Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов



Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов
Способ получения препаративных количеств вирусных частиц флоэмно-органиченных вирусов

 


Владельцы патента RU 2555534:

Федеральное государственное бюджетное образовательное учреждение высшего образования "Московский государственный университет имени М.В. Ломоносова" (МГУ) (RU)

Изобретение относится к биотехнологии и фундаментальной вирусологии. Предложен способ получения препаративных количеств вирусных частиц, имитирующих вирионы вируса скручивания листьев картофеля (ВСЛК). Способ предусматривает получение химерного вируса путем вставки гена белка оболочки икосаэдрического низкокопийного флоэмно-ограниченного вируса (ИНФОВ) в эффективный вирусный вектор на основе РНК тобамовируса. Далее проводят заражение растения полученным химерным вирусом для размножения и его накопления в тканях растений. В заключении проводят выделение химерного вируса из тканей растения. Также описаны плазмида для осуществления такого способа, препарат химерного вируса, получаемого с помощью описанного способа, способ получения антисыворотки к природным изолятам ВСЛК и ее использование. Изобретение может быть использовано в области сельского хозяйства. 7 н. и 3 з.п. ф-лы, 12 ил.

 

Изобретение относится к биотехнологии и фундаментальной вирусологии.

Сущность изобретения заключается в разработке способа получения препаративных количеств химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус (ИНФОВ) растений. Для осуществления способа химерный вирус, имитирующий ИНФОВ растений, получают путем вставки гена белка оболочки ИНФОВ в эффективный вирусный вектор на основе РНК тобамовируса, способного распространяться в растении. При заражении растений полученным химерным вирусом, вирус размножается и накапливается в растении, что позволяет выделить его из тканей растения в препаративных количествах (сотни мг - граммы из 1 кг растительной ткани).

Таким образом, объектом изобретения является способ получения препаративных количеств химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус (ИНФОВ) растений, включающий получение химерного вируса путем вставки гена белка оболочки ИНФОВ в эффективный вирусный вектор на основе РНК тобамовируса, способного распространяться и накапливаться в растении, после чего осуществляют системное заражение растений полученным химерным вирусом для размножения и накопления его в тканях растения с последующим выделением химерного вируса из тканей растения в препаративных количествах.

Химерный вирус представляет собой химерную РНК, транскрибированную с ДНК-вектора, состоящую из генома тобамовируса и гена капсидного белка целевого вируса низкокопийного флоэмно-ограниченного вируса растений, причем белок оболочки упаковывает РНК тобамовирусного генома в икосаэдр. Для системного заражения растения химерным вирусным вектором может быть использована техника агроинокуляции.

Объектом изобретения является также антисыворотка к капсидному белку химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус (ИНФОВ) растений, полученная способом, включающим иммунизацию животных химерными вирусными частицами, полученными вышеуказанным способом.

В качестве икосаэдрического низкокопийного флоэмно-ограниченного вируса растений может быть использован вирус скручивания листьев картофеля (ВСЛК). В частности, реализация способа показана на примере получения препаративных количеств вирусных частиц (сотни мг - граммы в 1 кг растительной ткани), имитирующих вирионы вируса скручивания листьев картофеля, для получения антисыворотки к ВСЛК.

Таким образом, объектом изобретения является также способ получения препаративных количеств вирусных частиц, имитирующих вирионы вируса скручивания листьев картофеля (ВСЛК), для осуществления которого получают генно-инженерную плазмиду TVCV-PLRV-CP с нуклеотидной последовательностью SEQ ID NO: 1. При этом получение химерного вирусного вектора включает следующие этапы:

а) клонирование кДНК вируса просветления жилок турнепса (ВПЖТ, TVCV), принадлежащего к тобамовирусам, с транскрипционным промотером с одной стороны и терминатором транскрипции с другой в агробактериальный вектор pCambia1300;

б) вставку гена белка оболочки ВСЛК из плазмиды pBNUP110 вместо гена собственного тобамовирусного гена белка оболочки.

Для системного заражения растений осуществляют трансформацию агробактерии штамма GV3101 плазмидой TVCV-PLRV-CP, после чего заражают растения Nicotiana benthamiana вирусной химерной ДНК путем впрыскивания суспензии трансформированных плазмидой TVCV-PLRV-CP агробактерий шприцом со снятой иглой в межклетники листьев растения. Выделение химерного вируса из тканей растения осуществляют путем гомогенизации листьев в блендере в 5 объемах 0.1М цитратного буфера с pH 6.0 с 0.1% 2-меркаптоэтанолом, корректировки pH до 7.0 с помощью 0.5M Na2HPO4, добавления 1% Triton X-100, перемешивания гомогената листьев в этом буфере 30 мин на льду, отделение дебриса центрифугированием при 10.000g с последующим осветлением супернатанта 1/4 V хлороформа и высаживанием химерного вируса на ультрацентрифуге при 40.000g в течение 90 мин через 20% сахарозную подушку.

Объектом изобретения является также плазмида TVCV-PLRV-CP с нуклеотидной последовательностью SEQ ID NO: 1, которая может быть использована для получения препаративных количеств химерного вируса, имитирующего вирус скручивания листьев картофеля.

Кроме того, объектом изобретения является также препарат химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус растений, полученный вышеуказанным способом. В частности, препарат химерного вируса, в котором в качестве икосаэдрического низкокопийного флоэмно-ограниченного вируса растений используют вирус скручивания листьев картофеля (ВСЛК), может быть получен с использованием плазмиды TVCV-PLRV-CP.

Объектом изобретения является также способ получения антисыворотки к природным изолятам ВСЛК, включающий иммунизацию животных препаратом, полученным вышеуказанным способом с использованием плазмиды TVCV-PLRV-CP.

Объектами изобретения являются также антисыворотка к природным изолятам вируса скручивания листьев картофеля, полученная вышеуказанным способом, и применение такой антисыворотки для диагностики инфицированных природными изолятами ВСЛК растений.

ВСЛК вызывает снижение урожайности картофеля от 20% до 70% в зависимости от устойчивости сорта картофеля и количества тли. Клубни, собранные от больных растений, более мелкие и имеют сетчатый некроз сосудистой системы (Фиг. 1), то есть теряют товарный вид и плохо хранятся. Вторичная инфекция, которая происходит при выращивании картофеля из зараженных клубней, приводит к еще большим потерям.

Вирус передается с помощью тлей и является флоэмно-ограниченным, в связи с чем, крайне плохо накапливается в растении, т.к. доля флоэмной ткани составляет десятые доли процента от общего числа клеток, в которых могут накапливаться другие вирусы растений, такие как тобамовирусы. Из-за некротизации флоэмы (проводящих пучков) отмирают черешки листьев и стебель растения, которое быстро из-за этого погибает. Из одного килограмма зараженного материала можно получить всего от 0.4 до 1.3 мг вируса.

Основная проблема получения препаративных количеств ВСЛК состоит в его эффективной экстракции из жестких проводящих пучков и очистке от примесей совыделяющихся растительных белков. Например, в работе A. Poison «Purification of Potato Leaf Roll Virus» // Preparative Biochemistry, 1993. - V.23, N 1-2. P.267-271, приводятся данные по эффективной очистке ВСЛК, который был выделен из заражённых растений. Эффективность метода заключается в получении препарата вируса со степенью очистки более 20%. При этом общее количество ВСЛК остаётся на уровне 1,3 мг вируса на 1 кг заражённого растительного материала. Такая чистота препарата совершенно недостаточна для иммунизации с целью получения антисыворотки к вирусу для ее последующего использования в диагностике зараженного картофеля.

УРОВЕНЬ ТЕХНИКИ

Для получения больших количеств белка оболочки ВСЛК, годного для иммунизации было предпринято несколько попыток его экспрессии в E. coli. Следует заметить, что в E. coli белок оболочки ВСЛК накапливается плохо, в том числе и из-за содержания большого количества редких для бактерии кодирующих аминокислоты триплетов. Блок из двух и более редких кодонов, идущих подряд в начале последовательности, почти непроходим для прокариотической рибосомы. Ниже приведен анализ редких кодонов в гене белка оболочки ВСЛК, выполненный в программе RACC (http://nihserver.mbi.ucla.edu/RACC/).

RaCC results:

Жирным шрифтом и прописными буквами выделены редкие кодоны Arg: AGG, AGA, CGA

Жирным шрифтом и прописными буквами курсивом выделен редкий кодон Leu: CTA

Прописными буквами выделен редкий кодон Ile: ATA

Прописными буквами курсивом выделен редкий кодон Pro: CCC

atg agt acg gtc gtg gtt aaa gga aat gtc aat ggt ggt gca cac caa cca AGA AGG CGA AGA AGG caa tcc ctt cgc AGG cgc gct aac AGA gtt cag cca gtg gtt atg gtc acg gcc cct ggg caa CCC AGG cgc CGA AGA cgc AGA AGA gga ggc aat cgc cgc tca aga aga act gga gtt CCC CGA gga CGA ggc tca agc gag aca ttc gtg ttt aca aag gac aac ctc atg ggc aac tcc caa gga agt ttc acc ttc ggg ccg agt CTA tca gac tgt ccg gca ttc aag gat gga ATA ctc aag gcc tac cat gag tat aag atc aca agc atc tta ctt cag ttc gtc agc gag gcc tct tcc acc tcc tcc ggt tcc atc gct tat gag ttg gac CCC cat tgc aaa gta tca tcc ctc cag tcc tac gtc aac aag ttc caa att acg aag ggc ggc gcc aaa att tat caa gcg cgg atg ATA aac ggg gta gaa tgg cac gat tct tct gag gat cag tgc cgg ATA ctg tgg aag gga aat gga aaa tct tca gat acc gca gga tcc ttc AGA gtc acc att AGG gtg gct ttg caa aac CCC aaa

Однако этот рекомбинантный белок накапливается в клетках E. coli в виде телец включения, которые необходимо растворять в хаотропных агентах для последующей ренатурации белка. Выход растворимого белка после ренатурации составляет несколько процентов с неизвестной конформацией, что ухудшает его иммунологические свойства. Кроме того, если белок оболочки не собрать потом в вирусный капсид, то антитела будут нарабатываться и на ту часть белка, которая у вируса находится внутри капсида (внутренняя поверхность). Такие антитела будут бесполезны в ИФА. Нужно упомянуть, что вирусные икосаэдры обладают большей иммуногенностью, чем отдельные капсомеры и имеют несколько другие антигенные детерминанты по сравнению со свободным белком из-за изменения конформации в процессе сборки в вирион. Можно экспрессировать в E. coli не весь белок оболочки, а только эпитопы, состоящие из нескольких аминокислот, которые расположены на поверхности икосаэдра.

Европейским патентом EP1758925 “RECOMBINANT ICOSAHEDRAL VIRUS LIKE PARTICLE PRODUCTION IN PSEUDOMONADS” защищено право на использование технологии получения рекомбинантных частиц икосаэдрических вирусов в результате клеточной экспрессии капсидных белков таких вирусов в псевдомонадах в условиях in vivo.

Всего на тему получения химерных вирусных частиц, в том числе для разработки иммунохимических технологий диагностики ВСЛК, нами обнаружено 9 патентов и 11 печатных работ. На наш взгляд, существующие аналоги разработанного нами способа получения препаративных количеств антигенов флоэмно ограниченных вирусов, не позволяют получать ВСЛК более 1,3 мг вируса на 1 кг заражённого растительного материала.

Однако массовую диагностику зараженности сельскохозяйственных растений традиционно проводят методами иммунохимической или иммуноферментной молекулярной диагностики, в которых используются антисыворотки или антитела к вирусному антигену. В связи с чем является актуальной разработка способов получения препаративных количеств вирусных частиц, имитирующих вирионы ВСЛК, необходимых для получения антисыворотки к ВСЛК.

Поскольку иммуногенность цельных вирусных икосаэдров самая высокая, была поставлена задача обеспечения сборки вириона ВСЛК в нативных для него условиях, а именно в растениях. Для хорошего накопления продукта с помощью вирусного вектора необходимо, чтобы вектор имел эффективную полимеразу для амплификации генома, транспортный белок, функционирование которого не зависело бы от собственного белка оболочки. Кроме того, ген белка оболочки должен иметь эффективный промотер. Важно, что экспрессируемый белок оболочки должен быть способен инкапсидировать чужую (векторную) РНК, т.е. не зависеть от ориджина («точки» начала) сборки или иметь его в своей нуклеотидной последовательности. Наиболее полно этим условиям соответствует тобамовирусный вектор на основе TVCV. Таким образом, для решения поставленной задачи ген белка оболочки ВСЛК экспрессировали с помощью тобамовирусного вектора.

СОЗДАНИЕ ХИМЕРНОЙ ПЛАЗМИДЫ

Для решения поставленной задачи были использованы генно-инженерные подходы. Разработана оригинальная генноинженерная конструкция рекомбинантная ДНК, способная экспрессировать РНК тобамовируса и капсидный белок ВСЛК.

Элементы конструкции плазмиды TVCV-PLRV-CP

/обозначение="RB-right border T-DNA repeat"

247- Элемент конструкции 272

Необходим для переноса ДНК из агробактерии в ядро растительной клетки.

Элемент конструкции 1313-2313

/обозначение="STA region from pVS1 plasmid"

Функция - обеспечивает стабильность плазмиды в клетке Agrobacterium tumefaciens.

Элемент конструкции 2906-3906

/обозначение="pVS1-REP; replication origin from pVS1"

Функция - репликация плазмиды в клетках Agrobacterium tumefaciens.

Элемент конструкции 4316-4576

/обозначение="bom site from pBR322" (basis of mobilization)

Функция - перенос ДНК с помощью коньюгации у E. coli.

Элемент конструкции 4716-4996

/обозначение="pBR322 origin of replication"

Функция - репликация плазмиды в клетках E. coli.

Элемент конструкции 5287-6081

/обозначение="Km-aminoglycoside phosphotransferase" - фермент, который обеспечивает устойчивость к антибиотику канамицину, необходимую для селекции целевых клеток E.coli, устойчивых к канамицину.

Первичная структура фермента: «MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF»

Элемент конструкции 6506-6531

/обозначение="LB-left border repeat"

Необходим для переноса ДНК из агробактерии в ядро растительной клетки.

Элемент конструкции 6598-6783

/обозначение="CaMV 3'UTR "

Функция - терминатор транскрипции.

Элемент конструкции 1-168

/обозначение="LacZ alpha fragment"

Функция - лактозный оперон с сайтами рестрикции.

Элемент конструкции 6812-7598

/обозначение="AtAct2Prom"

Функция - промотор транскрипции для клеточной РНК-полимеразы II гена актина из арабидопсиса (Arabidopsis thaliana).

Элемент конструкции 7667-12469

/обозначение="RdRp" Функция-РНК-зависимая РНК-полимераза, функция-размножение РНК вируса.

Первичная структура фермента: «MAQFQQTIDMQTLQAAAGRNSLVNDLASRRVYDNAVEELNARSRRPKVHFSKAVSTEQTLIATNAYPEFEISFTHTQSAVHSLAGGLRSLELEYLMMQVPFGSLTYDIGGNFSAHLFKGRDYVHCCMPNLDVRDIARHEGHKEAIYSYVNRLKRQQRPVPEYQRAAFNNYAENPHFVHCDKPFQQCELTTAYGTDTYAVALHSIYDIPVEEFGSALLRKNVKTCFAAFHFHENMLLDCDTVTLDEIGATFQKSGDNLSFFFHNESTLNYTHSFSNIIKYVCKTFFPASQRFVYHKEFLVTRVNTWYCKFTRVDTFTLFRGVYHNNVDCEEFYKAMDDAWHYKKTLAMLNAERTIFKDNAALNFWFPKVRDMVIVPLFDASITTGRMSRREIMVNKDFVYTVLNHIKTYQAKALTYANVLSFVESIRSRVIINGVTARSEWDTDKAILGPLAMTFFLITKLGHVQDEIILKKFQKFDRTTNELIWTSLCDALMGVIPSVKETLVRGGFVKVAEQALEIKVPELYCTFADRLVLQYKKAEEFQSCDLSKPLEESEKYYNALSELSVLENLDSFDLEAFKTLCQQKNVDPDMAAKVVVAIMKSELTLPFKKPTEEEISESLKPGEGSCAEHKEVLSLQNDAPFPCVKNLVEGSVPAYGMCPKGGGFDKLDVDIADFHLKSVDAVKKGTMMSAVYTGSIKVQQMKNYIDYLSASLAATVSNLCKVLRDVHGVDPESQEKSGVWDVRRGRWLLKPNAKSHAWGVAEDANHKLVIVLLNWDDGKPVCDETWFRVAVSSDSLIYSDMGKLKTLTSCSPNGEPPEPNAKVILVDGVPGCGKTKEIIEKVNFSEDLILVPGKEASKMIIRRANQAGVIRADKDNVRTVDSFLMHPSRRVFKRLFIDEGLMLHTGCVNFLLLLSQCDVAYVYGDTKQIPFICRVANFPYPAHFAKLVADEKEVRRVTLRCPADVTYFLNKKYDGAVMCTSAVERSVKAEVVRGKGALNPITLPLEGKILTFTQADKFELLEKGYKDVNTVHEVQGETYEKTAIVRLTSTPLEIISSASPHVLVALTRHTTCCKYYTVVLDPMVNVISEMEKLSNFLLDMYRVEAGVQYQLQIDAVFRDSNLFVQTPKSGDWRDMQFYYDALLPGNSTILNEFDAVTMNLRDISLNVKDCRIDFSKSVQLPKEQPIFLKPKIRTAAEMPRTAGLLENLVAMIKRNMNAPDLTGTIDIEDTASLVVEKFWDSYVDKEFSGTNEMTMTRESFSRWLSKQESSTVGQLADFNFVDLPAVDEYKHMIKSQPKQKLDLSIQDEYPALQTIVYHSKKINAIFGPMFSELTRMLLERIDSSKFLFYTRKTPAQIEDFFSDLDSTQAMEILELDISKYDKSQNEFHCAVEYKIWEKLGIDEWLAEVWKQGHRKTTLKDYTAGVKTCLWYQRKSGDVTTFIGNTIIIAACLSSMIPMDKVIKAAFCGDDSLIYIPKGLDLPDIQAGANLMWNFEAKLFRKKYGYFCGRYVIHHDRGAIVYYDPLKLISKLGCKHIRDVVHLEELRESLCDVASNLNNCAYFSQLDEAVAEVHKTAVGGSFAFCSIIKYLSDKRLFRDLFFV»

Элемент конструкции 12475-13227

/обозначение="MP" прим. 17 аминокислотных остатков удалены на С-конце белка. Транспортный белок, функция - распространение вируса по растению

Первичная структура белка:

«MSIVSYEPKVSDFLNLSKKEEILPKALTRLKTVSISTKDIISVKESETLCDIDLLINVPLDKYRYVGILGAVFTGEWLVPDFVKGGVTISVIDKRLVNSKECVIGTYRAAAKSKRFQFKLVPNYFVSTVDAKRKPWQVHVRIQDLKIEAGWQPLALEVVSVAMVTNNVVMKGLREKVVAINDPDVEGFEGVVDEFVDSVAAFKAVDNFRKRKKKVEERDVVSKYKYRPEKYAGPDSFNLKEENVLQHYKPE»

Элемент конструкции 13244-13867

/обозначение="CP" Капсидный белок вируса ВСЛК, функция-упаковка вирусной РНК в вирион.

Первичная структура белка:

«MSTVVVKGNLNRGAHQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLMGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKIYQARMINGVEWHDSSEDQCRILWKGNGKSSDTAGSFRVTIRVALQNPK»

Элемент конструкции 13884-14118

/обозначение="3'NTR"

3'-нетранслируемя часть вируса TVCV, необходимая для репликации вирусной РНК вирусной полимеразой.

Элемент конструкции 14141-14410

/обозначение="nosT"

Функция - терминатор транскрипции клеточной полимеразы II.

Полная нуклеотидная последовательность кольцевой плазмиды TVCV-PLRV-CP (14410 пар нуклеотидов ДНК) - SEQ ID NO: 1

1 agcttggcac tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg cgttacccaa

61 cttaatcgcc ttgcagcaca tccccctttc gccagctggc gtaatagcga agaggcccgc

121 accgatcgcc cttcccaaca gttgcgcagc ctgaatggcg aatgctagag cagcttgagc

181 ttggatcaga ttgtcgtttc ccgccttcag tttaaactat cagtgtttga caggatatat

241 tggcgggtaa acctaagaga aaagagcgtt tattagaata acggatattt aaaagggcgt

301 gaaaaggttt atccgttcgt ccatttgtat gtgcatgcca accacagggt tcccctcggg

361 atcaaagtac tttgatccaa cccctccgct gctatagtgc agtcggcttc tgacgttcag

421 tgcagccgtc ttctgaaaac gacatgtcgc acaagtccta agttacgcga caggctgccg

481 ccctgccctt ttcctggcgt tttcttgtcg cgtgttttag tcgcataaag tagaatactt

541 gcgactagaa ccggagacat tacgccatga acaagagcgc cgccgctggc ctgctgggct

601 atgcccgcgt cagcaccgac gaccaggact tgaccaacca acgggccgaa ctgcacgcgg

661 ccggctgcac caagctgttt tccgagaaga tcaccggcac caggcgcgac cgcccggagc

721 tggccaggat gcttgaccac ctacgccctg gcgacgttgt gacagtgacc aggctagacc

781 gcctggcccg cagcacccgc gacctactgg acattgccga gcgcatccag gaggccggcg

841 cgggcctgcg tagcctggca gagccgtggg ccgacaccac cacgccggcc ggccgcatgg

901 tgttgaccgt gttcgccggc attgccgagt tcgagcgttc cctaatcatc gaccgcaccc

961 ggagcgggcg cgaggccgcc aaggcccgag gcgtgaagtt tggcccccgc cctaccctca

1021 ccccggcaca gatcgcgcac gcccgcgagc tgatcgacca ggaaggccgc accgtgaaag

1081 aggcggctgc actgcttggc gtgcatcgct cgaccctgta ccgcgcactt gagcgcagcg

1141 aggaagtgac gcccaccgag gccaggcggc gcggtgcctt ccgtgaggac gcattgaccg

1201 aggccgacgc cctggcggcc gccgagaatg aacgccaaga ggaacaagca tgaaaccgca

1261 ccaggacggc caggacgaac cgtttttcat taccgaagag atcgaggcgg agatgatcgc

1321 ggccgggtac gtgttcgagc cgcccgcgca cgtctcaacc gtgcggctgc atgaaatcct

1381 ggccggtttg tctgatgcca agctggcggc ctggccggcc agcttggccg ctgaagaaac

1441 cgagcgccgc cgtctaaaaa ggtgatgtgt atttgagtaa aacagcttgc gtcatgcggt

1501 cgctgcgtat atgatgcgat gagtaaataa acaaatacgc aaggggaacg catgaaggtt

1561 atcgctgtac ttaaccagaa aggcgggtca ggcaagacga ccatcgcaac ccatctagcc

1621 cgcgccctgc aactcgccgg ggccgatgtt ctgttagtcg attccgatcc ccagggcagt

1681 gcccgcgatt gggcggccgt gcgggaagat caaccgctaa ccgttgtcgg catcgaccgc

1741 ccgacgattg accgcgacgt gaaggccatc ggccggcgcg acttcgtagt gatcgacgga

1801 gcgccccagg cggcggactt ggctgtgtcc gcgatcaagg cagccgactt cgtgctgatt

1861 ccggtgcagc caagccctta cgacatatgg gccaccgccg acctggtgga gctggttaag

1921 cagcgcattg aggtcacgga tggaaggcta caagcggcct ttgtcgtgtc gcgggcgatc

1981 aaaggcacgc gcatcggcgg tgaggttgcc gaggcgctgg ccgggtacga gctgcccatt

2041 cttgagtccc gtatcacgca gcgcgtgagc tacccaggca ctgccgccgc cggcacaacc

2101 gttcttgaat cagaacccga gggcgacgct gcccgcgagg tccaggcgct ggccgctgaa

2161 attaaatcaa aactcatttg agttaatgag gtaaagagaa aatgagcaaa agcacaaaca

2221 cgctaagtgc cggccgtccg agcgcacgca gcagcaaggc tgcaacgttg gccagcctgg

2281 cagacacgcc agccatgaag cgggtcaact ttcagttgcc ggcggaggat cacaccaagc

2341 tgaagatgta cgcggtacgc caaggcaaga ccattaccga gctgctatct gaatacatcg

2401 cgcagctacc agagtaaatg agcaaatgaa taaatgagta gatgaatttt agcggctaaa

2461 ggaggcggca tggaaaatca agaacaacca ggcaccgacg ccgtggaatg ccccatgtgt

2521 ggaggaacgg gcggttggcc aggcgtaagc ggctgggttg tctgccggcc ctgcaatggc

2581 actggaaccc ccaagcccga ggaatcggcg tgacggtcgc aaaccatccg gcccggtaca

2641 aatcggcgcg gcgctgggtg atgacctggt ggagaagttg aaggccgcgc aggccgccca

2701 gcggcaacgc atcgaggcag aagcacgccc cggtgaatcg tggcaagcgg ccgctgatcg

2761 aatccgcaaa gaatcccggc aaccgccggc agccggtgcg ccgtcgatta ggaagccgcc

2821 caagggcgac gagcaaccag attttttcgt tccgatgctc tatgacgtgg gcacccgcga

2881 tagtcgcagc atcatggacg tggccgtttt ccgtctgtcg aagcgtgacc gacgagctgg

2941 cgaggtgatc cgctacgagc ttccagacgg gcacgtagag gtttccgcag ggccggccgg

3001 catggccagt gtgtgggatt acgacctggt actgatggcg gtttcccatc taaccgaatc

3061 catgaaccga taccgggaag ggaagggaga caagcccggc cgcgtgttcc gtccacacgt

3121 tgcggacgta ctcaagttct gccggcgagc cgatggcgga aagcagaaag acgacctggt

3181 agaaacctgc attcggttaa acaccacgca cgttgccatg cagcgtacga agaaggccaa

3241 gaacggccgc ctggtgacgg tatccgaggg tgaagccttg attagccgct acaagatcgt

3301 aaagagcgaa accgggcggc cggagtacat cgagatcgag ctagctgatt ggatgtaccg

3361 cgagatcaca gaaggcaaga acccggacgt gctgacggtt caccccgatt actttttgat

3421 cgatcccggc atcggccgtt ttctctaccg cctggcacgc cgcgccgcag gcaaggcaga

3481 agccagatgg ttgttcaaga cgatctacga acgcagtggc agcgccggag agttcaagaa

3541 gttctgtttc accgtgcgca agctgatcgg gtcaaatgac ctgccggagt acgatttgaa

3601 ggaggaggcg gggcaggctg gcccgatcct agtcatgcgc taccgcaacc tgatcgaggg

3661 cgaagcatcc gccggttcct aatgtacgga gcagatgcta gggcaaattg ccctagcagg

3721 ggaaaaaggt cgaaaaggtc tctttcctgt ggatagcacg tacattggga acccaaagcc

3781 gtacattggg aaccggaacc cgtacattgg gaacccaaag ccgtacattg ggaaccggtc

3841 acacatgtaa gtgactgata taaaagagaa aaaaggcgat ttttccgcct aaaactcttt

3901 aaaacttatt aaaactctta aaacccgcct ggcctgtgca taactgtctg gccagcgcac

3961 agccgaagag ctgcaaaaag cgcctaccct tcggtcgctg cgctccctac gccccgccgc

4021 ttcgcgtcgg cctatcgcgg ccgctggccg ctcaaaaatg gctggcctac ggccaggcaa

4081 tctaccaggg cgcggacaag ccgcgccgtc gccactcgac cgccggcgcc cacatcaagg

4141 caccctgcct cgcgcgtttc ggtgatgacg gtgaaaacct ctgacacatg cagctcccgg

4201 agacggtcac agcttgtctg taagcggatg ccgggagcag acaagcccgt cagggcgcgt

4261 cagcgggtgt tggcgggtgt cggggcgcag ccatgaccca gtcacgtagc gatagcggag

4321 tgtatactgg cttaactatg cggcatcaga gcagattgta ctgagagtgc accatatgcg

4381 gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgct cttccgcttc

4441 ctcgctcact gactcgctgc gctcggtcgt tcggctgcgg cgagcggtat cagctcactc

4501 aaaggcggta atacggttat ccacagaatc aggggataac gcaggaaaga acatgtgagc

4561 aaaaggccag caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag

4621 gctccgcccc cctgacgagc atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc

4681 gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt

4741 tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct

4801 ttctcatagc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg

4861 ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct

4921 tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat

4981 tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg

5041 ctacactaga aggacagtat ttggtatctg cgctctgctg aagccagtta ccttcggaaa

5101 aagagttggt agctcttgat ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt

5161 ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc

5221 tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa gggattttgg tcatgcattc

5281 taggtactaa aacaattcat ccagtaaaat ataatatttt attttctccc aatcaggctt

5341 gatccccagt aagtcaaaaa atagctcgac atactgttct tccccgatat cctccctgat

5401 cgaccggacg cagaaggcaa tgtcatacca cttgtccgcc ctgccgcttc tcccaagatc

5461 aataaagcca cttactttgc catctttcac aaagatgttg ctgtctccca ggtcgccgtg

5521 ggaaaagaca agttcctctt cgggcttttc cgtctttaaa aaatcataca gctcgcgcgg

5581 atctttaaat ggagtgtctt cttcccagtt ttcgcaatcc acatcggcca gatcgttatt

5641 cagtaagtaa tccaattcgg ctaagcggct gtctaagcta ttcgtatagg gacaatccga

5701 tatgtcgatg gagtgaaaga gcctgatgca ctccgcatac agctcgataa tcttttcagg

5761 gctttgttca tcttcatact cttccgagca aaggacgcca tcggcctcac tcatgagcag

5821 attgctccag ccatcatgcc gttcaaagtg caggaccttt ggaacaggca gctttccttc

5881 cagccatagc atcatgtcct tttcccgttc cacatcatag gtggtccctt tataccggct

5941 gtccgtcatt tttaaatata ggttttcatt ttctcccacc agcttatata ccttagcagg

6001 agacattcct tccgtatctt ttacgcagcg gtatttttcg atcagttttt tcaattccgg

6061 tgatattctc attttagcca tttattattt ccttcctctt ttctacagta tttaaagata

6121 ccccaagaag ctaattataa caagacgaac tccaattcac tgttccttgc attctaaaac

6181 cttaaatacc agaaaacagc tttttcaaag ttgttttcaa agttggcgta taacatagta

6241 tcgacggagc cgattttgaa accgcggtga tcacaggcag caacgctctg tcatcgttac

6301 aatcaacatg ctaccctccg cgagatcatc cgtgtttcaa acccggcagc ttagttgccg

6361 ttcttccgaa tagcatcggt aacatgagca aagtctgccg ccttacaacg gctctcccgc

6421 tgacgccgtc ccggactgat gggctgcctg tatcgagtgg tgattttgtg ccgagctgcc

6481 ggtcggggag ctgttggctg gctggtggca ggatatattg tggtgtaaac aaattgacgc

6541 ttagacaact taataacaca ttgcggacgt ttttaatgta ctgaattaac gccgaattaa

6601 ttcgggggat ctggatttta gtactggatt ttggttttag gaattagaaa ttttattgat

6661 agaagtattt tacaaataca aatacatact aagggtttct tatatgctca acacatgagc

6721 gaaaccctat aggaacccta attcccttat ctgggaacta ctcacacatt attatggaga

6781 aactcgaaat tcgagctcgg taccacgcgt ttcgacaaaa tttagaacga acttaattat

6841 gatctcaaat acattgatac atatctcatc tagatctagg ttatcattat gtaagaaagt

6901 tttgacgaat atggcacgac aaaatggcta gactcgatgt aattggtatc tcaactcaac

6961 attatactta taccaaacat tagttagaca aaatttaaac aactattttt tatgtatgca

7021 agagtcagca tatgtataat tgattcagaa tcgttttgac gagttcggat gtagtagtag

7081 ccattattta atgtacatac taatcgtgaa tagtgaatat gatgaaacat tgtatcttat

7141 tgtataaata tccataaaca catcatgaaa gacactttct ttcacggtct gaattaatta

7201 tgatacaatt ctaatagaaa acgaattaaa ttacgttgaa ttgtatgaaa tctaattgaa

7261 caagccaacc acgacgacga ctaacgttgc ctggattgac tcggtttaag ttaaccacta

7321 aaaaaacgga gctgtcatgt aacacgcgga tcgagcaggt cacagtcatg aagccatcaa

7381 agcaaaagaa ctaatccaag ggctgagatg attaattagt ttaaaaatta gttaacacga

7441 gggaaaaggc tgtctgacag ccaggtcacg ttatctttac ctgtggtcga aatgattcgt

7501 gtctgtcgat tttaattatt tttttgaaag gccgaaaata aagttgtaag agataaaccc

7561 gcctatataa attcatatat tttcctctcc gctttgaagt tttagtttta ttgcaacaac

7621 aacaacaaat tacaataaca acaaacaaaa tacaaacaac aacaacatgg cacaatttca

7681 acaaacaatt gacatgcaaa ctctccaagc cgctgcggga cgcaacagct tggtgaatga

7741 tttggcatct cgtcgcgttt acgataatgc agtcgaggag ctgaatgctc gttccagacg

7801 tcccaaggtt catttctcca aggcagtgtc tacggaacag acactgattg caacaaacgc

7861 atatccggag ttcgagattt cctttactca tacgcaatcc gctgtgcact ccttggccgg

7921 aggccttcgg tcacttgagt tggagtatct catgatgcaa gttccgttcg gttctctgac

7981 gtacgacatc ggcggtaact tttccgcgca ccttttcaaa gggcgcgatt acgttcactg

8041 ctgcatgcct aatctggatg tacgtgacat tgctcgccat gaaggacaca aggaagctat

8101 ttacagttat gtgaatcgtt tgaaaaggca gcagcgtcct gtgcctgaat accagagggc

8161 agctttcaac aactacgctg agaacccgca cttcgtccat tgcgacaaac ctttccaaca

8221 gtgtgaattg acgacagcgt atggcactga cacctacgct gtagctctcc atagcattta

8281 tgatatccct gttgaggagt tcggttctgc gctactcagg aagaatgtga aaacttgttt

8341 cgcggccttt catttccatg agaatatgct tctagattgt gatacagtca cactcgatga

8401 gattggagct acttttcaga agtccggtga taatttaagt tttttctttc ataatgagag

8461 cactctcaat tacacccaca gttttagtaa tataattaag tatgtgtgta aaacgttctt

8521 tcctgctagt caacggtttg tgtatcataa ggagttttta gttactagag tcaacacttg

8581 gtactgtaag tttacgagag tggatacttt tactcttttc cgtggtgtgt accataataa

8641 tgtggattgc gaagagtttt acaaggctat ggacgatgcg tggcactaca aaaagacgtt

8701 agcaatgctt aatgccgaga ggaccatctt caaggataac gctgcgttaa acttttggtt

8761 cccgaaagtg agagacatgg ttatcgtccc tctctttgac gcttctatca caactggtag

8821 gatgtctagg agagagatta tggtgaacaa ggatttcgtt tatacggtcc taaatcacat

8881 aaaaacgtat caagctaagg ctttaactta cgcaaatgtt ctgtcctttg tggagtctat

8941 taggtctaga gtgataatta acggtgtcac tgccaggtct gaatgggaca cagacaaggc

9001 aattctaggt ccattagcaa tgacattttt ccttataaca aagttgggtc atgtgcagga

9061 tgaaataatc ctgaaaaagt tccagaagtt cgacagaacc accaatgagc tgatttggac

9121 aagtctctgc gatgccctga tgggggttat tccctcggtc aaggagacgc ttgtgcgcgg

9181 tggttttgtg aaagtagcag aacaagcctt agagataaag gttcccgagc tatactgtac

9241 ctttgccgac agattggtac tacagtacaa gaaggcggag gagttccaat cgtgtgatct

9301 ttccaaacct ctagaagagt cagagaagta ctacaacgca ttatccgagc tatcagtgct

9361 tgagaatctc gactcttttg acttagaggc gtttaagact ttatgtcagc agaagaatgt

9421 ggacccggat atggcagcaa aggtggtcgt agcaatcatg aagtcagaat tgacgttgcc

9481 tttcaagaaa cctacagaag aggaaatctc ggagtcgcta aaaccaggag aggggtcgtg

9541 tgcagagcat aaggaagtgt tgagcttaca aaatgatgct ccgttcccgt gtgtgaaaaa

9601 tctagttgaa ggttccgtgc cggcgtatgg aatgtgtcct aagggtggtg gtttcgacaa

9661 attggatgtg gacattgctg atttccatct caagagtgta gatgcagtta aaaagggaac

9721 tatgatgtct gcggtgtaca cagggtctat caaagttcaa caaatgaaga actacataga

9781 ttacttaagt gcgtcgctgg cagctacagt ctcaaacctc tgcaaggtgc ttagagatgt

9841 tcacggcgtt gacccagagt cacaggagaa atctggagtg tgggatgtta ggagaggacg

9901 ttggttactt aaacctaatg cgaaaagtca cgcgtggggt gtggcagaag acgccaacca

9961 caagttggtt attgtgttac tcaactggga tgacggaaag ccggtttgtg atgagacatg

10021 gttcagggtg gcggtgtcaa gcgattcctt gatatattcg gatatgggaa aacttaagac

10081 gctcacgtct tgcagtccaa atggtgagcc accggagcct aacgccaaag taattttggt

10141 cgatggtgtt cccggttgtg gaaaaacgaa ggagattatc gaaaaggtaa acttctctga

10201 agacttgatt ttagtccctg ggaaggaagc ttctaagatg atcatccgga gggccaacca

10261 agctggtgtg ataagagcgg ataaggacaa tgttagaacg gtggattcct tcttgatgca

10321 tccttctaga agggtgttta agaggttgtt tatcgatgaa ggactaatgc tgcatacagg

10381 ttgtgtaaat ttcctactgc tgctatctca atgtgacgtc gcatatgtgt atggggacac

10441 aaagcaaatt ccgttcattt gcagagtcgc gaactttccg tatccagcgc attttgcaaa

10501 actcgtcgct gatgagaagg aggttagaag agttacgctc aggtgcccgg ctgatgttac

10561 gtatttcctt aacaagaagt atgacggggc ggtgatgtgt accagcgcgg tagagagatc

10621 cgtgaaggca gaagtggtga gaggaaaggg tgcattgaac ccaataacct taccgttgga

10681 gggtaaaatt ttgaccttca cacaagctga caagttcgag ttactggaga agggttacaa

10741 ggatgtgaac actgtgcacg aggtgcaagg ggagacgtac gagaagactg ctattgtgcg

10801 cttgacatca actccgttag agatcatatc gagtgcgtca cctcatgttt tggtggcgct

10861 gacaagacac acaacgtgtt gtaaatatta caccgttgtg ttggacccga tggtgaatgt

10921 gatttcagaa atggagaagt tgtccaattt ccttcttgac atgtatagag ttgaagcggg

10981 ggtccaatag caattacaga tcgatgcagt attcagggac agcaacttgt ttgttcagac

11041 gcccaagtca ggagattggc gagatatgca attttactat gacgctcttc ttcccggaaa

11101 cagtactatt ctcaatgaat ttgatgctgt tacgatgaat ttgagggata tttccttaaa

11161 cgtcaaagat tgcagaatcg acttctccaa atccgtgcaa cttcctaaag aacaacctat

11221 tttcctcaag cctaaaataa gaactgcggc agaaatgccg agaactgcag gtttgctgga

11281 aaatttggtt gcaatgatca aaagaaacat gaatgcgccg gatttgacag ggacaattga

11341 cattgaggat actgcatctc tggtggttga aaagttttgg gattcgtatg ttgacaagga

11401 atttagtgga acgaacgaaa tgaccatgac aagggaaagt ttttctagat ggctttcgaa

11461 acaagagtca tctacagttg gtcagttagc ggactttaac tttgtggatt tgccggcagt

11521 agatgagtac aagcatatga tcaagagtca accaaagcaa aagttagact tgagtattca

11581 agacgaatat cctgcattgc agacgatagt ctaccattcg aaaaagatca atgcgatttt

11641 cggtccaatg ttttcagaac ttacgaggat gttactcgaa aggattgact cttcgaagtt

11701 tctgttctac accagaaaga cacctgcaca aatagaggac ttcttttctg acctagactc

11761 aacccaggcg atggaaattc tggaactcga catttcgaag tacgataagt cacaaaacga

11821 gttccattgt gctgtagagt acaagatctg ggaaaagtta ggaattgatg agtggctagc

11881 tgaggtatgg aaacaaggac acagaaaaac gaccttgaaa gattatacgg ccggagtcaa

11941 aacatgtctt tggtatcaaa ggaaaagtgg tgatgtgaca acctttattg gtaataccat

12001 catcattgca gcctgtttga gctcaatgat ccccatggac aaagtgataa aggcagcttt

12061 ttgtggagac gatagcctga tttacattcc taaaggttta gacttgcctg atattcaggc

12121 gggcgcgaac ctcatgtgga acttcgaggc caaactcttc aggaagaagt atggttactt

12181 ctgtggtcgt tatgttattc accatgatag aggagccatt gtgtattacg atccgcttaa

12241 actaatatct aagttaggtt gtaaacatat tagagatgtt gttcacttag aagagttacg

12301 cgagtctttg tgtgatgtag ctagtaactt aaataattgt gcgtattttt cacagttaga

12361 tgaggccgtt gccgaggttc ataagaccgc ggtaggcggt tcgtttgctt tttgtagtat

12421 aattaagtat ttgtcagata agagattgtt tagagatttg ttctttgttt gataatgtcg

12481 atagtctcgt acgaacctaa ggtgagtgat ttcctcaatc tttcgaagaa ggaagagatc

12541 ttgccgaagg ctctaacgag gttaaaaacc gtgtctatta gtactaaaga tattatatct

12601 gtcaaggagt cggagacttt gtgtgatata gatttgttaa tcaatgtgcc attagataag

12661 tatagatatg tgggtatcct aggagctgtt tttaccggag agtggctagt gccagacttc

12721 gttaaaggtg gagtgacgat aagtgtgata gataagcgtc tggtgaactc aaaggagtgc

12781 gtgattggta cgtacagagc cgcagccaag agtaagaggt tccagttcaa attggttcca

12841 aattactttg tgtccaccgt ggacgcaaag aggaagccgt ggcaggttca tgttcgtata

12901 caagacttga agattgaggc gggttggcag ccgttagctc tggaagtagt ttcagttgct

12961 atggtcacca ataacgttgt catgaagggt ttgagggaaa aggtcgtcgc aataaatgat

13021 ccggacgtcg aaggtttcga aggtgtggtt gacgaattcg tcgattcggt tgcagcattt

13081 aaagcggttg acaactttaa aagaaggaaa aagaaggttg aagaaaaggg tgtagtaagt

13141 aagtataagt acagaccgga gaagtacgcc ggtcctgatt cgtttaattt gaaagaagaa

13201 aacgtcttac aacattacaa acccgaataa tcgataactc gagatgagta cggtcgtggt

13261 taaaggaaat ctcaatcgtg gtgcacacca accaagaagg cgaagaaggc aatcccttcg

13321 caggcgcgct aacagagttc agccagtggt tatggtcacg gcccctgggc aacccaggcg

13381 ccgaagacgc agaagaggag gcaatcgccg ctcaagaaga actggagttc cccgaggacg

13441 aggctcaagc gagacattcg tgtttacaaa ggacaacctc atgggcaact cccaaggaag

13501 tttcaccttc gggccgagtc tatcagactg tccggcattc aaggatggaa tactcaaggc

13561 ctaccatgag tataagatca caagcatctt acttcagttc gtcagcgagg cctcttccac

13621 ctcctccggt tccatcgctt atgagttgga cccccattgc aaagtatcat ccctccagtc

13681 ctacgtcaac aagttccaaa ttacgaaggg cggcgccaaa atttatcaag cgcggatgat

13741 aaacggggta gaatggcacg attcttctga ggatcagtgc cggatactgt ggaagggaaa

13801 tggaaaatct tcagataccg caggatcctt cagagtcacc attagggtgg ctttgcaaaa

13861 ccccaaatag agcggcccct agagcgtggt gcgcacgata gcgcatagtg tttttctctc

13921 cacttgaatc gaagagatag acttacggtg taaatccgta ggggtggcgt aaaccaaatt

13981 acgcaatgtt ttgggttcca tttaaatcga aaccccttat ttcctggatc acctgttaac

14041 gcacgtttga cgtgtattac agtgggaata agtaaaagtg agaggttcga atcctcccta

14101 accccgggta ggggcccagc ggccgcttgg atcctctaga gtcaagcaga tcgttcaaac

14161 atttggcaat aaagtttctt aagattgaat cctgttgccg gtcttgcgat gattatcata

14221 taatttctgt tgaattacgt taagcatgta ataattaaca tgtaatgcat gacgttattt

14281 atgagatggg tttttatgat tagagtcccg caattataca tttaatacgc gatagaaaac

14341 aaaatatagc gcgcaaacta ggataaatta tcgcgcgcgg tgtcatctat gttactagat

14401 cgaccagctt

Описание плазмиды TVCV-PLRV-CP

Для экспрессии белка оболочки ВСЛК выбрали вирусный вектор на основе вируса просветления жилок турнепса (ВПЖТ, TVCV), который принадлежит к тобамовирусам, и способен накапливаться в количестве до 7 грамм на 1 кг зараженного материала. С этой целью из имеющихся в лаборатории кДНК TVCV и ВСЛК с помощью методов генной инженерии была создан агробактериальный вирусный вектор TVCV-PLRV-CP.

Вначале инфекционная копия тобамовируса TVCV50 (NCBI Reference Sequence: NC_001873.1), содержащая репортерный ген GFP вместо гена белка оболочки тобамовируса, поставленная под контроль промотера гена актина 2 из Arabidopsis thaliana (GenBank accession no. BRU03387), (Marillonnet, S., Giritch, A., Gils, M., Kandzia, R., Klimyuk, V., and Gleba, Y. (2004) Proc. Natl. Acad. Sci. USA, 101, 6852-6857), была переклонирована из бинарного вектора BV1 в другой бинарный вектор pCambia 1300 и названа TVCV.

Схема химерного вирусного вектора TVCV-PLRV-CP, где:

35S Pr - транскрипционный промотер.

35Т - терминатор транскрипции.

Act2 Pr - транскрипционный промотер.

NosT - терминатор транскрипции.

P0 - ген антисайленсингового белка, модулятора патогенности ВСЛК.

P1 - ген протеазы ВСЛК.

P2 - ген полимеразы ВСЛК.

P3 - ген мажорного капсидного белка ВСЛК.

P4 - ген транспортного белка ВСЛК.

P5 - ген минорного капсидного белка ВСЛК, ассоциированного с капсидом, который образуется при супрессии амбер-стоп кодона P3.

P6 и P7 - гены белков ВСЛК с неизвестными функциями.

Полимераза - полимераза TVCV.

Тр. белок - ген транспортного белка TVCV, содержащий субгеномный промотер для P3.

Бел. оболочки - ген белка оболочки TVCV.

T-like - шпилечная структура на конце генома TVCV.

В этой плазмиде произвели замену гена GFP на ген белка оболочки ВСЛК. Для этого фрагмент длиной 627 нуклеотидов (3572-4199), содержащий ген белка оболочки PLRV р3, был амплифицирован с имеющейся матрицы pBNUP110, содержащей инфекционную копию канадского изолята PLRV (GenBank: D13954.1), с помощью праймеров:

5' TTCTCGAG3572ATGAGTACGGTCGTGGTTAAAGGAAACGTCAACGG-3' PLRV-CPΔ4-p

5'-TTGGTACC4199CTATTTGGGGTTTTGCAAAGCCA-3' PLRV-CP-m

Дополнительно был инактивирован транспортный ген PLRV p4, который находится полностью внутри гена белка оболочки p3, и экспрессируется с той же субгеномной РНК, но находится в другой рамке трансляции. Для этого в праймер PLRV-CPΔ4-p были внесены замены T на C (подчеркнуты), которые элиминировали два стартовых ATG кодона в p4, но не изменяли аминокислотный состав p3 (Asp aat→aac). Полученный PCR фрагмент был разрезан по сайтам XhoI-Acc65I и заклонирован в плазмиду TVCV по сайтам рестрикции XhoI-BsrGI. Полученную конструкцию назвали TVCV-PLRV-CP.

Такой рекомбинантной плазмидой была трансформирована агробактерия A. tumefaciens штамма GV3101, способная эффективно встраивать кДНК химерного вируса в хромосому растительной клетки.

Таким образом, получился химерный вирусный вектор, с геном белка оболочки ВСЛК, вместо собственного тобамовирусного капсидного белка.

АГРОИНОКУЛЯЦИЯ РАСТЕНИЙ N. benthamiana

Плазмидой TVCV-PLRV-CP трансформировали агробактерии штамма GV3101, наращивали бактерии в среде 2YT, содержащей антибиотики (Rif 50, Gent 25 и Km 100 мкг/мл) при температуре 28°С в течение ночи. Клетки высаживали и ресуспендировали в буфере для инфильтрации (10 mM MgCl2+10mM MES pH 6.5) до плотности 0.2 о.е. при OD600. Суспензию агробактерии впрыскивали шприцом в межклетники листьев растения Nicotiana benthamiana в присутствии агробактерии с антисайленсинговыми генами p19 (TBSW) P1-HcPro (PVA) или без них.

Вектор оказался способен системно заражать N. benthamiana и показывать высокий титр белка оболочки ВСЛК в верхних листьях растения (фиг. 2). На фотографии можно увидеть, что в молодых листьях развиваются симптомы накопления вирусной химеры.

Репликация генома химерного вируса происходила с помощью тобамовирусной полимеразы, и химерный вирус распространялся по тканям растения, не ограничиваясь флоэмой. Накопление белка оболочки ВСЛК в зараженном растении оценивали методом электрофореза в полиакриламидном геле (ПААГ) в денатурирующих условиях (Фиг. 3). В зараженных листьях первого, второго и третьего ярусов, начиная с верхушки, делали высечки одинаковой площади, растирали зеленый материал в 3 объемах 10 mM Tris-HCl pH 7.5, и далее проводили анализ электрофорезом в ПААГ по Лэмли (U. K. Laemmli “Cleavage of Structural Proteins during the Assembly of the Head of Bacteriophage T4” Nature 227, 680 - 685).

Количество белка оболочки ВСЛК оценивали относительно с известным количеством БСА (бычий сывороточный альбумин). Оказалось, что количество белка оболочки ВСЛК в листьях первого яруса соответствует концентрации 3 грамма на 1 килограмм зеленой массы, во втором ярусе концентрация вируса падает примерно в пять раз, в третий ярус вирус практически не доходит из-за некротизации черешка листочка. Таким образом, концентрация химерного вируса в двух верхних ярусах на три порядка превосходит концентрацию настоящего ВСЛК с накоплением 0.4-1мг/кг.

ПОЛУЧЕНИЕ ПРЕПАРАТА ВИРУСА И ЕГО ХАРАКТЕРИСТИКА

С 50 лабораторных растений N. Benthamiana удалось собрать 25 грамм зараженных листьев и выделить более 20 мг химерного вируса по следующей методике.

Листья гомогенизировали в коммерческом блендере в 5 объемах 0.1 М цитратного буфера с pH 6.0 с 0.1% 2-меркаптоэтанолом, корректировали pH до 7.0 с помощью 0.5M Na2HPO4, добавляли 1% Triton X-100. Гомогенат листьев перемешивали в этом буфере 30 мин на льду. Дебрис откручивали при 10.000g, а супернатант осветляли 1/4 V хлороформа. Далее химерный вирус высаживали на ультрацентрифуге при 40.000g в течение 90 мин через 20% сахарозную подушку. Осадок растворяли в 1 ml 10 mM Tris-HCl pH 7.5.

Вирусный препарат был разведен в 50 раз и контрастирован 2% уранилацетатом. Размер икосаэдра химерного вируса равен ~25 нм (Фиг. 4). На правой микрофотографии видно некоторое количество сильноконтрастированных вирионов, возможно, они не содержат РНК.

Несмотря на то, что химерная РНК больше РНК ВСЛК на 1000 нуклеотидов, и на отсутствие минорного капсидного белка (55К - read-through protein), вирионы выглядят похожими на вирионы ВСЛК. Чистоту вирусного препарата оценивали с помощью электофореза в ПААГ в денатурирующих условиях по Лемли.

На 12% ПААГ нанесены 5, 10 и 15 мкл вирусного препарата. Электрофоретический анализ очищенного химерного вируса TMV-PLRV-CP в денатурирующем 12% полиакриамидном геле показал (Фиг. 5), что молекулярная масса капсидного белка равна предполагаемой 23 kDa. Видно, что в препарате присутствует незначительная примесь высокомолекулярных клеточных белков. Выделенный препарат химерного ВСЛК был охарактеризован спетрофотометрически.

Поскольку концентрированные суспензии вирусов сильно рассеивают УФ-свет и вирус ВСЛК склонен к агрегации (Фиг. 6, левый), обработку спектра проводили по методу, описанному в («Определение спектров истинного поглощения фага СД и ВТМ. Поправка на светорассеяние вирусной суспензии». Практикум по общей вирусологии (под ред. И.Г.Атабекова), Изд-во МГУ, 1981). В результате обработки спектра, устраняющей эффект рассеяния, удается определить поглощение в УФ-свете вирусного препарата. Далее определяли его соответствия чистому препарату ВСЛК по спектральным данным согласно Таканами и Кубо (Y. Takanami, S. Kubo “Enzyme-assisted Purification of two Phloem-limited Plant Viruses: Tobacco N e c r o t i c Dwarf and Potato Leafroll

J. gen. Virol. (I979), 44, I53-I59), а именно A260/A280 = 1.78; A260/A240=1.43, а затем концентрацию вируса по формуле A260 (0.1%;1 cm)=8.6, т.е. раствор вируса с концентрацией 1 мг/мл в 1 см кювете имеет оптическое поглощение при 260 нм, равное 8,6 о.е.

Полученный препарат химерного ВСЛК имел отношение A260/A280 = 1,37 и A260/A240=0,99 (Фиг. 6, правый), что было близко спектральным характеристикам изолята природного вируса. Проведенные расчеты показали хорошее совпадение результатов определения выхода химерного вируса методами ИФА, электрофореза в ПААГ и УФ-спектрофотометрии.

Для определения насколько химерные вирусных частицы иммунологически похожи на вирионы природного изолята ВСЛК использовали метод т.н. «иммунотреппинга», в котором на электронномикроскопические сеточки с коллодиевой пленкой-подложкой, закрепленной напылением атомов графита, помещали 30 мкл-каплю коммерческих иммуноглобулинов G (0.2 мг/мг, «Агдия», США) к ВСЛК. Сетки выдерживали для сорбции антител 10 мин, отмывали 2 раза PBS и помещали в суспензию инфицированного клеточного экстракта с предполагаемой по данным электрофореза концентрацией ВСЛК (0.05-10 нг/мл) в PBS на ночь при комнатной температуре. Сетки отмывали 4 раза PBS и 2 раза водой. Для контрастирования использовали 2% раствор уранил ацетата в воде (Фиг. 7).

Электронномикроскопическое исследование разбавленного в 100 раз препарата выделенного вируса с помощью ТЭМ (фиг. 8) подтвердило данные иммунной электронной микроскопии экстрактов зараженного растения (Фиг. 7) о форме (икосаэдр) и размерах (25-27 нм) вирусной частицы.

Таким образом, за счет создания химерного ВСЛК технология получения препаративных количеств целевых антигенов флоэмно-ограниченного вируса ВСЛК стала многократно проще и эффективней: нет зависимости от природного переносчика ВСЛК - персиковой тли; выделение химерных вирусных частиц из всего листа растения проще, чем выделение природного ВСЛК, который нужно экстрагировать из жестких проводящих пучков сосудов листовой ткани растения. Количественный эффект технологии состоит в том, что 20 мг вирусной химеры можно получить всего лишь из 25 грамм, а не 1-1,3 мг из 1 килограмма зараженных листьев картофеля, как в случае природного изолята вируса. Полученные таким способом препаративные количества химерного вируса химически более чистые, а их выделение является менее трудоемким.

Важно отметить, что накопившийся в растении капсидный белок ВСЛК упаковывает РНК вируса ВПЖТ в икосаэдрический вирион (Фиг. 4, 7, 8). По своим спектрофотометрическим (Фиг. 6) и электронномикроскопическим характеристикам химерный вирус подобен ВСЛК, поэтому стереометрия его антигенных детерминант должна быть близка таковой природного изолята вируса, поскольку она определяется общим механизмом сборки вирусных частиц. Именно сборка химерного капсида, подобного капсиду природного изолята, является необходимым условием для использования химерной частицы в качестве антигена для иммунизации лабораторных животных.

ПОЛУЧЕНИЕ АНТИСЫВОРОТКИ К ХИМЕРНОМУ ВИРУСУ

Выделенным препаратом химерного ВСЛК иммунизовали кроликов для получения антисывороток, которые использовали для диагностического анализа растений, инфицированных ВСЛК. Двух кроликов (1 и 2) иммунизовали трижды препаратами ВСЛК с полным (1 раз) и неполным (1 раз) адъювантом Фрейнда, вводя под кожу по 300-500 мкг препарата ВСЛК.

Было важно установить степень перекрестного и прямого узнавания вирусных препаратов (природного изолята и химерного ВСЛК) антисыворотками, коммерческой к природном изоляту ВСЛК и полученной нами к химерному вирусу. Анализ полученных на химерный ВСЛК антисывороток проводили методом дот-блот иммуноферментного анализа с флуоресцентным субстратом и твердофазным непрямым иммуноферментным анализом.

Для дот-блот анализа (Фиг. 9) на нитратцеллюлозную мембрану Protran ВА-85 (Schleicher&Shull) наносили следующие препараты (по 1 мкл):

1. Химерный ВСЛК препарат №1 (2-3 мг/мл), разведенный PBS 1:1 и еще 3 последовательных 5-кратных разведения.

2. Химерный ВСЛК препарат №1 после гель-фильтрации на носителе HW-60 (Toyo Pearl) без разведения и еще 3 последовательных 5-кратных разведения.

3. Природный изолят ВСЛК 0.08 мг/мл, разведенный PBS 1:1 и еще 2 последовательных 5-кратных разведения.

4. Экстракт N. benthamiana, полученный из 10 мг листовой ткани, растертой в 100 мкл PBS и отцентрифугированной 8000 об/мин, 5 мин. Экстракт разведен сначала в 2 раза и последовательно в 10 раз.

Далее мембраны помещали в 5% блокирующий раствор раствор («Амершам») в TBS, рН 9.1 с 0.1% ТВ.-20 на 1 час при комнатной температуре на качалке.

Затем мембраны отмывали последовательно в TBS с 0.1% Tween-20, 2 раза быстро, 1 раз 15 мин и 2 раза по 5 мин. Готовили разведения антисывороток 1:25, 1:125 , 1:625 буфером TBS, рН 9.1 и инкубировали мембраны с каждым разведением 1час при комнатной температуре, а затем отмывали последовательно в TBS с 0.1% Tween-20, 2 раза быстро (1 раз 15мин и 2 раза по 5 мин буфером).

Далее мембраны помещали в раствор вторичных антител, конъюгированных с пероксидазой хрена, разбавленных в 5000 раз буфером TBS - 0,5% БСА, на 1час при комнатной температуре, отмывали последовательно в TBS с 0.1% Tween-20, 2 раза быстро (1 раз 15 мин и 2 раза по 5 мин).

Для детекции вируса использовали хемилюминесцентный субстрат по протоколу ECL («Амершам»).

Как видно (ряд 1), антисыворотка к химерному ВСЛК при развелении в 625 раз узнает антиген, разведенный в 250 раз, а дополнительная очистка антигена гель-фильтрацией (ряд 2) приводит к ослаблению чувствительности его определения либо за счет разведения и потерь при очистке, либо от освобождения от интерферирующей примеси. Следует отметить, что изолят природного типа определяется ИФА с полученной нами антисывороткой (ряд 3), но с меньшей чувствительностью. И наконец, антисыворотка четко различает незараженное растение (ряд 4а, б) и зараженный природным изолятом ВСЛК картофель.

Таким образом, полученная к химерному ВСЛК антисыворотка определяет зараженный природным изолятом ВСЛК картофель.

При сравнении (см. Фиг. 9) антисыворотка №2 проявляет те же свойства, что и №1, но обладает меньшей чувствительностью (ряд 4в, г) и специфичностью - дает больший фон для незараженного растения (ряд 4а, б), что может объясняться большим загрязнением антигена клеточными компонентами.

В предварительных экспериментах твердофазным непрямым иммуноферментным анализом полученной антисыворотки к химерному ВСЛК было установлено, что чувствительность детекции химерного вируса, выделенного из зараженной N. bentomiana, составляет 2 нг/мл, в то время чувствительность определения природного изолята ВСЛК, выделенного из картофеля равна 5 нг/мл (Фиг. 10).

Таким, образом, по результатам твердофазного непрямого ИФА можно заключить, что достоверные отличия иммунологической реакции антисыворотки к химерному ВСЛК сохраняются после разведения ее в 8-10 тысяч раз.

Наблюдаемый неспецифический фон при разведениях антисыворотки мы объясняем примесью антител на хозяйские антигены. Эту проблему обычно снимают истощением антисыворотки соком растения-хозяина. Несмотря на то, что мы этого не делали, результаты ИФА однозначно говорят о высоком титре (достоверный сигнал целевых антител в антисыворотке виден при 8000-кратном разведении).

Краткое описание рисунков

Фиг.1. Картофель, зараженный ВСЛК.

Фиг. 2. Фото N. benthamiana через 14 дней после инокуляции агробактерией, несущей плазмиду TVCV-PLRV-CP: А - зона инокуляции агробактерией, Б - некроз проводящей ткани черешка, I - лист первого яруса, II - лист второго яруса, III - лист третьего яруса, I-III - симптомы, вызванные накоплением вируса.

Фиг. 3. Накопление белка оболочки ВСЛК в зависимости от яруса листьев по окраске кумасси в ПААГ. Стрелочкой обозначена зона, соответствующая подвижности белка оболочки ВСЛК.

Фиг. 4. Электронная микрофотография вирусного препарата (А - Увеличение 600.000 раз, В - увеличение 60.000 раз).

Фиг. 5. Оценка чистоты полученного препарата химерного ВСЛК электрофорезом в 12% ПААГ.

Фиг. 6. УФ-спектрофотометрия препарата химерного ВСЛК. Кривая 1- видимый спектр вирусного препарата. Кривая 2 - кстраполяция раасеяния света вирусными частицами на область их поглощения света. Кривая 3 - истинный УФ-спектр поглощения препаратом вируса с вычетом светорассеивания.

Фиг. 7. Иммунная электронная микроскопия (trapping mode) неочищенного препарата -экстракт листьев N. benthamiana , зараженных химерным вирусом, с помощью антител к ВСЛК.

Фиг. 8. Просвечивающая электронная микроскопия очищенного препарата химерного вируса ВСЛК, нанесенного на формваровую подложку. Контрастирование 2% уранилацетатом.

Фиг. 9. Дот-блот иммуноанализ специфичности антисыворотки (см. фиг. 10) к химерному вирусу скручивания листьев картофеля. * - при нанесении на мембрану 1000 и более нанограмм происходит отслоение части окрашенного вещества.

На мембраны наносили:

1 ряд - химерный ВСЛК, 2 ряд - тот же вирус, после дополнительной очистки гель-фильтрацией, 3 ряд - изолят природного ВСЛК, 4а,б -отрицательный контроль - экстракт N. benthamiana, 4 в, г - сок картофеля, зараженного природным изолятом ВСЛК.

Количество ВСЛК (нг): 1а* - 1000, 1б - 200, 1в - 40, 1г - 8, 2а - 100, 2б - 20, 2в - 8, 2г - 1.6, 3а - 40, 3б - 8, 3в - 1.6, 3г - 0.3.

Фиг. 10. Чуствительность определения очищенных препаратов химерного (кривая - ряд 1) и природного изолята (кривая - ряд 2) ВСЛК в непрямом ИФА с использованием антисыворотки к химерному вирусу. Оптическая плотность в отрицательных контролях в среднем составляла 0.08 о.е. в картофеле и 0.03 в N. bentomiana.

1. Способ получения препаративных количеств химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус (ИНФОВ) растений, включающий получение химерного вируса путем вставки гена белка оболочки ИНФОВ в эффективный вирусный вектор на основе РНК тобамовируса, способного распространяться и накапливаться во всех тканях растения, после чего осуществляют системное заражение растений полученным химерным вирусом для размножения и накопления его в тканях растения с последующим выделением химерного вируса из тканей растения в препаративных количествах, при этом химерный вирус представляет собой химерную РНК, транскрибированную с ДНК-вектора, состоящую из генома тобамовируса и гена белка оболочки целевого вируса низкокопийного флоэмно-ограниченного вируса растений, в качестве которого используют вирус скручивания листьев картофеля (ВСЛК), причем белок оболочки ВСЛК упаковывает РНК тобамовирусного генома в икосаэдр, и где получение химерного вирусного вектора включает следующие этапы:
а) клонирование кДНК вируса просветления жилок турнепса (ВПЖТ, TVCV), принадлежащего к тобамовирусам, с транскрипционным промотером с одной стороны и терминатором транскрипции с другой в агробактериальный вектор pCambia1300;
б) вставку гена белка оболочки ВСЛК из плазмиды pBNUP110 вместо гена собственного тобамовирусного гена белка оболочки;
при этом получают генно-инженерную плазмиду TVCV-PLRV-CP с нуклеотидной последовательностью SEQ ID NO: 1.

2. Способ по п. 1, в котором растения заражают системно химерным вирусным вектором с помощью техники агроинокуляции.

3. Способ по п. 1, в котором для системного заражения растений осуществляют трансформацию агробактерии штамма GV3101 плазмидой TVCV-PLRV-CP, после чего заражают растения Nicotiana benthamiana вирусной химерной ДНК путем впрыскивания суспензии трансформированных плазмидой TVCV-PLRV-CP агробактерий шприцом со снятой иглой в межклетники листьев растения.

4. Способ по п. 1, в котором выделение химерного вируса из тканей растения осуществляют путем гомогенизации листьев в блендере в 5 объемах 0.1 М цитратного буфера с рН 6.0 с 0.1% 2-меркаптоэтанолом, корректировки рН до 7.0 с помощью 0.5М Na2HPO4, добавления 1% Triton Х-100, перемешивания гомогената листьев в этом буфере 30 мин на льду, отделение дебриса центрифугированием при 10.000g с последующим осветлением супернатанта 1/4 V хлороформа и высаживанием химерного вируса на ультрацентрифуге при 40.000g в течение 90 мин через 20% сахарозную подушку.

5. Плазмида TVCV-PLRV-CP с нуклеотидной последовательностью SEQ ID NO: 1 для получения препаративных количеств химерного вируса, имитирующего вирус скручивания листьев картофеля.

6. Препарат химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус растений, для получения антисыворотки к вирусу скручивания листьев картофеля (ВСЛК), полученный способом по любому из пп. 1-4.

7. Способ получения антисыворотки к природным изолятам ВСЛК, включающий иммунизацию животных препаратом по п. 6.

8. Антисыворотка к природным изолятам вируса скручивания листьев картофеля, полученная способом по п. 7.

9. Применение антисыворотки по п. 8 для диагностики инфицированных природными изолятами ВСЛК растений.

10. Антисыворотка к капсидному белку химерного вируса, имитирующего икосаэдрический низкокопийный флоэмно-ограниченный вирус (ИНФОВ) растений, полученная способом, включающим иммунизацию животных химерными вирусными частицами, полученными способом по любому из пп. 1-4.



 

Похожие патенты:

Представленные изобретения относятся к лиофилизированной композиции для индукции иммунного ответа на флавивирус, композиции для получения указанной лиофилизированной композиции и способу получения лиофилизированной композиции.

Представленные изобретения относятся к области биотехнологии и, в частности, онкологии и касаются онколитического аденовируса, его применения и фармацевтической композиции, содержащей такой аденовирус.

Изобретение относится к области биотехнологии, вирусологии и медицины. Предложена комбинация флавивирусных частиц.

Изобретение относится к области биотехнологии и касается кДНК, кодирующей дисферлин человека, генно-инженерной конструкции, в которую клонирована такая кДНК, рекомбинантного аденовируса и фармацевтической композиции.

Изобретение относится к области биотехнологии и касается рекомбинантных векторов, используемых для производства противогриппозных вакцин. Охарактеризованы рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа и способ ее использования.

Изобретение относится к области биотехнологии. Предложен аденовирусный вектор-помощник для получения рекомбинантного аденовируса с высокой емкостью.

Изобретение относится к иммунологии и медицине и представляет собой средство для нейтрализации вируса натуральной оспы, представляющее собой искусственное одноцепочечное антитело человека 1A, имеющее аминокислотную последовательность, приведенную в материалах заявки, экспонированное на поверхности нитчатого бактериофага М13.

Изобретение относится к области биотехнологии. Описана молекула химерной нуклеиновой кислоты цирковируса свиней (PCV2Gen-1Rep), которая включает молекулу нуклеиновой кислоты, кодирующую цирковирус свиней 2 типа (PCV2), которая содержит последовательность нуклеиновой кислоты, кодирующую белок Rep цирковируса свиней 1 типа (PCV1).

Изобретение относится к области биотехнологии, вирусологии и медицины. Предложен поксвирус осповакцины, который содержит дефектный F2L ген и суицидальный ген.

Изобретение относится к области биотехнологии. Создана рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа, содержащая экспрессирующую кассету со вставкой гена гемагглютинина вируса гриппа.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная плазмидная ДНК, кодирующая химерное антитело против фактора некроза опухолей-альфа человека (ФНО-альфа), на основе плазмиды pOptiVECTM-TOPO®.

Изобретение относится к биотехнологии, а именно к применению аспарагиназы и способу приготовления пищевого продукта с использованием данной аспарагиназы. Аспарагиназу, аминокислотная последовательность которой имеет по крайней мере 90% гомологию с аминокислотной последовательностью <SEQ ID NO:2>, остаточная активность которой после инкубации продолжительностью 5 минут при температуре в диапазоне от 70°C до 100°C составляет 200 ед./мг, применяют для приготовления пищевого продукта, который содержит аспарагин.

Настоящее изобретение относится к биотехнологии и представляет собой генетически модифицированный штамм бактерии Streptomyces thermotolarences WSJ-IA, продуцирующий изовалерилспирамицин I.

Изобретение относится к области биотехнологии. Представлен полипептид D-лактатдегидрогеназы, который содержит полипептид с аминокислотной последовательностью, которая характеризуется идентичностью по последовательности на уровне не менее 80% с аминокислотной последовательностью, показанной в SEQ ID NO:1 или 2, раскрытые в описании, где указанный полипептид обладает D-лактатдегидрогеназной активностью.

Изобретения касаются инфекционной молекулы нуклеиновой кислоты, кодирующей инфекционный вирус Torque teNO свиней (PTTV), которая содержит по меньшей мере одну копию геномной последовательности, выбранной из группы, состоящей из последовательностей, соответствующих генотипам или подтипам PTTV1a-VA, PTTV1b-VA, PTTV2b-VA и PTTV2c-VA, а также биологически функциональной плазмиды или вирусного вектора, содержащего такую инфекционную нуклеотидную геномную последовательность, и клетки-хозяина, содержащей такую плазмиду или вектор.

Изобретение относится к области биохимии, в частности к применению гена, кодирующего белок, который состоит из аминокислотной последовательности, представленной в SEQ ID NO.2, для получения трансгенного риса с длинными, большими и многочисленными зернами и увеличенной урожайностью, увеличенным количеством зерен в метелке и скрученными листьями.

Изобретение относится к областям медицинской и молекулярной генетики, а также к генотерапии. Описана генетическая конструкция, продуцирующим siPHK, которые являются ингибиторами репродукции вируса иммунодефицита человека 1 типа, субтипа А.

Изобретение относится к областям медицинской и молекулярной генетики, а также к генотерапии. Описана генетическая конструкция, продуцирующая siPHK, которые являются ингибиторами репродукции вируса иммунодефицита человека 1 типа, субтипа А.
Предложенное изобретение относится к области иммунологии. Раскрыты варианты антитело человека или антиген-связывающий фрагмент антитела человека, которые специфическим образом связывают и ингибируют человеческую пропротеинконвертазу субтилизин/кексин тип 9 («hPCSK9»).
Изобретение относится к области биохимии, в частности к моноклональным антителам, связывающимся с с-Met, способных ингибировать как лиганд-зависимую, так и лиганд-независимую активацию с-Меt.
Изобретение относится к вирусологии и касается штамма вируса осповакцины. Предложенный штамм выделен из гомогената тканей легких морских свинок, инфицированных 7-м пассажем вируса осповакцины.
Наверх