Средства и способы диагностики и лечения рассеянного склероза

Изобретение относится к области биотехнологии, конкретно к применению пептида, состоящего из по меньшей мере 8 последовательных аминокислотных остатков последовательности, представленной в SEQ ID NO:3, для диагностики рассеянного склероза, что может быть использовано в медицине. Диагностируют рассеянный склероз или предрасположенность к рассеянному склерозу у пациента по присутствию антитела против KIR4.1 в образце пациента. Изобретение позволяет получить альтернативные средства и способы диагностики и/или лечения рассеянного склероза. 5 н. и 4 з.п. ф-лы, 8 ил., 1 табл., 6 пр.

 

Настоящее изобретение относится к пептиду, содержащему или состоящему из по меньшей мере 8 последовательных аминокислотных остатков из последовательности, представленной в SEQ ID NO:3, при условии, что указанный пептид не состоит из последовательности, представленной в SEQ ID NO:3, или из соответствующего пептидомиметика, где указанный пептид или пептидомиметик связывается с антителом против KIR4.1, содержащимся в образце от пациента с рассеянным склерозом или предрасположенного к развитию рассеянного склероза, где предпочтительно (i), указанные по меньшей мере 8 последовательных аминокислотных остатков представляют собой подпоследовательность внеклеточного домена KIR4.1, состоящего из последовательности, представленной в SEQ ID NO:1 или 2; или (ii) указанный пептид содержит или состоит из последовательноти SEQ ID NO:1 или 2. Настоящее изобретение также относится к способу диагностики рассеянного склероза или предрасположенности к рассеянному склерозу у пациента, включающему определение присутствия антитела против KIR4.1 в образце, полученном от указанного пациента, где присутствие антитела против KIR4.1 в указанном образце указывает на наличие рассеянного склероза или предрасположенности к рассеянному склерозу.

В настоящем описании приведены ссылки на ряд документов, включающих патентные заявки и инструкции производителей. Содержание этих документов не рассматривается, как относящееся к патентоспособности настоящего изобретения, и они включены в настоящее описание посредством ссылки во всей их полноте. Более конкретно, все цитируемые документы включены посредством ссылки в той же мере, как если бы каждый отдельный документ был указан конкретно и отдельно как включенный в данное описание посредством ссылки.

Рассеянный склероз (РС) является наиболее распространенным хроническим воспалительным заболеванием центральной нервной системы (ЦНС), приводящим к инвалидности большинство больных, страдающих этой патологией (1). Этиология РС не выявлена, но эпидемиологические данные свидетельствуют о сложной взаимосвязи генетических и экологических факторов (2-4). Неясный патогенетический механизм, клиническая гетерогенность и непредсказуемость исхода у конкретного больного усугубляют сложность заболевания (5).

Принятая в настоящее время рабочая гипотеза патогенеза РС предполагает центральную роль аутореактивных Т-клеток (6). Вместе с тем, гистопатологические исследования выявили подгруппу больных РС, у которых в значительной степени выражены депонирование иммуноглобулинов и активация комплемента при острых демиелинизирующих поражениях (7, 8). Такие больные особенно хорошо реагируют на терапевтический плазмаферез (9). Кроме того, В-клеточное истощение посредством терапевтических моноклональных антител оказывает глубокое влияние на воспалительное действие при РС (10). Все эти данные поддерживают утверждение, что по меньшей мере в подгруппе больных РС наблюдается существенный вклад В-клеток и антител в развитие и прогрессирование заболевания (11, 12). Притом, что приведенные доказательства являются косвенными, не было установлено прямых доказательств присутствия клинически значимых антител при РС, в связи с тем, что остаются нераскрытыми конкретные молекулярные мишени для гуморального ответа при РС.

Можно представить техническую задачу изобретения, как получение альтернативных или улучшенных средств и способов диагностики и/или лечения рассеянного склероза.

В первом аспекте настоящее изобретение относится к пептиду, содержащему или состоящему из по меньшей мере 8 последовательных аминокислотных остатков из последовательности, представленной в SEQ ID NO:3, при условии, что указанный пептид не состоит из последовательности, представленной в SEQ ID NO:3, или из соответствующего пептидомиметика, где указанный пептид или пептидомиметик связывается с антителом против KIR4.1, содержащимся в образце от пациента с рассеянным склерозом или предрасположенного к рассеянному склерозу, где предпочтительно (i) указанные по меньшей мере 8 последовательных аминокислотных остатков представляют собой подпоследовательность внеклеточного домена KIR4.1, и указанный внеклеточный домен состоит из последовательности, представленной в SEQ ID NO:1 или 2; или (ii) указанный пептид содержит или состоит из последовательности SEQ ID NO:1 или 2. Соответственно, предпочтительными также являются пептидомиметики, соответствующие пептидам согласно вариантам (i) и (ii). Также предпочтительно, указанный пептид не содержит последовательность SEQ ID NO:3.

"KIR4.1" является сокращенным обозначением специфичного направленного внутрь калиевого канала. Предпочтительно, указанный KIR4.1 имеет человеческое происхождение. Последовательность человеческого KIR4.1 представлена в SEQ ID NO:3. Термины "последовательность человеческого белка KIR4.1" и "последовательность SEQ ID NO:3" использованы в изобретении для описания одного и того же объекта.

Данное антитело против KIR4.1 также называется "аутоантителом" согласно настоящему изобретению. Аутоантитело представляет собой встречающееся в природе антитело и предпочтительно является антителом IgG. В частности, аутоантитело представляет собой антитело против KIR4.1, выявляемое у больных РС и у пациентов, имеющих предрасположенность к развитию РС, и его следует отличать от других антител против KIR4.1, которые не встречаются у указанных больных или пациентов, а также от других антител, которые могут быть использованы в терапевтических целях, как описано ниже в настоящем описании. Последние указанные типы антител против KIR4.1 не встречается в природе и не являются показателями заболевания. Аутоантитело предпочтительно связывается с внеклеточным доменом KIR4.1, где указанный внеклеточный домен состоит из последовательности, представленной в SEQ ID NO:1 или 2. Предпочтительно, указанное аутоантитело связывается с внеклеточным доменом, состоящим из последовательности, представленной в SEQ ID NO:1.

Предпочтительные подпоследовательности последовательностей SEQ ID NO:1 и 2 представляют собой последовательности SEQ ID NO:4 и 5, соответственно. Предполагается, что последовательности SEQ ID NO:4 и 5 являются полностью внеклеточными. Таким образом, также является предпочтительным, что указанный пептид содержит или состоит из последовательноти SEQ ID NO:4 или 5. Кроме того, намеренно предусмотрен пептидомиметик, соответствующий последнему указанному пептиду.

Предпочтительными являются пептиды, имеющие последовательности, содержащие или состоящие из одной из любых последовательностей SEQ ID NO:1, 2, 4 или 5, но вместе с тем, предусмотрено наличие других пептидных последовательностей, причем указанные пептидные последовательности могут только частично перекрываться или совсем не перекрываться с любой из последовательностей SEQ ID NO:1, 2, 4 и 5. Для дополнительного разъяснения и, как известно в данной области техники, Т-клетки и В-клетки могут иметь различные предпочтительные эпитопы в пределах данного антигена.

Термин "пептид" относится к поликонденсации аминокислот. Предпочтительно, указанные аминокислоты выбирают из 20 природных аминокислот. Длина пептида согласно изобретению составляет по меньшей мере 8 аминокислотных остатков. Предпочтительный верхний предел длины указанного пептида составляет 100, 50, 40, 30, 25, 20, 15, 14, 13, 12, 11, 10 или 9 аминокислотных остатков, и, в самом широком смысле, верхний предел длины отсутствует, и, соответственно, в изобретение включены полипептиды любой длины. Предпочтительно, чтобы длина указанного пептида выбиралась таким образом, чтобы быть уникальной. Как подробно описано ниже, предпочтительно выбирают такую длину, чтобы пептид был способен связываться с молекулой главного комплекса гистосовместимости (МНС). В частности, известно, что молекулы МНС I обычно задают определенные ограничения для размера пептидов, способных связываться с этими молекулами. Таким образом, предпочтительные значения длины и диапазоны длины составляют от 8 до 12, от 8 до 10, и наиболее предпочтительно, 9 аминокислот. Молекулы MHC II, с другой стороны, обычно способны связываться с пептидами большей длины, и соответственно, не задают ограничений для верхнего предела длины пептида согласно изобретению.

Термин "пептидомиметики" общеизвестен в данной области техники. Этот термин относится к производным пептидов, и ниже приведено определение указанных производных в отношении их структуры. "Соответствующий пептидомиметик" представляет собой пептидомиметик, который связывается с указанными антителами. Такое связывание может быть достигнуто путем сохранения структурных характеристик каждой аминокислоты, составляющей пептид, производным которого является этот пептидомиметик, например, где исходный пептид также связывается с указанным антителом. В предпочтительном варианте осуществления каждая из боковых цепей по меньшей мере 8 последовательных аминокислотных остатков остается в указанном соответствующем пептидомиметике в модифицированном или в немодифированном виде. Модификации боковой цепи включают замену одного или нескольких атомов водорода атомами галогена, предпочтительно атомами фтора. Дополнительно, предпочтительные модификации боковой цепи включают циклизацию. Независимо от этого, одну или более пептидных связей основной цепи можно независимо заменять функциональными группами, которые являются изостерическими или, другими словами, имитируют эту пептидную связь. Предпочтительно, что пептидную связь -CO-NH- можно заменить любым из следующего: -NH-CO-, -CH-(OH)-CH2-, -CO-CH2-, -CH2-NH-, -CH2-О-, -CH2-CH2-, -CH=CH-, -CO-N(CH3)- и ΡО2-Χ-, где Х предпочтительно выбирают из NH, О и СН2. Так, например, в соответствующем пептидомиметике все пептидные связи исходного пептида можно заменить ретро-инверсо связями (-H-CO-).

Следует понимать, что пептидомиметикам по изобретению присущи по существу неизмененные функциональные свойства исходного пептида. В частности, соответствующий пептидомиметик связывается с антителом против KIR4.1, содержащимся в образце больного рассеянным склерозом. Оценку таких связей можно проводить без дополнительных усилий с помощью средств и способов, описанных в изобретении.

Следует понимать, что первый аспект настоящего изобретения относится, с одной стороны, к пептиду и ,с другой стороны, к пептидомиметику. Дискламация вычеркивает из определения пептида аминокислотную последовательность, состоящую из последовательности, представленной в SEQ ID NO:3. Другими словами, первый аспект относится: (а) к пептиду, содержащему или состоящему из по меньшей мере 8 последовательных аминокислотных остатков в последовательности, представленной в SEQ ID NO:3, при условии, что указанный пептид не состоит из последовательности, представленной в SEQ ID NO:3, или (b) к соответствующему пептидомиметику, где указанный пептид или пептидомиметик связывается с антителом против KIR4.1, содержащимся в образце от пациента с рассеянным склерозом или предрасположенного к развитию рассеянного склероза, где предпочтительно, (i) указанные по меньшей мере 8 последовательных аминокислотных остатков представляют собой подпоследовательность внеклеточного домена KIR4.1, где указанный внеклеточный домен состоит из последовательности, представленной в SEQ ID NO:1 или 2; или (ii) указанный пептид содержит или состоит из последовательности SEQ ID NO:1 или 2.

Пептид или пептидомиметик по изобретению связываются с антителом против KIR4.1, где указанное антитело против KIR4.1 содержится в образце от больного рассеянным склерозом (РС) или в образце от пациента с предрасположенностью к развитию РС. Как дополнительно подробно описано ниже, настоящее изобретение предоставляет различные средства и способы выявления наличия у больного РС аутоантител против KIR4.1, а также для выделения таких антител у больного РС. В число указанных средств включены средства, которые в настоящем изобретении в целом называются "рецепторами". Способы выделения антител согласно изобретению включают стадию приведения в контакт указанных рецепторов с образцом, полученным от пациента, где образец предположительно содержит антитела против KIR4.1. С помощью использования таких полученных от больного РС антител против KIR4.1 специалист в данной области может без дополнительных усилий определить, способен или не способен к связыванию с антителом пептид, содержащий или состоящий из по меньшей мере 8 последовательных аминокислотных остатков из KIR4.1 или соответствующего пептидомиметика. Предпочтительный способ, который может использовать специалист в данной области, представляет собой анализ ELISA. В таком анализе указанный пептид или пептидомиметик согласно основному варианту осуществления является иммобилизованным на носителе, создается возможность связывания аутоантитела от больного РС или от пациента, имеющего предрасположенность к РС, с пептидом или пептидомиметиком, и указанное связывание выявляют с помощью вторичного антитела, которое, в свою очередь, является ферментно-связанным. Указанное вторичное антитело, может, например, представлять собой антитело, способное к связыванию с Fc-фрагментами, и, соответственно, оно будет связываться с Fc-участком аутоантитела.

В связи с вышеизложенным, настоящее изобретение также относится к антителу против KIR4.1, которое можно получать от больного рассеянным склерозом или от пациента, имеющего предрасположенность к развитию РС. Определение такого аутоантитела приведено выше.

Как описано более подробно в прилагаемых примерах, в KIR4.1 присутствуют по меньшей мере два внеклеточных домена. Эти два внеклеточных домена также называются большим и малым внеклеточными доменами. Антитело против KIR4.1, являющееся показателем рассеянного склероза, предпочтительно связывается с большим внеклеточным доменом, малым внеклеточным доменом или с двумя указанными внеклеточными доменами. Последовательности большого и малого внеклеточного домена KIR4.1, соответственно, представлены в SEQ ID NO:1 и 2. Строго внеклеточные части показаны в SEQ ID NO:4 и 5, соответственно.

Термин "рассеянный склероз" относится к воспалительным заболеваниям нервной системы; см. также цитируемую литературу, приведенную в разделе предыдущего уровня выше. Так или иначе, пациент или больной рассеянным склерозом может выявляться способом диагностики согласно изобретению, который предоставляется во втором аспекте изобретения и описан ниже. Альтернативно или в дополнение, диагноз рассеянного склероза можно устанавливать на основе подтвержденных клинических симптомов, и указанные клинические симптомы известны специалистам в данной области. Клинические симптомы рассеянного склероза включают нарушения зрения, головокружение, сенсорные дисфункции, слабость, нарушение координации, потерю равновесия, утомляемость, боль, нейрокогнитивные расстройства, расстройства психического здоровья, дисфункцию мочевого пузыря, дисфункцию кишечника, сексуальную дисфункцию, температурную чувствительность.

При том, что обнаружение аутоантител против KIR4.1 в образце, взятом у больного или у пациента, указывает на рассеянный склероз или предрасположенность к рассеянному склерозу, следует понимать, что рассеянный склероз или предрасположенность к нему необязательно характеризуются наличием указанных антител у указанного пациента или больного, или во взятом у них образце.

Таким образом, присутствие аутоантител против KIR4.1 определяет подгруппу людей с предрасположенностью к развитию РС, и указанная подгруппа отличается наличием указанных аутоантител. Аналогично, в изобретении описана подгруппа больных РС, где указанная подгруппа отличается наличием указанных аутоантител. Другими словами, присутствие аутоантител означает вторичный показатель в рамках показателей диагноза рассеянного склероза. Предполагается, что больные с выявленным вторичным показателем РС реагируют на лечение иным образом, по сравнению с больными РС, которые не являются носителями указанных аутоантител. Также ожидается, что профиль риска у пациентов - носителей указанных аутоантител, будет отличаться от профиля риска у пациентов, которые не имеют указанных аутоантител. Как следствие, можно выбирать разные способы терапевтического лечения, а также разные способы профилактического лечения в зависимости наличия или отсутствия аутоантител у больного РС, и наличия или отсутствия указанных аутоантител у пациента с риском развития РС, соответственно.

Термин "подпоследовательность" означает участок смежных аминокислотных остатков, взятых из более длинной последовательности. Другими словами, если указанная более длинная последовательность состоит из n остатков, максимальная длина подпоследовательности составляет (n-1) остатков.

Настоящее изобретение также относится к нуклеиновой кислоте, кодирующей описанный выше пептид согласно изобретению. Нуклеиновая кислота может представлять собой ДНК, например, кДНК или геномную ДНК, или РНК. Кроме того, в изобретении предоставляется вектор, содержащий указанную нуклеиновую кислоту. Кроме того, настоящее изобретение относится к клетке-хозяину, содержащей нуклеиновую кислоту и/или вектор согласно изобретению. Клетка-хозяин может быть любого происхождения, и предпочтительно существует in vitro, например, в выделенном виде или в культуре. Следует отметить, что в распоряжении квалифицированного специалиста имеются линии человеческих эмбриональных стволовых клеток, но вместе с тем, является предпочтительным получение клеток-хозяев без использования или уничтожения человеческих эмбрионов. Также предпочтительно, чтобы клетки-хозяева не были клетками человеческого происхождения, если они представляют собой эмбриональные клетки или эмбриональные стволовые клетки.

Во втором аспекте настоящее изобретение относится к способу диагностики рассеянного склероза или предрасположенности к рассеянному склерозу у пациента, включающему определение присутствия антител против KIR4.1 в образце, полученном от указанного пациента, где присутствие антител против KIR4.1 в указанном образце свидетельствует о рассеянном склерозе или предрасположенности к рассеянному склерозу.

Данный способ дает возможность диагностировать рассеянный склероз, или способ предназначен для диагностики предрасположенности к рассеянному склерозу, при условии, что диагноз рассеянного склероза не является очевидным для указанного пациента. Термин "предрасположенность" имеет принятое в данной области значение и предпочтительно означает вероятность развития заболевания. В частности, указанная вероятность превышает этот показатель у нормального пациента из контрольной группы. Указанную вероятность у нормального пациента из контрольной группы можно представить в виде средней вероятности развития РС в случайной выборке из популяции.

Подходящие агенты для определения указанного присутствия антител против KIR4.1 описаны ниже, в частности, в качестве активных агентов, относящихся к раскрываемым диагностическим композициям и диагностическим применениям.

Предпочтительную группу людей для проведения тестирования на указанную предрасположенность к РС представляют люди с семейным анамнезом РС.

Авторы настоящего изобретения были первыми, кто идентифицировал молекулярную мишень ранее предполагаемого аутоиммунного ответа при РС. Следует отметить, что целью общепринятых стратегий выявления антител при РС в основном является серологический скрининг на иммуноглобулины к предварительно выбранным возможным молекулам-мишеням на основе их функционального отношения к природе миелина и энцефалитогенного потенциала на животных моделях (13). Также проводился скрининг экспрессии E.coli, фагового дисплея и пептидных библиотек для выявления линейных мишеней РС-специфичных аутоантител (14-17). До настоящего времени ни одна из стратегий не выявила каких-либо потенциальных мишеней, которые могли бы быть или специфичными, или прогностическими для рассеянного склероза (18, 19).

Авторы настоящего изобретения обнаружили высокие титры антител против KIR4.1 в сыворотке пациентов в 50,8% случаях в двух независимых когортах. Таким образом, средства и способы, описанные в данном описании, дают возможность диагностировать РС или предрасположенность к РС примерно в половине случаев РС или среди пациентов из группы риска развития заболевания, соответственно. В частности, способы по изобретению дают возможность проводить раннюю диагностику РС или предрасположенности к РС, или подтверждать неустановленный диагноз. Тест на антитела может давать возможность неинвазивной диагностики клинически изолированного синдрома (КИС) или РС (например, без забора и анализа спинномозговой жидкости) и проводить более раннюю диагностику РС, КИС или предрасположенности к РС, чем это было возможно с помощью диагностических процедур, известных в данной области. "КИС" означает "клинически изолированный синдром" и будет рассмотрен ниже. Общеизвестно, что лечение РС бывает наиболее эффективным при максимально раннем начале лечения в ходе болезни. Таким образом, ранняя диагностика дает возможность осуществлять раннее лечение больных с КИС, РС или с риском развития этих заболеваний. У некоторых людей из группы риска лечение может даже предотвращать (дальнейшее) развитие заболевания.

Как показано в прилагаемых примерах, аутоантитела могут истощать экспрессию KIR4.1 глиальными клетками с помощью антитело-зависимой клеточно-опосредованной цитотоксичности (ADCC) или активации комплемента (фиг.6). Дополнительно, антитела могут нарушать функционирование калиевого канала в результате функциональных последствий в отношении буферизации ионов и нейромедиаторов гомеостаза (20, 21, 22). Это может приводить к поражению тканей или нарушению ремиелинизации.

В предпочтительном варианте осуществления способов согласно изобретению и в случае присутствия антител против KIR4.1 в указанном образце (i) наличие по меньшей мере одного клинического симптома рассеянного склероза у указанного пациента указывает на рассеянный склероз; и (ii) отсутствие каких-либо клинических симптомов рассеянного склероза является показателем указанной предрасположенности к рассеянному склерозу.

Как указано выше, способы согласно изобретению предназначены для диагностики рассеянного склероза, а также для диагностики предрасположенности к РС. Представленный предпочтительный вариант осуществления предусматривает дополнительную информацию, получаемую в отношении указанного пациента, при этом указанная дополнительная информация способствует проведению дифференциальной диагностики заболевания и диагностики предрасположенности к заболеванию. В частности, указанная дополнительная информация содержит или состоит из по меньшей мере одного клинического симптома рассеянного склероза. Рассеянный склероз является хорошо изученным заболеванием с установленными клиническими симптомами. Специалистам хорошо известны клинические симптомы, характерные для рассеянного склероза или свидетельствующие о его наличии (см. ниже), и они могут определить наличие или отсутствие РС без лишних усилий.

Согласно представленному предпочтительному варианту осуществления, отсутствие каких-либо клинических симптомов рассеянного склероза, наблюдаемое одновременно вместе с присутствием антител против KIR4.1, является показателем предрасположенности к рассеянному склерозу. Другими словами, в случаях неэффективности существующих способов диагностики и прогнозирования настоящее изобретение дает возможность выявлять пациентов, у которых в определенный момент в будущем возникнет повышенный риск развития рассеянного склероза.

С другой стороны, у пациентов с выявленным по меньшей мере одним клиническим симптомом рассеянного склероза определение антител против KIR4.1 дополнительно подтверждает диагноз рассеянного склероза. В тех случаях, когда клинические параметры сами по себе не позволяют установить четкий диагноз, настоящее изобретение способствует проведению диагностики и обоснованию указанного диагноза. В частности, это относится к ранним формам рассеянного склероза. В данной области общеизвестно, что ранняя диагностика рассеянного склероза является весьма желательной, поскольку обычно ранние стадии в более высокой степени подходят для лечения.

Согласно другому предпочтительному варианту осуществления указанный клинический симптом представляет собой по меньшей мере один симптом, выбранный из следующих: нарушения зрения, головокружения, сенсорных дисфункций, слабости, нарушения координации, потери равновесия, утомляемости, боли, нейрокогнитивных расстройств, расстройств психического здоровья, дисфункции мочевого пузыря, дисфункции кишечника, сексуальной дисфункции, температурной чувствительности, наличия маркера (маркеров) воспаления в спинномозговой жидкости (СМЖ), наличия поражений головного мозга и/или спинного мозга. Приведенные поражения можно визуализировать с помощью МРТ. Обычно такие поражения возникают в перивентрикулярной, юкстакортикальной и/или субтенториальной области мозга. Маркеры воспаления, показательные для РС, хорошо известны в данной области и предпочтительно их выбирают из плеоцитоза (аномально увеличенного количества клеток в СМЖ, при том, что типичные значения повышенного количества клеток составляют от 5 до 50 клеток/мкл или выше), синтеза интратекального иммуноглобулина IgG и появления полос в олигоклональном IgG в спинномозговой жидкости.

Согласно другому предпочтительному варианту осуществления указанный пациент имеет клинически изолированный синдром (КИС) или по меньшей мере один клинический симптом КИС. В данной области КИС обычно считается ранней стадией рассеянного склероза, при этом характерные для него клинические характеристики еще не полностью установлены. Информацию о КИС, см., например, в публикации Thrower, Neurology 68, S12-S15 (2007). Преимущество средств и способов согласно настоящему изобретению состоит в том, что они дают возможность собрать дополнительные доказательства для пациентов с КИС.

Согласно другому предпочтительному варианту осуществления указанное антитело против KIR4.1, т.е. антитело против KIR4.1, которое можно выявлять у больных с РС, а также у пациентов из группы риска развития РС, связывается с KIR4.1 (SEQ ID NO:3) или с внеклеточным доменом KIR4.1, состоящим из последовательности, представленной в любой из SEQ ID NO:1, 2, 4 или 5. Структура KIR4.1 дополнительно описана в прилагаемых примерах. В частности, KIR4.1 содержит (по меньшей мере) два внеклеточных домена, которые предположительно разделены одним трансмембранным сегментом, см. фиг.4c. Эти два внеклеточных домена в данном описании также называются большим внеклеточным доменом и малым внеклеточным доменом и представлены в SEQ ID NO:1 и 2. Остальные области показаны на фиг.4с в виде SEQ ID NO:4 и 5, соответственно.

Еще в одном предпочтительном варианте осуществления обнаружение антител против KIR4.1 в указанном образце осуществляется с помощью способа, выбранного из группы, состоящей из твердофазного иммуноферментного анализа ELISA, иммунопреципитации, вестерн-блоттинга, иммунофлюоресценции, иммуногистохимического анализа, проточной цитометрии, металлоиммуноанализа (например, GLORIA), анализа флуоресцентного резонансного переноса энергии (FRET) и масс-спектрометрии. Эти способы хорошо известны и доступны специалисту в данной области. Например, с помощью анализа ELISA можно использовать связывание антитела с указанным антителом против KIR4.1. Аналогичные соображения применимы к анализам иммунопреципитации, вестерн-блоттингу, иммунофлюоресценции и иммуногистохимии. Как отмечалось выше, специалист в данной области может выделить и определить свойства антитела против KIR4.1 без лишних усилий, если это предусмотрено теорией настоящего изобретения. Для такого определения свойств предпочтительно используется масс-спектрометрия. Масс-спектрометрию можно использовать после определения свойств для определения наличия или отсутствия антител против KIR4.1 в любом конкретном образце. Можно использовать FRET-анализ, например, в контексте анализа связывания, при этом указанный анализ связывания предпочтительно проводят с использованием рецепторов, и определение указанного рецептора приведено ниже. Можно выполнять FRET-анализ таким образом, что детектируемый перенос между донором и акцептором FRET-пары происходит только в случае, если рецептор и антитело против KIR4.1 находятся в непосредственной специфичной близости, и эта непосредственная специфичная близость указывает на присутствие антитела против KIR4.1.

В других предпочтительных вариантах присутствие указанного антитела против KIR4.1 определяют с помощью (а) приведения в контакт образца с рецептором, связанным с указанным антителом против KIR4.1, и (b) обнаружения образования комплекса рецептор-антитело против KIR4.1, где указанный рецептор предпочтительно выбирают из группы, состоящей из пептида или пептидомиметика согласно изобретению, белка KIR4.1 (SEQ ID NO:3) и связывания антитела с указанным антителом против KIR4.1. Как описано ниже, специалисту в данной области доступны средства и способы получения антител против конкретного антигена (включая антитела).

В отличие от предыдущего предпочтительного варианта, предусматривающего разные схемы считывания, представленный предпочтительный вариант осуществления содержит специальные способы обнаружения антитела против KIR4.1, и указанные специальные способы отличаются в структурном отношении. Соответственно, эти предпочтительные варианты осуществления, а также любые другие варианты осуществления, описанные в данном описании, можно комбинировать, если не указано иное, с любой из указанных комбинаций, которая является объектом дополнительных предпочтительных вариантов осуществления согласно настоящему изобретению. В предпочтительном анализе проводят экспрессию белка KIR4.1 в клетках, указанные клетки инкубируют с сывороткой, и определяют связывание аутоантител с белком KIR4.1 с помощью анализов проточной цитометрии и иммуногистохимии с использованием вторичного антитела. Как указано выше, указанное вторичное антитело предпочтительно связывается с указанным аутоантителом, например, посредством связывания с его участком Fc. Дополнительные предпочтительные анализы описаны в прилагаемых примерах.

Предпочтительными вариантами указанных рецепторов являются пептид или пептидомиметик согласно изобретению и антитело, связанное с указанным антителом против KIR4.1. В любом случае, более предпочтительно, указанный рецептор является специфичным для указанного антитела против KIR4.1. Специфичность можно определить в сравнительных или конкурентных анализах, в которых с одной стороны выявляют связывание с рецептором указанного антитела против KIR4.1 других белков, связывающих белков или антител. Предпочтительно, что константа связывания (Kd) рецептора для аутоантитела ниже по меньшей мере на порядок величины, предпочтительно по меньшей мере ниже на два, три, четыре, пять или шесть порядков величины, чем для других исследуемых белков. "Порядок величины" находится в пределах одного порядка.

Терапевтические или диагностические антитела, описанные в данном описании, могут быть моноклональными или поликлональными антителами. Кроме того, в частности, в контексте диагностических и терапевтических антител, описанных в данном описании, термин "антитело" также включает одноцепочечные антитела или их фрагменты, которые специфично связываются со своими соответствующими мишенями, а также биспецифичные антитела, синтетические антитела, фрагменты антител, такие как Fab, F(ab2)′, фрагменты Fv и ScFv и тому подобное, а также их химически модифицированные производные.

Моноклональные антитела могут быть получены, например, с помощью методик, исходно описанных Kohler and Milstein, Nature 256 (1975), 495, и Galfre, Meth. Enzymol. 73 (1981), 3, и эти методики содержат слияние клеток миеломы мышей с клетками селезенки, полученными от иммунизированных млекопитающих, с модификациями, разработанными в данной области техники. Кроме того, можно получать антитела или их фрагменты к вышеуказанным пептидам с использованием способов, описанных, например, Harlow and Lane "Antibodies, A Laboratory Manual", CSH Press, Cold Spring Harbor, 1988. Если производные указанных антител получают технологией фагового дисплея, можно применять поверхностный плазмонный резонанс, используемый в системе BIAcore, для повышения эффективности фаговых антител, которые связываются с эпитопом пептида или полипептида согласно изобретению (Schier, Human Antibodies Hybridomas 7 (1996), 97-105; Malmborg, J. Immunol. Methods 183 (1995), 7-13). Получение химерных антител описано, например, в WO 89/09622. Еще одним источником антител, используемых согласно настоящему изобретению, являются так называемые ксеногенные антитела. Общий принцип получения ксеногенных антител, например, человеческих антител у мышей, описан, например, в патентах WO 91/10741, WO 94/02602, WO 96/34096 и WO 96/33735. Используемые согласно изобретению антитела или их соответствующая иммуноглобулиновая цепь(и) можно модифицировать с помощью общепринятых способов, известных в данной области, например, с помощью аминокислотной делеции(й), инсерции(й), замещения(й), добавления(й) и/или рекомбинации(й), и/или любой другой модификации(й), известных в данной области, применяя их по отдельности или в комбинации. Способы внедрения таких модификаций в последовательность ДНК, лежащие в основе аминокислотной последовательности цепи иммуноглобулина, хорошо известны специалистам в данной области техники, см., например, Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, Нью-Йорк, 1989 год.

Термин "моноклональное" или "поликлональное антитело" (см. Harlow and Lane (1988), loc. cit.) также относится к производным указанных антител, которые сохраняют или по существу сохраняют свою специфичность связывания. Особенно предпочтительные варианты осуществления этих производных указаны ниже в настоящем описании, при этом существуют другие предпочтительные производные таких антител, представляющие собой химерные антитела, содержащие, например, мышиную или крысиную вариабельную область и человеческую константную область.

Термин "scFv-фрагмент" (одноцепочечный Fv фрагмент) общеизвестен в данной области и является предпочтительным благодаря своему небольшому размеру и возможности рекомбинантного получения таких фрагментов.

В особенно предпочтительном варианте осуществления способа согласно изобретению указанное антитело или его антитело-связывающий фрагмент является человеческим антителом или гуманизированным антителом, или их производным. Согласно настоящему изобретению, термин "гуманизированное антитело" означает антитело не человеческого происхождения, в котором по меньшей мере одна область, определяющая комплементарность (CDR) в вариабельных областях, таких как CDR3, и, предпочтительно, все шесть областей CDR были заменены областями CDR из антител человеческого происхождения, имеющими желаемую специфичность. Необязательно, что не человеческая константная область(и) антитела заменяется/была заменена на константную область(и) человеческого антитела. Способы получения гуманизированных антител описаны, например, в патентах EP-A1 0239400 и WO 90/07861.

В другом предпочтительном варианте осуществления указанный образец выбирают из крови, сыворотки, плазмы, лимфатических узлов, СМЖ, слезной жидкости, мочи, мокроты и биоптата мозга.

В третьем аспекте настоящее изобретение относится к рецептору, описанному выше, для применения в лечении рассеянного склероза или в диагностике рассеянного склероза, или предрасположенности к РС. Для этих медицинских целей предназначен рецептор, определение которого приведено выше, а также полностью белок KIR4.1 (то есть белок, состоящий из последовательности, представленной в SEQ ID NO:3). Введение этих агентов служит для уменьшения числа циркулирующих антител против KIR4.1. Как более подробно описано ниже, эти агенты можно не только вводить больному, страдающему РС, или пациенту с наличием или подозрением на предрасположенность к РС, но также можно использовать в способах ex vivo, где указанные способы ex vivo обеспечивают удаление аутоантител из организма больного РС или, более конкретно, из биологической жидкости указанного больного или пациента с риском развития РС.

Термин "лечение" относится к лечению терапевтическими способами и охватывает облегчение заболевания и/или его симптомов, а также полную ремиссию. Кроме того, термин "лечение" распространяется на профилактику.

В предпочтительных вариантах медицинского применения согласно настоящему изобретению один или несколько указанных средств являются единственными активными средствами, предназначенными для применения. В альтернативных, предпочтительных вариантах осуществления один или несколько средств из указанных в явной форме могут использоваться в сочетании с одним или несколькими средствами, известными в качестве полезных для больных РС или известных в качестве способствующих диагностике РС. До настоящего времени предотвращают или смягчают прогрессирование РС и предотвращают рецидивы путем введения одного или более одного из следующих средств: интерферон-бета, глатирамерацетат, натализумаб, митоксантрон, финголимод, азатиоприн. Рецидивы лечат высокими дозами метилпреднизолона и/или проведением плазмафереза.

В предпочтительных вариантах осуществления указанный рецептор должен контактировать с кровью, сывороткой, плазмой, лимфатическими узлами, СМЖ, слезной жидкостью, мочой, мокротой и/или биоптатом мозга, полученными от пациента. Этот вариант осуществления относится к предпочтительным образцам, которые должны использоваться в диагностике.

В другом предпочтительном варианте осуществления третьего аспекта настоящего изобретения, в той степени, в которой указанный третий аспект относится к терапии, указанный рецептор необходимо вводить пациенту по меньшей мере два раза. Неоднократное введение обеспечивает высокую степень удаления, предпочтительно полное удаление аутоантител и, в конечном итоге, приводит к улучшению или ремиссии заболевания.

Еще в одном предпочтительном варианте осуществления пептид можно выбрать таким образом, чтобы он связывался с аллельным MHC пациента, подлежащего лечению. Указанная молекула МНС может быть молекулой MHC класса I или класса II. Для гарантии связывания с молекулой МНС класса I предпочтительно, чтобы в указанном пептиде было от 8 до 12, предпочтительно от 8 до 10 и наиболее предпочтительно от 9 аминокислот. Кроме того, предпочтительно наличие якорных аминокислотных остатков, и указанные якорные аминокислотные остатки представляют собой остатки, достоверно вовлеченные в связывание МНС. Специалистам в данной области известна методика выбора подходящих пептидных последовательностей в SEQ ID NO:1 и 2. Например, Rammensee et al. (Immunogenetics, 41: 178-228, 1995) описывают признаки, включающие якорные аминокислоты МНС-связывающих пептидов. Представление указанного пептида в контексте МНС позволяет нацелить дополнительный или альтернативный механизм для лечения или профилактики РС. Более конкретно, это дает возможность направлять в апоптоз Т-клетки, специфичные к KIR4.1, тем самым уменьшая или устраняя аутоиммунную реакцию на эндогенный белок KIR4.1. Еще в одном предпочтительном варианте осуществления рассмотрены МНС-пептидные комплексы для использования в лечении рассеянного склероза. Особенно предпочтительным является использование МНС-мультимеров, таких как МНС-тетрамеры, в которых предпочтительно каждая молекула МНС имеет связь с пептидом или пептидомиметиком по изобретению. Предпочтительно, указанный пептид или пептидомиметик является одинаковым для всех молекул МНС указанного мультимера или тетрамера. Как известно в данной области техники, тетрамер можно получать с использованием биотинилированных молекул МНС. Предпочтительной целью биотинилирования является карбокси-конец молекулы МНС. Образование тетрамеров происходит при инкубировании со стрептавидином, поскольку стрептавидин имеет четыре биотин-связывающих сайта. Такие мультимеры или тетрамеры связывают антиген-специфичные Т-клеточные рецепторы с особенно высокой аффинностью. Таким образом, использование мультимеров, предпочтительно тетрамеров молекул МНС с пептидными связями, дает возможность идентифицировать и впоследствии инактивировать KIR4.1-специфичные Т-клетки.

Кроме того, и без привязки к конкретной теории, предполагается, что введение пептидов или пептидомиметиков согласно изобретению позволяет осуществлять десенсибилизацию Т-клеток и В-клеток, ответственных за данную болезнь. В этой связи, предоставляется одно или несколько положений указанного пептида или пептидомиметика, и можно модифицировать указанные положения, взаимодействующие с Т-клеточным рецептором, с целью точной регулировки взаимодействия Т-клеточного рецептора указанного пептида или пептидомиметика. Такие положения и подходы к их модификации известны в данной области, см., например, публикации Kappos et al., Nature Med., 6, 1176-1182 (2000).

Другими словами, изобретение относится к средствам и способам индукции толерантности KIR4.1. Термин "толерантность" имеет значение, установленное в данной области, и относится к отсутствию реактивности иммунной системы к данному антигену. Как правило, существует толерантность по отношению к собственным антигенам. В отсутствие толерантности к собственному антигену может происходить образование антител, и могут возникать аутоиммунные заболевания. Как очевидно из описания настоящего изобретения, рассеянный склероз имеет признаки аутоиммунного заболевания. Одним из предпочтительных подходов для уменьшения или устранения образования аутоантител против белка KIR4.1 является индукция толерантности или десенсибилизация. Предполагаемый эффект состоит в создании аутотолерантности в отношении KIR4.1. Поскольку толерантность является антиген-зависимым эффектом, она может наблюдаться в В-клетках, Т-клетках или в обоих типах клеток как в В-клетках, так и Т-клетках. Феномен толерантности как таковой, а также механизмы, лежащие в основе В-клеточной и Т-клеточной толерантности известны в данной области.

В четвертом аспекте настоящее изобретение относится к связыванию антитела с KIR4.1 (SEQ ID NO:3) или с внеклеточным доменом KIR4.1 для использования в лечении рассеянного склероза, указанный домен состоит из последовательности, представленной в SEQ ID NO:1 или 2, и указанное антитело препятствует связыванию с KIR4.1 антитела против KIR4.1, содержащегося в образце от пациента с рассеянным склерозом или предрасположенного к его развитию.

Предпочтительно, что связывающееся с внеклеточным доменом KIR4.1 указанное антитело является специфичным для этого домена. Средства и способы определения специфичности антител доступны специалистам в данной области и описаны в данном описании выше. Особенно предпочтительно, что вышеуказанное антитело, предназначенное для применения в терапии, может связываться с эпитопом, который не распознается каким-либо аутоантителом. В этой связи, следует отметить, что специалисту в данной области доступны средства и способы картирования эпитопа. Вышеуказанные функциональные требования, т.е. нарушение связывания антитела, могут быть обеспечены путем выбора соответствующего эпитопа. Кроме того, предпочтительно, чтобы связывание терапевтического антитела не нарушало или не оказывало значительного влияния на биохимическое или клеточное функционирование KIR4.1. Известно, что KIR4.1 вовлечен в гомеостаз воды и ионов калия в центральной нервной системе. Таким образом, предполагается, что поддержание или восстановление функции KIR4.1 оказывает защитный эффект для нейронов и прозрачных клеток.

Эти варианты осуществления относятся к способу влияния на связывание аутоантител с их когнатной мишенью, что облегчает болезнь.

В пятом аспекте настоящее изобретение относится к композиции, содержащей (i) пептид по изобретению, (ii) антитело, связывающееся с антителом против KIR4.1, как описано выше (т.е. антитело, связывающееся с аутоантителом), и/или (iii) антитело из предшествующих вариантов осуществления, т.е. антитело, препятствующее связыванию аутоантитела со своей мишенью.

Соответственно, настоящее изобретение относится к трем разным типам антител. Во-первых, в изобретении раскрыто аутоантитело, связывающееся с внеклеточной петлей KIR4.1. Считается, что это антитело является причиной и/или показателем РС приблизительно у половины больных РС. Во-вторых, данное изобретение относится к антителу, способному связываться с аутоантителом. Такой второй тип антитела подходит как для терапевтических, так и для диагностических целей, подробно описанных выше. Наконец, настоящее изобретение относится к антителу, которое связывается с KIR4.1 и в то же время препятствует связыванию аутоантитела со своей мишенью. Это последнее антитело подходит для терапевтических целей, описанных в изобретении выше.

Предпочтительные варианты осуществления композиции по настоящему изобретению относятся к фармацевтической композиции, необязательно дополнительно содержащей фармацевтически приемлемый носитель и/или разбавитель, и к диагностической композиции в той степени, в которой указанная композиция относится к пептиду или антителу, связывающемуся с антителом против KIR4.1. Специалист в данной области может выбрать подходящие фармацевтически приемлемые носители, эксципиенты и/или разбавители без лишних усилий. Например, антитело может поставляться в растворе, например, в буферном растворе.

Буферы хорошо известны в данной области, и специалисту в данной области известны подходящие буферы в зависимости от анализируемых веществ. Общепринятые буферы содержат (в скобках указаны значения pKa) H3PO4/NaH2PO4 (pKa=2,12), глицин (pKa,1=2,34), уксусную кислоту (4,75), лимонную кислоту (4,76), MES (6,15), какодиловую кислоту (6,27), H2CO3/NaHCO3 (pKa,1=6,37), бис-Трис (6,50), ADA (6,60), бис-Трис пропан (pKa,1=6,80), PIPES (6,80), ACES (6,90), имидазол (7,00), BES (7,15), MOPS (7,20), Na2PO4/Na2HPO4 (pKa,2=7,21), TES (7,50), HEPES (7,55), HEPPSO (7,80), триэтаноламин (7,80), трицин (8,10), трис (8,10), глицинамид (8,20), бицин (8,35), глицилглицин (pKa,2=8,40), TAPS (8,40), бис-трис пропан (pKa,2=9,00), борную кислоту (Н3ВО3/Na2B4O7) (9,24), CHES (9,50), глицин (pKa,2=9,60), NaHCO3/Na2CO3(pKa,2=10,25), CAPS (10,40) и Na2HPO4/Na3PO4 (pKa,3=12,67).

Кроме того, можно регулировать ионную силу указанного выше буфера, например, путем добавления хлорида натрия и/или хлорида калия. Предпочтительные концентрации хлорида натрия составляют от 0 до 2М, предпочтительно от 100 до 200 мМ. Примеры буферов, содержащих хлорид натрия, включают PBS (забуференный фосфатный раствор), содержащий 1,37 М NaCl, 27 мМ KCl, 43 мМ Na2HPO4.7H2O и 14 мМ KH2PO4 в 10-кратном объеме водного стокового раствора, уровень рН которого доведен до 7,3; SSC, содержащим 3 М NaCl и 0,3 М цитрата натрия в 20-кратном объеме водного стокового раствора, уровень рН которого доведен до 7,0, и STE (раствор Трис-EDTA), содержащий 10 мМ Трис-основания, 10 мМ NaCl, и 1 мМ этилентетрауксусной кислоты (ЭТА). Альтернативно, в буферных препарата отсутствует хлорид натрия. Примерами общепринятых буферных препаратов без хлорида натрия или калия являются ТАЕ (Трис ацетат-EDTA), содержащий 2 М Трис-ацетата и 0,1 М EDTA в 50-кратном объеме водного растворе при рН 8,5; TBE (Трис-борат EDTA), содержащий 0,89 М Трис-основания, 0,89 М борной кислоты и 0,02 М EDTA в 10-кратном объеме водного стокового раствора при рН 8,0, и TE (Трис-EDTA), содержащий 10 мМ Трис-основания и 1 мМ EDTA (кислоты) при рН 7,5.

Фармацевтические композиции, описанные в изобретении, можно вводить пациенту в подходящей дозе. Введение подходящих композиций можно осуществлять разными способами, например, путем внутривенного, внутрибрюшинного, подкожного, а также трансдермального введения.

В частности, фармацевтические композиции можно вводить перорально, парентерально, например, подкожно, внутривенно, внутримышечно, внутрибрюшинно, интратекально, чрескожно, через слизистую оболочку, субдурально, назальным путем, локально или местно с помощью ионтофореза, сублингвально, с помощью ингаляционного спрея, аэрозоля или ректально и тому подобными путями, в стандартных лекарственных формах, необязательно содержащих обычные фармацевтически приемлемые эксципиенты.

Режим дозирования будет определяться лечащим врачом и клиническими факторами. Как общеизвестно в области медицины, для любого пациента дозировки зависят от множества факторов, включающих массу и размер пациента, площадь поверхности тела, возраст, конкретное соединение, предназначенное для введения, пол, время и способ введения, общее состояние здоровья, и наличие других лекарств, вводимых параллельно.

Препараты для парентерального введения включают стерильные водные или неводные растворы, суспензии и эмульсии. Примерами неводных растворителей являются пропиленгликоль, полиэтиленгликоль, растительные масла, такие как оливковое масло, и органические сложные эфиры для инъекций, такие как этилолеат. Водные носители включают воду, спиртовые/водные растворы, эмульсии или суспензии, включающие солевые и буферные среды. Парентеральные наполнители включают раствор хлорида натрия, декстрозу Рингера, декстрозу и хлорид натрия, раствор Рингера с лактатом или жирные масла. Внутривенные наполнители включают жидкие и питательные наполнители, электролитные наполнители (например, на основе декстрозы Рингера) и тому подобное. Также могут присутствовать консерванты и другие добавки, такие как, например, противомикробные препараты, антиоксиданты, хелатирующие агенты, инертные газы и тому подобное. Кроме того, описанные в изобретении фармацевтические композиции могут содержать дополнительные агенты, в зависимости от предполагаемого применения фармацевтической композиции.

Фармацевтически полезные эксципиенты, которые можно использовать в композиции, могут содержать носители, наполнители, разбавители, растворители, такие как одноатомные спирты, например, этанол, изопропанол и многоатомные спирты, например, гликоли, и пищевые масла, такие как соевое масло, кокосовое масло, оливковое масло, сафлоровое масло, хлопковое масло, жирные сложные эфиры, такие как этилолеат, изопропилмиристат, связующие вещества, вспомогательные вещества, солюбилизаторы, загустители, стабилизаторы, дезинтегрирующие агенты, глиданты, лубриканты, буферные агенты, эмульгаторы, смачивающие агенты, суспендирующие агенты, подсластители, красители, ароматизаторы, агенты для покрытия, консерванты, антиоксиданты, технологические агенты, модификаторы и усилители доставки лекарственных средств, такие как фосфат кальция, стеарат магния, тальк, моносахариды, дисахариды, крахмал, желатин, целлюлоза, метилцеллюлоза, натрийкарбоксиметилцеллюлоза, декстроза, гидроксипропил-β-циклодекстрин, поливинилпирролидон, воски с низкой температурой плавления и/или ионообменными смолами.

Другие подходящие фармацевтически приемлемые эксципиенты описаны в Remington' с Pharmaceutical Sciences, 15-е изд., Mack Publishing Co, New Jersey (1991).

Лекарственные формы для перорального введения включают таблетки, капсулы, пастилки, пилюли, облатки, гранулы, пероральные жидкости, такие как сиропы, суспензии, растворы, эмульсии, порошок для разведения.

Лекарственные формы для местного/локального введения содержат инсуффляции, аэрозоли, дозированные аэрозоли, трансдермальные терапевтические системы, лечебные пластыри, ректальные суппозитории и/или овули.

Для целей настоящего изобретения терапевтически эффективная доза указанных агентов, которые можно вводить в одной или в нескольких дозах, обычно составляет от около 2,5 до 100 мг/день, предпочтительно примерно от 5 примерно до 50 мг/день, и наиболее предпочтительно примерно от 10 примерно до 30 мг/день.

Вместе с тем, следует иметь в виду, что конкретный уровень дозы соединений по изобретению для любого конкретного пациента будет зависеть от различных факторов, таких как возраст, пол, масса тела, общее состояние здоровья, рацион питания, индивидуальная реакция пациента, получающего лечение, время введения, степень тяжести заболевания, подлежащего лечению, активность конкретного применяемого соединения, лекарственная форма, способ введения и сопутствующая лекарственная терапия. Терапевтически эффективное количество для конкретной ситуации легко определяется экспериментальным путем и находится в рамках компетенций и решений рядового врача или клинициста.

В шестом аспекте настоящее изобретение относится к средству, выбранному из ритуксимаба, окрелизумаба, офатумумаба и Fc-связывающего средства, для использования при лечении рассеянного склероза у больного, характеризующегося присутствием антитела против KIR4.1 в какой-либо биологической субстанции из крови, сыворотки, плазмы, лимфатических узлов, спинномозговой жидкости (СМЖ), слезной жидкости, мочи, мокроты и биоптата мозга. Как описано выше в настоящем изобретении, можно ожидать, что, с одной стороны, больные РС с аутоантителами и, с другой стороны, больные РС без аутоантител по-разному реагируют на введение этих агентов.

Fc-связывающие средства известны как средства, подходящие для устранения антител. Такие средства связываются с Fc-участком антител и подходят для устранения или инактивации антител. Такое явление устранения также называется иммуноадсорбцией.

В седьмом аспекте настоящее изобретение относится к способу скрининга на лекарственное средство или соединение-прототип, включающему приведение в контакт с тестируемым соединением комплекса, содержащего или состоящего из (i) антитела против KIR4.1, как указано выше (т.е. аутоантитела), и (ii) KIR4.1 белка или пептида, или пептидомиметика, как указано выше, где снижение количества указанного комплекса в тестируемом соединении является показателем того, что тестируемое соединение представляет собой лекарственное средство или соединение-прототип.

Ввиду неожиданного открытия, что антитела против KIR4.1 вовлечены в рассеянный склероз, настоящее изобретение также предоставляет средства и способы идентификации лекарственных средств и соединений-прототипов, где указанные лекарственные средства и соединения прототипы подходят для лечения или для разработки препаратов для лечения рассеянного склероза. Предполагается, что указанное приведение в контакт осуществляют в условиях, которые содержат указанный комплекс. Специалисту в данной области известны такие подходящие условия, которые включают, например, буферные растворы, содержащие тестируемое соединение, антитело против KIR4.1 и KIR4.1 белок, или пептид, или пептидомиметик согласно изобретению.

Предпочтительно, указанный способ осуществляют в высокопроизводительном формате. Высокопроизводительные анализы, независимо от того, проводятся ли биохимические, клеточные или другие анализы, обычно можно выполнять в лунках микротитровальных планшетов, причем каждый планшет может содержать 96, 384 или 1536 лунок. Работа с планшетами, включающая инкубацию при температурах, отличных от температуры окружающей среды, и приведение в контакт тестируемых соединений в анализируемой смеси, предпочтительно осуществляется с помощью одной или нескольких автоматизированных систем с компьютерным управлением, включающих устройства-пипетки для раскапывания. В случае необходимости скрининга больших библиотек тестируемых соединений и/или необходимости проведения скрининга в течение короткого времени, можно в каждую лунку добавлять смеси, например, из 10, 20, 30, 40, 50 или 100 тестируемых соединений. В случае если в лунке выявлена биологическая активность, указанную смесь тестируемых соединений можно подвергнуть деконволюции для идентификации одного или нескольких тестируемых соединений в указанной смеси, которые вызывают указанную активность.

Тестируемые соединения, соединения-прототипы и/или лекарственные средства предпочтительно представляют собой малые молекулы, более предпочтительно малые органические молекулы. Молекулярная масса составляет предпочтительно менее 2000 дальтон, более предпочтительно менее 1500, 1000, 900, 800, 700, 600, 500 или 400 дальтон. Любое выявленное при скрининге попадание можно подвергать оптимизации в отношении его фармакологических свойств (включающих всасывание, распределение, метаболизм и экскрецию), тем самым осуществляя разработку лекарство из соединения-прототипа.

Способы оптимизации фармакологических свойств, идентифицированных при скрининге соединений, обычно называемых соединениями-прототипами, известны в данной области и содержат способ модификации соединения, идентифицированного как соединение-прототип, для достижения: (I) изменения места действия, спектра активности, органной специфичности и/или (II) повышенной эффективности, и/или (III) пониженной токсичности (улучшенного терапевтического индекса), и/или (IV) уменьшения побочных эффектов, и/или (V) изменения начала терапевтического действия, продолжительности эффекта, и/или (VI) модификации фармакокинетических параметров (резорбция, распределение, метаболизм и экскреция), и/или (VII) изменения физико-химических параметров (растворимость, гигроскопичность, цвет, вкус, запах, стабильность, состояние), и/или (VIII) улучшения общей специфичности, специфичности к органу/ткани, и/или (IX) оптимизации лекарственной формы; и пути введения посредством (i) этерификации карбоксильных групп или (ii) этерификации гидроксильных групп с карбоновыми кислотами, или (iii) этерификацию гидроксильных групп, например, фосфатов, пирофосфатов или сульфатов или геми-сукцинатов, или (iv) образования фармацевтически приемлемых солей, или (v) образования фармацевтически приемлемых комплексов, или (vi) синтеза фармакологически активных полимеров, или (vii) введения гидрофильных фрагментов, или (viii) введение/обмен заместителей на ароматических группах или боковых цепях, изменение структуры заместителя, или (ix) модификации путем введения изостерических или биоизостерических фрагментов, или (х) синтеза гомологичных соединений, или (xi) введения разветвленных боковых цепей, или (xii) преобразования алкильных заместителей в циклические аналоги, или (xiii) дериватизации гидроксильной группы в кетали, ацетали, или (xiv) N-ацетилирование в амиды, фенилкарбаматы, или (xv) синтеза оснований Манниха, иминов, или (xvi) превращения кетонов или альдегидов в Шиффовы основания, оксимы, ацетали, кетали, енольные эфиры, оксазолидины, тиазолидины или их комбинации.

Указанные выше различные стадии обычно известны в данной области. Они включают или основаны на количественном анализе взаимосвязей структура-активность (QSAR) (Kubinyi, "Hausch-Analysis and Related Approaches", VCH Verlag, Weinheim, 1992), комбинаторной биохимии, классической химии и др. (см., например, Holzgrabe and Bechtold, Deutsche Apotheker Zeitung 140 (8), 813-823, 2000).

В восьмом аспекте настоящее изобретение относится к применению рецептора, как указано выше, для удаления антител против KIR4.1 из крови или сыворотки или для снижения их количества, где указанное применение должно проводиться ex vivo.

В этой связи, настоящее изобретение относится к ex vivo способу удаления антител против KIR4.1 из биологической жидкости, такой как кровь или сыворотка, или снижения их количества, включающему

(a) приведение взятой у пациента крови в контакт с рецептором, описанным выше, и/или с Fc-связывающим агентом и/или;

(b) проведение плазмафереза.

Эти аспекты относятся ко всем ex vivo применениям, и указанные ex vivo применения направлены на снижение количества аутоантител или на их полное истощение. Предпочтительно, кровь или сыворотка больного РС или пациента с предрасположенностью к развитию РС подвергается обработке ex vivo. Предполагается, что указанное приведение в контакт осуществляют в условиях, позволяющих связывание антител, в случае их присутствия, с указанным рецептором. В одном варианте осуществления указанные условия могут быть созданы путем приведения в контакт крови или сыворотки с помощью носителя или устройства согласно изобретению, описание указанного носителя или устройства дополнительно приведено ниже. В данной области известен и может применяться плазмаферез согласно изобретению, для уменьшения количества циркулирующих антител.

В предпочтительном варианте способа ex vivo согласно изобретению после указанного приведения в контакт крови или сыворотки их необходимо возвращать в организм этого пациента.

В других предпочтительных вариантах применения ex vivo или способа ex vivo по изобретению указанный белок, пептид и/или антитело связаны с носителем. Предусмотрен любой носитель, в том числе твердый носитель. Для целей настоящего изобретения предназначены материалы матрицы или носителя, обычно используемые в данной области и содержащие стекло, пластик, золото и кремний. Подходящие покрытия носителя или матрицы, в случае их присутствия, включают поли-L-лизиновые и аминосилановые покрытия, а также эпокси- и альдегид-активированные поверхности. В предпочтительном варианте осуществления указанный носитель является матрицей колонки. Подходящие матрицы известны в данной области, и их можно получать путем присоединения указанного рецептора.

Настоящее изобретение также относится к носителю с рецептором, описанным выше, который является иммобилизованным на нем.

В этой связи, изобретение также относится к устройству для удаления антител против KIR4.1 из крови, где указанное устройство содержит носитель, как указано выше.

В предпочтительном варианте осуществления указанное устройство дополнительно содержит впускной и/или выпускной элемент, позволяющий выпускать кровь или сыворотку из пациента через фильтр, и/или возвращать кровь или сыворотку этому же пациенту.

В отношении вариантов осуществления, характеристика которых приведена в настоящем описании, в частности, в формуле изобретения, подразумевается, что каждый вариант осуществления, приведенный в зависимом пункте, совместим с каждым вариантом осуществления из каждого пункта формулы (независимого или зависимого), от которого зависит указанный зависимый пункт. Например, в случае независимого пункта 1 приведены 3 альтернативы A, B и C, в зависимом пункте 2 приведены 3 альтернативы D, E и F, и в пункте 3, зависимом от пунктов 1 и 2, приведены 3 альтернативы G, H и I, и следует понимать, что описание однозначно раскрывает варианты осуществления, соответствующие комбинациям A, D, G; A, D, H; A, D, I; A, E, G; A, E, H; A, E, I; A, F, G; A, F, H; A, F, I; B, D, G; B, D, H; B, D, I; B, E, G; B, E, H; B, E, I; B, F, G; B, F, H; B, F, I; C, D, G; C, D, H; C, D, I; C, E, G; C, E, H; C, E, I; C, F, G; C, F, H; C, F, I, если конкретно не указано иное.

Аналогично, а также в тех случаях, когда в независимых и/или зависимых пунктах не приведены альтернативы, следует понимать, что если зависимые пункты относятся обратно к совокупности предыдущих пунктов, любая комбинация объекта изобретения, охватываемая ими, считается в явной форме раскрытой. Например, в случае независимого пункта 1, зависимый пункт 2 относится обратно к пункту 1, и зависимый пункт 3 относится обратно к обоим пунктам 2 и 1, и из этого следует, что комбинация объекта изобретения из пунктов 3 и 1 является ясно и однозначно раскрытой, как раскрыта комбинация объекта изобретения из пунктов 3, 2 и 1. В случае присутствия дополнительного зависимого пункта 4, который относится к любому одному из пунктов 1-3, следует, что комбинация объекта изобретения из пунктов 4 и 1, из пунктов 4, 2 и 1, из пунктов 4, 3 и 1, а также из пунктов 4, 3, 2 и 1 раскрыта ясно и однозначно.

Приведенные выше соображения применимы mutatis mutandis ко всем прилагаемым пунктам формулы изобретения. В качестве нескольких примеров, комбинация пунктов 6, 5, 4(b), 3 и 2 ясно и однозначно предусмотрена в плане структуры формулы изобретения. То же самое относится к комбинации из пунктов 6, 5, 4(а), 3 и 2, и, в виде нескольких дополнительных примеров, которые не служат ограничением, к комбинации пунктов 4(а) и 2 и комбинации пунктов 5, 4(а) и 2.

Описание фигур

Фиг.1: Реактивность сывороточных IgG с мембранными антигенами ЦНС при РС

(а) представлены микрофотографии иммунофлюоресцентного мечения, выполненного на мозжечке крысы (верхние изображения) и срезах человеческого мозга (нижние изображения) с сывороточным IgG у больных с РС или больных с другими неврологическими нарушениями (ДНН), согласно изображению. Масштаб шкалы 100 мкм (верхние изображения) и 20 мкм (нижние изображения).

(b) В анализе ELISA захват с мембранным белком фракции, полученной из ткани мозга крыс. Показана реактивность сыворотки в ионной РС и больных ДНН (OD, оптической плотности).

Фиг.2: Идентификация KIR4.1 в качестве мишени сывороточного IgG при РС

(a) Одномерный электрофорез в SDS-геле (слева) лизата человеческого мозга, преципитированного пулом IgG от больных ДНН или РС. Следует отметить, что уникальные полосы (третья полоса) выше и ниже полосы тяжелой цепи IgG группы (показано стрелкой) были получены после иммунопреципитации с пулом сывороточных очищенных IgG от больных РС. Двумерный электрофорез (справа) мозговых антигенов, полученных после иммунопреципитации с сывороточными IgG от больных РС. Рамкой выделено пятно, содержащее белок KIR4.1, который идентифицируют с помощью анализа MALDI-МС/МС (матрица-активированная лазерная десорбция/ионизация с тандемной масс-спектрометрией. Стрелка показывает пятно тяжелой цепи IgG.

(b) Детекция KIR4.1 в анализе вестерн-блоттинга в различных иммунопреципитатах согласно обозначениям. Иммунопреципитацию проводили с сывороточным IgG от больных ДНН или РС на обогащенных фракциях мембранных белков из лизатов крысиной почки и человеческого мозга, соответственно.

(c) Анализ вестерн-блоттинг KIR4.1 в иммунопреципитатах транслируемого in vitro KIR4.1-белка с сывороточным IgG от больных ДНН или РС.

Фиг.3: Подтверждение KIR4.1 в качестве мишени для реактивности сывороточного IgG у больных РС

(a) Двойное иммунофлуоресцентное мечение показывает совместную локализацию сывороточного IgG от больных РС с помощью моноклональных против KIR4.1 в срезах мозжечка крысиного головного мозга. Окрашивание с сывороткой больного ДНН показано в качестве контроля. Масштаб шкалы 200 мкм.

(b) Иммунофлуоресцентное мечение срезов мозжечка от мышей дикого типа (левое изображение) и мышей Kir4.1-/- (правое изображение) с очищенным сывороточным IgG от больных РС. Масштаб шкалы 100 мкм (верхние изображения) и 50 мкм (нижние изображения).

(c) Двойное иммунофлюоресцентное окрашивание в мышиных первичных астроглиальных клеточных культурах. Детекцию окрашивания с сывороточным IgG от больных ДНН (верхние изображения) и сывороточным IgG от больных РС (нижние изображения) проводили в зеленом канале. Детекцию дополнительного окрашивания GFAP (правое изображение) проводили в красном канале.

(d) Окрашивание и анализ проточной цитометрии мышиных первичных астроцитов с сывороткой от больных РС и ДНН.

Фиг.4: Реактивность сыворотки с высоким титром к KIR4.1 в подгруппе больных РС.

(a) Скрининг ELISA с использованием белка на реактивность к анти-KIR4.1 сыворотке. Очищенные рекомбинантные KIR4.1 из клеток НЕК293 ковалентно связывали с твердой фазой планшета ELISA. Связывание сывороточных антител к KIR4.1 определяли у здоровых доноров (ЗД), больных ДНН и больных рассеянным склерозом. Частоту антитело-положительных и антитело-отрицательных сывороток сопоставляли между ЗД (n=14), больными ДНН (n=71) и больными РС (n=122) с помощью теста Крускала-Уоллиса. Пунктирной горизонтальной линией обозначено пороговое значение для положительной реакции на антитело против KIR4.1 (отсечка OD 0,866, 5 SD выше медианного OD у пациентов-ЗД).

(b) ROC-кривые, отображающие диагностическое значение антитела против KIR4.1 в анализе ELISA в двух независимых группах больных РС и ДНН. Когорта исследования (сплошная линия) соответствует когорте, показанной в (а). Подтверждающая группа (пунктирная линия) состояла из 132 больных ДНН и 147 больных РС. Площадь под ROC-кривой (AUC), когорта исследования: 0,76 (доверительный интервал 95% ДИ: 0,69-0,81), когорта подтверждения: 0,82 (95% ДИ: 0,76-0,87).

(b) Двумерная графическая иллюстрация KIR4.1-белка на основе аннотации последовательности из базы данных UniProt (http://www.uniprot.org/uniprot/P78508). Большие и малые внеклеточные петли выделены красным и желтым, соответственно.

(d) Анализ ELISA связанного на планшете белка KIR4.183-120, который содержит первую внеклеточную петлю KIR4.1. Сывороточная реактивность против KIR4.183-120 была определена у ЗД, у больных ДНН и больных РС из когорты исследования (см. (а)). Частоту антитело-положительных и антитело-отрицательных сывороток сопоставляли между ЗД, больными ДНН и больными РС с помощью теста Крускала-Уоллиса. Пунктирной горизонтальной линией обозначено пороговое значение для положительной реакции на антитело против KIR4.1 (отсечка 0,7558 OD, 5 SD выше медианного OD у пациентов-ЗД).

Фиг.5: KIR4.1-специфичные сывороточные IgG антитела от больного РС являются специфичными к внеклеточной петле или KIR4.1 (KIR4183-120).

(a) Конкурентное связывание аффинно очищенного анти-KIR4.1 сывороточного IgG посредством KIR4183-120 (первая внеклеточная петля) или KIR4.1356-375 (С-концевой домен) против полноразмерного очищенного рекомбинантного His-меченого KIR4.1. Анти-KIR4.1 сывороточный IgG иммобилизовали на планшетах ELISA и инкубировали с возрастающими концентрациями пептидов (диапазон концентраций 0,045-150 нМ) в присутствии постоянной концентрации (150 нМ) His-меченого рекомбинантного белка KIR4.1. Связывание KIR4.1-белка определяли по детекции анти-His-меченых антител.

(b) Корреляция анализов ELISA связанного на планшете белка KIR4.1 или пептида KIR4.183-120 для количественного определения реактивности анти-KIR4.1 сыворотки в образцах от больных РС (n=122).

(c) Клеточный анализ на основе конкурентного связывания. Клетки НЕК293, экспрессирующие KIR4.1, иммуномеченные с РС-сывороточным IgG, или без конкуренции (слева), или в присутствии KIR4183-120 (среднее изображение), или KIR4.1356-375 (справа). Представлены микрофотографии.

Фиг.6:

(a) иммунофлуоресцентное мечение выполняли на P10 срезах мышиного мозжечка. Окрашивание проводили с РС-сывороточным IgG (левое изображение) и антителом против GFAP (правое изображение). Масштаб шкалы 50 мкм.

(b) Изображение периваскулярного окрашивания, полученного с РС-сывороточным IgG (левое изображение) и иммунномеченым антителом против GFAP (правое изображение) на кортикальных срезах от человека. Рамки обозначают области увеличения большой кратности, представленные в нижнем изображении. Масштаб шкалы 100 мкм (верхние изображения) и 20 мкм (нижние изображения).

Фиг.7: KIR4.1-специфичные РС-сывороточные IgG антитела индуцируют потерю окрашивания KIR4.1, нарушение нитевидной структуры GFAP и активацию комплемента in vivo.

PBS (первый ряд), сывороточный IgG от больного РС с истощенной реактивностью KIR4.1-специфичным антителом (второй ряд) или сывороточный IgG с сохраненной анти-KIR4.1 реактивностью (третий и четвертый ряд) вводили мышам C57BL/6 в мостомозжечковую цистерну вместе с человеческим комплементом. Через 24 часа после инъекций мышей умерщвляли и проводили иммуногистохимический анализ срезов мозга на реактивность GFAP (слева), KIR4.1 (в центре) и C9neo (справа). Масштаб шкалы 50 мкм и 20 мкм (нижнее изображение).

Фиг.8:

(a) Очистка His-меченого белка KIR4.1 из клеток НЕК293, трансфецированных экспрессирующей конструкцией KIR4.1 [pcDNA3.1 (+)/KIR4.1]. Полоса 1: очищенный лизат HEK293; полоса 2: проточный анализ, полосы 3-5: промывные фракции, полосы 6-8: фракции элюирования.

(b) Истощение анти-KIR4.1 реактивности у сывороточного IgG от больных РС. Полоса 1: гранулы, смешанные с имитацией трансфецированных линий лизированных клеток HEK293, и полоса 2: гранулы, смешанные с pcDNA3.1(+)/KIR4.1 трансфицированными линиями лизированных клеток HEK293. Эти гранулы были использованы для создания модели предварительной абсорбции и колонок для предварительной абсорбции, соответственно. Иммуноблоттинг справа показывает сывороточный IgG, захваченный с помощью колонки предварительной абсорбции на основе связывания на гранулах KIR4.1.

(c) Неконцентрированный поток через модель предварительной абсорбции и колонки для предварительной абсорбции тестировали на KIR4.1-реактивность в анализе ELISA с очищенной рекомбинантной KIR4.1 ELISA.

Далее изобретение проиллюстрировано примерами.

Пример 1

Материалы и способы

Пациенты и контрольные группы

Пациентов и контрольные группы набирали в отделении неврологии Клиники Rechts der Isar Мюнхенского Технического университета. В исследование были включены две независимые когорты больных рассеянным склерозом и пациенты с высоким риском клинически изолированного синдрома. Контрольная группа состояла из соответствующих по возрасту здоровых доноров (ЗД) или пациентов с другими неврологическими заболеваниями (ДНН). Характеристика больных и контрольных групп приведена в таблице 1. Данное исследование получило одобрение университетских комитетов по этике.

Таблица 1
Когорта исследования Когорта подтверждения
Характеристика образца ЗД (n=14) †ДНН (n=71) РС (n=122) †ДНН (n=130) РС (n=149)
Возраст (лет)/
средний/диапазон
34
(25-48)
48
(16-85)
38
(18-73)
49
(21-78)
36
(18-83)
Пол (число лиц): женщины/мужчины 6:6 37:34 77:45 58:72 90:59
Сокращения: ЗД = здоровые доноры, ДНН = другие неврологические заболевания, РС = рассеянный склероз. Группа †ДНН включает больных с бактериальными или вирусными менингитами, вирусным энцефалитом, нейросифилисом и ВИЧ-инфекцией.

Антитела

Во всех экспериментах с иммунными метками в качестве первичных антител использовали кроличьи поликлональные анти-человеческие/мышиные/крысиные KIR4.1 (полученные от компании Millipore, Billerica, Массачусетс, США, и Sigma-Aldrich, Сент-Луис, Миссури, США), мышиные моноклональные анти-человеческие/крысиные KIR4.1 (Sigma-Aldrich), моноклональные анти-крысиные/мышиные GFAP (Invitrogen), кроличьи антитела против человеческого C9neo или очищенные сывороточные IgG, и в качестве вторичных антител использовали кроличьи поликлональные анти-человеческие анти-крысиные (Invitrogen, Carlsbad, CA, США), или анти-мышиные IgG (Vector Laboratories Inc, Burlingame, CA, США), меченные биотином, AlexaFluor 488 или AlexaFluor 555.

Иммунофлуоресценция и иммуногистохимия

Для иммунофлюоресцентного окрашивания свежие срезы ткани ЦНС мышиного, крысиного или человеческого происхождения замораживали и помещали в прибор для заключения препаратов Tissue-Tek ОСТ (VWR Int., LLC, Radnor, Пенсильвания, США). При -20°С делали криотомию для получения срезов 10 мкм. После фиксации 100% ледяным метанолом в течение 10 мин проводили стадии блокирования с пероксидазными, авидиновыми и биотиновыми блокирующими реагентами (Vector Laboratories Inc) в течение 15 мин с каждым агентом, и с 10% козьей, мышиной или крысиной сывороткой в PBS-T (0,05% твин-20 в забуференном фосфатном растворе с уровнем рН 7,0) в течение 30 мин. Затем срезы инкубировали с разведенным очищенным сывороточным IgG (10 мкг/мл в PBS-T) или с коммерческим раствором антител в течение ночи при 4°С. После нескольких стадий промывки срезы инкубировали с биотин-меченными вторичными антителами в течение 1 часа при комнатной температуре. Срезы дополнительно инкубировали с авидин-биотиновым комплексом (Vector) в течение 1 часа и с 1 мкл биотинилированного тирамида в PBS с 8,8 мМ H2O2. Все стадии промывки проводили с PBS-T. Связывание антитела обнаруживали с помощью авидина, меченного AlexaFluor 488 или AlexaFluor 555. Ядерное окрашивание проводили с использованием красителя Gold antifade с DAPI (Invitrogen). После инкубации с авидин-биотиновым комплекс срезы обрабатывали или хромогеном DAB (Dako), или хромогеном AEC (Sigma). Контрастное окрашивание проводили с раствором гематоксилина. В случае хромогена DAB срезы обезвоживали и заливали ксилол-совместимой средой для заливки тканей рото-гистологического комплекта, и в случае AEC - водорастворимой средой для заливки тканей (Vector). Изображения получали с использованием микроскопа Zeiss Cell Observer с камерой AxioCam MRm (Carl Zeiss MicroImaging, Ltd, Геттинген, Германия).

Получение мембранных белков, обогащенных фракцией ткани ЦНС

Ткани ЦНС из мозга 8 крыс или человеческого мозга (2,4 г) гомогенизировали с использованием стеклянного тканевого гомогенизатора в ледяном буфере для гомогенизации (0,32 М сахарозы, 10 мМ HEPES, рН 7,4, 2 мМ EDTA) и коктейля ингибиторов протеазы (Sigma-Aldrich). Суспензию центрифугировали при 1000 g до осаждения ядерной фракции. Для обогащения мембранной фракции применяли высокоскоростное центрифугирование и способ сахарозного градиента. Обогащенный мембранный осадок ресуспендировали в HEPES-буфере для лизиса (50 м HEPES, рН 7,4, 2 мМ EDTA и коктейль ингибиторов протеазы). Обогащенную мембранную фракцию из ткани ЦНС использовали для получения цианогенбромид (CNBr)-активированной сефарозной обогатительной колонки на гранулированной основе (GE Healthcare Life Sciences, Питтсбург, Пенсильвания, США) в соответствии с протоколом производителя.

Иммунопреципитация, 2-D электрофорез и вестерн-блоттинг

Проводили обогащение реактивных сывороточных IgG антител мембран ЦНС от 12 больных РС с использованием CNBr активированной сефарозной обогатительной колонки (см. выше) и очищали способом с применением гранул протеина G (GE Healthcare Life Sciences). Очищенные РС-сывороточные IgG антитела объединяли и использовали для иммунопреципитации реактивных антигенов на очистительных колонках с магнитными гранулами протеина G (Invitrogen) в соответствии с протоколом производителя. Элюированные фракции антигена осаждали смесью хлороформ-метанол и растворяли в 2-D белковом солюбилизаторе (Invitrogen). Солюбилизированные фракции загружали на полоски с изоэлектрическим фокусированием (Invitrogen) и запускали при рН от 3 до 10 или рН от 4 до 6. Для идентификации иммунопреципитированных антигенов ЦНС проводили 2-D-электрофорез с небольшим настольным 2-D устройством (Invitrogen). Пятна удаляли и для идентификации подвергали матрица-активированной лазерной десорбции/тандемной масс-спектрометрии (MALDI-РС/РС; Alphalyse, Inc, CA, США). В качестве контроля запускали параллельные образцы, включавшие пул сывороточных IgG антител, выделенных от 24 больных ДНН.

В целях подтверждения лизаты крысиной почки (RKL)41, лизат человеческого мозга (HBL) и транслированный in vitro белок KIR4.1 подвергали иммунопреципитации с сывороточным IgG от больных РС и от контрольных групп с помощью сефарозных гранул протеина G (Invitrogen). В общей сложности 4 мг очищенного сывороточного IgG, разведенного в 5 мл PBS, заключали в 400 мкл суспензии и сшивали диметилпимелимидатом (DMP) - 2HCl в 50 мМ боратного буфера при комнатной температуре (КТ). После сшивания избыток DMP гасили 50 мМ боратного буфера и проводили блокирование с этаноламиновым буфером (200 мМ, рН 8,0). Готовые гранулы использовали для иммунопреципитации KIR4.1 из транслированной in vitro реакционной смеси RKL HBL и KIR4.1. Все эксперименты с вестерн-блоттингом проводили на 4-12% SDS-геле (Invitrogen) с кроличьим поликлональным антителом против человеческого KIR4.1 с использованием системы электрохемилюминесцентной детекции ECL (GE Healthcare Life Sciences).

Трансляция белка KIR4.1 in vitro

Общую РНК человеческого мозга использовали для синтеза полноразмерной кДНК, кодирующей KIR4.1. Использовали праймеры 5'-GGA TCC ATG ACG TCA GTT GCC AAG GTG-3' и 3'-CTC GAG GAC TCA ATT GAT GCT GCG CAC-5' для добавления сайтов рестрикции BamHI и Xho1 на 5' и 3' концах, соответственно. Продукт ПЦР клонировали в плазмиду pT7CFE1-ChiS (Pierce, Thermo Fisher Scientific, Rockford, IL, США). Трансляцию in vitro проводили с комплектом для экспрессии человеческих белков (Pierce, Thermo Fisher Scientific) в соответствии с протоколом производителя. Использовали конструкцию pT7CFE1-CHIS, кодирующую зеленый флуоресцирующий белок (GFP) в качестве контроля во всех в лабораторных экспериментах с трансляцией. Для подтверждения экспрессии KIR4.1 проводили вестерн-блоттинг на 4-12% SDS геле (Invitrogen) с использованием кроличьего поликлонального антитела против человеческого KIR4.1 с детекцией ECL.

Подготовка мышиной первичной кортикальной астроглиальной культуры и проточная цитометрия

Для выделения первичных кортикальных астроглиальных клеток мышат умерщвляли, иссекали мозжечок и зрительный нерв и помещали ткани в ледяной буфер [1,47 М NaCl, 5 мМ KCl, 0,2 мМ NaHPO4 (2Н2О), 0,2 мМ KH2PO4, 5,5 глюкозы, 0,058 М сахарозы в 1 литре, уровень pH 6,5]. После этого ткани измельчали и расщепляли 0,5%-ным трипсином при 37°С в течение 10 мин. После промывки с использованием среды MG [среда MEM (Sigma-Aldrich) с добавлением 10% фетальной телячьей сыворотки FCS (низкий эндотоксин), 1% L-глутамина и 0,5% пенициллина/стрептомицина] использовали пастеровские пипетки с оплавленным наконечником для создания тканевых суспензий. Для астроглиальной культуры тканевую суспензию высевали в среду MG. Среду заменяли свежей средой через каждые два-три дня. Через две недели полученную смешанную глиальную клеточную культуру подвергали осторожному встряхиванию при 37°С в течение 6 часов для удаления микроглии. Астроглиальную культуру использовали в экспериментах с двойным иммунофлуоресцентным окрашиванием и в анализе проточной цитометрии (CyAn ADP, Beckmann Coulter Inc, Fl) с использованием сывороточных антител IgG от больных РС и ДНН и антимышиных GFAP качестве первичных антител.

Клонирование, экспрессия и очистка

Для рекомбинантной экспрессии KIR4.1 в клетках НЕК293 синтезировали кодирующую человеческий KIR4.1 полноразмерную кДНК с С-концевой гексагистидиновой меткой (His-tag) из общей мРНК человеческого мозга (BD Biosciences. San Jose, California), используя 5'-GCG GCC GCA CCA TGA CGT CAG TTG CCA AGG TGT ATT ACA GTC AG-3' и 5'-CTC GAG TCA GTG GTG GTG GTG GTG GTG GAC ATT GCT GAT GCG CAC-3' в качестве прямого и обратного праймера (подчеркнута His-tag кодирующая последовательность). Клонирование в pcDNA 3,1(+) (Invitrogen) проводили с использованием сайтов рестрикции NotI-и Xhol, вставленных, соответственно, с помощью прямого и обратного праймеров, для получения экспрессионной конструкции PcDNA 3,1(+)/KIR4.1. Клетки НЕК 293 транзиторно трансфицировали с PcDNA 3,1(+)/KIR4.1 с использованием реагента для трансфекции липофектамина 2000 (Invitrogen) в соответствии с инструкциями производителя. Через 6 часов после трансфекции в среду добавляли 10% FCS и 300 мМ хлорида бария. Через 36 часов после трансфекции клетки собирали и дважды промывали ледяным PBS. После подсчета подвергали лизису 30000000 клеток в 10 мл 50 мМ натрий-фосфатного буфера с уровнем рН 7,4, содержащем 550 мМ хлорида натрия, 5 мМ трис-HCl, 1,0% Fos-холина, 500 единиц нуклеазы Бензоназа® (Sigma) и 1X коктейль ингибиторов протеаз (Sigma), не содержащий EDTA. Клеточный лизат центрифугировали при 20000 об./мин в течение 30 минут при 4°C, используя ротор SS34 Sorvall RC6 плюс центрифугу. После центрифугирования собирали супернатант (очищенный лизат), и белок в общем количестве 40 мг вносили в колонку для очистки, содержащую 1 мл кобальтовой смолы HisPure™ (Pierce), предварительно уравновешенную 5 мл связывающего буфера (аналогичного лизирующему буферу). Промывку проводили с 6 мл промывочного буфера (аналогичного лизирующему буферу). Элюирование his-меченной белковой фракции проводили с 3 мл элюирующего буфера (50 мМ фосфата натрия, 300 мМ хлорида натрия, 150 мМ имидазола, рН 6,0). В конце проводили диализ фракции элюирования против PBS и тестировали на наличие очищенной KIR4.1 с помощью анализа вестерн-блоттинга с зондированием кроличьим антителом против человеческого 4,1 (Millipore).

Иммуноферментный анализ (ELISA)

Для обнаружения сывороточной реактивности при РС и у контрольных пациентов с мембранными белками ЦНС использовали мозжечок крыс (400 мг быстрозамороженного мозжечка) для получения белковых фракций, обогащенных мембранными и цитоплазматическими антигенами. Белковые фракции поверхностно биотинилировали сульфо-NHS-SS-биотином (Pierce) и был разводили в PBS до конечной концентрации 80 нг/мл. Для покрытия добавляли 100 мкл разведенной белковой фракции в каждую лунку ELISA-планшетов Nunc immobilizer™, предварительно покрытых стрептавидином и предварительно блокированных (Pierce). Планшеты выдерживали в течение ночи при 4°С на ротационном шейкере с небольшим покачиванием. После нанесения покрытия планшеты дважды промывали PBS-T.

Для скрининга анти-KIR4.1 реактивности в образцах сыворотки использовали твердофазный связанный очищенный рекомбинантный KIR4.1. Очищенный белок KIR4.1 разводили в PBS до конечной концентрации 6 мкг/мл и 100 мкл добавляли в каждую лунку амино-планшетов Nunc immobilizer™ (Pierce). Планшеты выдерживали в течение ночи 4°С на ротационном шейкере при небольшом встряхивании. Покрытые планшеты дважды промывали PBS-T и блокировали в течение 1 часа 10 мМ этаноламина в 100 мМ Na-карбоната, рН 9,6.

Для скрининга реактивности анти-KIR4.1 внеклеточного пептида в образцах сыворотки использовали аминокислотную последовательность, представляющую первую и вторую внеклеточные петли белка KIR4.1 [GVVWYLVAVAHGDLLELDPPANHTPCWQVHTLTGAFL] (большой внеклеточный домен; KIR4.1183-120; SEQ ID NO:1; подчеркнутые последовательности: KIR490-114, SEQ ID NO:4) и TIGYGFRYISEECPLAIVLLI (малый внеклеточный домен; KIR4.1128-148, SEQ ID NO:2; подчеркнутые последовательности: KIR4.1134-142, SEQ ID NO:5), соответственно] с N-концевой биотиновой модификацией, которые были приобретены в фирме JPT peptide Technologies Ltd. (Берлин, Германия). Пептиды разводили в концентрации 16 мкг/мл в натрий-фосфатном буфере, рН 8,0. Покрытие наносили на предварительно покрытые стрептавидином и предварительно блокированные планшеты ELISA Nunc immobilizer™ (Pierce), как описано выше. Во всех экспериментальных скринингах на контрольные ELISA-планшеты наносили бычий сывороточный альбумин (Sigma). Образцы сыворотки разводили в 3% обезжиренном молоке (Biorad Inc) с получением концентрации IgG 10 мкг/мл. Для детекции использовали конъюгированное с пероксидазой хрена (HRP) антитело против человеческого IgG (Dako). Измерения оптической плотности (OD) проводили при 450 нм в микропланшет-ридере Tecan (Tecan Group Ltd., Швейцария).

Анализ конкурентного связывания

Общий сывороточный IgG очищали с использованием сефарозных гранул с протеином G (GE Biosciences) в соответствии с протоколом производителя. Для выделения KIR4.1-реактивной фракции IgG из общего сывороточного IgG использовали KIR4.1-связанные CNBr-активированные сефарозные аффинные гранулы (GE Biosciences).

Связывающую способность выделенной KIR4.1-реактивной фракции сывороточного IgG оценивали с помощью прямого анализа ELISA с очищенным рекомбинантным KIR4.1. Для анализа конкурентного связывания KIR4.1-реактивный сывороточный IgG разводили в PBS до 5 мкг/мл и в каждую лунку Nunc immobilizer™ (Pierce) добавляли амино-полоски. Нанесение покрытия и блокирование проводили, как описано выше. Затем в лунки добавляли в увеличенных концентрациях (от 12 нМ до 144 нМ) внеклеточный белок KIR4.1 (KIR4.1128-148) или KIR4.1-внутриклеточный С-концевой белок (KIR4.1356-375). Через 1 час инкубации планшеты промывали 3 раза PBS-T, и в каждую лунку в течение 1 часа добавляли 145 нМ очищенного рекомбинантного his-меченного белка KIR4.1. После промывки (3 раза с помощью PBS-T) для обнаружения использовали HRP-конъюгированное анти-his-tag антитело. Анализы конкурентного связывания воспроизводили дважды и проведение анализа подтверждали путем связывания коммерчески доступного моноклонального антитела против KIR4.1 (Millipore) с С-концевым белком KIR4.1 (KIR4.1356-375). Клеточный анализ конкурентного связывания проводили с KIR4.1-трансфецированными клетками НЕК293 с использованием KIR4.1-реактивного сывороточного IgG и без предварительной инкубации с внеклеточными (KIR128-148) и внутриклеточными С-концевыми (KIR356-375) пептидами, соответственно.

Интратекальное введение мышам РС-сывороточного IgG

Для инъекций были подготовлены РС-сывороточный общий IgG, РС-сывороточный IgG с истощенной KIR4.1-реактивностью и аликвотное количество PBS (в качестве контроля). Для истощения KIR4.1-реактивности в РС-сывороточном IgG использовали KIR4.1-связанные Ni-NTA-агарозные гранулы (Pierce) в соответствии с инструкциями производителя. Для приготовления инъекционных аликвот все препараты сывороточного IgG концентрировали до 30 мг/мл с использованием центробежного концентратора с отсечением на уровне 10 кДа (Pierce). Были подготовлены инъекционные аликвоты по двадцать микролитров, содержащие равные объемы концентрированного сывороточного IgG (или PBS) и человеческий комплемент (30 ед/мл). Мышей C57BL/6 в возрасте от шести до восьми недель разделяли на 3 группы (n=3-6 мышей в каждой группе), которым вводили или РС-сывороточный общий IgG с истощением KIR4.1-реакционной способности или без истощения, или PBS. Мышам проводили ингаляционную анестезию изофлураном. Использовали адаптированный протокол чрескожных интрацистернальных инъекций, как описано ранее (Klein М, Ann Neurol 2003, Oct;. 54 (4):451-8). Через 24 часа мышей умерщвляли с последующей перфузией ледяного PBS и параформальдегида (4%, рН 7,4) через левый желудочек сердца. Ствол мозга и мозжечок иссекали и на ночь помещали в 20% раствор сахарозы при 4°С. Сагиттальные срезы ствола мозга и мозжечка заливали в Tissue Tek (Sakura), замораживали в жидком азоте и проводили криотомию по 10 мкм (Leica CM3050S). Иммуногистохимическое исследование проводили согласно описанию.

Статистический анализ

Сыворотка считалась антитело-положительной, когда OD превышала пороговое значение, определяемое по титрам, которые выявлены у ЗД [среднее значение OD плюс 5-кратное стандартное отклонение]. Тест Крускала-Уоллиса использовали для сравнения количества антитело-положительных и антитело-отрицательных больных в группах ДНН и РС. Значимой считалась p-величина ниже 0,05. По графику зависимости чувствительности от частоты ложноположительных заключений (ROC) проводили анализ и рассчитывали площади под кривой ROC (AUC) для двух независимых наборов образцов с использованием программного обеспечения MedCalc (или Analyse-it).

Пример 2

РС-сывороточные IgG антитела специфично связываются с мембранными антигенами в ЦНС

IgG антитела очищали из образцов сыворотки от 19 больных РС и 24 больных с другими неврологическими заболеваниями (ДНН) и тестировали на их реактивность с тканевыми срезами крысиного и человеческого мозга с помощью иммунофлуоресценции. Используя РС-сывороточный IgG, наблюдали мембранную иммунореактивность в 37% случаев (7/19) на мозжечке крысы и в 58% случаев (11/19) на срезе человеческого головного мозга (фиг.1). С другой стороны, не смогли выявить конкретную структуру окрашивания с использованием сывороточного IgG у какого-либо из больных ДНН (фиг.1). Для подтверждения специфичной реактивности мембран осуществляли захват путем ELISA на основе белковых фракций крысиного мозжечка, обогащенных мембранными и цитоплазматическими антигенами. Повышенная реактивность с мембранной фракцией белка наблюдалась только в сыворотках больных РС (n=56), но не в сыворотке больных ДНН (n=29), что указывает на наличие специфичных сывороточных IgG антител против мембранного белка ЦНС у больных РС (фиг.1b). Для сравнения, реактивность в цитоплазматической фракции белка была одинаковой в обеих сыворотках от больных РС и ДНН (данные не показаны). Таким образом, в последующих исследованиях с иммунопреципитацией работали с фракцией ткани ЦНС, обогащенной мембранными белками для выявления антигенов-мишеней при РС.

Пример 3

Идентификация KIR4.1 в качестве целевого сывороточного IgG при РС

Реактивные сывороточные IgG ЦНС от 12 больных с рассеянным склерозом объединяли и обогащали с использованием CNBr-активированных гранул, покрытых фракцией мембранных белков, которые получали из ткани человеческого мозга. РС-сывороточный IgG, элюированный из обогатительной колонки, использовали для последующего иммунопреципитации антигена. Комплексы антиген-IgG, элюированные из колонки для преципитации, затем анализировали с использованием электрофореза в полиакриламидном геле в присутствии додецилсульфата натрия (SDS-PAGE) и разделяли посредством 2-D электрофореза в геле (фиг.2а). Вырезали 7 пятен белка и анализировали MALDI-МС/МС, аббревиатура "МС" в данном конкретном контексте обозначает масс-спектрометрию. В одном из пятен был выявлен внутренний выпрямляющий калиевый канал KIR4.1. Идентичность KIR4.1 как РС-сывороточного IgG антитела-мишени впоследствии была подтверждена с помощью иммунопреципитации и вестерн-блоттинга с использованием экстрактов из лизата крысиной почки, лизата человеческого мозга (фиг.2b) и в реакционной смеси in vitro транслируемого KIR4.1 (фиг.2с).

Пример 4

Реактивность KIR4.1 с РС-сывороточными IgG, расположенными в астроглии гиппокампа и мозжечка

Выполняли двойное иммунофлуоресцентное мечение на срезах крысиного головного мозга, как с очищенными IgG антителами из сыворотки больных РС, так и с моноклональными антителами против KIR4.1 (фиг.3а). В качестве контроля аналогичное окрашивание проводили с очищенными IgG с сывороткой больных ДНН. Специфичные совместные локализации моноклональных анти-KIR4.1 и сывороточных IgG антител в срезах крысиного мозжечка разделах наблюдались только в случае РС-IgG, но не в случае ДНН-IgG (фиг.3а). Для дополнительного подтверждения этого наблюдения проводили иммунномечение срезов мозжечка у 10-дневных мышей дикого типа и Kir4.1-нулевых мышей (Kir4.1-/-) с РС сыворотке IgG (фиг.3b). Известно, что на 10 день после рождения (P10) наблюдаются высокие уровни экспрессии KIR4.1 (20). Астроглиальные клетки в срезах мозжечка и гиппокампа мышей дикого типа окрашивались KIR4.1-антитело-положительной РС-сывороткой, но отсутствовала реакция срезов от Kir4.1-/- мышей (фиг.3b и фиг.6). KIR4.1-антитело-отрицательные сыворотки не окрашивали ткани ЦНС как у мышей дикого типа, так и у мышей Kir4.1-/- (данные не показаны). Для подтверждения астроглиальной локализации реактивности анти-KIR4.1 в РС-сыворотке авторы подготовили мышиные смешанные глиальные первичные культуры. Высокоспецифичное к РС-сыворотке мембранное окрашивание наблюдалось в GFAP-позитивных клетках (фиг.3с). Аналогичное специфичное к РС-сыворотке окрашивание поверхности глиальных клеток наблюдалось также при помощи проточной цитометрии (фиг.3d).

Пример 5

Реактивность сыворотки с высокими титрами к внеклеточной петле белка KIR4.1 относится исключительно к РС

Для количественной оценки анти-KIR4.1-реактивности использовали анализ захвата с помощью ELISA на основе белка KIR4.1, выделенного из человеческой линии клеток РС3. Были проанализированы сыворотки от 122 больных РС/КИС, 70 больных ДНН и 14 здоровых доноров (ЗД) (фиг.4а). Были обнаружены высокие концентрации KIR4.1-сывороточных аутоантител (>5 SD от среднего показателя здоровых людей) у 16,9% больных ДНН (12/71) и у 50,8% больных РС (62/122) (p<0,0001). Все положительные РС-сыворотки содержали более высокие концентрации антитела, чем любая другая сыворотка из группы ДНН.

Эти выводы были независимо подтверждены во второй когорте случай-контроль с участием 130 больных ДНН и 149 больных РС (фиг.4d).

Аналогичные результаты были получены в меньшей группе больных и в контрольной группе с помощью анализа ELISA, в котором в транслируемый in vitro KIR4.1 белок был использован в качестве захватывающей матрицы (данные не показаны). В этом анализе ни одна из сывороток от больных ДНН не содержала значительно повышенных титров антител, тогда как 22,5% (10/44) сывороток от больных РС были антитело-положительными сыворотками (р=0,0108). Анализ мембранной топологии (база данных Uniprot, версия 107, доступ 78508 (Последнее изменение 5 апреля 2011 года); http://www.uniprot.org/uniprot/P78508) прогнозирует две внеклеточных петли для белка KIR4.1; большая петля охватывает 25 аминокислот (KIR4.190-114, SEQ ID NO:4) и меньшая петля охватывает 9 аминокислот (KIR4.1134-142, SEQ ID NO:5), см. фиг.4c.

Для имитации топологии внешней петли KIR4.1 были синтезированы пептиды, содержащие аминокислотную последовательность внеклеточной области KIR4.1 и прилегающих внутримембранных доменов, с биотиновыми метками, и они были иммобилизованы на планшетах, покрытых авидином. Сыворотку больных РС и контрольных групп тестировали на связывание антитела с этими пептидами. Реактивность антитела к пептиду, представляющему малый внеклеточный домен KIR4.1 (KIR4.1128-148; SEQ ID NO:2), наблюдалась только у 4% больных РС и ни у одного ЗД или больного ДНН (данные не показаны). Однако, когда РС-сыворотку анализировали на способность связываться с первой внеклеточной петлей KIR4.1 (KIR4.183-120; SEQ ID NO:1), наблюдались значительно повышенные концентрации антител у больных РС (37/122, 30,3%) по сравнению с больными ДНН (1/70, 1,4%) (р<0,0001). Это наблюдение было независимо воспроизведено во второй когорте случай-контроль (данные не представлены).

Связывание человеческих KIR4.1-специфичнох антител к большому внеклеточному домену было подтверждено в конкурентном анализе, см. фиг.5.

В целом наблюдалась сильная корреляция между реактивностью антитела из клеток РС3, измеренной с помощью ELISA с белком KIR4.1, и анализами ELISA на основе белка KIR4.183-120 (SEQ ID NO:1), и предполагается, что РС-сывороточные антитела против KIR4.1 распознают эпитоп в первой внеклеточной петле KIR4.1.

Пример 6

Сывороточные KIR4.1-специфичные антитела индуцируют потерю экспрессии KIR4.1, нарушение нитевидной структуры GFAP и активации комплемента in vivo

У мышей после введения сывороточного IgG, содержащего KIR4.1-специфичные антитела, выявлены нарушения нитевидной структуры GFAP в астроцитах, потеря KIR4.1 экспрессии и активации комплемента в областях, где наблюдалась потеря KIR4.1. Такие изменения не наблюдались у мышей, которые получали PBS или сывороточный IgG от того же пациента, имевшего истощенные KIR4.1-специфичные антитела. Соответствующие данные показаны на фиг.7 и 8.

Дополнительные ссылки

1. Применение пептида для диагностики рассеянного склероза или предрасположенности к рассеянному склерозу у пациента, где пептид состоит из по меньшей мере 8 последовательных аминокислотных остатков в последовательности, представленной в SEQ ID NO: 3, при условии, что указанный пептид не состоит из последовательности, представленной в SEQ ID NO: 3, где указанный пептид связывается с антителом против KIR4.1, которое содержится в образце, выбранном из крови, сыворотки, плазмы, лимфатических узлов, СМЖ, слезной жидкости, мочи, мокроты и биоптата мозга, от указанного пациента с рассеянным склерозом или предрасположенного к развитию рассеянного склероза,
где предпочтительно:
(i) указанные по меньшей мере 8 последовательных аминокислотных остатков являются по меньшей мере 8 последовательными аминокислотными остатками в последовательности внеклеточного домена KIR4.1, состоящего из последовательности, представленной в SEQ ID NO: 1 или 2, при условии, что указанные по меньшей мере 8 последовательных аминокислотных остатков не представляют собой последовательность, представленную в SEQ ID NO: 1 или 2; или
(ii) указанный пептид состоит из последовательности SEQ ID NO: 1 или 2.

2. Способ диагностики рассеянного склероза или предрасположенности к рассеянному склерозу у пациента, включающий определение присутствия антитела против KIR4.1 в образце, выбранном из крови, сыворотки, плазмы, лимфатических узлов, СМЖ, слезной жидкости, мочи, мокроты и биоптата мозга, полученном от указанного пациента, где присутствие антитела против KIR4.1 в указанном образце свидетельствует о наличии рассеянного склероза у указанного пациента или предрасположенности к рассеянному склерозу указанного пациента.

3. Способ по п. 2, в котором, в случае присутствия антитела против KIR4.1 в указанном образце,
(i) присутствие по меньшей мере одного клинического симптома рассеянного склероза у указанного пациента является показателем рассеянного склероза; и
(ii) отсутствие каких-либо клинических симптомов рассеянного склероза является показателем указанной предрасположенности к рассеянному склерозу.

4. Способ по
(a) п. 2, в котором указанный пациент имеет клинически изолированный синдром (КИС); или
(b) п. 3, в котором по меньшей мере один клинический симптом представляет собой КИС.

5. Способ по п. 2 или 3, в котором антитело против KIR4.1 связывается с KIR4.1 (SEQ ID NO: 3) или с его внеклеточным доменом, причем указанный внеклеточный домен состоит из последовательности, представленной в любой из SEQ ID NO: 1, 2, 4 или 5.

6. Способ по п. 2 или 3, в котором присутствие указанного антитела против KIR4.1 определяют
(a) приведением в контакт образца с рецептором, связывающимся с указанным антителом против KIR4.1; и
(b) обнаружением образования комплекса рецептор-антитело против KIR4.1, где указанный рецептор предпочтительно выбирают из группы, состоящей из пептида, определенного в п. 1, белка KIR4.1 и антитела, связывающегося с указанным антителом против KIR4.1.

7. Применение пептида в лечении рассеянного склероза, где указанный пептид состоит из по меньшей мере 8 последовательных аминокислотных остатков в последовательности, представленной в SEQ ID NO: 3, при условии, что указанный пептид не состоит из последовательности, представленной в SEQ ID NO: 3, где указанный пептид связывается с антителом против KIR4.1, которое содержится в образце, выбранном из крови, сыворотки, плазмы, лимфатических узлов, СМЖ, слезной жидкости, мочи, мокроты и биоптата мозга, от указанного пациента с рассеянным склерозом или предрасположенного к развитию рассеянного склероза,
где предпочтительно:
(i) указанные по меньшей мере 8 последовательных аминокислотных остатков являются по меньшей мере 8 последовательными аминокислотными остатками в последовательности внеклеточного домена KIR4.1, состоящего из последовательности, представленной в SEQ ID NO: 1 или 2, при условии, что указанные по меньшей мере 8 последовательных аминокислотных остатков не представляют собой последовательность, представленную в SEQ ID NO: 1 или 2; или
(ii) указанный пептид состоит из последовательности SEQ ID NO: 1 или 2.

8. Применение антитела, связывающегося с KIR4.1 (SEQ ID NO: 3) или его внеклеточным доменом, в лечении рассеянного склероза, причем указанный домен состоит из последовательности, представленной в SEQ ID NO: 1 или 2, и указанное антитело препятствует связыванию с KIR4.1 антитела против KIR4.1, содержащегося в образце от пациента с рассеянным склерозом или предрасположенного к его развитию.

9. Применение средства, выбранного из ритуксимаба, окрелизумаба и офатумумаба, и Fc-связывающего средства в лечении рассеянного склероза у пациента, отличающегося присутствием антитела против KIR4.1 в субстанции из крови, сыворотки, плазмы, лимфатических узлов, спинномозговой жидкости (СМЖ), слезной жидкости, мочи, мокроты и биоптата мозга.



 

Похожие патенты:

Изобретение относится к медицине, а именно к лабораторной диагностике, и может быть использовано для оценки угрозы нарушения энергетического обмена в фетоплацентарном барьере ворсинок плаценты.

Изобретение относится к области медицины и касается способа, тест-системы диагностики диабетической нефропатии. Сущность способа заключается в том, что в образце от субъекта определяют биомаркер, который представляет собой подобный антигену CD5.

Изобретение относится к области медицины, к клинико-биохимической лабораторной диагностике, а именно к методам определения модифицированных белков и предназначается для селективного количественного определения степени окисления фибриногена в клинических образцах плазмы крови по содержанию карбонильных групп в фибриновом сгустке.

Настоящее изобретение относится к биохимии, в частности к лигандам для аффинной хроматографии на основе различных доменов белка A (SpA) Staphylococcus. Лиганд содержит либо несколько доменов C, либо несколько доменов B, либо несколько доменов Z белка SpA.

Изобретение относится к области медицины, а именно к способу отбора партий компонентов культивации, подлежащих применению при культивации клетки млекопитающего, экспрессирующей интересующий белок, когда при культивировании используют по меньшей мере два разных компонента, включающему следующие стадии: а) берут спектры разных партий первого компонента, полученные первым спектроскопическим способом, спектры второго компонента, полученные вторым отличным спектроскопическим способом, и выход интересующего белка из культивационного супернатанта, полученный при культивировании с использованием комбинаций данных разных партий первого и второго компонентов, б) идентифицируют связь слитых спектров этих двух различных спектроскопических методов после расчета счетов РСА спектров с выходом культивирования, в) берут спектр дополнительной партии первого компонента, полученный первым спектроскопическим способом, и спектр дополнительной партии второго компонента, полученный вторым спектроскопическим способом, г) выбирают комбинацию взятого первого компонента и взятого второго компонента, если предсказанный выход из культивационного супернатанта, основанный на связи слитых спектров после расчета счетов РСА спектров, идентифицированной в б), находится в пределах +/-10% среднего выхода, приведенного в а).

Настоящее изобретение относится к биотехнологии, конкретно к новым аллергенам собаки, и может быть использовано в медицине. Рекомбинантным путем получают аллерген Can f 4.

Изобретение относится к области биотехнологии, конкретно к модифицированному тамавидину, и может быть использовано для детекции связанной с биотином субстанции. Получают модифицированный биотин-связывающий белок на основе тамавидина с последовательностью SEQ ID NO: 2, который содержит до 7 мутаций и при этом остаток аспарагина в 115 положении заменен на цистеин.

Изобретение относится к области медицины, а именно к способу прогноза риска дыхательной недостаточности у септического пациента. Сущность способа состоит в том, что проводят стадию измерения концентрации эндокана в образце крови, полученной от упомянутого септического пациента, и стадию сравнения концентрации эндокана с заданными пороговыми значениями, представляющими концентрации, измеренные в среднем у пациентов, у которых не развилась дыхательная недостаточность.
Изобретение относится к гепатологии и предназначено для прогнозирования ответа на противовирусную терапию при хроническом гепатите С у взрослых и детей. До начала лечения определяют уровень интерферона в плазмоцитоидных дендритных клетках крови и при его значении 136,7 пг/мл и более прогнозируют эффективность противовирусной терапии.

Изобретение относится к биотехнологии и представляет собой пептид, который имеет аминокислотную последовательность, состоящую из смежных аминокислот, полученных из белка WT1, и индуцирует WT1-специфические хелперные Т-клетки связыванием с молекулой МНС класса II.

Изобретения относятся к области молекулярной биологии и касаются рекомбинантной ДНК pA4, рекомбинантной плазмидной ДНК pQE 30-А4, штамма Esherichia coli M15-A4, рекомбинантного полипептида А4, обладающего способностью селективно связывать человеческий сывороточный альбумин (ЧСА), аффинного сорбента, содержащего такой полипептид, аффинного комбинированного сорбента и способов последовательного удаления ЧСА и IgG из сыворотки крови.

Изобретение относится к области биохимии, в частности к способу получения мутеинов липокалина 2 (Lcn2, hNGAL) человека. Способ основан на мутагенезе молекулы нуклеиновой кислоты, кодирующей белок Lcn2 человека.

Изобретение относится к способу скрининга нетератогенного вещества, который включает приведение испытуемого вещества в контакт с цереблоном или фрагментом цереблона, оценку способности испытуемого вещества связываться с цереблоном или фрагментом цереблона и отбор испытуемого вещества, не связывающегося с цереблоном или фрагментом цереблона, или испытуемого вещества, характеризующегося более низкой способностью связываться с цереблоном или фрагментом цереблона по сравнению с талидомидом.

Изобретение относится к генной инженерии, а именно к полипептидам GPCR Drosophila melanogaster (DmGPCR) и полинуклеотидам, которые определяют и кодируют такие полипептиды. .

Изобретение относится к области молекулярной биологии и может быть использовано для определения гидрофобных лигандов липидпереносящих белков, установления липидсвязывающей и липидпереносящей активности белков и изучения липид-белковых взаимодействий in vitro.

Изобретение относится к новому классу нуклеиново-кислотных лигандов с высокой степенью сродства, которые специфически связываются с нужной молекулой-мишенью. .

Изобретение относится к биотехнологии и представляет собой выделенное моноклональное антитело или его антиген-связывающий участок, которые специфически связываются с рецептором 1 интерферона альфа человека (IFNAR-1), содержащие CDR1 вариабельной области тяжелой цепи, содержащую SEQ ID NO: 4 с консервативными модификациями в последовательности; CDR2 вариабельной области тяжелой цепи, содержащую SEQ ID NO: 8 с консервативными модификациями в последовательности; CDR3 вариабельной области тяжелой цепи, содержащую SEQ ID NO: 12 с консервативными модификациями в последовательности; CDR1 вариабельной области легкой цепи, содержащую SEQ ID NO: 16 с консервативными модификациями в последовательности; CDR2 вариабельной области легкой цепи, содержащую SEQ ID NO: 20 с консервативными модификациями в последовательности; CDR3 вариабельной области легкой цепи, содержащую SEQ ID NO: 24 с консервативными модификациями в последовательности.

Изобретение относится к области биотехнологии, конкретно к применению пептида, состоящего из по меньшей мере 8 последовательных аминокислотных остатков последовательности, представленной в SEQ ID NO:3, для диагностики рассеянного склероза, что может быть использовано в медицине. Диагностируют рассеянный склероз или предрасположенность к рассеянному склерозу у пациента по присутствию антитела против KIR4.1 в образце пациента. Изобретение позволяет получить альтернативные средства и способы диагностики иили лечения рассеянного склероза. 5 н. и 4 з.п. ф-лы, 8 ил., 1 табл., 6 пр.

Наверх