Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция



Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция
Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена и содержащая его фармацевтическая композиция

 


Владельцы патента RU 2426745:

ФЭЙДЖЕН БАЙОМЕДИКАЛ ИНК. ЧУНЦИН (CN)
ЛУНЭН ФАРМАСЬЮТИКАЛ ГРУП КОРПОРЕЙШН (CN)

Настоящее изобретение относится к рекомбинантному химерному белку, содержащему фактор ингибирования нейтрофилов, пептид FPRP, специфически узнающий активный сайт тромбина, и гируген. Данный белок способен направленно ингибировать активность тромбина. Кроме того, предлагается нуклеиновая кислота, кодирующая химерный белок, вектор, содержащий эту нуклеиновую кислоту, и клетка-хозяин, несущая вектор. Настоящее изобретение также относится к фармацевтической композиции, включающей рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена. Эффект от применения данной композиции заключается в ингибировании агрегации тромбоцитов или ингибировании активации периферических лейкоцитов. Данная композиция может быть использована для лечения кардио-цереброваскулярного заболевания или профилактики ишемического повреждения головного мозга или гематомы головного мозга. 6 н. и 7 з.п. ф-лы, 11 ил., 16 табл.

 

Область изобретения, к которой относится изобретение

Изобретение относится к рекомбинантному химерному белку фактора ингибирования нейтрофилов и гиругена (TNHH), кодирующей его полинуклеотидной последовательности, рекомбинантному вектору, содержащему указанную полинуклеотидную последовательность, микроорганизму, трансформированному указанным вектором, и фармацевтической композиции, содержащей указанный рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена.

Уровень техники

В настоящее время кардио-цереброваскулярные заболевания являются одним из основных заболеваний, угрожающих здоровью человека, среди которых инсульт головного мозга приводит к чрезвычайно высокому коэффициенту смертности. Основные патологические симптомы таких заболеваний включают: (1) образование гематомы головного мозга, (2) тромбоз головного мозга, (3) ишемию головного мозга и (4) отек головного мозга. На настоящий момент считается, что приведенные выше симптомы следует рассматривать как связанные с лейкоцитарной инфильтрацией, активацией тромбина и нарушениями микроциркуляции. Известно, что фактор ингибирования нейтрофилов и гирудин могут ингибировать лейкоцитарную инфильтрацию и активацию тромбина соответственно (Moyle M. et al.: US 5789175; Madden Ketal, Inflamm Res 1997, 46(6):216-223; Masadda T. et al., Brain Res, 2000, 867(2):173-179). Фактор ингибирования нейтрофилов (NIF) состоит из 257 аминокислот и содержит семь сайтов гликозилирования. Было доказано, что рекомбинантный дегликозилированный NIF сохраняет эти биологические свойства. NIF может эффективно ингибировать активность нейтрофилов, в том числе адгезию к эндотелиальным клеткам, высвобождение перекиси водорода и ионов супероксидов, а также хемотаксис, агрегацию и фагоцитоз нейтрофилов, и тому подобное (Moyle M. et al.: J Biol chem 1994, 269(13):10008-10015). В связи с вышеуказанной активностью NIF на модели животного было продемонстрировано, что рекомбинантный NIF имеет клиническую значимость для профилактики и лечения ишемического нейронального повреждения (модель МСАО крысы), улучшения циркуляции крови во время поражения головного мозга и уменьшения зоны поражения ткани головного мозга (Zhang L. et al.:stroke. 2003, 34(7):1790-1795).

Было обнаружено, что С-концевой додекапептид (т.е. 53-64 аминокислоты) гирудина обладают всеми этими функциями, такими как антитромбиновая активность гирудина, согласно исследованию структуры и функции гирудина (Naski MC. et al.: J Biochem. 1990, 265(23):13484-13489; Maraganore J metal: Biochemistry. 1990, 29(30):7095-7101). На основании вышеприведенных результатов был синтезирован искусственный додекапептид, названный гиругеном. Оказалось, что гируген может связываться с анионсвязывающей областью тромбина, но не может связываться с областью каталитического сайта и фибрином. Тромбин может связываться с фибрином, то есть гируген не может специфически связываться с тромбином, то есть гируген не может действовать на тромбин. Однако гируген может ингибировать как in vivo, так и in vitro превращение фибриногена в фибрин тромбином и удлинять APTT (активированное частичное тромбопластиновое время), PT (протромбиновое время) и TT (тромбиновое время), осуществляя таким образом антикоагуляционный эффект.

На основании вышеуказанных патологических исследований и исследований биологической активности NIF и гиругена в Китайской заявке на патент (№ 031011551) описан бифункциональный химерный белок (гибрид NIF-гирудина, или кратко - NHH), полученный из NIF и гиругена способами генетической рекомбинации. Этот химерный белок представляет собой NIF-(Gly)5-гируген. NHH состоит из 274 аминокислот и способен ингибировать адгезию и активацию нейтрофилов, а также ингибировать активности тромбина и, таким образом, может использоваться при лечении острых цереброваскулярных заболеваний. К сожалению, поскольку гируген, содержащийся в NHH, не может связываться с областью каталитического сайта, то NHH не может действовать на тромбин, что в значительной степени уменьшает терапевтическую эффективность NHH для кардио-цереброваскулярных заболеваний.

Сущность изобретения

Для устранения недостатков уровня техники настоящее изобретение направлено на получение нового рекомбинантного химерного белка фактора ингибирования нейтрофилов и гиругена, способного направленно ингибировать активность тромбина, улучшая таким образом терапевтическую эффективность при лечении кардио-цереброваскулярных заболеваний, например инсульта головного мозга.

Для достижения вышеуказанных целей настоящее изобретение в первом аспекте относится к рекомбинантному химерному белку фактора ингибирования нейтрофилов и гиругена (TNHH) со следующей структурой: Met-NIF-линкер 1-FPRP-линкер 2-гируген или NIF-линкер 1-FPRP-линкер 2-гируген. Предпочтительно, линкер 1 является 5-15 глицинами и, более предпочтительно, является 5-10 глицинами, а линкер 2 является (GSGG)n, n=1-3.

Во втором аспекте изобретение относится к полинуклеотидной последовательности, кодирующей рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена.

В третьем аспекте изобретение относится к вектору экспрессии, содержащему полинуклеотидную последовательность.

В четвертом аспекте изобретение относится к микроорганизму, содержащему вектор экспрессии.

В пятом аспекте изобретение относится к фармацевтической композиции, содержащей рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена.

TNHH в соответствии с изобретением имеет структуру: Met-NIF-линкер 1-FPRP-линкер 2-гируген или NIF-линкер 1-FPRP-линкер 2-гируген. Предпочтительно, линкер 1 является 5-15 глицинами, более предпочтительно, является 5-10 глицинами; линкер 2 является (GSGG)n, где n=1-3, более предпочтительно, n=1. В FPRP фенилаланин (F) находится, предпочтительно, в L-форме, и Met обозначает метионин. Предпочтительно, химерный белок представляет собой Met-NIF(257)-(Gly)5-FPRPGSGG-гируген, где фенилаланин (F) в FPRP находится в L-форме.

TNHH по изобретению также включает аминокислотную последовательность, которая приблизительно на 80% или больше, предпочтительно, на 90% или больше, идентична аминокислотной последовательности Met-NIF-линкер 1-FPRP-линкер 2-гиругена или NIF-линкер 1-FPRP-линкер 2-гиругена, имеющую терапевтическую значимость в отношении кардио-цереброваскулярных заболеваний, например инсульта головного мозга. Обычно указанная величина идентичности предпочтительно является более высокой. Идентичность аминокислотных последовательностей может быть определена при помощи алгоритма BLAST (Algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87:2264-2268, 1990; Proc. Natl. Acad. Sci. USA 90:5873, 1993).

Структура FPRP в TNHH может специфически связываться с фибрином, обеспечивая TNHH направленное ингибирование активности тромбина и лечение кардио-цереброваскулярного заболевания.

Кроме того, TNHH по изобретению необычайно эффективен для лечения или профилактики кардио-цереброваскулярных заболеваний, например для лечения или профилактики ишемического повреждения головного мозга или гематомы головного мозга, и обеспечивает значительное ингибирование агрегации тромбоцитов или ингибировании активации периферических лейкоцитов. Кардио-цереброваскулярным заболеванием является, предпочтительно, инсульт головного мозга.

Для получения TNHH по изобретению используют следующие стадии: (1) конструирование последовательности кДНК, соответствующей искусственно синтезируемому NHH, основанной на кДНК NIF из GenBank и последовательности кодонов, расшифрованной из додекапептида гиругена, в комбинации с предпочтительными кодонами Escherichia coli, дрожжей или СНО, (2) конструирование множественных пар комплементарных перекрывающихся праймеров на основе сконструированной, как описано выше, кДНК-последовательности, амплификацию этой кДНК-последовательности при помощи рекурсивной ПЦР, встраивание продукта амплификации в секвенирующую плазмиду pUC57 и секвенирование автоматическим ДНК-секвенатором (ABI) для обеспечения идентичности сконструированной последовательности кДНК и искусственно синтезированной последовательности кДНК, (3) конструирование праймеров с использованием pUC57, содержащей последовательность оснований, сконструированную в стадии (2), в качестве матрицы для амплификации гена TNHH, и в этом амплифицированном гене начальная область и область в конце последовательности содержат сайты расщепления соответственно, а область в конце последовательности, кроме того, содержит терминатор, предпочтительно, терминатор TAATGA, перед этим сайтом расщепления, для удобства введения амплифицированного гена в вектор экспрессии и экспрессии вектора в клетках-хозяевах; сайты расщепления NdeI и BamHI являются соответственно предпочтительными для начальной области и области в конце последовательности для удобства введения амплифицированного гена в прокариотический вектор экспрессии pET-3c, (4) использование секвенирующей плазмиды с теми же самыми сайтами расщепления, что и сайты расщепления гена TNHH, если амплифицированный ген содержит сайты расщепления в начальной области и в конце последовательности, с последующим расщеплением секвенирующей плазмиды, содержащей правильный ген TNHH и вектор экспрессии, и лигирование правильного гена TNHH с этим вектором экспрессии с получением вектора экспрессии, содержащего ген TNHH, и (5) трансформацию клетки-хозяина вектором экспрессии, содержащим ген TNHH, проведение анализа секвенирования на трансформированной клетке-хозяине для подтверждения правильного введения гена TNHH и идентичности сконструированной последовательности и последовательности гена-мишени, экспрессию белка TNHH в клетке-хозяине, а также экстракцию и очистку белка TNHH из клетки-хозяина. Последовательность белка TNHH состоит из NIF, линкеров и гиругена, где последовательность NIF расположена на N-конце и состоит из 274 аминокислот. Согласно примерам 1-7 вектор экспрессии для получения рекомбинантного TNHH представляет собой pET-систему, экспрессирующуюся в E. coli. При экспрессии в прокариотических организмах стартовый кодон ATG на 5'-конце рекомбинантного TNHH транслируется в метионин (Met). Таким образом, рекомбинантным продуктом TNHH, экспрессируемым в E. coli, является met-TNHH. При экспрессии той же самой полинуклеотидной последовательности TNHH в эукариотических системах экспрессии, таких как дрожжи, клетки млекопитающего (СНО) и тому подобное, рекомбинантный продукт TNHH не содержит Met на N-конце. В этом изобретении биологическая активность и фаромакодинамические эффекты TNHH не зависят от Met на N-конце рекомбинантного продукта TNHH, полученного экспрессией аминокислотной последовательности TNHH по изобретению в прокариотических или эукариотических организмах.

Изобретение также относится к полинуклеотидным последовательностям, кодирующим рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена, среди которых предпочтительным является полинуклеотид SEQ ID NO:2.

Предпочтительно, вектор экспрессии, содержащий полинуклеотид по изобретению, является системой pET.

Клетки-хозяева, содержащие вектор экспрессии по изобретению, включают E. coli, клетки дрожжей и клетки СНО и так далее, среди которых предпочтительной является E. coli.

Фармацевтическая композиция по изобретению может быть в любой общепринятой лекарственной форме, вводимой любым общепринятым способом доставки, среди которых предпочтительным является парентеральное введение. Предпочтительной лекарственной формой является инъекционный препарат, в том числе раствор для инъекции, лиофилизированный порошок для инъекции и так далее. При получении препарата для инъекции TNHH по изобретению добавляют к определенному количеству буфера, содержащему неорганическую соль, или аминокислотному буферу, такому как фосфатный, ацетатный, карбонатный, цитратный, глициновый, гистидиновый буфер, где солью является, предпочтительно, соль натрия, и ионная сила буфера находится в диапазоне 5-100 ммоль/л. Величина рН фармацевтической композиции находится в диапазоне 5,0-9,0. Белковый протектор, такой как альбумин, желатин, полисахарид, крахмал, глицерин и тому подобное, также может быть добавлен в композицию, где полисахарид выбран из одного или нескольких компонентов, таких как маннит, сахароза и трегалоза, до концентрации (г/мл) 2,0-6,0%.

Фармацевтическая композиция, содержащая TNHH, по изобретению может быть использована для лечения кардио-цереброваскулярного заболевания, в частности инсульта головного мозга.

Краткое описание фигур

Фиг.1 - ДНК-фрагменты, амплифицированные при помощи ПЦР, где M: маркер-лэддер 100 п.н. ДНК; 1: ген Hirulog (70 п.н.); 2: ген NIF (810 п.н.); 3: ген TNHH (870 п.н.).

Фиг.2 - Идентификация плазмид pLEX-TNHH, pLEX и pET3c ферментативным расщеплением, где M1: продукт расщепления λDNA/Hind III+EcoR I; 1: pLEX-TNHH/Nde I+BamH I; 2: pLEX/Nde I+BamH I; 3: pET3c/Nde I+BamH I; M2: маркер-лэддер 100 п.н. ДНК.

Фиг.3 - Конструирование рекомбинантной экспрессионной плазмиды pET3-TNHH.

Фиг.4 - Идентификация рекомбинантной плазмиды pET3-TNHH, где M: продукт расщепления λDNA/HindIII+EcoRI; 1: pET3c/Nde I+BamH I; 2-3: pET3-TNHH/Nde I+BamH I; 4: ПЦР-фрагмент гена TNHH.

Фиг.5 - Иммуноблоттинг-идентификация TNHH, где M: маркер молекулярной массы белка; 1: очищенный TNHH; 2: Гирудин; 1': иммуноблоттинг TNHH; 2': иммуноблоттинг гирудина.

Фиг.6 - В группе нормального контроля, нервные клетки в коре головного мозга имели правильное расположение, хорошо окрашенное ядро, сморщивание или исчезновение цитоплазмы.

Фиг.7 - В модельной группе, нервные клетки в коре головного мозга имели неправильное расположение, хорошо окрашенные ядра и сморщивание или исчезновение цитоплазмы.

Фиг.8 - В группе NIF, нервные клетки в коре головного мозга имели не совсем правильное расположение, часть хорошо окрашенного ядра и некоторое сморщивание или исчезновение цитоплазмы.

Фиг.9 - В NHH-группе, нервные клетки в коре головного мозга имели не совсем правильное расположение, часть хорошо окрашенного ядра и некоторое сморщивание или исчезновение цитоплазмы.

Фиг.10 - В TNHH-группе, нервные клетки в коре головного мозга имели более правильное расположение, часть хорошо окрашенного ядра и некоторое сморщивание или исчезновение цитоплазмы (HE 10×10).

Фиг.11 - В TNHH-группе, нервные клетки в коре головного мозга имели более правильное структурные расположение, часть хорошо окрашенного ядра и некоторое сморщивание или исчезновение цитоплазмы (HE 40×40).

Подробное описание изобретения

Настоящее изобретение иллюстрируется следующими конкретными примерами. Однако объем данного изобретения не ограничивается этими примерами.

Пример 1: Получение гена NHH

Полный ген был искусственно синтезирован Shanghai Sangon Biological Engineering Technology & Services Co., Ltd., и схема этого конструирования была следующей:

14 олигонуклеотидных фрагментов длиной от 80 до 130 п.н. синтезировали на основе полноразмерной последовательности гена NHH (SEQ ID NO:1). Фрагменты с номерами 1, 3, 5, 7, 9, 11 и 13 были прямыми фрагментами, а фрагменты с номерами 2, 4, 6, 8, 10, 12 и 14 были обратными фрагментами. Между двумя смежными фрагментами был сконструирован комплементарный район из приблизительно 20 п.н. Вышеописанные фрагменты синтезировали, очищали и смешивали в эквивалентных количествах в качестве субстрата для повторяющейся (рекурсивной) ПЦР. Затем ген NHH 822 п.н. получали при помощи ПЦР.

Сайт Kex2 добавляли перед геном NHH и в первых 6 п.н. сайта Kex2 находился сайт XhoI; за геном NHH следовали два стоп-кодона, и за этими стоп-кодонами следовал сайт Xba I.

Полноразмерная последовательность синтезированного гена NHH показана как следующая последовательность (SEQ ID NO: 1):

CTC GAG AAA AGA AAC GAA CAC AAC TTG AGA TGT CCA CAA

Kex2

XhoI

AAC GGT ACT GAA ATG CCA GGT TTC AAC GAC TCC ATC AGA TTG CAA TTC TTG GCT ATG CAC AAC GGT TAC AGA TCC AAG TTG GCT TTG GGT CAC ATC TCC ATC ACT GAA GAA TCC GAA TCC GAC GAC GAC GAC GAC TTC GGT TTC TTG CCA GAC TTC GCT CCA AGA GCT TCC AAG ATG AGA TAC TTG GAA TAC GAC TGT GAA GCT GAA AAG TCC GCT TAC ATG TCC GCT AGA AAC TGT TCC GAC TCC TCC TCC CCA CCA GAA GGT TAC GAC GAA AAC AAG TAC ATC TTC GAA AAC TCC AAC AAC ATC TCC GAA GCT GCT TTG AAG GCT ATG ATC TCC TGG GCT AAG GAA GCT TTC AAC TTG AAC AAG ACT AAG GAA GGT GAA GGT GTT TTG TAC AGA TCC AAC CAC GAC ATC TCC AAC TTC GCT AAC TTG GCT TGG GAC GCT AGA GAA AAG TTC GGT TGT GCT GTT GTT AAC TGT CCA TTG GGT GAA ATC GAC GAC GAA ACT AAC CAC GAC GGT GAA ACT TAC GCT ACT ACT ATC CAC GTT GTT TGT CAC TAC CCA AAG ATC AAC AAG ACT GAA GGT CAA CCA ATC TAC AAG GTT GGT ACT CCA TGT GAC GAC TGT TCC GAA TAC ACT AAG AAG GCT GAC AAC ACT ACT TCC GCT GAC CCA GTT TGT ATC CCA GAC GAC GGT GTT TGT TTC ATC GGT TCC AAG GCT GAC TAC GAC TCC AAG GAG TTC TAC AGA TTC AGA GAA TTG GGC GGT GGC GGT GGC AAC GGT GAC TTC GAA GAA ATC CCA GAA GAA TAC TTG TAA TGA TCT AGA

терминатор Xba I

Синтезированный ген вводили в плазмиду pUC57, которая была обозначена как pUC57-NHH. Ген NHH рекомбинировали с pPIC9K для конструирования рекомбинантной плазмиды, которую затем линеаризовали и трансформировали в Pichia pastoris. Индуцируемую экспрессию выполняли для получения рекомбинантного NHH в качестве контрольного белка для модели животного.

Пример 2: Получение гена TNHH

В этом примере сконструированный TNHH имел структуру Met-NIF-GGGGG-FPRP-GSGG-гируген, которая соответствовала следующей полинуклеотидной последовательности (SEQ ID NO:2):

AAC GAA CAC AAC TTG AGA TGT CCA CAA AAC GGT ACT GAA ATG CCA GGT TTC AAC GAC TCC ATC AGA TTG CAA TTC TTG GCT ATG CAC AAC GGT TAC AGA TCC AAG TTG GCT TTG GGT CAC ATC TCC ATC ACT GAA GAA TCC GAA TCC GAC GAC GAC GAC GAC TTC GGT TTC TTG CCA GAC TTC GCT CCA AGA GCT TCC AAG ATG AGA TAC TTG GAA TAC GAC TGT GAA GCT GAA AAG TCC GCT TAC ATG TCC GCT AGA AAC TGT TCC GAC TCC TCC TCC CCA CCA GAA GGT TAC GAC GAA AAC AAG TAC ATC TTC GAA AAC TCC AAC AAC ATC TCC GAA GCT GCT TTG AAG GCT ATG ATC TCC TGG GCT AAG GAA GCT TTC AAC TTG AAC AAG ACT AAG GAA GGT GAA GGT GTT TTG TAC AGA TCC AAC CAC GAC ATC TCC AAC TTC GCT AAC TTG GCT TGG GAC GCT AGA GAA AAG TTC GGT TGT GCT GTT GTT AAC TGT CCA TTG GGT GAA ATC GAC GAC GAA ACT AAC CAC GAC GGT GAA ACT TAC GCT ACT ACT ATC CAC GTT GTT TGT CAC TAC CCA AAG ATC AAC AAG ACT GAA GGT CAA CCA ATC TAC AAG GTT GGT ACT CCA TGT GAC GAC TGT TCC GAA TAC ACT AAG AAG GCT GAC AAC ACT ACT TCC GCT GAC CCA GTT TGT ATC CCA GAC GAC GGT GTT TGT TTC ATC GGT TCC AAG GCT GAC TAC GAC TCC AAG GAG TTC TAC AGA TTC AGA GAA TTG GGC GGT GGC GGT GGC TTC CCA AGA CCA GGT AGC GGT GGC AAC GGT GAC TTC GAA GAA ATC CCA GAA GAA TAC TTG

Ген TNHH получают с использованием следующих стадий:

синтеза 4 праймеров P1, P2, P3 и P4 с использованием рекомбинантной плазмиды pUC57-NHH в качестве матрицы, амплификации гена NIF (содержащего последовательность оснований в области в конце последовательности для кодирования FPRP) с праймерами P1 и P2 и амплификации гена Hirulog (содержащего последовательность оснований в начальной области для кодирования FPRP) с праймерами P3 и P4; затем использования гена NIF и гена Hirulog в качестве матриц и амплификации гена TNHH с праймерами P3 и P4. Сайты Nde I и BamH I добавляли к начальной области и области в конце последовательности гена TNHH соответственно для удобного инсертирования гена TNHH в прокариотический вектор экспрессии pET-3c. Эти праймерные последовательности показаны как следующие (P1, P2, P3 и P4 показаны в виде SEQ ID NO: 4, 5, 6 и 7 соответственно):

P1 (прямой): 5'-CG CAT ATG AAC GAA CAC AAC TTG AGA TGT CCA -3'

P2 (обратный): 5'-ACC TGG TCT TGG GAA GCC ACC GCC ACC GCC CAA TTC TCT GAA-3'

P3 (прямой): 5'-GGC TTC CCA AGA CCA GGT AGC GGT GGC AAC GGT GAC TTC-3'

P4 (обратный): 5'-TG GGA TCC TTA CAA GTA TTC TTC TGG GAT TTC-3'

CATATG: сайт Nde I; GGA TCC: сайт BamH I; аминокислотная последовательность, кодируемая вставленными в рамку парами оснований, была FPRP; и аминокислотная последовательность, кодируемая подчеркнутыми парами оснований, была GGGGG или GSGG.

Реакционная система, используемая для амплификации гена-мишени TNHH, посредством ПЦР с перекрывающимся удлинением показана следующим образом: каждую реакционную систему ПЦР устанавливали в соответствии с инструкцией изготовителя Набора для реакции ПЦР (TaKaRa, Dalian) (таблица 1).

Ген NIF 810 п.н. (показанный в дорожке 2, фиг.1) амплифицировали с использованием рекомбинантной плазмиды pUC57-NHH в качестве матрицы и P1 и P2 в качестве праймеров. Ген гиругена 70 п.н. (показанный в дорожке 1, фиг.1) амплифицировали с использованием рекомбинантной плазмиды pUC57-NHH в качестве матрицы и P3 и P4 в качестве праймеров. Ген TNHH 870 п.н. (показанный в дорожке 3, фиг.1) в конечном счете амплифицировали с использованием гель-очищенного гена NIF и гена гиругена в качестве матриц и P1 и P4 в качестве праймеров.

Таблица 1
Реакционная система ПЦР
Матрица 1 мкл
Прямой праймер (25 пмоль/л) 2 мкл
Обратный праймер (25 пмоль/л) 2 мкл
dNTPs (2,5 ммоль/л для каждого основания) 8 мкл
Буфер для 10×ПЦР 10 мкл
MgCl2 (25 ммоль/л) 10 мкл
Taq ДНК-полимераза 1 мкл
ddH2O 66 мкл
Общий объем 100 мкл

Эту реакционную систему тщательно смешивали и центрифугировали и затем в эту реакционную систему добавляли 40 мл парафинового масла.

Используемые параметры реакции были следующими:

94°С предварительная денатурация 3 мин,

Далее 35 циклов:

94°С 1 мин
55°С 1 мин
72°С 1,5 ми
72°С 10 мин

После этой реакции 3 мкл продукта реакции извлекали для детектирования результата ПЦР с использованием электрофореза на 1,0% агарозном геле (фиг.1).

Результат ПЦР показал, что фрагменты ДНК-мишени амплифицировались в каждой стадии ПЦР, и был получен ген TNHH. Последовательность гена TNHH идентифицировали: ферментативным расщеплением гена TNHH и вектора pLEX (Invitrogen) рестриктазами Nde I и BamH I, извлечением фрагментов-мишеней, лигированием ДНК-лигазой Т4 с образованием рекомбинантной плазмиды pLEX-TNHH и секвенированием (TaKaRa, Dalian). Результат секвенирования продемонстрировал полную идентичность между амплифицированным геном TNHH и сконструированной последовательностью.

Пример 3: Конструирование рекомбинантной плазмиды

1. Основные материалы

Бактерии-хозяева E. coli BL21(DE3)pLysS, E. coli DH5α, плазмида pET3c (Novagen), Набор для экстракции и очистки ДНК (Shanghai Huashun Bioengineering Co., Ltd.), маркер λDNA/Hind III+EcoRI (Huamei), рабочие ферменты: Nde I, BamH I, Hind III, маркер-лэддер ДНК, набор для выделения ДНК и набор для лигирования ДНК Ver.2.1 (TaKaRa, Dalian), антибиотики ампициллин, стрептомицин, тетрациклин, канамицин (AMRESCO).

2. Способы

pLEX-TNHH ферментативно расщепляли Nde I и BamH I и получали фрагменты-мишени. Набор для лигирования ДНК использовали для лигирования гена TNHH с большим фрагментом плазмиды pET3c, полученным ферментативным расщеплением с использованием Nde I и BamH I. Компетентную E. coli DH5α получали в соответствии с CaCl2-способом и трансформировали. Эту трансформированную E. coli DH5α распределяли на LB-чашке, содержащей 100 мг/л ампицилина. LB-планшет инкубировали в термостате при 37°С в течение 12 часов с получением опалесцирующей полупрозрачной единственной колонии. Эту единственную колонию выскребали стерильными зубочистками и культивировали в жидкой LB-среде, содержащей 100 мг/л ампициллина для экстракции плазмид. Экспрессирующую плазмиду pET3-TNHH, содержащую химерный фрагмент 860 п.н., подвергали скринингу ферментативным расщеплением с использованием Nde I и BamH I.

① Экстракция плазмид

Процедуры экстракции выполняли в соответствии с инструкцией изготовителя набора для экстракции и очистки ДНК.

② Ферментативное расщепление

Плазмиду pLEX-TNHH и плазмиду pET3c расщепляли в указанном порядке. Реакционной системой была ДНК-плазмида 0,5 мкг, BamH I 1,0 Е, NdeI 1,0 Е, 10×буферный раствор для ферментативной реакции 2,0 мкл с добавлением деионизованной воды (DDW) до 20 мкл. Ферментативное расщепление выполняли в термостате при 37°С в течение 2 часов. 1 мкл расщепленной плазмиды брали из каждой реакции и детектировали электрофорезом в 1% агарозном геле. Расщепленная плазмида pLEX-TNHH показала полосу 860 п.н. и полосу 2900 п.н., а расщепленная плазмида pET3c показала полосу 4600 п.н. (фиг.2).

③ Лигирование pET-3c и гена TNHH

Все расщепленные пробы извлекали гель-электрофорезом и фрагмент-мишень из расщепленной плазмиды pLEX-TNHH и линеаризованную плазмиду pET-3c выделяли в соответствии с инструкцией изготовителя набора для выделения ДНК. Выделенную линеаризованную плазмиду pET-3c и этот фрагмент-мишень лигировали при 16°С в течение 30 минут в соответствии с инструкцией изготовителя набора для лигирования ДНК с получением pET3-TNHH (фиг.3).

④ Получение и трансформация компетентных клеток

Получение компетентных E. coli DH5α и E. coli BL21(DE3)pLysS и трансформацию pET3-TNHH выполняли в соответствии с общепринятым кальций-хлоридным способом (Molecular Cloning, Second edition, P55).

Пример 4

1. Лигирование и трансформация

E. coli DH5α трансформировали pET3-TNHH-положительным раствором для лигирования и pET3-TNHH-негативным раствором для лигирования соответственно. E. coli DH5α отдельно распределяли на двух чашках LB, содержащих 100 мг/л ампициллина в каждом случае, и инкубировали при постоянной температуре 37°С в течение 12 часов. 5 отдельных колоний наблюдали на негативной чашке и приблизительно 100 отдельных колоний наблюдали на позитивной чашке, что демонстрировало успешные лигирование и трансформацию. Эти колонии обнаруживали типичную морфологию E. coli.

2. Идентификация рекомбинантной экспрессионной плазмиды pET3-TNHH ферментативным расщеплением

Две отдельные колонии выскребали стерильными зубочистками из позитивной чашки и затем культивировали в жидкой LB-среде, содержащей 100 мг/л ампициллина, при 37°С в течение 12 часов. Затем рекомбинантную экспрессионную плазмиду pET3-TNHH экстрагировали и расщепляли Nde I и BamH I. Результаты показывали полосу 4600 п.н. и полосу 860 п.н. (с использованием ПЦР-продукта TNHH в качестве контроля), как и ожидалось (фиг.4).

3. Идентификация рекомбинантной экспрессионной плазмиды pET3-TNHH секвенированием

Выполняли экстракцию плазмиды pET3-TNHH из pET3-TNHH/E. coli DH5α и выполняли анализ последовательности после идентификации ферментативным расщеплением. Результаты секвенирования (полученные TaKaRa, Dalian) показали, что последовательность TNHH, содержащаяся в этой плазмиде, была такой, какая и ожидалась.

Пример 5: Экстракция и очистка TNHH

Сконструированные бактерии pET3-TNHH/BL21(DE3)pLysS инокулировали в LB-среду (содержащую 100 мкг/мл ампициллина) и культивировали при 30°С и 250 об/мин в течение 1,5-3 часов. При достижении величины OD 0,4-0,6 добавляли 0,5 мМ IPTG (конечная концентрация) для 3-4-часовой индукции. Сконструированные бактерии собирали и лизировали и TNHH экстрагировали и очищали.

Подробные процедуры были следующими:

Бактерии

Лизис бактерий гомогенизацией под давлением: 1 л раствора лизирующего буфера (50 ммоль/л Трис, 10 ммоль/л ЭДТА, 1% Тритон Х-100, pH 10,0, 4°С) добавляли в 100 г бактерий и эти бактерии подвергали гомогенизации под давлением 2-3 раза при давлении 40 МПа

Центрифугирование: 4°С, 12000 об/мин, 15 мин, сохранение осадка

Промывание содержащихся включений: промывочный буферный раствор (50 ммоль/л Трис, 5 ммоль/л ЭДТА, 2 моль/л мочевина, 1% Тритон Х-100 pH 8,0) с тем же самым объемом, какой добавляли выше, и достаточным перемешиванием для растворения

Центрифугирование: 4°С, 12000 об/мин, 15 мин, с сохранением осадка

Растворение содержащихся включений: раствор буфера для растворения (50 ммоль/л Трис, 0,5/1000 Я-ME, 6 моль/л мочевина, pH 9,0) с тем же самым объемом, какой добавляли выше, и достаточным перемешиванием для растворения

Ренатурация: градиентное разведение с использованием 50 ммоль/л Трис-Cl, 6 моль/л мочевина, 1/2000 Я-ME, концентрация белка 2,5~3,0 мг/мл, 0,3 ммоль/л цистин при рН 9,0, 15~20°С и ренатурация раствором для ренатурации: 25 ммоль/л Tris-Cl, 0,3 ммоль/л L-цистин, pH 9,0

Ультрафильтрационное концентрирование: около 10°С, отсечение молекулярной массы 3KD, ультрафильтрация до 20-30-кратного увеличения концентрации

Грубая очистка TNHH: среда Бутил-Сефароза F.F., буферный раствор для уравновешивания: 25 ммоль/л Трис, 0,3 M (NH4)2SO4, 0,5 моль/ NaCl, pH 8,0, сбор белка-мишени из проходящего через колонку пика, элюция этого белка в виде примесей 25 ммоль/л Трисом 25 pH 8,0

Белок-мишень из проходящего через колонку пика очищали бутил-колонкой и осаждали при рН 3,0~4,0 (доведенном с использованием HCl)

Центрифугирование: 4°С, 12000 об/мин, 15 мин, с сохранением осадка

Растворение этого осадка в 20 ммоль/л буферного раствора PB pH 8,0 с получением прозрачного раствора и фильтрование с использованием мембраны 0,45 мкм

Тонкая очистка TNHH: среда Source 30 Q., буфер А для уравновешивания: 20 ммоль/л PB, 0,2 моль/л NaCl, pH 8,0, условия элюции В (20 ммоль/л PB 0,5 моль/л NaCl pH 8,0), элюция линейным градиентом, сбор представляющего интерес белкового пика (приблизительно 35% раствор В)

Представляющий интерес белок очищали с использованием колонки Source 30 Q и осаждали при pH 3,0~4,0 (доведенном фосфорной кислотой)

Центрифугирование: 4°С, 12000 об/мин, 15 мин, с сохранением осадка

Полное растворение осадка 10 ммоль/л буферного раствора PB, pH 7,4 и фильтрование с использованием пленки 0,45 мкм

Удаление источника тепла и некоторого количества высокомолекулярного белка: среда Супердекс 75, буфер для уравновешивания: 10 ммоль/л PB pH 6,5, условие элюции для представляющего интерес белка: 10 ммоль/л PB pH 6,5

Маточный раствор TNHH

Полученный таким образом маточный раствор TNHH разбавляли 10 ммоль/л PB (pH 7,5), пока не достигалась концентрация TNHH 3,0 мг/мл, и затем лиофилизировали с получением продукта после добавления 4,0% маннита.

Пример 6: Идентификация маточной жидкости TNHH иммуноблоттингом и секвенированием

Очищенный TNHH анализировали гель-электрофорезом в ДСН-ПААГ с тем же самым количеством нанесенной пробы и затем переносили на нитроцеллюлозную пленку с использованием электропереносящего прибора для связывания сначала с мышиным антителом против гирудина (первичным антителом) и затем связывания с козьим HRP-антителом против мышиного IgG (вторичным антителом). Результаты иммуноблоттинга получали с использованием развивающих окраску реакций с субстратами (фиг.5).

Из фиг.5 можно видеть, что в TNHH имелся компонент, специфически связывающий анти-гирудин-антитело, что позволяет предположить, что сконструированный эпитоп антигена HV2 был достаточно экспонирован (выставлен) и мог специфически связываться с этим антителом.

Результаты секвенирования показали, что N-концевой аминокислотной последовательностью TNHH была MNEHNLRCPQNGTEM, а С-концевой аминокислотной последовательностью TNHH была EYL, обе из которых согласуются с последовательностями сконструированной последовательности: MNEHNLRCPQNGTEMPGFNDSIRLQFLAMHNGYRSKLALGHISITEESESDDDDDFGFLPDFAPRASKMRYLEYDCEAEKSAYMSARNCSDSSSPPEGYDENKYIFENSNNISEAALKAMISWAKEAFNLNKTKEGEGVLYRSNHDISNFANLAWDAREKFGCAVVNCPLGEIDDETNHDGETYATTIHVVCHYPKINKTEGQPIYKVGTPCDDCSEYTKKADNTTSADPVCIPDDGVCFIGSKADYDSKEFYRFRELGGGGGFPRPGSGGNGDFEEIPEEYL (SEQ ID NO:3). Идентичность между аминокислотной последовательностью TNHH и этой сконструированной последовательностью дополнительно определяли в свете результатов секвенирования ДНК.

Аминокислотной последовательностью перед (Gly)5 был NIF, а аминокислотной последовательностью гирудина была NGDFEEIPEEYL.

Из приведенных выше результатов можно видеть, что полученный TNHH имел структуру Met-NIF-GGGGG-FPRP-GSGG-гируген.

Пример 7: Получение TNHH, содержащего линкер 1 (Gly)15 и линкер 2 (GSGG)3

Линкер 1 и линкер 2 в гене TNHH заменяли при помощи ПЦР с получением NIF-(Gly)15-FPRP-(GSGG)3-гиругена.

Синтезировали две пары праймеров:

P5 (прямой): тот же самый, что и Р1 в примере 2

P6 (обратный): 5'-ACCTGG TCT TGG GAA GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC CAA TTC TCT GAA-3' (SEQ ID NO:8)

P7 (прямой): 5'-GGCTTC CCA AGA CCA-GGT AGC-GGT GGC GGT AGC GGT GGC GGT AGC GGT GGC AAC GGT GAC TTC-3' (SEQ ID NO:9)

P8 (обратный): тот же самый, что и P4 в примере 2,

где аминокислотной последовательностью, кодируемой парами оснований, представленными в рамке, был FPRP; аминокислотной последовательностью, кодируемой подчеркнутыми парами оснований в P6, был (Gly)15 и аминокислотной последовательностью, кодируемой подчеркнутыми основаниями в P7, был (GSGG)3.

Представляющий интерес ген получали с использованием полинуклеотида TNHH в качестве матрицы и выполнением ПЦР в соответствии со способом, используемым в примерах 2, 3, 4 и 5. Затем выполняли конструирование рекомбинантной плазмиды, лигирование, трансформацию, экстракцию и очистку.

Полученный рекомбинантный TNHH был назван TNHH-G15/n3.

In vitro сравнительный анализ показал, что TNHH-G15/n3 и TNHH имели одну и ту же антитромбиновую активность и адгезионную в отношении лейкоцитов активность.

Синтезировали две пары праймеров:

P5 (прямой): тот же самый, что и P1 в примере 2

P6 (обратный): 5'-ACCTGG TCT TGG GAA GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC ACC GCC CAA TTC TCT GAA-3'

P7 (прямой): 5'-GGCTTC CCA AGA CCA-GGT AGC-GGT GGC GGT AGC GGT GGC GGT AGC GGT GGC AAC GGT GAC TTC-3'

P8 (обратный): тот же самый, что и P4 в примере 2,

где аминокислотной последовательностью, кодируемой парами оснований, представленными в рамке, был FPRP; аминокислотной последовательностью, кодируемой подчеркнутыми парами оснований в P6, был (Gly)15 и аминокислотной последовательностью, кодируемой подчеркнутыми основаниями в P7, был (GSGG)3.

антитромбиновая активность
(ATU/мг)
активность против адгезии лейкоцитов
(ЕД/мг)
TNHH 1200 750
TNHH-G15/n3 1200 740
NHH 800 650
NIF отсутствует 750
Гируген 1000 отсутствует

Пример 8: фармацевтическая композиция, содержащая TNHH

8.1 Инъекционные растворы

Маточный раствор рекомбинантного белка TNHH из примера 5 готовили в соответствии со следующим рецептом для приготовления инъекционного раствора, где указанная концентрация TNHH была конечной концентрацией.

Рецепт A:

TNHH 3,0 мг/мл
Na2HPO4/NaH2PO4 10 ммоль/л
pH 7,0-8,0

Рецепт В:

TNHH 6,0 мг/мл
ацетат натрия/уксусная кислота 20 ммоль/л
глицерин 20 мг
pH 5,5 - 7,0

8.2 Лиофилизированный порошок

Маточный раствор рекомбинантного белка TNHH из примера 5 готовили в соответствии со следующим рецептом для получения лиофилизированного порошка, где концентрация TNHH была конечной концентрацией.

Рецепт С:

TNHH 3,0 мг/мл
Na2HPO4/NaH2PO4 10 ммоль/л
глицин 40 мг
pH 6,0-8,0

Рецепт D:

TNHH 6,0 мг
ацетат натрия/уксусная кислота 10 ммоль/л
сахароза 60 мг
pH 5,0-6,0

Рецепт E:

TNHH 9,0 мг
бикарбонат натрия/карбонат натрия 20 ммоль/л
трегалоза 40 мг
pH 8,0-9,0

Способы приготовления в примере 8, все, соответствовали общепринятым способам для приготовления инъекционных растворов и лиофилизированных порошков.

Следующие примеры были экспериментами на TNHH данного изобретения для определения его биологических активностей. Все пробы TNHH в этих экспериментах были TNHH-продуктами из примера 5; NIF и NHH готовили FAGEN BIOMEDICAL INC. CHONGQING в соответствии с Китайской заявкой на патент № 031011551.

Пример 9: Сравнение терапевтических действий NIF, NHH и TNHH на ишемическом повреждении головного мозга в крысах, подвергнутых окклюзии (закупорке) средней мозговой артерии

1. Материалы

Лекарственные средства: испытуемыми лекарственными средствами были NIF, NHH и TNHH.

Агенты: хлорид трифенилтетразолия (TTC), приобретенный из China National Medicine Group, Shanghai Chemical Reagent Company, Lot № F20020610; APTT kit, приобретенный из Shanghai Sunbiote Company, Lot № Medical Device Registration Record JIN(2002) № 3401632.

Животные: 24 крыс Wistar, самцов, 180~230 г, обеспеченных Animal Center, Chongqing Medical University.

2. Способы

Крыс Wistar случайным образом делили на 4 группы (6 животных на группу), включающие в себя группу-модель, группу NHH, группу NIF и группу TNHH. Затем выполняли анестезию каждой из крыс Wistar с использованием 10% хлоральгидрата (350 мг/кг, i.p.). Крысу фиксировали в положении на спине и кожу рассекали вдоль срединного надреза шеи для поиска правой общей сонной артерии, который затем зашивали 2 швами для более позднего применения. Наружную сонную артерию затем отделяли и лигировали (перевязывали). Внутреннюю сонную артерию и крылонебную артерию ниже наружной сонной артерии выделяли и последнюю также лигировали. Выделенные проксимальный конец и дистальный конец выделенной общей сонной артерии клиппировали и затем небольшой разрез открывали на наружной сонной артерии, в который вставляли найлоновую нить (Φ=0,22~0,30 мм). Затем эту нить проталкивали в переднюю мозговую артерию (приблизительно на 20 мм) медленно и вытягивали обратно приблизительно 2 мм для помещения в отверстие средней мозговой артерии (средней артерии головного мозга) (с длиной приблизительно 17 мм). После этого зажимы артерии удаляли после фиксации найлоновой нити лигированием швом №7 и затем зашивали мышцу и кожу. После хирургии эту крысу содержали отдельно в большой клетке. После прихода в себя из бессознательного состояния крыс оценивали на основе балльного показателя поведения, посредством которого успешное установление модели животного определялось баллом <11. Соответствующие лекарственные средства (2 мг/кг, bid) вводили через хвостовую вену животным с объемом введения 1 мл/100 г в каждой группе после успешного установления модели животного (в соответствии с баллом менее 11 на основе поведенческого балльного оценивания поведения), тогда как группа модели получала физиологический солевой раствор в соответствующем объеме. Нейроэтологический балл (с полным баллом 11) оценивали при 4 ч, 12 ч, 24 ч, 48 ч и 72 ч после хирургии. После оценивания при 72 ч брали пробы крови 1,8 мл с использованием катетера сонной артерии и быстро добавляли в силикатированную пробирку, которая содержала 0,2 мл 0,109 моль/л антикоагулянта цитрата натрия. После тщательного смешивания легким встряхиванием ее затем центрифугировали при 300 об/мин в течение 15 минут. Супернатант собирали для определения APTT в соответствии с инструкцией для этого реагента. Затем этих крыс умерщвляли декапитацией и череп удаляли для обнажения головного мозга. После удаления обонятельной луковицы, мозжечка и нижнего ствола головного мозга остальную часть взвешивали и затем большой мозг разрезали на 5 частей вдоль венечного шва. Эти части головного мозга помещали в фосфатный буфер, содержащий 4% ТТС, и инкубировали при 37оС в течение 30 минут. Эти части переворачивали 3-4 раза во время инкубирования. Нормальная ткань мозга окрашивалась в красный цвет, тогда как поврежденная ткань головного мозга была белой. Затем эту белую зону повреждения вырезали и взвешивали. Долю поврежденной ткани головного мозга в общей массе головного мозга рассчитывали как пораженный инфарктом участок с использованием способа “масса-площадь”.

Двух других животных в каждой группе отбирали для патологического исследования головного мозга после умерщвления.

3. Результаты

3.1 Сравнение поведенческого балльного оценивания NIF, NHH и TNHH на ишемии головного мозга в крысах, подвергнутых окклюзии (перевязке) средней мозговой артерии

Как показано в таблице 2, NIF, NHH и TNHH могли явно улучшать поведенческий балл ишемии головного мозга в крысах, подвергнутых окклюзии средней мозговой артерии, и имелись различие и значимое различие между группой лечения и модельной группой (P<0,05 и P<0,01).

3.2 Сравнение действий NIF, NHH и TNHH на объем инфаркта головного мозга в крысах, подвергнутых окклюзии средней мозговой артерии

Как показано в таблице 3, NIF, NHH и TNHH могли явно уменьшать объем инфаркта головного мозга в крысах, подвергнутых окклюзии средней мозговой артерии, и имелись различие и значимое различие между группой лечения и модельной группой (P<0,05 и P<0,01).

Таблица 3
Сравнение действий NIF, NHH и TNHH на объем инфаркта головного мозга в крысах, подвергнутых окклюзии средней артерии головного мозга
Группы Животные Объем инфаркта головного мозга (%)
Группа модели 4 39,4±5,7
Группа NIF 4 24,9±9,6*
Группа NHH 4 25,2±5,2**
Группа TNHH 4 23,2±5,4**

3.3 Результаты патологических срезов для действий NIF, NHH и TNHH на объем инфаркта головного мозга в крысах, подвергнутых окклюзии средней артерии головного мозга

В сравнении с тканями головного мозга в нормальной контрольной группе в группе модели и в группе лечения нервные клетки в коре головного мозга имели нестандартную структуру на различных уровнях, глубоко окрашенное и сморщенное (пикнотическое) ядро и сморщенные тела клеток. Пирамидальные клетки в зоне гиппокампа СА1 имели нестандартную структуру на различных уровнях, рыхлое расположение клеток, слабо окрашенную цитоплазму, глубоко окрашенное и пикнотическое (сморщенное) ядро и уменьшенные количества тел клеток до различных степеней. В сравнении с группой модели группа NIF, группа NHH и группа TNHH имели меньшие патологические изменения. Группа TNHH имела наименьшие патологические изменения (Фиг.6-11).

Приведенные выше результаты патологических срезов показали, что группы NIF, NHH и TNHH в сравнении с группой модели имели защитные эффекты на инфаркте головного мозга в крысах, подвергнутых окклюзии мозговой артерии, причем ишемический некроз головного мозга в группе TNHH был наименьшим.

4. Выводы

Имелись явные терапевтические действия NIF, NHH и TNHH на ишемическом повреждении головного мозга в крысах, подвергнутых окклюзии средней мозговой артерии, и TNHH оказывал наиболее очевидные терапевтические действия.

Пример 10: Сравнение действий NIF, NHH и TNHH на экспериментальной гематоме головного мозга в крысах

1. Материалы

Лекарственные средства: испытуемыми лекарственными средствами были NIF, NHH и TNHH, обеспеченные FAGEN BIOMEDICAL INC. CHONGQING

Животные: 32 крысы SD, самцы, 180~230 г, обеспеченные Animal Center, Daping Hospital, Third Military Medical University.

2. Способы

2.1 Установление модели кровоизлияния в головной мозг (инсульта) в крысах

Крыс SD случайным образом делили на 4 группы (8 животных на группу), включающие в себя группу модели, группу NHH, группу NIF и группу TNHH. Крыс в каждой группе анестезировали хлоральгидратом и затем собирали 0,1 мл крови ампутацией хвоста. Крыс фиксировали в стереотаксическом аппарате. Выполняли срединный разрез скальпа (волосистой части кожи головы) и периост (надкостницу) разрезали для обнажения брегмы. Затем проделывали небольшое отверстие с диаметром 1 мм с глубиной для внедрения 5,8 мм (т.е. до положения хвостатого ядра) в участке, который находился на 1 мм сзади относительно брегмы и на 3 мм слева от срединной линии, и затем медленно инъецировали 0,1 мл аутокрови. Балльную оценку дефекта неврологической функции немедленно оценивали на основе критерия оценивания после прихода животного в сознание. В этом исследовании отбирали животное с поведенческой балльной оценкой, меньшей чем 11. Оценивание поведенческого балла проводили непрерывно после установления модели до конца этого эксперимента.

2.2 Наблюдаемый показатель

Балл дефекта неврологической функции оценивали в 5 временных точках 4 ч, 12 ч, 24 ч, 48 ч и 72 ч после установления модели. Изменения содержания воды в головном мозге и гистопатологическое наблюдение выполняли при 72 ч после установления модели на умерщвленных крысах.

2.3 Способы введения

Соответствующие лекарственные средства (2 мг/кг, bid) вводили через хвостовую вену животным с объемом введения 1 мл/100 г в каждой группе после успешного установления модели животного (в соответствии с баллом менее 11 на основе поведенческого балльного оценивания поведения), тогда как группа модели получала физиологический солевой раствор в соответствующем объеме.

2.4 Определение содержания воды головного мозга

Головной мозг извлекали сразу же после умерщвления животных и затем собирали 150-200 г серого вещества коры головного мозга (кору удаляли) на краю гематомы. Содержание воды головного мозга определяли с использованием сухого или сырого способа на основе следующей формулы:

Содержание воды головного мозга = (сырая масса-сухая масса)/сырая масса×100%

2.5 Наблюдение при помощи обычного светового микроскопа

Головной мозг немедленно извлекали декапитацией в определенных временных точках и делали срезы его до толщины 2 мм вдоль венечного шва и затем фиксировали в 10% формальдегиде. Эти срезы окрашивали обычным НЕ (гематоксилином-эозином) и готовили препараты. Затем наблюдали патологические изменения, встречающиеся в патологическом участке и соседних тканях головного мозга.

2.6 Оценка поведенческого (бихевиористического) показателя

Оценивание выполняли при времени 4 ч, 12 ч, 24 ч, 48 ч и 72 ч после хирургии. Этот способ был следующим.

Сгибание передних конечностей наблюдали поднятием крысы за ее хвост. Если передние конечности симметрично простирались в направлении к полу, балльная оценка была равна 0, тогда как, если сгибание кисти, или сгибание локтя, или поворот внутрь плеча, или как сгибание локтя, так и поворот внутрь плеча происходят в отношении передних конечностей на стороне, противоположной участку хирургии, это оценивается баллами 1, 2, 3 и 4 соответственно.

Животное помещают на плоский пол и затем оба плеча заставляют двигаться в направлении противоположной стороны для испытания резистентности. Если эти резистентности на обеих сторонах являются равными или сильными, балл оценивается как 0, тогда как, если эта резистентность уменьшалась слегка, средне или сильно при толкании к противоположной стороне относительно участка хирургии, ее оценивали как 1, 2 или 3 соответственно.

Обе передние конечности этого животного помещали на металлическую сетку для наблюдения напряжения (ригидности) мышц. Крысу с равным или сильным мышечным напряжением обеих передних конечностей оценивали как 0. Таким же образом крысу оценивали как 1, 2 или 3 соответственно при уменьшении мышечного напряжения на противоположной стороне относительно участка хирургии, описанного выше.

Животное, старающееся сохранять переворачивание на одну сторону, оценивали как имеющее балл 1. На основе этого критерия оценивания (с полной шкалой 11) чем выше была оценка, тем тяжелей было нарушение поведения.

3. Результаты

3.1 Сравнение действий NIF, NHH и TNHH на поведенческую оценку крыс с экспериментальной гематомой головного мозга

Из таблицы 5 можно видеть, что поведенческая оценка крыс с экспериментальной гематомой головного мозга значимо улучшалась NIF, NHH и TNHH, и эти результаты в разных группах обработки были значимо или очень значимо отличающимися от оценки в группе модели (P<0,05 и P<0,01).

Таблица 5
Сравнение действий NIF, NHH и TNHH на поведенческое оценивание в крысах, подвергнутых экспериментальной гематоме головного мозга
Группа Животные Поведенческая оценка
4 ч 12 ч 24 ч 48 ч 72 ч
Группа модели 8 2,50±0,84 2,83±0,75 3,83±1,72 5,33±1,63 6,17±1,47
Группа NIF 8 1,86±0,90 2,14± 0,90* 2,43±0,53** 3,14±0,90** 4,14±1,68**
Группа NHH 8 2,14±0,69 1,86±0,90** 2,43±1,00** 2,57±0,13** 3,57±1,72**
Группа TNHH 8 2,00±1,07 2,00±0,76** 2,25±0,46** 2,12±0,64** 2,88±1,46**
В сравнении с группой модели *P<0,05, **P<0,01 являются такими же здесь далее.

3.2 Сравнение действий NIF, NHH и TNHH на содержание воды головного мозга в крысах, подвергнутых экспериментальной гематоме головного мозга

Как показано в таблице 6, NIF, NHH и TNHH могли явно уменьшать содержание воды в головном мозге в крысах, подвергнутых экспериментальной гематоме головного мозга, и имелись различие и значимое различие между группами обработки и модельной группой (P<0,05 и P<0,01).

Таблица 6
Сравнение действий NIF, NHH и TNHH на поведенческую оценку в крысах, подвергнутых экспериментальной гематоме головного мозга
Группы Животные Содержание воды головного мозга (%)
Группа модели 8 83,35±2,07
Группа NIF 8 79,36±0,47**
Группа NHH 8 78,66±0,55**
Группа TNHH 8 78,28±1,97**

3.3 Результаты наблюдений действий NIF, NHH и TNHH на патологические срезы крыс с экспериментальной гематомой головного мозга

Наблюдаемый показатель: отек головного мозга, дегенерация или некроз нервных клеток, демиелинизация нервных волокон, гиперплазия глиальных клеток, инфильтрация воспалительных клеток и интерстициальное кровоизлияние.

Наблюдение на контралатеральном головном мозге в контрольной группе: структура коры головного мозга и головного мозга были ясными, и нервная клетка, глиальная клетка, распределение сосудов и структура сосудов, все, были нормальными, и не встречались гидроцефалия, инфильтрация воспалительных клеток или кровоизлияние.

В группе модели: структура коры головного мозга и головного мозга были неясными, и некоторые нервные клетки стали денатурированными или некротическими, и имели место значительный отек головного мозга и инфильтрация воспалительных клеток и интерстициальное кровоизлияние и гиперплазия глиальных клеток. Степень патологического изменения, описанного выше, была такая, что большинство животных относились к патологическому изменению ++ → +++, в то время как 2 случая относились к патологическому изменению +.

Группа NIF: большинство вышеупомянутых случаев относились к патологическому изменению ± → +, в то время как 3 случая относились к патологическому изменению +→ ++.

Группа NHH: большинство вышеупомянутых случаев относились к патологическому изменению 0 → +, в то время как 3 случая относились к патологическому изменению +→ ++.

Группа TNHH: развивались значимые улучшения вышеупомянутого патологического изменения, и большинство случаев относились к патологическому изменению 0 → ±, в то время как только 2 случая относились к патологическому изменению ±.

4. Выводы

NIF, NHH и TNHH обнаруживали явно терапевтические действия на крысах, подвергнутых экспериментальной гематоме головного мозга, и TNHH имел наиболее очевидные терапевтические действия.

Пример 11: In vitro связывание TNHH с фибрином и тромбином

1. Тест-материалы

1.1 Лекарственные средства

Маточная жидкость TNHH (3,0 мг/мл); фибрин человека (1 г на ампулу, F5386), Sigma company, тромбин человека (127 единиц на ампулу), Партия № 20021105, National Institute for The Control of Pharmaceutical and Biological Products.

1.2 Растворы

Забуференный фосфатом раствор (10 ммоль/л PB, 0,15 моль/л NaCl, pH 7,4); буферный раствор для подвижной фазы хроматографии: 20 ммоль/л NaH2PO4-Na2HPO4, 0,15 моль/л (NH4)2SO4, pH 6,8.

1.3 Оборудование

Термостатическая водяная баня; гель-хроматографическая колонка (Shodex PROTEIN KW-82.5), ВЖХ-система Waters 600, рабочая станция для хроматографии Zhejiang University N2000. Штатив для ЕР-пробирок на 1 мл, множество ЕР-пробирок на 1 мл, пипеттор для 1 мл и наконечники для пипеток.

2. Тест-способы и результаты

2.1 Тест-материалы

Взвесьте TNHH, разбавьте до 1,0 мг/мл раствором фосфатного буфера, и он готов для использования; взвесьте точно фибрин, растворите и разбавьте до 0,1 мг/мл раствором фосфатного буфера, и он готов для использования; взвесьте тромбин, растворите и разбавьте до 100 единиц/мл раствором фосфатного буфера, и он готов для использования.

2.2 Реакция тест-материалов

Согласно приведенным ниже процедурам тест-материалы реагировали при 37°С в течение 1 часа и затем их анализировали при следующих хроматографических условиях.

(1) пипетируйте растворы тест-материалов (20 мкл для каждого), нанося для анализа и регистрируя каждое время удерживания,

(2) пипетируйте растворы фибрина и тромбина (0,5 мл для каждого), смешивая и давая реагировать при 37оС в течение 1 часа и нанося пробу 20 мкл для анализа,

(3) пипетируйте растворы TNHH и фибрина (0,5 мл для каждого), смешивая и давая реагировать при 37°С в течение 1 часа и нанося пробу 20 мкл для анализа,

(4) пипетируйте растворы TNHH и тромбина (0,5 мл для каждого), смешивая и давая реагировать при 37°С в течение 1 часа и нанося пробу 20 мкл для анализа,

(5) пипетируйте TNHH и смесь растворов фибрина и тромбина (0,5 мл для каждого), смешивая и давая реагировать при 37°С в течение 1 часа и нанося пробу 20 мкл для анализа.

2.3 Условия хроматографии

Скорость потока 0,5 мл/мин; длина волны детектирования: 214 нм, температура колонки: комнатная температура; время записи хроматограммы: 25 мин.

2.4 Результаты хроматографии

Таблица 7
Результаты хроматографии SEC-HPLC связывания TNHH с фибрином и тромбином
Пробы время удерживания (мин)
пик 1 пик 2
TNHH (T) 23,657 /
Фибрин (F) 16,680 /
тромбин (t) 18,778 /
тромбин+фибрин (t+F) 12,582 18,578
TNHH+фибрин (T+F) 14,598 /
TNHH+тромбин+фибрин (T+F+t) 10,265 12,772

Анализ результатов: Время удерживания TNHH, фибрина и тромбина было различным в SEP-HPLC, равняясь 23,657, 16,680 и 18,778 мин соответственно, так что они могли быть эффективно разделены. Время удерживания частично связанного тромбина-фибрина было равно 12,582 мин, время удерживания эффективно связанного TNHH-фибрина было равно около 14,598 мин, и время удерживания связанного TNHH, фибрина и тромбина было равно 10,265 мин.

3. Выводы

Время удерживания TNHH, фибрина человека и тромбина человека было различным в SEP-HPLC. При испытанных условиях их смесь показала явные пики белков с более высокой молекулярной массой. Фибрин мог связываться с тромбином, а TNHH данного изобретения мог связываться с фибрином и тромбином. Эти результаты показали, что TNHH мог связываться с фибрином и тромбином in vitro, что позволяет предположить, что гируген, который содержался в TNHH и связывался с фибрином и тромбином, сохранял его пространственную конформацию.

Пример 12: In vitro тест на обратимую реакцию TNHH и тромбина

1. Тест-материалы

1.1 Лекарственные средства

TNHH (3,0 мг/мл); тромбин (127 единиц на ампулу, National Institute for the Control of Pharmaceutical and Biological Products, Lot № 20021105); IMUBIND® Hirudin ELISA (American Diagnostica inc. Product № 853).

1.2 Оборудование

Электротермическая водяная баня (XMTB/H-3000 Shanghai Instrument Group Co., Ltd.); универсальный микропланшет-ридер (Elx-800, BIO-TEK INSTRUMENTS INC.); центрифуга (TGL-16B ShangHai Anting Scientific Instrument Factory).

2. Тест-способы

Добавление 1,27 мл воды в одну ампулу тромбина человека и смешивание с получением раствора 100 единиц/мл; разбавление маточного раствора TNHH водой до 1,0 мг/мл, взятие 0,5 мл полученного таким образом раствора и добавление 0,1 мл раствора тромбина (50 единиц тромбина), проведение реакции при 37оС в течение 2 часов, центрифугирование и сбор супернатанта, разбавление в 10 раз раствором для разведения (согласно инструкции набора IMUBIND® Hirudin ELISA), повторение этого разбавления 6 раз при четырехкратном градиенте, детектирование в соответствии с инструкцией набора IMUBIND® Hirudin ELISA Kit и определение оптической плотности при длине волны 450 нм.

3. Тест-результаты и обсуждения

Ни одна из проб не окрашивалась, и положительно меченный гирудин (содержащийся в этом наборе) имел линейную зависимость. Эти результаты показали, что взаимодействие in vivo между TNHH и тромбином было необратимым. Набор ELISA для гирудина был набором ELISA для специфического связывания с С-пептидом гирудина и определения его концентрации (см. прилагаемую инструкцию) с пределом детектирования 0,1 нг/мл. Согласно сведениям об Angiomax (бивалентном гирудине) пептидная связь между PG в структуре D-FPRP-4×Gly-гируген могла быть гидролизована тромбином, и С-концевой пептидный сегмент, содержащий гируген, высвобождался. Приведенные выше тесты показали, что структура “FPRP-GSGG-гируген” в TNHH данного изобретения не могла быть гидролизована тромбином, и эта комбинация была необратимой.

Пример 13: In vitro анализ действия против агрегации тромбоцитов

1 Тест-материалы

1.1 Лекарственные средства

TNHH (6,0 мг/мл); тромбин человека (127 единиц на ампулу, партия № 20021105, National Institute for the Control of Pharmaceutical and Biological Products). Инъекционный раствор маннита (20% маннит), Beijing Double-crane Pharmaceutical Co., Ltd. Рекомбинантный гирудин (1,0 мг на ампулу), партия № 20050301, хранящийся при 20°С, Fujin Biology and Medicine Company.

1.2 Животные

Здоровые самцы Японских белых кроликов с гигантскими ушами (Giant Ear White Rabbits), масса тела 2,32±0,21 кг, обеспечиваемых Animal Center, Third Military Medical University.

1.3 Оборудование

Самописец для регистрации агрегации тромбоцитов, типа BS634, Beijing Biochemical Instruments Factory

2. Способы эксперимента

Коэффициент агрегации тромбоцитов определяли пункцией центральной артерии уха перед введением, после чего кроликов случайным образом делили на 5 групп (4 в каждой группе) на основе коэффициента агрегации тромбоцитов и массы тела: (1) группа отрицательного контроля (5,12 мг маннита на кг, (2) группа высокой дозы TNHH (4,0 мг/кг), (3) группа средней дозы TNHH (2,0 мг/кг), (4) группа низкой дозы TNHH (1,0 мг/кг) и (5) группа положительного контроля (0,1 мг рекомбинантного гирудина на кг). Кроликам в каждой группе вводили указанную дозу, соответственно, посредством внутривенной инъекции из маргинальной вены уха. Пробы крови брали при времени 15 минут после введения (с таймингом с использованием секундомера) пункцией центральной артерии уха для определения коэффициента агрегации тромбоцитов. Способ определения агрегации тромбоцитов описан следующим образом: пробы крови брали пункцией центральной артерии уха с использованием силикатированного шприца. Использовали 3,8% раствор антикоагулянта цитрата натрия (кровь:антикоагулянт = 9:1). Эту пробу центрифугировали при 200×g в течение 8 минут, и полученный супернатант был обогащенной тромбоцитами плазмой (PRP); затем остальную часть снова центрифугировали при 2200×g в течение 10 минут, и полученный супернатант был бедной тромбоцитами плазмой (PPP). Количество тромбоцитов в PRP было приблизительно 4,0×105/мм3. В соответствии с нефелометрией Борна нефелометрическую пробирку с 200 мкл PRP и маленьким магнитным стержнем помещали в прибор для агрегации тромбоцитов и инкубировали при 37°С в течение 1 минуты. После калибровки с использованием РРР тромбоциты индуцировали для агрегации добавлением индуцирующего тромбина человека (0,76 МЕ/мл) при перемешивании. Действие лекарственных средств на агрегацию тромбоцитов анализировали с использованием кривой агрегации и максимальный коэффициент агрегации получали на основе показаний этого прибора. Максимальный коэффициент агрегации рассчитывали по приведенной ниже формуле:

3. Результаты теста

Таблица 8
Действие TNHH на агрегацию тромбоцитов в кроликах
Группы Доза (мг/кг) Кролики коэффициент агрегации (%, ±SD)
перед введением Спустя 15 мин после введения различие
маннит / 4 58,13±9,61 60,51±9,18 2,38±7,04
Высокая доза 4,0 4 59,23±6,30 9,22±4,51 50,92±4,33*
Средняя доза 2,0 4 59,62±7,22 19,33±10,25 30,30±9,92*
Низкая доза 1,0 4 57,19±4,42 36,27±12,13 20,82±7,98*
гирудин 0,1 4 58,44±4,42 4,34±6,88 54,09±8,69*
* в сравнении с контрольной группой (маннитом) P<0,01

Результаты определений показали, что имелось значимое различие среди групп перед введением в кроликах с индуцированной тромбином агрегацией тромбоцитов. При времени 15 минут после введения коэффициенты агрегации тромбоцитов в группе обработки и группе положительного контроля были значимо более низкими, чем эти результаты группы отрицательного контроля (P<0,01) с явным зависимым от дозы действием.

4. Выводы

Эти результаты показали, что все три дозы TNHH могли значимо уменьшать коэффициент агрегации тромбоцитов в кролике, индуцированной тромбином (P<0,01), при времени 15 мин после введения внутривенной инъекцией из маргинальной вены уха кролика. Было сделано предположение, что TNHH проявлял эффективность ингибирования агрегации тромбоцитов, хотя его эффективность была значительно более низкой, чем эффективность положительного контроля гирудина.

Пример 14: Анализ ингибирования высвобождения H2O2 из лейкоцитов периферической крови человека

1. Тест-материалы

1.1 Получение лейкоцитов периферической крови человека

10 мл венозной крови брали из здоровых людей и добавляли натрий-гепарин для антикоагуляции. 10 мл HAS-буфера (содержащего RPMI 1640+10 mM HEPES+1,2 мМ CaCl2+1,0 мМ MgCl2+1% HAS, pH 7,4) добавляли в эту кровь и перемешивали. Раствор для отделения лейкоцитов (Sangon) вносили в стерильную центрифужную пробирку и смесь цельной крови того же самого объема добавляли медленно и затем центрифугировали при 2000 об/мин в течение 15 минут. Раствор лейкоцитов извлекали из границы раздела и добавляли достаточное количество культуральной среды 1640, центрифугировали в течение 10 минут и дважды промывали. Этот супернатант выбрасывали и добавляли достаточное количество буфера HAS для ресуспендирования этого остатка для получения суспензии лейкоцитов. Плотность клеток определяли счетом и доводили до 4×107/мл. Этот продукт отделяли при 37°С и использовали в пределах часа.

1.2 Лекарственные средства и реагенты

TNHH (1,0 мг/мл, титр против адгезии лейкоцитов 720 единиц/мл); пероксидаза хрена (100 единиц/мг), приобретенная из Shanghai Sangon. FMLP (5 мг на ампулу, F3506), Sigma Company; H2O2, приобретенная из Chongqing Dongshi Chemical Co., Ltd.; буферный раствор для анализа высвобождения был раствором Хенкса, содержащим 25 мМ глюкозу, 10% фетальную телячью сыворотку, 200 мг/мл фенолового красного, 32 мг/мл пероксидазы хрена.

1.3 Оборудование

Универсальный микропланшет-ридер (El×-800, BIO-TEK INSTRUMENTS INC.); центрифуга (TGL-16B ShangHai Anting Scientific Instrument Factory).

2. Тест-способы

Покрытие 24-луночного планшета раствором Хенкса, содержащим 50% фетальную бычью сыворотку, и культивирование при 37°С в течение 60 минут; промывание этого планшета дважды 0,15 М NaCl; разбавление этих клеток до 6,0×106/мл буферным раствором для анализа высвобождения, добавление клеток и культивирование при 37°С в течение 5 минут; добавление FMLP до конечной концентрации 250 нМ; добавление проб TNHH в различных концентрациях и культивирование при 37°С в течение 60 минут; пипетирование клеточной суспензии, центрифугирование при 8000×g в течение 3 минут и сбор супернатанта. Добавление этого супернатанта во множественные лунки 96-луночного ELISA-планшета, добавление 1 н. NaOH (25 мкл) для остановки этой реакции и определение OD при длине волны 610 нм. Расчет IC50-величины TNHH для ингибирования высвобождения H2O2 и использование стандартного раствора H2O2 в качестве контроля.

3. Результаты теста (см. таблицу 9)

Таблица 9
Анализ ингибирования высвобождения H2O2 из лейкоцитов периферической крови человека
Концентрация TNHH (мкг/мл) Средняя величина OD Коэффициент ингибирования (%)
100 0,121 81,99
50 0,135 79,91
25 0,259 61,45
12,5 0,317 50,82
6,25 0,402 40,17
3,125 0,519 22,76
1,562 0,628 6,55
0,781 0,681 -1,3
Контроль 0,672

Коэффициент ингибирования H2O2=(величина OD контроля-величина OD пробы)/величина OD×100%

4. Выводы

Результаты в таблице 9 показали, что величина IC50 TNHH для ингибирования высвобождения H2O2 из лейкоцитов периферической крови человека была равна 8,5 мкг/мл. Было сделано предположение, что TNHH мог ингибировать высвобождение H2O2 из лейкоцитов периферической крови человека, и этот коэффициент ингибирования был равен приблизительно 70% в сравнении с контрольной группой. Было показано, что TNHH мог ингибировать активацию периферических лейкоцитов наряду с ингибированием адгезии лейкоцитов.

Пример 15: In vitro анализ антикоагуляции цельной крови

1. Тест-материалы

1.1 Лекарственные средства

TNHH; натрий-гепарин, Shanghai Sangon; раствор фосфатного буфера (10 ммоль/л PB, 0,15 моль/л NaCl, pH 7,4).

1.2 Животные

Здоровый белый кролик, масса тела 2,49 кг.

1.3 Оборудование

Один бокс для фиксации кролика, два инжектора на 10 мл, один штатив для пробирок, шесть пробирок, пипетка на 1 мл и наконечники для пипетки.

2. Способы и результаты теста

2.1 Разбавление проб

TNHH разбавляли до 4 мг/мл, 2 мг/мл, 1 мг/мл, 0,5 мг/мл соответственно раствором фосфатного буфера (10 ммоль/л PB, 0,15 моль/л NaCl, pH 7,4). Натрий-гепарин готовили до концентрации 1 мг/мл с использованием того же самого буферного раствора.

2.2 Тест-способ

Венозную кровь брали из маргинальной вены уха кролика и быстро добавляли в пробирки 0#-5#. 0,2 мл проб разбавленного TNHH с различными концентрациями добавляли в пробирки 1#-4# соответственно. 0,2 мл раствора фосфатного буфера добавляли в пробирку 0#, которую использовали в качестве отрицательного контроля. 0,2 мл натрий-гепарина (1 мг/мл) добавляли в пробирку 5#, которую использовали в качестве положительного контроля. Эти реагенты быстро перемешивали и хранили при комнатной температуре в течение 15 минут для наблюдения результатов.

3. Результаты (таблица 10)

Таблица 10
Анализ действий in vitro TNHH на антикоагуляцию крови
Пробирка 0#
отрицательный контроль
Пробирка
1#
0,5 мг/мл
Пробирка
2# 1 мг/мл
Пробирка 3#
2 мг/мл
Пробирка 4#
4 мг/мл
Пробирка 5#
Пробирка 5#
положительный контроль
4 мг/мл
Кровь кролика (мл) 1,0 1,0 1,0 1,0 1,0 1,0
TNHH (мл) / 0,2 0,2 0,2 0,2 /
Раствор фосфатного буфера
(мл)
0,2 / / / / /
натрий-гепарин / / / / / 0,2
Результаты теста Коагули-рованная Коагули-рованная Коагули-рованная Коагули-рованная Коагули-рованная Некоагули-рованная

4. Выводы

В растворе фосфатного буфера (отрицательный контроль) кровь была коагулированной, а в растворе гепарина (положительный контроль) кровь не была коагулированной. При различных концентрациях TNHH кровь была коагулированной. Эти результаты показали, что TNHH имел действия антикоагуляции цельной крови in vitro.

Пример 16: Действия TNHH на систему коагуляции крови в новозеландском кролике

1. Экспериментальные материалы

1.1 Тестируемые лекарственные средства

1.1.1 Название: TNHH

Способ приготовления: растворение и разбавление до желаемой концентрации 0,9% инъекционным раствором хлорида натрия.

1.1.2 Название: Бивальрудин (изготовляемый Chengdu Jiexun Biotechnical Co., Ltd.)

Характерный признак: лиофилизированный порошок для инъекции

Спецификация: 1,0 мг на склянку

№ партии: 20071001

Способ хранения: хранение в темном месте при низкой температуре (2~8оС)

Способ приготовления: растворение и разбавление до желаемой концентрации 0,9% инъекционным раствором хлорида натрия.

2.2 Экспериментальные животные

Новозеландский кролик, обеспеченный Thrid Military Medical University (Animal Center, Daping Hospital); номер сертификата экспериментального животного: SCXK2002-008, самец или самка, масса тела 2,5~3,0 кг. Нормальные условия разведения животных (температура 20-25°С; относительная влажность 40-70%; смена дня и ночи 10/14).

2.3 Основные экспериментальные реагенты

Реагент для определения активированного частичного тромбопластинового времени (APTT): France SAGO company: Lot № 061982;

Реагент для определения протромбинового времени (PT): France SAGO company: Lot № 061933;

Реагент для определения тромбинового времени (TT): France SAGO company: Lot № 060201;

Пробирка с цитратом натрия для антикоагуляции: Hubei Jinxing Science & Technology Development Co., Ltd., Lot № 070208.

2.4 Экспериментальный прибор

Полностью автоматический анализатор коагуляции, France DIAGNOSTICA STAGO Co., Ltd., Type: STA.

3. Экспериментальные способы

3.1 Действие TNHH на систему коагуляции крови новозеландских кроликов in vivo

24 новозеландских кролика случайным образом делили на четыре группы: (1) группа 6,75 мг/кг TNHH; (2) группа 3,375 мг/кг TNHH; (3) группа 1,5 мг/кг бивальрудина и (4) группа 0,5 мг/кг гирудина. Лекарственные средства вводили внутривенной инъекцией из маргинальной вены уха и 1,8 мл собирали из маргинальных вен уха во временной точке перед введением (0 мин) и 10 мин, 30 мин, 60 мин, 120 мин и 240 мин после введения соответственно (время для инъекции было равно 2 мин). Добавляли 3,2% цитрат натрия (9:1) для антикоагуляции и затем перемешивали и центрифугировали при 3000 об/мин в течение 3 мин. Плазму отсылали в Department of Clinical Laboratory, Southwest Hospital для определения показателей коагуляции крови (APTT, TT и PT) полным автоматическим анализатором коагуляции и различие перед введением и после введения получали сравнением.

3.2 Действия TNHH на систему коагуляции крови новозеландских кроликов in vitro

Лекарственные средства разбавляли до следующих концентраций для использования: TNHH: 3,0 мг/мл; 1,0 мг/мл; 333 мкг/мл; бивальрудин: 600 мкг/мл; 200 мкг/мл; 67 мкг/мл; гирудин: 660 мкг/мл; 220 мкг/мл; 73 мкг/мл.

Кровь собирали из шести новозеландских кроликов (10×1,8 мл для каждого кролика) из маргинальной вены уха и добавляли в 10 пробирок для определения антикоагуляции соответственно. 3,2% цитрат натрия (9:1) добавляли для антикоагуляции.

20 мкл антикоагулированной крови брали из каждой пробирки с последующим добавлением 20 мкл разведенных, как описано выше, лекарственных средств для каждой пробирки. В контрольную пробирку добавляли 20 мкл физиологического солевого раствора. Пробы перемешивали тщательно и центрифугировали при 3000 об/мин и плазму отсылали в Department of Clinical Laboratory, Southwest Hospital для определения показателей коагуляции крови (APTT, TT и PT) полным автоматическим анализатором коагуляции и различие перед введением и после введения получали сравнением.

4. Статистический анализ

Для статистического анализа использовали программу SPSS 13.0. Эти экспериментальные результаты представлены с использованием Однофакторный дисперсионный анализ использовали для сравнения между группами. p<0,05 обозначает значимое различие, а p<0,01 обозначает очень значимое различие.

5. Экспериментальные результаты

5.1 Действия TNHH на систему коагуляции крови новозеландских кроликов in vivo.

5.1.1 Изменения APTT

Изменения APTT при различных дозах TNHH и при различном времени взятия проб крови были показаны в таблице 11.

Результаты в таблице 11 показали, что в сравнении с контрольной группой 0 не было явного удлинения для APTT в группе 3,375 мг/кг TNHH и в группе 6,675 мг/кг TNHH при 10 мин, 30 мин, 60 мин, 120 мин и 240 мин после введения (P>0,05), что предполагает, что ни одна из вышеуказанных доз не имела явных действий на APTT в пределах 4 часов.

Сходным образом, не было очевидного удлинения для APTT в группе бивальрудина 1,5 мг/кг и группе гирудина 0,5 мг/кг при 10 мин, 30 мин, 60 мин, 120 мин и 240 мин после введения (P>0,05).

Таблица 11
Действия TNHH на APTT в кроликах при различном времени (x±s, n=6)
Время
(мин)
TNHH (мг/кг Бивальрудин (мг/кг) Гирудин
(мг/кг)
3,375 6,675 1,50 0,50
0 36,45±6,60 44,25±5,39 40,7±5,77 38,02±6,54
10 37,38±6,35 39,87±4,98 45,75±7,20 39,97±5,69
30 31,97±2,11 37,98±4,77 39,33±6,62 37,72±5,55
60 31,93±2,39 36,17±6,76 38,03±5,55 35,02±7,59
120 30,52±6,86 38,95±8,85 32,68±4,77* 32,05±5,69
240 35,65±9,36 38,03±9,11 34,57±5,56 32,07±5,97
*: P < 0,05 vs 0 мин;
без *: P>0,05 vs 0 мин

5.1.2 Протромбиновое время плазмы (PT)

Изменения РТ при различных дозах TNHH и различных временных точках взятия крови показаны в таблице 12.

Результаты в таблице 12 показали, что в сравнении с контрольной группой 0 мин не было явного удлинения для PT в группе 3,375 мг/кг TNHH при 10 мин, 30 мин, 60 мин, 120 мин и 240 мин после введения (P>0,05), в то время как было явное удлинение для PT в группе 6,675 мг/кг TNHH при 120 мин и 240 мин после введения (P<0,05). Время удлинения в группе 6,675 мг/кг TNHH было менее 3 секунд, что не имело клинического значения. Было предположено, что низкая доза TNHH (3,375 мг/кг) не имела значимых действий на PT, в то время как высокая доза TNHH (6,675 мг/кг) оказывала определенные действия на РТ, но не была клинически значимой.

Имелось значимое удлинение РТ в группе бивальрудина (1,5 мг/кг) при 10 мин и 30 мин (P<0,05) и в группе гирудина (0,5 мг/кг) при 10 мин (P<0,05). Однако это удлинение было равно менее чем 3 мин, что не имело клинической значимости.

Таблица 12
Действия i.v. TNHH на PT в кроликах в различных временных точках (x±s, n=6)
Время
(мин)
TNHH (мг/кг) Бивальрудин (мг/кг) Гирудин (мг/кг)
3,375 6,675 1,50 0,50
0 6,78±0,28 6,88±0,17 6,87±0,21 6,80±0,28
10 6,90±0,21 7,17±0,36 8,27±0,67* 7,27±0,22*
30 6,85±0,23 7,12±0,47 7,40±0,27* 7,1±0,31
60 6,78±0,22 7,17±0,40 7,10±0,15 6,95±0,34
120 6,87±0,32 7,62±0,64* 7,02±0,12 6,97±0,27
240 7,02±0,24 7,97±0,99* 6,90±0,18 7,08±0,26
*: P< 0,05 vs 0 мин;
без *: P>0,05 vs 0 мин

5.1.3 Тромбиновое время плазмы (TT)

Изменения ТТ при различных дозах TNHH и различных временных точках взятия крови показаны в таблице 13.

Результаты в таблице 13 показали, что в сравнении с контрольной группой 0 мин было явное удлинение для ТТ в группе 3,375 мг/кг TNHH при 10 мин после введения (P<0,05), в то время как не было явного удлинения для времени взятия пробы при 20 мин или позже 20 мин после введения. Имелось явное удлинение для ТТ в группе 6,675 мг/кг TNHH при 10 мин и 30 мин после введения (P<0,05). Было предположено, что низкая доза TNHH (3,375 мг/кг) имела кратковременные действия на ТТ, в то время как высокая доза TNHH (6,675 мг/кг) оказывала определенные действия на ТТ.

Имелось значимое удлинение для ТТ в группе 1,5 мг/кг бивальрудина при 10 мин и 30 мин (P<0,01) и в группе 0,5 мг/кг гирудина при 10 мин, 30 мин и 60 мин (P<0,01).

Таблица 13
Действия TNHH на TT в кроликах в различных временных точках (x±s, n=6)
Время
(мин)
TNHH (мг/кг) Бивальрудин (мг/кг) Гирудин (мг/кг)
3,375 6,675 1,50 0,50
0 15,57±1,09 15,97±1,42 15,28±1,60 16,40±1,73
10 23,23±2,47* 33,57±4,47* 71,18±23,37# 112,70±38,55#
30 16,13±1,31 21,63±1,71* 36,12±14,00# 84,93±49,24#
60 14,75±1,44 15,55±0,95 26,68±7,30 58,17±33,19#
120 14,02±0,79 15,00±1,51 15,40±2,16 30,42±17,09
240 14,65±1,14 13,33±0,73* 15,50±2,36 16,30±2,32
*: P<0,05 vs 0 мин;
#: P<0,01 vs 0 мин;
без * или #: P>0,05 vs 0 мин

5.2 Действия TNHH на систему коагуляции крови новозеландских кроликов in vitro

Результаты в таблице 14 показали, что в сравнении с контрольной группой 0 не было значимого различия для APTT и РТ в группах TNHH низкой, средней и высокой доз (P>0,05) и было явное удлинение для ТТ только в группе TNHH высокой дозы (30 мкг/мл) (P<0,05).

Имелось явное удлинение для APTT, PT и TT только в группе бивальрудина высокой дозы (6 мкг/мл). В группах 2 мкг/мл и 0,67 мкг/мл бивальрудина не было явного удлинения для APTT (P>0,05), в то время как имелось явное удлинение для TT (2 мкг/мл бивальрудина, P<0,05; 0,67 мкг/мл бивальрудина, P<0,01) и PT (P<0,05). Однако время удлинения PT составляло менее чем 3 секунды и, следовательно, не имело клинического значения. В группе 0,73 мкг/мл гирудина не было явного удлинения для APTT и PT (P>0,05), в то время как имелось явное удлинение для TT (P<0,01).

Таблица 14
Действия TNHH на систему коагуляции крови в новозеландском кролике in vitro (x±s, n=6)
Группы (мкг/мл) APTT PT TT
Контрольная группа
(20 мкл NS)
34,28±4,58 7,08±0,27 15,50±1,83
TNHH 30,00 38,08±5,53 7,27±0,38 30,00±4,81*
10,00 31,87±4,46 7,15±0,24 20,43±1,59
3,33 33,73±6,35 7,08±0,28 17,13±1,46
бивальрудин 6,00 55,00±12,4* 11,08±1,20* 85,38±23,07#
2,00 40,75±8,71 8.75±0.52* 53,67±9,03#
0,67 35,12±8,04 7,83±0,39* 43,22±8,13*
гирудин 6,60 58,43±14,36* 9,37±1,30* 116,40±8,82#
2,20 52,85±15,88* 7,87±0,37* 102,77±21,90#
0,73 37,47±6,15 7,33±0,33 50,40±8,19#
*: P<0,05 vs контроля;
#: P<0,01 vs 0 мин;
без* или без #: P>0,05 vs 0 мин

7. Выводы

В том случае, когда вводят дозу, значительно превышающую эффективную дозу для экспериментального терапевтического острого ишемического инсульта головного мозга, TNHH не влияет на эндогенный путь коагуляции крови, хотя проявляет некоторые действия на экзогенный путь коагуляции крови и фибринолитическую систему.

Пример 17: Защитные действия TNHH на очаговую ишемию головного мозга - реперфузионное повреждение в крысах

1. Материалы и оборудование

1.1 Лекарственные средства и оборудование

(1) Хлоральгидрат, China National Medicine Group, Shanghai Chemical Reagent Company

(2) TNHH-продукт, полученный из примера 5

(3) хлорид 2,3,5-трифенилтетразолия, TTC, E.Merck, дополнительно упакованный Sub-packaging Department, Shanghai Chemical Reagent Company, приготовленный с ЗФР, хранящийся в темноте при низкой температуре.

(4) 25% маннит, Wuhan Binhu Double-crane pharmaceutical Co., Ltd., Lot № 070417-504, разбавленный до 4% маннита 10 мМ PB, pH 7,0.

1.2 Оборудование для эксперимента

(1) Коммерчески доступная найлоновая нить 2.5# (производимая в Китае), диаметр 0,22 мм, 0,24 мм, 0,26 мм.

(2) Медицинская нить 4#, производимая в Shanghai Medical sewing needle Factory.

(3) Японские электронные весы высокой точности типа 1472-CHA.

(4) Система программного обеспечения для анализа изображений, Chengdu TME.

1.3 Экспериментальные животные

Крысы Sprague-Dawley (SD), самцы, стандартной категории, масса тела 180-250 г, поставляемые Experimental Animal Center, Tongji Medical College of Huazhong University of Science & Technology. Animal certificate № SYXK (E) 2004-0029

2. Способы

2.1 Получение моделей очаговой ишемии головного мозга в крысах

Модели окклюзии средней артерии головного мозга (MCAO) (на одной стороне) устанавливали по способу Nagasawa [2] с некоторыми модификациями. Процесс операции содержал следующие стадии: взвешивание крыс, выполнение анестезии внутрибрюшинной инъекцией 10% хлоральгидрата (300 мг/кг) и фиксация этих крыс на термостатируемом операционном столе (37±0,5°С). Кожу шеи дезинфицировали спиртовым раствором йода и выполняли срединный разрез кожи, позволяющий разделять тупоконечным инструментом подкожные ткани и мышцы во избежание повреждения щитовидной железы и паращитовидной железы. Общую сонную артерию на одной стороне и ее ответвления наружную сонную артерию и внутреннюю сонную артерию отыскивали до ответвления крылонебной атерии и затем лигировали (перевязывали) крылонебную артерию, внутреннюю сонную артерию и общую сонную артерию соответственно нитями для последующего использования. Небольшое отверстие открывали в месте бифуркации общей сонной артерии и затем найлоновую нить с диаметром 0,23-0,26 мм (этот диаметр должен быть выбран в соответствии с массой животного) вставляли вдоль внутренней сонной артерии в направлении внутричерепной части относительно передней артерии головного мозга с глубиной вставления 17-20 мм, пока она могла двигаться в направлении встречного сопротивления. Эту найлоновую нить лигировали вместе с внутренней сонной артерией. Подкожные фасции и кожу зашивали и затем устанавливали модель окклюзии-реперфузии средней артерии головного мозга вытягиванием этого шва после 1 ч или 2 ч окклюзии. Процесс операции в ложнооперируемой группе был таким же, что и в оперируемой группе, но без окклюзии сосудов найлоновой нитью.

2.2 Оценивание нервных симптомов

После прихода в себя крыс наблюдали изменения нервных симптомов, которые проявлялись в основном в виде:

(1) синдрома Горнера: зрачок на ишемической стороне сморщивался, и глазное яблоко опускалось внутрь, глазные щели уменьшались, и мышечное напряжение соответственно повышалось; в то время как глазное яблоко на неишемической стороне слегка выступало, а зрачок и глазные щели были нормальными, и мышечное напряжение уменьшалось;

(2) положения тела: при поднятии за хвост крысы принимали напряженную позу и тело поворачивалось к неишемической стороне. Передняя конечность на неишемической стороне плотно прижималась к груди, тогда как передняя конечность и задняя конечность на ишемической стороне вытягивались наружу;

(3) синдрома ловли хвоста: тело вращалось в направлении неишемической стороны при движении, которое было подобно ловле собственного хвоста. Когда это вращение останавливалось, хвост закручивался в особой спиральной форме.

Нервный симптом оценивали на основе 5-уровневого стандарта Лонга [3]. Этот стандарт градации был описан следующим образом: отсутствие симптома нервного повреждения: 0; левая передняя лапка не могла полностью распрямляться: 1; поворачивание в направлении неишемической стороны: 2; падение в направлении неишемической стороны во время хождения: 3; неспособность самостоятельного хождения и потеря сознания: 4.

2.4 Окрашивание при помощи ТТС

Принцип окрашивания при помощи ТТС: TTC (хлорид 2,3,5-трифенилтетразолия) существует в восстановленной форме (красной) и окисленной форме (бесцветной). NADPH в ткани нормального головного мозга может восстанавливать бесцветный TTC в окисленной форме в красный TTC в восстановленной форме. Ишемия головного мозга приводит к ишемическому некрозу нервных клеток в поврежденной зоне и потере NADPH, который является ответственным за восстановление ТТС, и такой участок ткани головного мозга обнаруживает нестандартный белый цвет. В отличие от этого ткань нормального головного мозга обнаруживает красный цвет, происходящий из присутствия NADHP, который может восстанавливать окисленный ТТС в восстановленный ТТС, разграничивая таким образом зону ишемического повреждения и неишемическую ткань нормального головного мозга.

Способ окрашивания при помощи ТТС: После 48 часов ишемии-реперфузии крыс умерщвляли декапитацией. Головной мозг собирали с обонятельной луковицей, мозжечком и нижним стволом головного мозга и затем замораживали при -20°С в течение 10 мин. Делали срезы вдоль венечной части хиазмы (перекреста зрительных нервов) с получением 7 срезов головного мозга (толщина 2 мм). Эти срезы помещали в 2% раствор TTC, инкубировали в темноте при 37°С в течение 30 минут и фиксировали в 10% формальдегиде.

2.5 Определение объема инфаркта головного мозга

Объем инфаркта головного мозга: Эти срезы размещали должным образом и фотографировали цифровой камерой. Затем эти фотографии вводили в компьютер, анализировали с использованием аналитического программного обеспечения (см. способы в ссылке [4]) и рассчитывали процент инфаркта. Формула расчета: процент инфаркта (%) = площадь участка белого цвета/общая площадь всего головного мозга ×100%.

2.6 Разделение на группы и введение

1. Группа слепого контроля: не применяли никакой обработки, кроме кормления при тех же самых условиях

2. Группа ложной операции: подвергнутая тому же самому процессу операции, что и Группа модели, за исключением блокирования сосуда

3. Группа модели: эмболизация для 1-часовой реперфузии в течение 48 часов

Ишемия для 2-часовой реперфузии в течение 48 часов

4. Модели крыс случайным образом делили на группы трех доз:

Группа ишемия 60 мин-реперфузия 2 ч, i.v. введение TNHH 0,75 мг/кг;

Группа ишемия 60 мин-реперфузия 2 ч, i.v. введение TNHH 2,25 мг/кг;

Группа ишемия 60 мин-реперфузия 2 ч, i.v. введение TNHH 6,75 мг/кг;

Группа ишемия 120 мин-реперфузия 2 ч, i.v. введение TNHH 0,75 мг/кг;

Группа ишемия 120 мин-реперфузия 2 ч, i.v. введение TNHH TNHH 2,25 мг/кг;

Группа ишемия 120 мин-реперфузия 2 ч, i.v. введение TNHH TNHH 6,75 мг/кг.

5. Группа контроля-носителя

Группа ишемия 60 мин-реперфузия 2 ч, i.v. введение 4% маннита;

Группа ишемия 120 мин-реперфузия 2 ч, i.v. введение 4% маннита.

Способ введения: внутривенная инъекция (2 мин), дважды в день с интервалом по меньшей мере 8 часов; введение при времени 2 часа после реперфузии MCAO; объем введения: 0,5 мл/животное/время.

Время введения: первый день: введение при 2 ч и 10 ч после реперфузии соответственно; второй день: введение дважды в день с интервалом 8 часов; продолжительность эксперимента: умерщвление крыс после 48 часов от первого введения.

2.6 Статистический анализ

Экспериментальные данные представлены в виде среднего ±S.E.M. Анализ значимого различия выполняли с использованием однофакторного ANOVA, критерия post-hoc LSD и независимого Т-критерия с использованием программы SPSS 11.5. p<0,05 обозначает значимое различие, а p<0,01 обозначает очень значимое различие.

3. Результаты

3.1 Действия TNHH на симптом нервного поведения крысы с MCAO

Значимая невральная двигательная дисфункция встречалась в крысе с окклюзией в течение 1 часа и реперфузией в течение 48 часов. При поднимании этой крысы за хвост наблюдали симптом ловли хвоста, включающий в себя левую переднюю конечность, согнутую для сокращения внутрь, и уменьшенное мышечное напряжение в другой конечности, и крыса имела тенденцию поворачивания в направлении неишемической стороны при хождении. Эти симптомы прогрессирующим образом усугублялись во время наблюдения. Оценивание нервного симптома было следующим: 1,77±0,59 при 2 ч; 1,73±0,59 при 6 ч; 1,73±0,42 при 12 ч; 1,83±0,49 при 24 ч; 1,87±0,58 при 48 ч. Внутривенную инъекцию TNHH (с введением доз и делением на группы такими же, какие были описаны выше) выполняли при 2 ч после реперфузии, и этот симптом животных в разных группах обработки ослаблялся в разных временных точках, что было особенно значимым в группе высокой дозы с очень значимым статистическим различием (P<0,01) в сравнении с симптомом в группе модели. Этот симптом нервной функции крыс с MACO, имеющих окклюзию в течение 2 ч и реперфузированных в течение 48 ч, был более тяжелым, чем у крыс с MACO, имеющих окклюзию в течение 1 часа и реперфузированных в течение 48 часов. Оценивание этого нервного симптома было следующим: 1,96±0,75 при 2 ч; 2,19±0,69 при 6 ч; 2,32±0, при 12 ч; 2,12±0,79 при 24 ч; 2,23±0,69 при 48 ч. Этот нервный симптом крыс, обработанных TNHH, также значимо улучшался, и это было более значимым в группе высокой дозы. Это различие было статистически значимым (p<0,05) в сравнении с различием в соответствующей группе модели. Этот симптом крыс не улучшался значимо введением 4% маннита в группе контроля с носителем в сравнении с симптомом в группе-модели. Результаты этого эксперимента представлены в таблице 15.

3.2 Действия TNHH на объем инфаркта головного мозга в крысах с MCAO-реперфузией

После окклюзии MCAO в течение 1 часа и затем реперфузии в течение 48 часов, объем инфаркта головного мозга крыс был (22,281±4,71)%. Внутривенная инъекция TNHH при 2 ч после реперфузии приводила к уменьшенному объему инфаркта головного мозга: группа низкой дозы: (19,93±12,40)%; группа средней дозы: (19,41±11,74)% и группа высокой дозы: (12,89±8,94)%, уменьшающемуся на 10,54%, 12,88% и 42,14% соответственно в сравнении с объемом группы модели. Эффект группы высокой дозы было наиболее значимым в сравнении с эффектом группы модели (P<0,01). После окклюзии MCAO в течение 2 ч и затем реперфузии в течение 48 часов, объем инфаркта головного мозга крыс был (28,16±10,90)%. Обработка такой же дозой TNHH приводила к уменьшенному объему инфаркта головного мозга: группа низкой дозы: (27,52±17,63)%; группа средней дозы: (26,07±8,06)% и группа высокой дозы: (19,72±8,90)%, уменьшающемуся на 3,63%, 7,42% и 29,97% соответственно в сравнении с объемом группы модели. Действие группы высокой дозы было наиболее значимым в сравнении с действием группы модели (P<0,01). 4% маннит вводили в группу контроля с носителем, и он не показал улучшенных действий на объем инфаркта головного мозга животных в сравнении с двумя группами модели. Эти экспериментальные результаты показаны в таблице 16.

Таблица 15
Действие TNHH на нервные симптомы после 48 ч острой очаговой ишемии головного мозга-реперфузии в крысах (±s, n=10)
балл нервного симптома (время: ч)
Группы 2 6 12 24 48
Контрольная
группа
0 0 0 0 0
Ложноопери-рованная группа 0 0 0 0 0
м-1 1,77±0,59 1,73±0,59 1,73±0,42 1,83±0,49 1,87±0,58
М-2 1,96±0,75 2,19±0,69 2,32±0,82 2,12±0,79 2,23±0,69
М-1 0,75 мг/кг 1,46±0,58 1,42±0,60 1,42±0,60 1,40±0,43 1,36±0,62
2,25 мг/кг 1,47±0,92 1,47±0,92 1,37±0,92 1,38±0,41 1,30±0,76
6,75 мг/кг 1,50±0,58 1,50±0,68 1,39±0,65 1,20±0,36 1,00±0,42 ∗∗
М-2 0,75 мг/кг 1,94±0,56 1,94±0,56 1,94±0,73 1,88±0,64 1,86±0,77
2,25 мг/кг 1,81±0,92 1,80±0,92 1,79±0,92 1,68±0,41 1,67±0,76
6,75 мг/кг 1,75±0,52 1,75±0,27 1,50±0,45 1,37±0,52 1,22±0,38∗∗
М-1+ маннит 1,49±0,92 1,47±0,69 1,47±0,77 1,50±0,65 1,50±0,76
М-2+ маннит 1,51±0,98 1,49±0,92 1,49±0,92 1,50±0,41 1,58±0,78
* В сравнении с группами-моделями P<0,05: указывает значимое различие;
** В сравнении с группами-моделями P<0,01: указывает очень значимое различие P<0,01
Таблица 16
Действие TNHH на объем инфакта головного мозга после 48 ч острой очаговой ишемии головного мозга-реперфузии в крысах (±s, n=10)
Группы Дозы (мг/кг) Объем инфаркта головного мозга (%) на основе общего объема головного мозга Уменьшение в процентах (%) в сравнении с соответствующей группой-моделью
Группа слепого контроля 0
Ложнооперированная группа 0
м-1 0 22,28±8,46
м-2 0 28,16±10,90
м-1 0,75 19,93±12,40 10,54
2,25 19,41±11,74 12,88
6,75 12,89±8,94 42,15∗∗
М-2 0,75 27,52±7,63 3,63
2,25 26,07±8,06 7,42
6,75 19,72±5,90 29,97∗∗
М-1+4% маннит 0,5 мл 24,18±9,45 +8,52
М-2+4% маннит 0,5 мл 27,68±10,06 1,70
* В сравнении с группами-моделями P<0,05: указывает значимое различие;
** В сравнении с группами-моделями P<0,01: указывает очень значимое различие P<0,01

Хотя конкретные варианты осуществления этого изобретения были описаны здесь подробно, это было сделано в качестве примера и только для целей иллюстрации. Очевидно, что могут быть произведены различные изменения в отношении этого изобретения в свете приведенного выше описания. Исчерпывающий перечень всех вариантов осуществления не требуется и является необязательным. Эти очевидные изменения или модификации в пределах сущности этого изобретения будут находиться в объеме данного изобретения.

1. Рекомбинантный химерный белок фактора ингибирования нейтрофилов (NIF) и гиругена, специфически связывающий тромбин, выбранный из группы состоящей из:
(1) белка со следующей структурой:
Met-NIF-линкер 1 -FPRP-линкер 2-гируген,
(2) белка со следующей структурой:
NIF-линкер 1-FPRP-линкер 2-гируген,
где линкер 1 представляет собой (G)m, a m равно целому числу от 5 до 15;
где линкер 2 представляет собой (GSGG)n, a n равно целому числу от 1 до 3.

2. Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена по п.1, где фенилаланин (F) в FPRP находится в L-форме.

3. Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена по п.2, где m равно 5, а n равно 1.

4. Рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена по п.2, имеющий последовательность SEQ ID NO:3.

5. Полинуклеотидная последовательность, кодирующая рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена, которая является последовательностью SEQ ID NO:2.

6. Вектор экспрессии, содержащий полинуклеотидную последовательность по п.5.

7. Вектор экспрессии по п.6, где этот вектор экспрессии является вектором рЕТ.

8. Микроорганизм в качестве клетки-хозяина, экспрессирующий полинуклеотидную последовательность по п.5, содержащий вектор экспрессии по п.6 или 7.

9. Микроорганизм по п.8, где этим микроорганизмом является Escherichia coli.

10. Фармацевтическая композиция, ингибирующая агрегацию тромбоцитов или ингибирующая активацию периферических лейкоцитов, включающая рекомбинантный химерный белок фактора ингибирования нейтрофилов и гиругена по любому из пп.1-4.

11. Фармацевтическая композиция по п.10, которая находится в форме парентеральной композиции.

12. Применение рекомбинантного химерного белка фактора ингибирования нейтрофилов и гиругена по любому из пп.1-4 для получения лекарственного средства для лечения кардио-цереброваскулярного заболевания или профилактики ишемического повреждения головного мозга или гематомы головного мозга, ингибированием агрегации тромбоцитов или ингибированием активации периферических лейкоцитов.

13. Применение по п.12, где кардио-цереброваскулярным заболеванием является инсульт головного мозга.



 

Похожие патенты:

Изобретение относится к способу выделения рекомбинантных белков из трансформированных хозяев. .

Изобретение относится к области медицины и касается способов лечения заболеваний антагонистами VEGF. .

Изобретение относится к области генной инженерии, конкретно к носителям для доставки лекарственного средства, и может быть использовано в медицине. .

Изобретение относится к биотехнологии, в частности к области модификации гликозилирования белков. .

Изобретение относится к биотехнологии. .

Изобретение относится к области биотехнологии, конкретно к получению генно-инженерных вакцин, и может быть использовано в медицине. .

Изобретение относится к области генной и белковой инженерии и может быть использовано в медико-биологической промышленности. .

Изобретение относится к области биотехнологии и медицины, а именно к прямым ингибиторам тромбина. .

Изобретение относится к области генной инженерии, конкретно к носителям для доставки лекарственного средства, и может быть использовано в медицине. .

Изобретение относится к области биотехнологии и может быть использовано для получения фактора VII свертывания крови человека. .

Изобретение относится к области молекулярной биологии и может быть использовано в медицине. .

Изобретение относится к области биотехнологии и биохимии и может быть использовано в медицине. .

Изобретение относится к биотехнологии и может быть использовано в селекции организмов, например растений. .

Изобретение относится к новым ДНК-соединениям и клинирующим векторам рекомбинантной ДНК, кодирующим новые зимогенные формы человеческого белка С. .

Изобретение относится к области биотехнологии, а именно к способу получения мутантной молочной бактерии вида Streptococcus thermophilus, молочной закваске, способу получения ферментированного молочного продукта и к ферментированному молочному продукту.
Наверх