтиленгликоль (PEG).

Составы, такие как составы, описанные в настоящем описании, также могут содержать более одного активного соединения (например, молекул, например, антитела или антител, описанных в настоящем описании) при необходимости для конкретного подвергаемого лечению показания. В определенных вариантах осуществления составы включают антитело, описанное в настоящем описании, и одно или несколько активных соединений с дополняющими видами активности, которые не оказывают неблагоприятного влияния друг на друга. Такие составы соответственно присутствуют в комбинации в количествах, которые являются эффективными для предполагаемой цели. Например, антитело, описанное в настоящем описании, можно получать с одним или несколькими другими лекарственными средствами (например, ингибитором тирозинкиназы, таким как иматиниба мезилат или сунитиниб, или ингибитором деацетилазы гистонов, таким как вориностат). Такую комбинированную терапию можно проводить у пациента сериями, или одновременно, или последовательно.

Составы, предназначенные для применения для введения in vivo, могут быть стерильными. Это легко осуществить фильтрацией, например, через стерильные фильтрующие мембраны.

В конкретных аспектах фармацевтические композиции, описанные в настоящем описании, содержат терапевтически эффективные количества одного или нескольких антител (например, гуманизированных антител), описанных в настоящем описании, и необязательно одно или несколько дополнительных профилактических или терапевтических средств, в фармацевтически приемлемом носителе. Такие фармацевтические композиции подходят для предупреждения, лечения, контроля за или смягчения связанного с KIT нарушения или заболевания, такого как злокачественная опухоль (например, GIST) или воспалительное заболевание кишечника, или один или несколько его симптомов.

Фармацевтические носители, пригодные для введения антител, описанных в настоящем описании, включают любые такие носители, известные специалистам в данной области тем, что они являются пригодными для конкретного способа введения.

Кроме того, антитела, описанные в настоящем описании, можно составлять в качестве единственного фармацевтически активного ингредиента в композиции или их можно комбинировать с другими активными ингредиентами (такими как одно или несколько других профилактических или терапевтических средств).

Композиции могут содержать одно или несколько антител, описанных в настоящем описании. В одном из вариантов осуществления антитела составляют в виде подходящих фармацевтических препаратов, таких как растворы, суспензии, таблетки, диспергируемые таблетки, пилюли, капсулы, порошки, составы с замедленным высвобождением или эликсиры, для перорального введения или в стерильных растворах или суспензиях для парентерального введения, а также в виде препарата трансдермального пластыря и ингаляторов сухого порошка.

В композициях одно или несколько антител, описанных в настоящем описании (или их конъюгатов) смешивают с подходящим фармацевтическим носителем. Концентрации антитела или антител в композициях, например, могут быть эффективными для доставки при введении в количестве, которое лечит, предупреждает или смягчает связанное с KIT нарушение или заболевание, или его симптом. В конкретных вариантах осуществления концентрации конъюгата антитело-лекарственное средство или конъюгатов антитело-лекарственное средство в композициях могут, например, быть эффективными для доставки при введении количества лекарственного средства(средств), которое осуществляет лечение, предупреждение или смягчение связанного с KIT нарушения или заболевания, или их симптома.

В одном из вариантов осуществления композиции составляют для введения однократной дозировки. Для составления композиции весовую часть соединения растворяют, суспендируют, диспергируют или иным образом смешивают в выбранном носителе в эффективной концентрации, так чтобы подвергаемое лечению состояние смягчалось, предупреждалось, или один или несколько симптомов смягчались.

В некоторых аспектах антитело (например, гуманизированное антитело), описанное в настоящем описании (или конъюгат антитело-лекарственное средство) включено в фармацевтически приемлемый носитель в эффективном количестве, достаточном для того, чтобы проявлять терапевтически полезный эффект в отсутствие, или с минимальными или незначительными, нежелательными побочными эффектами на подвергаемого лечению пациента. Терапевтически эффективную концентрацию можно определять эмпирически путем исследования соединений в системах in vitro и in vivo с использованием общепринятых способов, а затем экстраполировать их в дозировки для человека.

Концентрация антитела в фармацевтической композиции зависит, например, от физико-химических характеристик антитела, схемы дозирования и вводимого количества, а также от других факторов, известных специалистам в данной области. В некоторых аспектах концентрация конъюгата антитело-лекарственное средство в фармацевтической композиции зависит, например, от физико-химических характеристик антитела и/или лекарственного средства, схемы дозирования и вводимого количества, а также от других факторов, известных специалистам в данной области.

В одном из вариантов осуществления терапевтически эффективная дозировка обеспечивает концентрацию антитела в сыворотке от приблизительно 0,1 нг/мл до приблизительно 50-100 нг/мл. В другом варианте осуществления фармацевтические композиции обеспечивают дозировку от приблизительно 0,001 мг до приблизительно 2000 мг антитела на килограмм массы тела для введения в течение периода времени, например, каждые сутки, каждую неделю, каждые 2 недели или каждые 3 недели. Фармацевтические единичные дозированные формы можно получать для обеспечения от приблизительно 0,01 мг до приблизительно 2000 мг, и В одном из вариантов осуществления от приблизительно 10 мг до приблизительно 500 мг антитела и/или комбинации других необязательных необходимых ингредиентов на единичную дозированную форму.

В конкретном варианте осуществления конъюгат антитело-лекарственное средство, описанный в настоящем описании, вводят в эффективной дозировке приблизительно от 1 до 100 мг конъюгата антитело-лекарственное средство на килограмм массы тела для введения в течение периода времени, например, каждые сутки, каждую неделю, каждые 2 недели или каждые 3 недели.

Антитело можно вводить за один раз или его можно разделять на ряд меньших доз, подлежащих введению с интервалами. Понятно, что точная дозировка и длительность лечения зависят от подвергаемого лечению заболевания, и их можно определять эмпирически с использованием известных протоколов исследования или путем экстраполирования из данных исследований in vivo или in vitro. Следует отметить, что концентрации и уровни дозировок также могут варьировать в зависимости от тяжести состояния, подвергаемого смягчению. Кроме того, следует понимать, что для любого конкретного индивидуума конкретные режимы дозирования можно корректировать с течением времени в соответствии с потребностями индивидуума и профессиональным мнением лица, осуществляющего введение или контролирующего введение композиции, и что диапазоны концентрации, указанные в настоящем описании, являются только иллюстративными и не предназначены для ограничения объема или практики заявленных композиций.

При смешении или добавлении антитела конечная смесь может представлять собой раствор, суспензию, эмульсию и т.п. Форма полученной смеси зависит от ряда факторов, включая предполагаемый способ введения и растворимость соединения в выбранном носителе или наполнителе. Эффективная концентрация является достаточной для смягчения симптомов подвергаемого лечению заболевания, нарушения или состояния, и она может быть определена эмпирически.

Предусматриваются фармацевтические композиции для введения человеку и животным в единичных дозированных формах, таких как стерильные парентеральные (например, внутривенные) растворы или суспензии, содержащие подходящие количества соединений или их фармацевтически приемлемых производных. Также предусматриваются фармацевтические композиции для введения человеку и животным в единичной дозированной форме, такой как таблетки, капсулы, пилюли, порошки, гранулы и пероральные растворы или суспензии, и эмульсии типа "масло-в-воде", содержащие подходящие количества соединений или их фармацевтически приемлемых производных. В одном из вариантов осуществления антитело составляют и вводят в единичных дозированных формах или формах для многократного дозирования. Единичные дозированные формы, как используют в рамках изобретения, относятся к физически дискретным единицам, пригодным для человека и животных и упакованным по отдельности, как известно в данной области. Каждая единичная доза содержит заданное количество антитела, достаточное для обеспечения желаемого терапевтического эффекта, вместе с требуемым фармацевтическим носителем, наполнителем или разбавителем. Примеры единичных дозированных форм включат ампулы и шприцы и упакованные по отдельности таблетки или капсулы. Единичные дозированные формы можно вводить частями или во множестве. Форма для многократного дозирования представляет собой множество идентичных единичных дозированных форм, упакованных в одном контейнере для введения в сегрегированной единичной дозированной форме. Примеры форм для многократного дозирования включают флаконы, бутылки с таблетками или капсулами, или бутылки с пинтами или галлонами формы. Таким образом, форма для многократного дозирования представляет собой множество единичных дозировок, которые не сегрегированы в упаковке.

В определенных вариантах осуществления одно или несколько антител против KIT, описанных в настоящем описании, находятся в жидком фармацевтическом составе. Жидкие фармацевтически вводимые композиции можно получать, например, путем растворения, диспергирования или иного смешения активного соединения, как определено выше, и необязательных фармацевтических адъювантов в носителе, например, таком как вода, солевой раствор, водный раствор декстрозы, глицерин, гликоли, этанол и т.п., чтобы тем самым получить раствор или суспензию. Если желательно фармацевтическая композиция, подлежащая введению, также может содержать небольшие количества нетоксичных вспомогательных веществ, таких как смачивающие вещества, эмульгаторы, солюбилизаторы и pH-буферные средства и т.п.

Фактические способы получения таких дозированных форм известны или будут поняты специалисту в данной области; например, см Remington’s Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA; Remington: The Science and Practice of Pharmacy, 21st ed. (2006) Lippincott Williams & Wilkins, Baltimore, MD.

Можно получать дозированные формы или композиции, содержащие антитело в диапазоне от 0,005% до 100% и остальную часть в виде нетоксичного носителя. Способы получения этих композиций известны специалистам в данной области.

Также в рамках настоящего изобретения предусматривается парентеральное введение, в одном из вариантов осуществления характеризующееся инъекцией подкожно, внутримышечно или внутривенно. Составы для инъекций можно получать в виде общепринятых форм, либо в качестве жидких растворов или суспензий твердых форм, пригодных для растворения или суспендирования в жидкости перед инъекцией, либо в качестве эмульсий. Составы для инъекций, растворы и эмульсии также содержат один или несколько эксципиентов. Пригодными эксципиентами являются, например, вода, солевой раствор, декстроза, глицерин или этанол. Кроме того, если желательно, фармацевтические композиции, подлежащие введению, также могут содержать небольшие количества вспомогательных веществ, таких как смачивающие вещества или эмульгаторы, pH-буферные средства, стабилизаторы, усилители растворимости и другие такие средства. Другие пути введения могут включать энтеральное введение, интрацеребральное введение, назальное введение, внутриартериальное введение, внутрисердечное введение, внутрикостное введение, интратекальное введение и внутрибрюшинное введение.

Препараты для парентерального введения включают стерильные растворы, готовые для инъекции, стерильные сухие растворимые продукты, такие как лиофилизированные порошки, готовые для комбинирования с растворителем непосредственно перед применением, включая гиподермальные таблетки, стерильные суспензии, готовые для инъекции, стерильные сухие нерастворимые продукты, готовые для объединения с носителем непосредственно перед применением, и стерильные эмульсии. Растворы могут быть либо водными, либо неводными.

При внутривенном введении пригодные носители включают физиологический солевой раствор или фосфатно-солевой буфер (PBS), и растворы, содержащие загустители и солюбилизаторы, такие как глюкоза, полиэтиленгликоль и полипропиленгликоль и их смеси.

Фармацевтически приемлемые носители, используемые для парентеральных препаратов, включают водные носители, неводные носители, противомикробные средства, обеспечивающие изотоничность средства, буферы, антиоксиданты, местные анестетики, суспендирующие и диспергирующие средства, эмульгаторы, секвестранты или хелатирующие средства и другие фармацевтически приемлемые вещества.

Фармацевтические носители также включают этиловый спирт, полиэтиленгликоль и пропиленгликоль для смешивающихся с водой носителей; и гидроксид натрия, хлористоводородную кислоту, лимонную кислоту или молочную кислоту для коррекции pH.

Иллюстративно, внутривенная или внутриартериальная инфузия стерильного водного раствора, содержащего активное соединение, является эффективным способом введения. Другой вариант осуществления представляет собой стерильный водный или масляный раствор или суспензия, содержащие активный материал, инъецируемый при необходимости для обеспечения желаемого фармакологического эффекта.

Антитело можно суспендировать в микронизированной или другой подходящей форме. Форма полученной смеси зависит от ряда факторов, включая предполагаемый способ введения и растворимость соединения в выбранном носителе или наполнителе. Эффективная концентрация является достаточной для смягчения симптомов состояния и ее можно определять эмпирически.

В других вариантах осуществления фармацевтические составы представляют собой лиофилизированные порошки, которые можно разбавлять для введения в качестве растворов, эмульсий и других смесей. Также их можно разбавлять и составлять в качестве твердых веществ или гелей.

Лиофилизированный порошок получают путем растворения антитела, описанного в настоящем описании, в подходящем растворителе. В некоторых вариантах осуществления лиофилизированный порошок является стерильным. Растворитель может содержать эксципиент, который повышает стабильность или другой фармакологический компонент порошка или восстановленного раствора, полученного из порошка. Эксципиенты, которые можно использовать, включают, но ими не ограничиваются, декстрозу, сорбит, фруктозу, кукурузный сироп, ксилит, глицерин, глюкозу, сахарозу или другое подходящее средство. Растворитель также может содержать буфер, такой как цитрат, фосфат натрия или фосфат калия, или другой такой буфер, известный специалистам в данной области, в одном из вариантов осуществления при приблизительно нейтральном значении pH. Последующая стерильная фильтрация раствора с последующей лиофилизацией в стандартных условиях, известных специалистам в данной области, обеспечивает желаемый состав. В одном из вариантов осуществления полученный состав распределяют во флаконы для лиофилизации. Каждый флакон содержит однократную дозу или многократные дозы соединения. Лиофилизированный порошок можно хранить в подходящих условиях, таких как от приблизительно 4°C до комнатной температуры.

Разбавление этого лиофилизированного порошка водой для инъекций обеспечивает состав для применения для парентерального введения. Для разбавления лиофилизированный порошок добавляют в стерильную воду или другой подходящий носитель. Точное количество зависит от выбранного соединения. Такое количество может быть определено эмпирически.

Антитела, описанные в настоящем описании, могут быть составлены для локального или местного применения, например, для местного нанесения на кожу и слизистые оболочки, такие как слизистые оболочки глаза, в форме геля, кремов и лосьонов, и для введения в глаз или для интрацистернального или внутрипозвоночного применения. Предусматривается местное введение для чрескожной доставки, а также для введения в глаза или на слизистую оболочку, или для ингаляционной терапии. Также можно вводить назальные составы активного соединения отдельно или в комбинации с другими фармацевтически приемлемыми эксципиентами.

Антитела и другие композиции, описанные в настоящем описании, также можно составлять для нацеливания на конкретную ткань, рецептор или другую область организма индивидуума, подвергаемого лечению. Множество таких способов нацеливания хорошо известно специалистам в данной области. Все такие способы нацеливания предусматриваются в настоящем описании для применения в настоящих композициях. Для неограничивающих примеров способов нацеливания см., например, патенты США № 6316652, 6274552, 6271359, 6253872, 6139865, 6131570, 6120751, 6071495, 6060082, 6048736, 6039975, 6004534, 5985307, 5972366, 5900252, 5840674, 5759542 и 5709874. В некоторых вариантах осуществления антитела против KIT, описанные в настоящем описании нацелены (или вводятся иным образом) на костный мозг, как например, у пациента, имеющего лейкоз или обладающего риском его наличия. В некоторых вариантах осуществления антитела против KIT, описанные в настоящем описании, нацелены (или вводятся иным образом) на желудочно-кишечный тракт, как например, у пациента, имеющего желудочно-кишечные стромальные опухоли или обладающего риском их наличия. В некоторых вариантах осуществления антитела против KIT, описанные в настоящем описании, нацелены (или вводятся иным образом) на легкие, как например, у пациента, имеющего рак легкого (например, мелкоклеточный рак легкого) или обладающего риском его наличия. В некоторых вариантах осуществления антитела против KIT, описанные в настоящем описании, нацелены (или вводятся иным образом) на головной мозг, как например, у пациента, имеющего нейробластому или обладающего ее риском. В конкретных вариантах осуществления антитело против KIT, описанное в настоящем описании, способно проходить через гематоэнцефалический барьер.

В рамках настоящего изобретения предусматривается фармацевтическая упаковка или набор, содержащие один или несколько контейнеров, заполненных одним или несколькими ингредиентами фармацевтических композиций, описанных в настоящем описании, таких как одно или несколько антител, описанных в настоящем описании. Необязательно к такому контейнеру(ам) может прилагаться сообщение в форме, назначенной правительственным учреждением, регулирующим производство, применение или продажу фармацевтических препаратов или биологических продуктов, где отражено одобрение учреждением производства, применения или продажи для введения человеку.

Также в рамках настоящего изобретения предусматриваются наборы, которые можно использовать в описанных выше способах. В одном из вариантов осуществления набор содержит антитело, описанное в настоящем описании, предпочтительно, очищенное антитело, в одном или нескольких контейнерах. В конкретном варианте осуществления наборы, описанные в настоящем описании, содержат по существу выделенный антиген KIT в качестве контроля. В другом конкретном варианте осуществления наборы, описанные в настоящем описании, дополнительно содержат контрольное антитело, которое не реагирует с антигеном KIT. В другом конкретном варианте осуществления наборы, описанные в настоящем описании, содержат один или несколько элементов для обнаружения связывания модифицированного антитела с антигеном KIT (например, антитело может быть конъюгировано с поддающимся обнаружению субстратом, таким как флуоресцентное соединение, ферментативный субстрат, радиоактивное соединение или люминесцентное соединение, или второе антитело, которое распознает первое антитело, может быть конъюгировано с поддающимся обнаружению субстратом). В конкретных вариантах осуществления набор может включать рекомбинантно продуцируемый или химически синтезируемый антиген KIT. Антиген KIT, предоставленный в наборе, также может быть связан с твердой подложкой. В более конкретном варианте осуществления средство для обнаружения в описанном выше наборе включает твердую подложку, с которой связан антиген KIT. Такой набор также может включать не прикрепленное меченное репортером антитело против антител человека. В этом варианте осуществления связывание антитела с антигеном KIT можно обнаруживать по связыванию меченного указанным репортером антитела.

5.6 Способы

В рамках настоящего изобретения предусматриваются способы профилактики, предупреждения, лечения и/или контроля связанного с KIT нарушения или заболевания (например, злокачественной опухоли). Такие способы включают введение индивидууму терапевтически эффективного количества антитела против KIT, описанного в настоящем описании (например, гуманизированных антител и их антигенсвязывающих фрагментов, или их конъюгатов). В некоторых аспектах также в рамках настоящего изобретения предусматриваются способы предупреждения, препятствования, лечения или контроля одного или нескольких симптомов связанного с KIT нарушения или заболевания.

Как используется в рамках изобретения "вводить" или "введение" относится к акту инъецирования или иной физической доставки вещества (например, гуманизированное антитело против KIT, описанное в настоящем описании, или его антигенсвязывающий фрагмент, или их конъюгат) индивидууму или пациенту (например, человеку), как например, посредством мукозальной, местной, внутрикожной, внутривенной, внутримышечной доставки и/или любого другого способа физической доставки, описанного в настоящем описании или известного в данной области.

Как используется в рамках изобретения, термины "эффективное количество" или "терапевтически эффективное количество" относятся к количеству терапевтического средства (например, гуманизированного антитела или фармацевтической композиции, описанных в настоящем описании), которое является достаточным для снижения и/или смягчения тяжести и/или длительности данного заболевания и/или симптома, связанного с ним. Эти термины также охватывают количество, необходимое для снижения или смягчения развития или прогрессирования данного заболевания, снижения или смягчения рецидива, развития или появления данного заболевания, и/или для улучшения или усиления профилактического или терапевтического эффекта(ов) другой терапии (например, терапия, отличная от антитела против KIT, описанного в настоящем описании). В некоторых вариантах осуществления "эффективное количество", как используют в рамках изобретения, также относится к количеству антитела, описанного в настоящем описании, для достижения определенного результата (например, ингибирование (например, частичное ингибирование) биологической активности KIT в клетке, такое как ингибирование пролиферации клетки или выживаемости клетки, или усиление или индукция апоптоза или дифференцировки клеток).

Как используется в рамках изобретения, термин "в комбинации" в контексте проведения другой терапии относится к использованию более чем одного терапевтического средства. Использование термина "в комбинации" не ограничивает порядок, в котором вводят терапевтические средства. Терапевтические средства можно вводить, например, сериями, последовательно, одновременно или совместно.

Как используется в рамках изобретения, термины "контроль" и "осуществление контроля" относятся к благоприятным эффектам, которые индивидуум получает от терапии (например, профилактического или терапевтического средства), которые не приводят к излечению связанного с KIT заболевания или нарушения. В определенных вариантах осуществления индивидууму проводят одну или несколько терапий (например, профилактическими или терапевтическими средствами, такими как антитело, описанное в настоящем описании) для "контроля за" связанным с KIT заболеванием (например, злокачественной опухоли, воспалительного состояния или фиброза) или одним или несколькими его симптомами, так чтобы предотвратить прогрессирование или ухудшение заболевания.

Как используется в рамках изобретения, термины "препятствовать" или "препятствование" в контексте связанного с KIT нарушения или заболевания относятся к общему или частичному ингибированию (например, менее чем на 100%, 95%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% или 5%) или блокированию развития, рецидива, возникновения или распространения связанного с KIT заболевания и/или симптома, связанного с ним, в результате введения терапевтического средства или комбинации терапевтических средств, описанных в настоящем описании (например, комбинации профилактических или терапевтических средств, таких как антитело, описанное в настоящем описании).

Как используется в рамках изобретения, термин "профилактическое средство" относится к любому средству, которое полностью или частично ингибирует развитие, рецидив, возникновение или распространение связанного с KIT заболевания и/или симптома, связанного с ним, у индивидуума. В определенных вариантах осуществления термин "профилактическое средство" относится к антителу, описанному в настоящем описании. В некоторых других вариантах осуществления термин "профилактическое средство" относится к средству, отличному от антитела, описанного в настоящем описании. Как правило, профилактическое средство представляет собой средство, о котором известно, что оно является полезным, или которое использовали или в настоящее время используют для предупреждения связанного с KIT заболевания и/или симптома, связанного с ним, или для препятствования возникновению, развитию, прогрессированию и/или тяжести связанного с KIT заболевания и/или симптома, связанного с ним. В конкретных вариантах осуществления профилактическое средство представляет собой антитело против KIT человека, такое как гуманизированное или полностью человеческое моноклональное антитело против KIT человека.

Как используется в рамках изобретения, термин "побочные эффекты" охватывает нежелательные и неблагоприятные эффекты терапии (например, профилактического или терапевтического средства). Нежелательные эффекты не обязательно являются неблагоприятными. Неблагоприятный эффект терапии (например, профилактического или терапевтического средства) может быть вредоносным, или вызывающим дискомфорт, или опасным. Примеры побочных эффектов включают диарею, кашель, гастроэнтерит, свистящее дыхание, тошноту, рвоту, анорексию, спазмы в животе, лихорадку, боль, снижение массы тела, дегидратацию, алопецию, одышку, бессонницу, головокружения, мукозит, нервные и мышечные эффекты, усталость, сухость во рту и потеря аппетита, сыпь или опухание области введения, гриппоподобные симптомы, такие как лихорадка, озноб и усталость, проблемы с пищеварительным трактом и аллергические реакции. Дополнительные нежелательные эффекты, испытываемые пациентами, многочисленны и известны в данной области. Многие из них описаны в Physician’s Desk Reference (63rd ed., 2009).

Как используется в рамках изобретения, термины "индивидуум" и "пациент" используют взаимозаменяемо. Как используется в рамках изобретения, индивидуумом, предпочтительно, является млекопитающее, такое как не являющееся приматом млекопитающее (например, коровы, свиньи, лошади, кошки, собаки, козы, кролики, крысы, мыши и т.д.) или примат (например, обезьяна и человек), наиболее предпочтительно, человек. В одном из вариантов осуществления индивидуумом является млекопитающее, предпочтительно, человек, имеющее связанное с KIT нарушение или заболевание. В другом варианте осуществления индивидуумом является млекопитающее, предпочтительно, человек, имеющее риск развития связанного с KIT нарушения или заболевания. В другом варианте осуществления индивидуумом является не являющийся человеком примат. В конкретном варианте осуществления индивидуумом является взрослый человек в возрасте по меньшей мере 18 лет.

Как используется в рамках изобретения, термины "способы терапии" и "терапия" могут относиться к любому протоколу(ам), способу(ам), композициям, составам и/или средству(ам), которые можно использовать для профилактики, лечения, контроля или смягчения состояния или нарушения, или их симптома (например, злокачественной опухоли или одного или нескольких симптомов, или состояния, связанного с ними; воспалительного состояния или одного или нескольких симптомов, или состояния, связанного с ними; фиброза или одного или нескольких симптомов, или состояния, связанного с ними). В определенных вариантах осуществления термины "способы терапии" и "терапия" относятся к медикаментозной терапии, адъювантной терапии, лучевой терапии, хирургической операции, биологической терапии, поддерживающей терапии и/или к другим способам терапии, подходящим для лечения, контроля, профилактики или смягчения состояния или нарушения или одного или нескольких его симптомов (например, злокачественной опухоли или одного или нескольких симптомов, или состояния, связанного с ними; воспалительного состояния или одного или нескольких симптомов, или состояния, связанного с ними; фиброза или одного или нескольких симптомов, или состояния, связанного с ними). В определенных вариантах осуществления термин "терапия" относится к терапии, отличной от терапии антителом против KIT, описанным в настоящем описании или его фармацевтической композицией. В конкретных вариантах осуществления "дополнительная терапия" и "дополнительные способы терапии" относятся к терапии, отличной от лечения с использованием антитела против KIT, описанного в настоящем описании, или фармацевтической композиции. В конкретном варианте осуществления терапия включает применение антитела против KIT, описанного в настоящем описании, в качестве адъювантной терапии. Например, антитело против KIT, описанное в настоящем описании, можно использовать совместно с медикаментозной терапией, биологической терапией, хирургической операцией и/или поддерживающей терапии.

Как используется в рамках изобретения, термин "терапевтическое средство" относится к любому средству, которое можно использовать для лечения, контроля или смягчения связанного с KIT заболевания и/или симптома, связанного с ним. В определенных вариантах осуществления термин "терапевтическое средство" относится к антителу против KIT, описанному в настоящем описании (например, любому из антител Hum1-Hum20), его антигенсвязывающему фрагменту, или их конъюгату. В некоторых других вариантах осуществления термин "терапевтическое средство" относится к средству, отличному от антитела, описанного в настоящем описании. Предпочтительно, терапевтическое средство представляет собой средство, о котором известно, что оно является подходящим для или используется в настоящее время для лечения, контроля или смягчения связанного с KIT заболевания или одного или нескольких симптомов, связанных с ним. В конкретных вариантах осуществления лекарственное средство представляет собой антитело против KIT человека, такое как полностью человеческое моноклональное антитело против KIT человека.

Как используется в рамках изобретения, термины "связанное с KIT нарушение" или "связанное с KIT заболевание" используют взаимозаменяемо и они относятся к любому заболеванию, которое полностью или частично вызывается, связано с или является результатом экспрессии и/или активности KIT или их отсутствия. В одном из аспектов связанное с KIT нарушение или заболевание может быть известно специалисту в данной области или может быть определено специалистом в данной области. В определенном варианте осуществления связанное с KIT заболевание или нарушение связано с экспрессией и/или активностью KIT. Например, экспрессия и/или активность KIT могут участвовать, в комбинации с одним или несколькими другими факторами (например, мутация, или экспрессия и/или активность другого гена), в развитии и/или прогрессировании связанного с KIT заболевания или нарушения. В определенном варианте осуществления связанное с KIT заболевание или нарушение связано с одной или несколькими мутациями KIT.

В определенных вариантах осуществления связанное с KIT заболевание представляет собой фиброз или воспалительное нарушение, например, воспалительное заболевание кишечника (IBD), такое как болезнь Крона (CD) или язвенный колит (UC). В других вариантах осуществления связанное с KIT заболевание представляет собой злокачественную опухоль, такую как рак легкого (например, мелкоклеточный рак легкого), лейкоз, нейробластома, меланома, саркома (например, саркома Юинга) или желудочно-кишечная стромальная опухоль (GIST).

Как используется в рамках изобретения, термины "лечить", "лечение" и "осуществление лечения" относятся к снижению или смягчению прогрессирования, тяжести и/или длительности связанного с KIT заболевания (например, злокачественной опухоли, воспалительного заболевания или фиброза) вследствие проведения одного или нескольких способов терапии (включая, но ими не ограничиваясь, введение одного или нескольких профилактических или терапевтических средств, таких как антитело, описанное в настоящем описании).

В конкретных вариантах осуществления способы лечения связанного с KIT нарушения или заболевания, описанные в настоящем описании, обеспечивают снижение или смягчение прогрессирования, тяжести и/или длительности связанного с KIT нарушения или заболевания (например, злокачественной опухоли, воспалительного состояния или фиброза) вследствие проведения одного или нескольких способов терапии (включая, но ими не ограничиваясь, введение одного или нескольких профилактических или терапевтических средств, таких как антитело против KIT, описанное в настоящем описании). В следующих конкретных вариантах осуществления, способы лечения связанного с KIT нарушения или заболевания, описанные в настоящем описании, относятся к снижению одного или нескольких симптомов связанного с KIT нарушения или заболевания. В конкретных вариантах осуществления антитело, описанное в настоящем описании, например, любое из антител Hum1-Hum20, например, антитело Hum8 или Hum4 или Hum17 или Hum10, или его антигенсвязывающий фрагмент, или их конъюгат, предназначено для лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли). В конкретном варианте осуществления связанное с KIT заболевание или нарушение, подвергаемое лечению или контролю с помощью антитела против KIT, описанного в настоящем описании, или его антигенсвязывающего фрагмента, или его конъюгата, связано с экспрессией и/или активностью KIT, например, вовлекает клетки, экспрессирующие KIT и/или проявляющие активность KIT, но не вызывается или не является результатом экспрессии или активности KIT.

В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело (например, гуманизированное антитело против KIT), например, любое из антител Hum1-Hum20, или Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающий фрагмент, или их конъюгат, для применения для лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли), где антитело содержит (i) область VL-цепи с аминокислотными последовательностями SEQ ID NO:7, 8, 9 или 10, и/или (ii) область VH-цепи с аминокислотными последовательностями SEQ ID NO: 2, 3, 4, 5 или 6. В другом конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело, или его антигенсвязывающий фрагмент, для применения для лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли), где антитело содержит комбинацию VH-домена (например, Н1-Н5, SEQ ID NO: 2-6) и VL-домена (L1-L4, SEQ ID NO: 7-10), выбранную из группы, представленной в таблице 4. В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело (например, гуманизированное антитело против KIT), например, любое из антител Hum1-Hum20, такое как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающий фрагмент, или их конъюгат, для применения для лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли), где антитело содержит (i) область VL-цепи, содержащую аминокислотную последовательность SEQ ID NO: 12 (см., например, фиг. 4 В), и/или (ii) область VH-цепи, содержащую консенсусную аминокислотную последовательность SEQ ID NO: 11 (см., например, фиг. 4А). В конкретном варианте осуществления в рамках настоящего изобретения предусматривается антитело (например, гуманизированное антитело против KIT), например, любое из антител Hum1-Hum20, такое как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающий фрагмент, или их конъюгат, для применения для лечения или контроля связанного с KIT нарушения (например, злокачественной опухоли), где антитело содержит (i) область VL-цепи, содержащую аминокислотную последовательность, указанную в таблице 6А (например, L1-L4 и LL1-LL62), и/или (ii) область VH-цепи, содержащую аминокислотную последовательность, указанную в таблице 6В (например, Н1-Н5 и НН1-НН256). В конкретном варианте осуществления антитело, используемое в способах, описанных в настоящем описании, интернализуется клеткой, с которой оно связывается.

В конкретном варианте осуществления в способах, описанных в настоящем описании, используют конъюгат, где конъюгат содержит антитело, описанное в настоящем описании (например, гуманизированное антитело против KIT, например, Hum4 или Hum8), или его связывающий KIT фрагмент.

В конкретном варианте осуществления конъюгат содержит антитело, описанное в настоящем описании (например, гуманизированное антитело против KIT), например, любое из антител Hum1-Hum20, такое как Hum17, Hum10, Hum8 или Hum4, или его связывающий KIT фрагмент, связанный, ковалентно или нековалентно, с лекарственным средством, таким как токсин. В определенном варианте осуществления конъюгат, используемый в способах, описанных в настоящем описании, интернализуется в клетку, с которой он связывается.

В определенных вариантах осуществления KIT аберрантно (например, на высоком уровне) экспрессируется клетками, например, KIT сверхэкспрессируется. В конкретных вариантах осуществления экспрессия KIT (например, на поверхности клетки) по меньшей мере приблизительно в 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, или 100% выше, чем экспрессия KIT на поверхности контрольной клетки (например, клетки, экспрессирующей нормальные уровни KIT, например, нормальной, например, человеческой, тучной клетки, стволовой клетки, клетки головного мозга, меланобласта или клетки яичника). В конкретных вариантах осуществления экспрессия KIT обеспечивает по меньшей мере приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 100% более высокую экспрессию KIT на клеточной поверхности, чем средняя экспрессия KIT на поверхности контрольной популяции клеток (например, популяция клеток, экспрессирующих нормальные уровни KIT, например, нормальной, например, человеческой, популяции тучных клеток, популяции стволовых клеток, популяции клеток головного мозга, популяции меланобластов или популяции клеток яичника). В конкретных вариантах осуществления такие контрольные клетки можно получать или могут происходить из здорового индивидуума (например, здорового человека). В некоторых вариантах осуществления KIT может аберрантно активироваться в конкретном типе клеток независимо от того, экспрессируется ли KIT аберрантно на клеточной поверхности. В конкретных вариантах осуществления передача сигнала или активность KIT может аберрантно активироваться в конкретном типа клеток независимо от того, экспрессируется ли KIT аберрантно на клеточной поверхности. В конкретных вариантах осуществления передача сигнала KIT по меньшей мере приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 100% превышает передачу сигнала KIT в контрольной клетке (например, клетке, имеющей нормальную передачу сигнала KIT, например, тучной клетке, стволовой клетке, клетке головного мозга, меланобласта или клетке яичника). В конкретных вариантах осуществления передача сигнала KIT по меньшей мере приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 100% превышает среднюю передачу сигнала KIT в контрольной популяции клеток (например, популяции клеток, проявляющая нормальную передачу сигнала KIT, например, нормальной, например, человеческой, популяции тучных клеток, популяции стволовых клеток, популяции клеток головного мозга, популяции меланобластов или популяции клеток яичника). В определенных вариантах осуществления нормальная, аберрантная или избыточная передача сигнала в клетке вызывается связыванием KIT с лигандом KIT. В других вариантах осуществления аберрантная или избыточная передача сигнала в клетке происходит независимо от связывания KIT с лигандом KIT.

В некоторых аспектах связанное с KIT нарушение или заболевание может характеризоваться активностью KIT с приобретением функции, увеличением активности KIT или сверхэкспрессией KIT. В одном из вариантов осуществления связанное с KIT нарушение или заболевание полностью или частично вызывается или является результатом активности или экспрессии KIT с приобретением функции, например, сверхэкспрессии KIT. В определенных вариантах осуществления активность KIT с приобретением функции может возникнуть независимо от связывания лиганда KIT (например, SCF) с KIT-рецептором. В конкретных аспектах высокая экспрессия или сверхэкспрессия KIT в клетке относится к уровню экспрессии, который по меньшей мере приблизительно на 35%, 45%, 55% или 65% превышает уровень экспрессии в эталонной клетке, о которой известно, что она имеет нормальную экспрессию KIT или активность KIT или более чем средний уровень экспрессии KIT в популяции клеток или образцах, о которых известно, что они имеют нормальную экспрессию KIT или активность KIT. Уровни экспрессии KIT можно оценивать способами, описанными в настоящем описании или известными специалисту в данной области (например, вестерн-блоттинг или иммуногистохимия). В конкретных вариантах осуществления связанное с KIT нарушение или заболевание характеризуется активностью KIT, которая превышает нормальную активность KIT и вносит вклад в трансформацию клеток, неоплазию и образование опухоли. В конкретных аспектах высокая активность или увеличение активности KIT в клетке относится к уровню активности KIT, который по меньшей мере приблизительно на 35%, 45%, 55% или 65% превышает уровень экспрессии в эталонной клетке, о которой известно, что она имеет нормальную активность KIT или более чем средний уровень активности KIT в популяции клеток или в образцах, о которых известно, что они имеют нормальную активность KIT. Неограничивающие примеры активности KIT включают фосфорилирование тирозина цитоплазматического домена KIT, и передачу сигнала ниже KIT, такую как передача сигнала Stat или Akt.

Неограничивающие примеры нарушений или связанных с KIT нарушений или заболеваний включают злокачественные опухоли, такие как рак молочной железы, лейкоз (например, хронический миелогенный лейкоз, острый миелоидный лейкоз, лейкоз тучных клеток), рак легкого (например, мелкоклеточный рак легкого), нейробластома, желудочно-кишечные стромальные опухоли (GIST), меланома, рак ободочной и прямой кишки, саркома (например, саркома Юинга) и герминогенные опухоли (например, семинома). В конкретном варианте осуществления злокачественная опухоль, которую подвергают лечению или контролю способами, описанными в настоящем описании, характеризуется мутацией KIT с приобретением функции или сверхэкспрессией KIT.

В конкретном варианте осуществления способ, описанный в настоящем описании, предназначен для лечения злокачественной опухоли (например, GIST, рак легкого или саркома (например, саркома Юинга)), где указанный способ включает введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В некоторых аспектах, также в рамках настоящего изобретения предусматриваются способы профилактики, лечения или контроля одного или нескольких симптомов злокачественной опухоли, где указанные способы включают введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В конкретном варианте осуществления антитело для применения в способе лечения злокачественной опухоли, описанной в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:8 (L2), и/или VH домен, содержащий аминокислотную последовательность SEQ ID NO:4 (H3). В конкретном варианте осуществления антитело для применения в способах лечения злокачественной опухоли, описанной в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:7 (L1), и/или VH домен, содержащий аминокислотную последовательность SEQ ID NO:5 (H4).

В конкретном варианте осуществления способ, описанный в настоящем описании, предназначен для лечения GIST, где указанный способ включает введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT) например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В некоторых аспектах также в рамках настоящего изобретения предусматриваются способы профилактики, лечения или контроля одного или нескольких симптомов GIST, где указанные способы включают введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT) например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В конкретном варианте осуществления антитело для применения в способах лечения GIST, описанных в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:8 (L2), и/или VH домен, содержащий аминокислотную последовательность SEQ ID NO:4 (H3). В конкретном варианте осуществления антитело для применения в способах лечения GIST, описанной в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:7 (L1), и/или VH-домен, содержащий аминокислотную последовательность SEQ ID NO:5 (H4).

В конкретном варианте осуществления способ, описанный в настоящем описании, предназначен для лечения рака легкого (например, мелкоклеточной карциномы легкого), где указанный способ включает введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании, (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В некоторых аспектах также настоящее изобретение относится к способам профилактики, лечения или контроля одного или нескольких симптомов рака легкого (например, мелкоклеточной карциномы легкого), где указанные способы включают введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В конкретном варианте осуществления антитело для применения в способах лечения рака легкого (например, мелкоклеточного рака легкого) содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:8 (L2), и/или VH домен, содержащий аминокислотную последовательность SEQ ID NO:4 (H3). В конкретном варианте осуществления антитело для применения в способах лечения рака легкого (например, мелкоклеточного рака легкого) содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:7 (L1), и/или VH домен, содержащий аминокислотную последовательность SEQ ID NO:5 (H4).

В конкретном варианте осуществления способ, описанный в настоящем описании, предназначен для лечения меланомы, где указанный способ включает введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В некоторых аспектах также настоящее изобретение относится к способам профилактики, лечения или контроля одного или нескольких симптомов меланомы, где указанные способы включают введение индивидууму терапевтически эффективного количества антитела, описанного в настоящем описании (например, гуманизированного антитела против KIT), например, любого из антител Hum1-Hum20, таких как Hum17, Hum10, Hum8 или Hum4, или его антигенсвязывающего фрагмента, или их конъюгата. В конкретном варианте осуществления антитело для применения в способах лечения меланомы, описанных в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:8 (L2), и/или VH-домен, содержащий аминокислотную последовательность SEQ ID NO:4 (H3). В конкретном варианте осуществления антитело для применения в способах лечения меланомы, описанных в настоящем описании, содержит VL-домен, содержащий аминокислотную последовательность SEQ ID NO:7 (L1), и/или VH-домен, содержащий аминокислотную последовательность SEQ ID NO:5 (H4).

В конкретных вариантах осуществления злокачественная опухоль, подвергаемая лечению в соответствии со способами, описанными в настоящем описании, может представлять собой любой тип злокачественной опухоли, которая включает злокачественную опухоль или опухолевые клетки, экспрессирующие на клеточной поверхности KIT или его мутантную форму, которая может быть подтверждена любым гистологическим или цитологическим способом, известным специалисту в данной области.

В определенных вариантах осуществления злокачественная опухоль является метастазирующей. В определенных вариантах осуществления злокачественная опухоль представляет собой развернутую злокачественную опухоль, которая распространилась за пределы области или органа происхождения, либо путем локальной инвазии, либо путем метастазирования.

В конкретных вариантах осуществления злокачественная опухоль представляет собой рецидивирующую злокачественную опухоль, которая выросла вновь, либо в исходной области, либо в отдаленной области, после ответа на первоначальную терапию (например, после хирургической операции для удаления опухоли и адъювантной терапии после хирургической операции). В некоторых вариантах осуществления злокачественная опухоль представляет собой рефрактерную злокачественную опухоль, которая прогрессирует, даже несмотря на то, что средство против злокачественной опухоли, такое как химиотерапевтическое средство, вводится или вводилось, пациенту со злокачественной опухолью. Неограничивающий пример рефрактерной злокачественной опухоли представляет собой злокачественную опухоль, которая является рефрактерной к ингибитору тирозинкиназы, такому как GLEEVEC® (иматиниба мезилат), SUTENT® (SU11248 или сунитиниб), IRESSA™ (гефитиниб), TARCEVA® (эрлотиниб), NEXAVAR® (сорафениб) или VOTRIENT™ (пазопаниб). В некоторых вариантах осуществления злокачественная опухоль представляет собой рефрактерную злокачественную опухоль, которая прогрессирует, даже несмотря на то, что лучевую терапию или химиотерапию проводят или проводили у пациента со злокачественной опухолью.

В конкретных вариантах осуществления в рамках настоящего изобретения предусматриваются способы лечения рефрактерной злокачественной опухоли у пациента, включающий введение пациенту терапевтически эффективного количества антитела, описанного в настоящем описании, где рефрактерная злокачественной опухоль является рефрактерной или устойчивой к средству против злокачественной опухоли, такому как ингибитор тирозинкиназы (например, GLEEVEC® (иматиниба мезилат) или SUTENT® (SU11248 или сунитиниб)). Другие неограничивающие примеры ингибиторов тирозинкиназы включают 706 и AMNI07 (нилотиниб). RAD00I, PKC412, гефитиниб (IRESSA™), эрлотиниб (TARCEVA®), сорафениб (NEXAVAR®), пазопаниб (VOTRIENT™), акситиниб, босутиниб, цедираниб (RECENTIN®), SPRYCEL® (дасатиниб), лапатиниб (TYKERB®), лестауртиниб, нератиниб, нилотиниб (TASIGNA®), семаксиниб, тоцераниб (PALLADIA™), вандетаниб (ZACTIMA™) и ваталаниб. В определенных вариантах осуществления рефрактерная злокачественная опухоль исходно отвечала на средство против злокачественной опухоли, такое как ингибитор тирозинкиназы (например, GLEEVEC® или SU11248 (т.е. сунитиниб)), однако у него развилась устойчивость к средству против злокачественной опухоли. В определенных вариантах осуществления индивидуум имеет одну или несколько мутаций в KIT, которые сообщают устойчивость к средству против злокачественной опухоли, такому как ингибитор тирозинкиназы.

В конкретных вариантах осуществления антитело, описанное в настоящем описании, вводят пациенту, которому ранее вводили или вводят одно или несколько средств против злокачественной опухоли, например, химиотерапевтических средств, или ингибитора тирозинкиназы (например, GLEEVEC® (иматиниба мезилат), SUTENT® (SU11248 или сунитиниб), IRESSA™ (гефитиниб), TARCEVA® (эрлотиниб), NEXAVAR® (сорафениб) или VOTRIENT™ (пазопаниб)), или ингибитора деацетилазы гистонов (например, вориностат или субероиланилидгидроксамовая кислота (SAHA)). В других конкретных вариантах осуществления антитело, описанное в настоящем описании, вводят пациенту, который является или предположительно является устойчивым или рефрактерным к терапии против злокачественной опухоли, например, ингибитору тирозинкиназы, например, GLEEVEC® (иматиниба мезилат), SUTENT® (SU11248 или сунитиниб), IRSSA™ (гефитиниб), TARCEVA® (эрлотиниб), NEXAVAR® (сорафениб) или VOTRIENT™ (пазопаниб).

В конкретных вариантах осуществления антитело, описанное в настоящем описании (например, любое из антител Hum1-Hum20, или их антигенсвязывающего фрагмента (например, их связывающего KIT фрагмента), или их конъюгата) вводят пациенту, которому ранее вводили или вводят в текущий момент одно или несколько средств против злокачественной опухоли, например, антитела против рецептора фактора роста (например, антитело против HER2, антитело против EGFR, антитело против VEGFR или антитело против KIT) или антитело против фактора роста (например, антитело против EGF, антитело против VEGF). В других конкретных вариантах осуществления антитело, описанное в настоящем описании, вводят пациенту, который является или предположительно является устойчивым или рефрактерным к средству против злокачественной опухоли, например, антителу против рецептора фактора роста (например, антитело против HER2, антитело против EGFR, антитело против VEGFR или антитело против KIT) или антителу против фактора роста (например, антитело против EGF, антитело против VEGF).

В конкретном варианте осуществления способ, описанный в настоящем описании, для лечения или контроля злокачественной опухоли у индивидуума может обеспечивать по меньшей мере один, два, три, четыре или более из следующих эффектов вследствие введения терапевтически эффективного количества антитела против KIT, описанного в настоящем описании: (i) снижение или смягчение тяжести злокачественной опухоли (например, лейкоза, рака легкого или желудочно-кишечной стромальной злокачественной опухоли) и/или одного или нескольких симптомов, связанных с ней; (ii) уменьшение длительности одного или нескольких симптомов, связанных со злокачественной опухолью (например, лейкозом, раком легкого или желудочно-кишечной стромальной злокачественной опухолью); (iii) предупреждение рецидива опухоли (например, опухоли легкого или желудочно-кишечной стромальной опухоли); (iv) регрессия злокачественной опухоли (например, лейкоза, рака легкого или желудочно-кишечной стромальной опухоли) и/или одного или несколько симптомов, связанного с ней; (v) уменьшение количества госпитализаций у индивидуума; (vi) уменьшение длительности госпитализации; (vii) увеличение выживаемости индивидуума; (viii) ингибирование прогрессирования злокачественной опухоли (например, лейкоза, рака легкого или желудочно-кишечной стромальной опухоли) и/или одного или нескольких симптомов, связанных с ней; (ix) усиление или улучшение терапевтического эффекта другой терапии (например, хирургическая операция, лучевая терапия, химиотерапия или другой ингибитор тирозинкиназы); (x) уменьшение или устранение популяции злокачественных клеток (например, популяция клеток лейкоза, популяция клеток рака легкого, популяция клеток желудочно-кишечной стромальной опухоли); (xi) снижение роста опухоли или новообразования; (xii) уменьшение размера опухоли (например, объема или диаметра); (xiii) уменьшение образования новых опухолей; (xiv) уничтожение, устранение или контроль первичной, регионарной и/или метастазирующей злокачественной опухоли; (xv) облегчение удаления опухоли путем уменьшения связанной с опухолью и/или отеком васкуляризации перед хирургическо