Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы



Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы
Антитела против сиглека-15 для лечения заболевания, связанного с потерей костной массы

 


Владельцы патента RU 2596392:

АЛЕТИА БАЙОТЕРАПЬЮТИКС ИНК. (CA)

Изобретение относится к области биотехнологии и иммунологии. Описаны новые антитела или антиген-связывающие фрагменты, которые специфично связываются с сиглеком-15. В некоторых вариантах воплощения антиген-связывающие фрагменты могут блокировать биологическую активность сиглека-15 и полезны в составе композиции для лечения потери костной массы, в частности заболеваний костей, при которых повышена экспрессия сиглека-15 на клеточной поверхности, таких как состояния, при которых повышена активность остеокластов по деградации кости. Изобретение также относится к клеткам, экспрессирующим антитела или антиген-связывающие фрагменты, такие как моноклональные, гуманизированные или химерные антитела. Дополнительно также раскрыты способы детекции и лечения потери костной массы, заболеваний, связанных с потерей костной массы или онкологического заболевания с применением антител или антиген-связывающих фрагментов. 15 н. и 11 з.п. ф-лы, 20 ил., 6 табл., 4 пр.

 

ОБЛАСТЬ ТЕХНИКИ

Настоящее изобретение относится к моноклональным антителам и их антиген-связывающим фрагментам, которые специфично связываются с сиглеком-15, и к их применению для лечения некоторых заболеваний, включая диагностику, профилактику и лечение онкологического заболевания или потери костной массы, такой как тяжелая или чрезмерная потеря костной массы, ассоциированная с заболеванием, связанным с костями, или ассоциированная с усилением дифференцировки или активности остеокластов. Настоящее изобретение также относится к применению этих антител для диагностики, профилактики и лечению различных иных типов заболеваний, при которых повышена активность остеокластов.

УРОВЕНЬ ТЕХНИКИ

Кость является динамичной соединительной тканью, состоящей из функционально отличных популяций клеток, необходимых для поддержания структурной, механической и биохимической целостности кости и минерального гомеостаза организма человека. Основные типы клеток, присутствующих в кости, включают остеобласты, отвечающие за формирование кости и поддержание костной массы, и остеокласты, отвечающие за резорбцию костной ткани. Остеобласты и остеокласты функционируют в динамическом процессе, называемом ремоделированием кости. Развитие и пролиферация этих клеток из их предшественников управляется сетью ростовых факторов и цитокинов, продуцируемых в микроокружении кости, а также системными гормонами. Ремоделирование кости продолжается в течение всей жизни индивидуума и необходимо для поддержания здоровой костной ткани и минерального гомеостаза. Процесс в основном поддерживается в равновесном состоянии и управляется сложным взаимодействием системных гормонов, пептидов и белков и управляемых ими сигнальных путей, местных транскрипционных факторов, цитокинов, факторов роста и генов ремоделирования матрикса.

Любая помеха или дисбаланс, возникающие в процессе ремоделирования кости, могут приводить к заболеванию скелета, при этом наиболее распространенные нарушения скелета характеризуются общим снижением костной массы. Основной причиной такого снижения костной массы является увеличение количества и/или активности остеокластов. Наиболее распространенным таким заболеванием, и, возможно, самым известным, является остеопороз, встречающийся, в частности, у женщин после начала менопаузы. И действительно, остеопороз является наиболее существенной причиной, лежащей в основе переломов костей скелета у женщин позднего периода среднего возраста и пожилых женщин. Хотя недостаток эстрогена рассматривался в качестве фактора постменопаузального остеопороза, давно существует доказательство того, что ремоделирование является процессом, контролируемым на местном уровне, с учетом того, что он происходит в дискретных областях по всему скелету, как впервые описал Фрост (Frost) более сорока лет назад (Frost H.M. 1964).

Так как ремоделирование кости происходит в дискретных областях, локально продуцируемые гормоны и ферменты могут играть более важную роль, чем системные гормоны, в инициации резорбции костной ткани и в нормальном процессе ремоделирования. Такой местный контроль опосредуется остеобластами и остеокластами в микроокружении, в котором они функционируют. Например, остеокласты прикрепляются к костному матриксу и образуют отдельный компартмент между собой и поверхностью кости, ограниченный зоной плотного прилегания, образованной кольцом актина, окружающим фестончатый край. Множество мелких везикул транспортируют ферменты к клеточному матриксу и интернализируют частично переваренный клеточный матрикс. Микроокружение в пределах зоны плотного прилегания обогащено лизосомальными ферментами и имеет высокую кислотность, по сравнению с нормальным физиологическим значением pH организма. На мембране фестончатого края также экспрессируется RANK, рецептор для RANKL, и рецептор колониестимулирующего фактора макрофагов (М-КСФ), оба из которых отвечают за дифференцировку остеокластов, а также рецептор кальцитонина, способный быстро инактивировать остеокласты (Baron, R. 2003).

В сложной сети ингибирования и стимулирования гормон роста, инсулиноподобный фактор роста-1, половые стероиды, гормон щитовидной железы, кальциотрофические гормоны, такие как паратиреоидный гормон и простагландин E2, различные цитокины, такие как интерлейкин-1 бета, интерлейкин-6 и фактор некроза опухолей-альфа, и 1,25-дигидроксивитамин D (кальцитриол) действуют в процессе ремоделирования кости скоординированно (Jilka et al. 1992; Poli et al. 1994; Srivastava et al. 1998; de Vemejoul 1996).

Таким образом, очевидно, что уникальное местное микроокружение, создаваемое этими специализированными клетками, возникает благодаря либо экспрессии уникальных генетических последовательностей, которые не экспрессируются в других тканях, и/или благодаря сплайс-вариантам полинуклеотидов и полипептидов, экспрессируемых в других тканях. Выделение и идентификация полинуклеотидов, полипептидов и их вариантов и производных, специфичных для активности остеокластов, позволит более ясно понять процесс ремоделирования и предложить тканеспецифичные терапевтические мишени для лечения болезненных состояний, связанных с ремоделированием кости.

Многие заболевания, связанные с ремоделированием кости, плохо изучены, в общем случае не поддаются лечению или излечиваются только в ограниченной степени. Например, остеоартрит трудно лечить из-за того, что не существует средства лечения, и терапия фокусируется на ослаблении боли и предотвращении деформации затронутых заболеванием суставов. Обычно для ослабления боли применяют нестероидные противовоспалительные средства (НСПВС).

Еще одним примером является остеопороз, для которого единственными лекарственными препаратами, одобренными в настоящее время FDA для применения в Соединенных штатах, являются антирезорптивные агенты, которые предотвращают разрушение кости. Заместительная терапия эстрогенами является одним из примеров антирезорптивных агентов. Другие примеры включают алендроновую кислоту (Фосамакс - костной резорбции ингибитор - бифосфонат), ризедроновая кислота (Актонель - костной резорбции ингибитор - бисфосфонат), ралоксифен (Эвиста - селективный эстрогеновых рецепторов модулятор (СЭРМ)), кальцитонин (Кальцимар - гормон) и паратиреоидный гормон/терипаратид (Форстео - синтетический аналог паратиреоидного гормона человека, который помогает регулировать метаболизм кальция).

Бисфосфонаты, такие как алендроновая кислота и ризедроновая кислота, перманентно связываются с поверхностью кости и препятствуют активности остеокластов. Это позволяет остеобластам превзойти в скорости процесс резорбции. Самыми распространенными побочными эффектами являются тошнота, боли в животе и непроизвольная дефекация. Однако сообщается, что алендроновая кислота также вызывает раздражение и воспаление пищевода и, в некоторых случаях, язвы пищевода. Ризедроновая кислота химически отлична от алендроновой кислоты и с меньшей вероятностью служит причиной раздражения пищевода. Однако некоторые пищевые продукты, кальций, железосодержащие пищевые добавки, витамины и минералы или антациды, содержащие кальций, магний или алюминий, могут снижать всасывание ризедроновой кислоты, тем самым приводя к потере эффективности.

Наиболее частыми побочными эффектами ралоксифена и других СЭРМ (таких как Тамоксифен) являются приливы. Однако было показано, что ралоксифен и другие представители гормонозаместительной терапии повышают риск образования сгустков крови, в том числе тромбоза глубоких вен и эмболии сосудов легких, сердечно-сосудистого заболевания и рака.

Кальцитонин не столь эффективен в повышении плотности костей и усилении костей, как эстроген и другие антирезорптивные агенты. Распространенными побочными эффектами инъекционного или вводимого в виде назального аэрозоля кальцитонина являются тошнота и гиперемия. У пациентов могут развиваться раздражение носовой полости, насморк или носовые кровотечения. Инъекционный кальцитонин может вызывать местное покраснение кожи в области инъекции, кожную сыпь и гиперемию.

Ситуацией, демонстрирующей связь между несколькими заболеваниями или болезненными состояниями, в которые вовлечено ремоделирование кости, является то, что применение этидроновой кислоты (Дидронела) было изначально одобрено FDA для лечения болезни Педжета. Болезнь Педжета - это заболевание костей, характеризующееся нарушенным и усиленным ремоделированием костей, приводящим к ослаблению костей и болям. Дидронел применяли «недокументированно», и в некоторых исследованиях было показано, что он повышает плотность костей у женщин в постменопаузе с установленным остеопорозом. Также было обнаружено, что он эффективен для профилактики потери костной массы у пациентов, которым требуется длительный прием стероидных препаратов (таких как преднизолон или кортизон). Однако высокая доза или непрерывное применение Дидронела может вызвать другое заболевание костей, называемое остеомаляцией. Как и остеопороз, остеомаляция может приводить к ослаблению костей с повышенным риском переломов. Из-за проблем, связанных с остеомаляцией, и отсутствия достаточного количества исследований, хоть и учитывая снижение частоты переломов костей, FDA Соединенных штатов не одобрила Дидронел для лечения остеопороза.

Терапия остеопороза в основном фокусировалась на антирезорптивных лекарственных препаратах, которые снижают степень потери костной массы, но появляющиеся новые способы терапии показывают перспективность повышения минеральной плотности кости, вместо простого поддержания состояния или замедления ухудшения состояния. Ассортимент находящихся на ранних стадиях разработки лекарств для лечения остеопороза в основном включает кандидатные лекарства в новых терапевтических классах, в частности, ингибиторы катепсина K, остеопротегрин и кальцилитические агенты, а также новые бисфосфонаты. Некоторые из них являются примерами того, как новые лекарства, при создании которых применяются программы в области геномики, разрабатывают на основе более глубокого понимания биологии кости, и эти лекарства потенциально могут изменить подходы к лечению нарушений костей в длительной перспективе.

Настоящее изобретение описывает применение антител, специфичных к сиглеку-15, для диагностики, прогнозирования и лечения (включая профилактику) онкологического заболевания или потери костной массы (например, тяжелой или чрезмерной потери костной массы, ассоциированной с заболеванием, связанным с костями, или ассоциированной с усилением дифференцировки или активности остеокластов). В частности, настоящее изобретение относится к применению антител против сиглека-15 для ингибирования дифференцировки остеокластов.

Сиалосвязывающие лектины суперсемейства иммуноглобулинов (сиглеки) являются членами суперсемейства иммуноглобулинов (Ig), которые обладают способностью взаимодействовать с сиаловыми кислотами (McMillan and Crocker, 2008; Crocker et al., 2007). Существует несколько членов семейства сиглеков, все из которых имеют общие специфичные структурные свойства, в частности, они экспонируют аминоконцевой V-подобный Ig домен, который связывается с сиаловой кислотой, и различное количество C2-подобных Ig доменов. Эти мембранные рецепторы в общем случае экспрессируются высокоспецифичным образом, и многие члены семейства экспрессируются в гематопоэтических клетках (McMillan and Crocker, 2008). Полагают, что эти белки способствуют межклеточным взаимодействиям, опосредуют сигналлинг и регулируют иммунные функции посредством узнавания гликанов (Crocker et al., 2007). Сиаловые кислоты - это содержащие девять атомов углерода сахара, в типичном случае расположенные на концах сложных гликоконъюгатов на поверхности клеток. Они могут быть присоединены к большому множеству белков и липидов (McMillan and Crocker, 2008).

Сиглек-15 является одним из недавно описанных членов семейства сиглеков, который имеет высокую степень гомологии с сиглеком-14 (Angata et al., 2007). Эти авторы сообщили, что он предпочтительно связывается с сиалил-Tn-структурой и что он взаимодействует с DAP12 и DAP10. Функциональное значение этих взаимодействий неизвестно, но было высказано предположение, что сиглек-15, возможно, имеет активирующую функцию (Angata et al., 2007). Несмотря на эти предварительные предположения о возможной роли сиглека-15 у млекопитающих, важные подвижки в понимании биологической функции этого белка произошли, когда его последовательность была идентифицирована в ходе скринингового исследования с целью обнаружения новых регуляторов дифференцировки остеокластов (Sooknanan et al. 2007). В настоящей заявке на патент было выявлено, что подавление транскриптов сиглек-15 с помощью РНК-интерференции в модели остеокластогенеза на мышах приводило к существенному снижению дифференцировки предшественников в ответ на обработку RANKL. Похожие результаты сообщались для остеокластов человека. Дополнительно, исследования, представленные в настоящем раскрытии, также показали, что локализация сиглека-15 в клеточной мембране была необходима для выполнения им своей функции в дифференцировке остеокластов. Дополнительно, в недавно опубликованной работе показано, что присутствие сиаловой кислоты на конце поверхностных гликоконъюгатов было необходимо для правильной дифференцировки остеокластов и было, вероятно, важно для слияния клеток-предшественников остеокластов (Takahata et al., 2007). Это последнее наблюдение выявляет прямую функциональную связь между связыванием сиаловой кислоты и экспрессией сиглека-15 в дифференцирующихся остеокластах, и дает серьезные основания полагать, что сиглек-15 играет роль в программе ранних этапов дифференцировки предшественников остеокластов.

Таким образом, профиль экспрессии сиглека-15, его существенная индуцибельность в ходе дифференцировки остеокластов, его локализация на поверхности мембраны и его структурные характеристики - все эти факторы свидетельствуют в пользу осуществимости применения этого белка на клеточной поверхности в качестве мишени для моноклональных антител. Единственным иным примером терапии на основе моноклональных антител, нацеленных на остеокласты, является деносумаб, моноклональное антитело человека, специфичное к RANKL (Ellis et al. 2008). Настоящее изобретение относится к применению антител против сиглека-15 или антиген-связывающих фрагментов в качестве блокаторов дифференцировки остеокластов при выявлении или лечении потери костной массы, особенно в контексте затрагивающих кости заболеваний или в контексте повышенной дифференцировки или активности остеокластов. Настоящее изобретение также относится к применению антител или антиген-связывающих фрагментов при выявлении или лечении онкологического заболевания.

КРАТКОЕ ОПИСАНИЕ ФИГУР

На фигуре 1 показан профиль экспрессии на основе ПЦР-анализа для мРНК сиглека-15 в пробах дифференцирующихся остеокластов человека, полученных от шести различных доноров. Также приведен профиль экспрессии в пробах РНК, взятых из 30 нормальных тканей человека. В качестве контроля характеристики экспрессии сиглека-15 сравнили с хорошо известным маркером остеокластов, катепсином К (CATK), и ген «домашнего хозяйства» глицеральдегид-3-фосфатдегидрогеназы (GAPDH) был включен в анализ для контроля количества РНК в каждой пробе.

На фигуре 2 представлена экспрессия мРНК сиглека-15 в пробах, выделенных из панели NCI-60 линий раковых клеток.

На фигуре 3 представлен окрашенный кумасси полиакриламидный гель с пробой очищенного рекомбинантного сиглека-15 человека, который экспрессировали в виде химерного белка, содержащего Fc-домен, в клетках 293-6E. Этот препарат использовали для получения моноклональных антител, описанных в настоящем патенте.

На фигуре 4 показаны результаты анализа методом ELISA белка Fc-сиглек-15 с применением отдельных моноклональных антител, выбранных из 96-луночного планшета библиотеки Omniclonal NO 25, содержащей Fab-фрагменты антител против сиглека-15. Лунки, цифры в которых выделены жирным шрифтом, содержали использованные в качестве примеров фрагменты моноклональных антител 25A1, 25B4, 25B8, 25C1, 25D8, 25E5, 25E6 и 25E9. Также представлен результат анализа ELISA, проведенного для того же планшета с применением только Fc-остатка для выявления тех моноклональных антител, которые были специфичны к Fc-части химерного белка Fc-сиглек-15.

На фигуре 5 представлена схема, иллюстрирующая этапы приготовления из Fab-фрагментов антител мыши химерных моноклональных антител IgG2 мыши-человека.

На фигуре 6 представлены графики сравнения связывания Fab-фрагментов антител мыши против сиглека-15 со связыванием соответствующих химерных моноклональных антител IgG2 для выбранных в качестве примеров антител 25B4, 25B8, 25C1, 25D8, 25E6 и 25E9. Результаты свидетельствуют, что относительное связывание вариабельных областей Fab-фрагментов сохранялось при переносе их на полноразмерный остов IgG2 человека.

На фигуре 7 показано ингибирование дифференцировки остеокластов человека при обработке возрастающими концентрациями химерных моноклональных антител IgG2 против сиглека-15: 25B8, 25E6 и 25E9. После обработки остеокласты окрасили для детекции экспрессии TRAP.

На фигуре 8 показано ингибирование дифференцировки остеокластов мыши при обработке возрастающими концентрациями химерных моноклональных антител IgG2 против сиглека-15: 25B8, 25E6 и 25D8. После обработки остеокласты окрасили для детекции экспрессии TRAP.

На фигуре 9 представлено сравнение связывания сиглека-15 человека и мыши в присутствии выбранного в качестве примера антитела 25C8. Результаты свидетельствуют, что антитела, выработанные против сиглека-15 человека, также связываются с сиглеком-15 мыши.

На фигурах 10A, 10B и 10С представлено резюме результатов выравнивания, полученных для избранных последовательностей CDRL1, CDRL2 и CDRL3, соответственно, с применением программы ClustalW2; при этом «*» означает, что остатки в данной колонке одинаковые во всех последовательностях, для которых проводится выравнивание, «:» означает, что наблюдались консервативные замены, и «.» означает, что наблюдались полуконсервативные замены. Консенсусные последовательности CDR были сгенерированы с применением программы ClustalW (Larkin M.A., et al., (2007) ClustalW and ClustalX version 2. Bioinformatics 2007 23(21): 2947-2948).

На фигурах 11A, 11B и 11C представлено резюме результатов выравнивания, полученных для избранных последовательностей CDRH1, CDRH2 и CDRH3, соответственно, с применением программы ClustalW2; при этом «*» означает, что остатки в данной колонке одинаковые во всех последовательностях, для которых проводится выравнивание, «:» означает, что наблюдались консервативные замены, и «.» означает, что наблюдались полуконсервативные замены. Консенсусные последовательности CDR были сгенерированы с применением программы ClustalW (Larkin M.A., et al., (2007) ClustalW and ClustalX version 2. Bioinformatics 2007 23(21): 2947-2948).

Фигура 12 иллюстрирует способность кандидатного антитела 25E9, которое специфично к сиглеку-15, ингибировать активность остеокластов, направленную на резорбцию кости.

Фигуры 13A, 13В, 13C, 13D и 13E демонстрируют, что антитела против сиглека-15 можно применять для детекции этого белка при помощи иммуноблоттинга лизатов, приготовленных из клеток, сверхэкспрессирующих кДНК сиглека-15 (13A), остеокластов человека (13B) и мыши (13C) и клеток глиобластомы U87, и при помощи проточной цитометрии интактных клеток U87.

На фигурах 14A и 14B показано, что антитела, выработанные против сиглека-15, не связываются с другими родственными сиглеками, включая сиглек-2 и CD33.

На фигуре 15 показан анализ ELISA, демонстрирующий, что антитела против сиглека-15 могут ингибировать взаимодействие между сиглеком-15 и сиаловыми кислотами.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к антителам и антиген-связывающим фрагментам, а также к наборам, полезным для лечения (включая профилактику), детекции и диагностики потери костной массы или онкологического заболевания. Антитела и антиген-связывающие фрагменты могут, в частности, быть полезны для детекции дифференцированных остеокластов, клеток рака яичника, клеток рака почки, клеток рака центральной нервной системы, клеток рака простаты, клеток меланомы, клеток рака молочной железы, клеток рака легких или клеток рака толстой кишки и диагностики потери костной массы, рака яичника, рака почки, рака центральной нервной системы, рака простаты, меланомы, рака молочной железы, рака легких или рака толстой кишки. Антитела или антиген-связывающие фрагменты по настоящему изобретению также могут быть полезны для лечения потери костной массы, рака яичника, рака почки, рака центральной нервной системы, рака простаты, меланомы, рака молочной железы, рака легких или рака толстой кишки.

Антитела или антиген-связывающие фрагменты по настоящему изобретению могут связываться с аминокислотами в положении от 20 до 259 в составе сиглека-15 (SEQ ID NO: 2) или с соответствующей областью варианта сиглека-15 (например, SEQ ID NO: 4). В частности, антитела или антиген-связывающие фрагменты по настоящему изобретению могут связываться с аминокислотами в положении от 49 до 165 в составе сиглека-15 (SEQ ID NO: 2) или с соответствующей областью варианта сиглека-15 (например, SEQ ID NO: 4).

Настоящее изобретение, в частности, относится к изолированному антителу или антиген-связывающему фрагменту, который может связываться с полипептидом, обладающим способностью активировать дифференцировку остеокластов, и ингибирующему активность полипептида, направленную на дифференцировку остеокластов.

Антитела или антиген-связывающие фрагменты по настоящему изобретению включают таковые, связывающиеся с аминокислотами в положении с 20 по 259 в SEQ ID NO: 2 или с вариантом, имеющим, по меньшей мере, 80% идентичности последовательности с областью с 20 по 259 аминокислоту в SEQ ID NO: 2.

В частности, антитело или антиген-связывающий фрагмент по настоящему изобретению могут, в частности, связываться с аминокислотами в положении с 49 по 165 в SEQ ID NO: 2 или с вариантом, имеющим по меньшей мере 80% идентичности последовательности с областью с 49 по 165 аминокислоту в SEQ ID NO: 2.

В частности, антитело или антиген-связывающий фрагмент по настоящему изобретению могут, в частности, связываться с полипептидом, имеющим, по меньшей мере, 80% идентичность последовательности с SEQ ID NO: 2.

Следовательно, в соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут препятствовать способности полипептида активировать дифференцировку остеокластов или активировать рост опухоли.

В частности, рассматривается антитело или антиген-связывающий фрагмент, способный связываться с внеклеточной областью SEQ ID NO:2 или варианта SEQ ID NO: 2.

Следовательно, настоящее изобретение направлено на создание изолированного антитела или антиген-связывающего фрагмента, способного связываться с полипептидом, способным активировать дифференцировку остеокластов и имеющим по меньшей мере 80% идентичности последовательности с SEQ ID NO: 2 или с аминокислотами в положениях с 20 по 259 в SEQ ID NO: 2 (или по меньшей мере 80% идентичности последовательности с аминокислотами в положениях с 49 по 165 в SEQ ID NO: 2) сиалосвязывающего лектина суперсемейства иммуноглобулинов 15 (сиглека-15; SEQ ID NO: 2), при этом указанное антитело или антиген-связывающий фрагмент способны ингибировать дифференцировку остеокластов, резорбцию (деградацию) кости или способны блокировать связывание сиглека-15 с сиаловой кислотой.

Антитело или антиген-связывающий фрагмент по настоящему изобретению могут обладать способностью препятствовать (ингибировать) дифференцировке клетки-предшественника остеокласта в дифференцированный остеокласт.

В соответствии с настоящим изобретением, изолированное антитело или антиген-связывающий фрагмент могут являться, например, поликлональным антителом, моноклональным антителом, химерным антителом, антителом человека или их фрагментом.

В одном из примеров воплощения изолированное антитело или антиген-связывающий фрагмент могут являться химерным антителом или антителом человека, которое может включать аминокислоты консервативной области антитела человека, или их фрагментом.

Консервативная область или ее фрагмент могут происходить из IgG1, IgG2, IgG3 или IgG4. В одном частном примере воплощения консервативная область может происходить из IgG2.

Антиген-связывающие фрагменты, которые могут быть полезны, в частности, включают, например, FV (scFv), Fab, Fab' или (Fab')2.

Антитело или антиген-связывающий фрагмент могут быть продуцированы в или получены из изолированной клетки млекопитающих (отличной от гибридомной клетки) или в гибридомной клетке. Примером воплощения изолированной клетки млекопитающих является клетка человека.

В частности, рассматривается продукция моноклонального антитела, химерного антитела, антитела человека или их фрагмента в изолированной клетке млекопитающих (например, клетке человека). Химерное антитело или антитело человека, продуцированное таким способом, может включать аминокислоты консервативной области антитела человека или ее фрагмент, включая, например, консервативную область или ее фрагмент из IgG1, IgG2, IgG3 или IgG4. В одном частном примере воплощения консервативная область может происходить из IgG2.

Особенностью изобретения является то, что антитело или антиген-связывающий фрагмент по настоящему изобретению могут препятствовать (ингибировать) дифференцировке клетки-предшественника остеокласта человека в дифференцированный остеокласт человека.

В одном из примеров воплощения антитело или антиген-связывающий фрагмент по настоящему изобретению могут препятствовать (ингибировать) дифференцировке первичной клетки-предшественника остеокласта человека в дифференцированный остеокласт человека.

Антитела или антиген-связывающие фрагменты, обладающие такой активностью, могут включать, например, поликлональное антитело, моноклональное антитело, химерное антитело, антитело человека или их фрагмент.

В более частном примере воплощения антитела или антиген-связывающие фрагменты, которые могут обладать такой активностью, включают, например, моноклональное антитело, химерное антитело, антитело человека или их фрагмент.

В еще более частном примере воплощения антитела или антиген-связывающие фрагменты, которые могут обладать такой активностью, включают, например, химерное антитело, антитело человека или их фрагмент, которые могут включать аминокислоты консервативной области антитела человека или ее фрагмента.

Консервативная область или ее фрагмент, принадлежащие химерному антителу или антителу человека, могут происходить из IgG1, IgG2, IgG3 или IgG4. В частности, консервативная область может происходить из IgG2.

Антитела и антиген-связывающие фрагменты по настоящему изобретению также могут применяться для общего нацеливания на клетки, экспрессирующие или сверхэкспрессирующие сиглек-15, включая клетки кости и клетки рака молочной железы, толстой кишки, легких, яичника, простаты и почки, а также клетки меланомы и клетки рака центральной нервной системы.

В частности, антитела и антиген-связывающие фрагменты могут применяться для нацеливания на клетки остеокластов, претерпевающих дифференцировку.

Одной из особенностей настоящего изобретения является то, что оно направлено на создание изолированного или в существенной степени очищенного антитела или антиген-связывающего фрагмента, которые могут быть способны к специфичному связыванию с SEQ ID NO: 2.

В частности, и в соответствии с воплощением изобретения, антитело или антиген-связывающий фрагмент могут связываться с доменом, расположенным между аминокислотой 20 и аминокислотой 259 в SEQ ID NO: 2.

В соответствии с еще одним воплощением изобретения, антитело или антиген-связывающий фрагмент могут иметь способность связываться с эпитопом, расположенным в пределах области между аминокислотой 20 и аминокислотой 259 в SEQ ID NO: 2.

По существу, настоящее изобретение включает диагностические и/или терапевтические антитела и антиген-связывающие фрагменты, обладающие специфичностью к SEQ ID NO: 2. Настоящее изобретение также включает антитела или антиген-связывающие фрагменты, обладающие той же специфичностью к эпитопу, что и антитело по настоящему изобретению. Кандидатное антитело может быть идентифицировано путем определения того, будет ли оно связываться с эпитопом, с которым связываются антитела, описанные в этом документе, и/или путем проведения конкурентного анализа с антителами или антиген-связывающими фрагментами, о которых известно, что они связываются с данным эпитопом.

Следовательно, еще одной особенностью настоящего изобретения является то, что оно направлено на создание изолированного антитела или антиген-связывающего фрагмента, способных конкурировать с антителом или антиген-связывающим фрагментом, описанными в этом документе.

Дополнительной особенностью настоящего изобретения является то, что оно направлено на создание способа лечения и способа детекции с применением антитела или антиген-связывающего фрагмента по настоящему изобретению.

Термин «антитело» относится к интактному антителу, моноклональным или поликлональным антителам. Термин «антитело» также включает мультиспецифичные антитела, такие как биспецифичные антитела. Антитела человека обычно состоят из двух легких цепей и двух тяжелых цепей, каждая из которых включает вариабельные области и консервативные области. Вариабельная область легкой цепи содержит 3 CDR, обозначаемые в этом документе как CDRL1, CDRL2 и CDRL3, фланкированные каркасными областями. Вариабельная область тяжелой цепи содержит 3 CDR, обозначаемые в этом документе как CDRH1, CDRH2 и CDRH3, фланкированные каркасными областями.

Термин «антиген-связывающий фрагмент» при использовании в этом документе, означает один или несколько фрагментов антитела, которые сохраняют способность связываться с антигеном (например, с SEQ ID NO: 2 или ее вариантами). Показано, что свойственная антителу функция связывания антигена может выполняться фрагментами интактного антитела. Примеры связывающих фрагментов, относящихся к термину «антиген-связывающий фрагмент» антитела, включают (i) Fab-фрагмент, моновалентный фрагмент, состоящий из доменов VL, VH, CL и CH1; (ii) F(ab')2-фрагмент, бивалентный фрагмент, включающий два Fab-фрагмента, соединенных дисульфидным мостиком в шарнирной области; (iii) Fd-фрагмент, состоящий из доменов VH и CH1; (iv) Fv-фрагмент, состоящий из доменов VL и VH единичного антитела, (v) dAb-фрагмент (Ward et al., (1989) Nature 341:544-546), который состоит из домена VH и (vi) изолированная область, определяющая комплементарность (CDR), например, VH CDR3. Дополнительно, хотя два домена Fv-фрагмента, VL и VH, кодируются разными генами, они могут быть объединены с помощью рекомбинантных методик, посредством синтетического линкера, что позволяет получать их в виде единой полипептидной цепи, в которой области VL и VH спарены с образованием моновалентных молекул (известных как одноцепочечный Fv (scFv); см., например, Bird et al. (1988) Science 242:423-426; и Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Подразумевается, что такие одноцепочечные антитела также включены в термин «антиген-связывающий фрагмент» антитела. Дополнительно, антиген-связывающие фрагменты включают содержащие связывающий домен иммуноглобулина химерные белки, включающие (i) полипептид связывающего домена (такой как вариабельная область тяжелой цепи, вариабельная область легкой цепи или вариабельная область тяжелой цепи, сшитая с вариабельной областью легкой цепи через линкерный пептид), (ii) консервативная область CH2 тяжелой цепи иммуноглобулина, сшитая с шарнирной областью, и (iii) консервативная область CH3 тяжелой цепи иммуноглобулина, сшитая с консервативной областью CH2. Шарнирная область может быть модифицирована путем замены одного или нескольких остатков цистеина остатками серина таким образом, чтобы предотвратить димеризацию. Такие содержащие связывающий домен иммуноглобулина химерные белки дополнительно раскрыты в US 2003/0118592 и US 2003/0133939. Эти фрагменты антител получают с применением стандартных методик, известных специалистам в данной области, и проводят скрининг фрагментов на полезность тем же способом, что и в случае интактных антител.

Типичный антиген-связывающий сайт состоит из вариабельных областей, образованных при спаривании легкой цепи иммуноглобулина и тяжелой цепи иммуноглобулина. Структура вариабельных областей антитела очень стабильна и очень схожа у разных представителей вариабельных областей. Эти вариабельные области в типичном случае состоят из относительно гомологичных каркасных областей (FR), между которыми расположены три гипервариабельные области, называемые областями, определяющими комплементарность (CDR). Общая связывающая активность антиген-связывающего фрагмента часто обусловлена последовательностью областей CDR. Области FR часто играют роль в правильном позиционировании и выравнивании в трехмерном пространстве областей CDR для оптимального связывания антигена.

Антитела и/или антиген-связывающие фрагменты по настоящему изобретению могут происходить, например, от мыши, крысы или любого другого млекопитающего или из других источников, таких как получение с помощью методик рекомбинантных ДНК.

Полный объем, применимость и преимущества настоящего изобретения будут очевидны из неограничивающего детального описания, приведенного далее. Следует, однако, понимать, что это детальное описание, хоть и дает примеры воплощений изобретения, приведено только в качестве примера, со ссылкой на сопутствующие графические материалы.

ДЕТАЛЬНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Профиль экспрессии сиглека-15 в остеокластах и нормальных тканях

Настоящее изобретение относится к применению моноклональных антител для нацеливания на остеокласты, обнаруживаемые при различных связанных с костями заболеваниях, при которых наблюдается тяжелая потеря костной массы из-за повышенной активности остеокластов. Для выработки антител к остеокластам необходимо проведение идентификации специфичных для остеокластов антигенов, которые экспрессируются на поверхности клеток. Существует несколько методик, доступных для идентификации антигенов, специфичных для конкретных клеток, и способ, примененный для идентификации сиглека-15 в дифференцирующихся остеокластах, обработанных RANKL, - это инновационная платформа для исследований, называемая амплификацией мРНК на основе вычитательной транскрипции (STAR), которая описана в опубликованной заявке на патент NO PCT/CA2007/000210.

Анализ STAR-библиотек остеокластов человека выявил множество генов, кодирующих секретируемые белки и белки клеточных поверхностей. Один из них, названный AB-0326, содержал открытую рамку считывания, кодирующую полипептид из 328 аминокислот, соответствующий SEQ ID NO: 2, которая кодировалась кДНК длиной 987 пар оснований с нуклеотидной последовательностью SEQ ID NO: 1. Поиск в общедоступных базах данных показал, что нуклеотидная последовательность AB-0326 была идентична таковой гена человека, называемого CD33 антиген-подобным 3 (CD33L3). Позже было обнаружено, что CD33L3 является членом семейства сиглеков, белков, связывающихся с сиаловой кислотой, и он был переименован в сиглек-15 на основании гомологии с другими сиглеками (Crocker et al., 2007). На основании этой информации был изолирован и секвенирован ортолог у мыши, и было обнаружено, что он примерно на 85% идентичен последовательности человека на уровне аминокислотных последовательностей. SEQ ID NO: 3 и SEQ ID NO: 4 демонстрируют последовательности ДНК и полипептида сиглека-15 мыши, соответственно. Биоинформационный анализ позволил предсказать заякоренный в мембране белок I типа, который экспонирует свой функциональный домен во внеклеточный компартмент. Как и в случае с последовательностями других сиглеков, аминоконцевой сигнальный пептид (расположенный между аминокислотами 1 и 19 в SEQ ID NO:2) нацеливает белок к мембране клетки, и конечный процессированный белок заякорен в мембране через одиночную трансмембранную спираль, расположенную на карбоксильном конце (локализованную между аминокислотами 261 и 283 в SEQ ID NO:2). V-подобный Ig домен расположен между аминокислотами 49 и 165 в SEQ ID NO: 2, тогда как C2-подобный Ig домен расположен между аминокислотами 178 и 244 в SEQ ID NO: 2.

Настоящее изобретение относится к функции сиглека-15 в ходе дифференцировки остеокластов. В предшествующих работах (Sooknanan et al. 2007) было установлено, что уровень транскрипта, кодирующего сиглек-15 человека, в существенной степени повышается в ответ на RANKL. Это определение проводили с применением РНК-микрочипов, которые содержали нанесенные в виде пятен пробы суммарной РНК из нескольких различных экспериментов по дифференцировке остеокластов человека, полученных от различных доноров МКПК человека. Дополнительно, в этих исследованиях (Sooknanan et al. 2007) выявили, что транскрипт сиглека-15 экспрессировался только в одной нормальной ткани среди обширной панели из 30 нормальных тканей человека, что свидетельствует об очень высокой специфичности экспрессии гена сиглека-15 для остеокластов. Применяя более чувствительные методы, такие как полуколичественная ОТ-ПЦР, показано, что экспрессия мРНК сиглека-15 стимулировалась в течение одного дня обработки RANKL во многих пробах остеокластов, свидетельствуя о том, что этот ген экспрессировался на раннем этапе в клетках-предшественниках остеокластов, до начала слияния клеток. Наконец, профиль экспрессии сиглека-15 в тканях оценили с применением полуколичественной ОТ-ПЦР и обнаружили, что он экспрессируется только в одной нормальной ткани человека, что, таким образом, подтвердило полученные с применением микрочипа результаты Sooknanan et al. Обобщая, эти результаты по экспрессии подчеркивают эффективность примененного заявителем способа исследования для идентификации мишеней, таких как служащий в качестве примера сиглек-15, присутствие которых в существенной степени ограничено дифференцирующимися остеокластами.

Исходя из экспрессии сиглека-15 на ранних стадиях дифференцировки остеокластов, его ограниченной экспрессии в нормальных тканях и критической биологической роли сиглека-15 в активности остеокластов, сиглек-15 был выбран в качестве терапевтической мишени для разработки моноклональных антител для детекции, профилактики и лечения связанных с костями заболеваний, таких как индуцированная онкологическим заболеванием потеря костной массы и остеопороз.

Следовательно, предложено множество антител против сиглека-15 и их иммунологически функциональных фрагментов, таких как химерные и гуманизированные моноклональные антитела, фрагменты антител, одноцепочечные антитела, доменные антитела и полипептиды с антиген-связывающей областью, для нацеливания на сиглек-15.

SEQ ID NO: 2 в качестве антигена и эпитопы, полученные из SEQ ID NO: 2

В международной заявке NO PCT/CA2007/000210 заявитель неожиданно обнаружил, что SEQ ID NO:2 вовлечена в дифференцировку остеокластов. Таким образом, этот антиген может быть полезен для нацеливания на клетки, экспрессирующие антиген in vitro или in vivo, и для разработки способов детекции для измерения антигена in vitro или in vivo.

Следовательно, настоящее изобретение направлено на создание антигена, полезного для выработки специфичных антител и/или специфичного для клеток, экспрессирующих SEQ ID NO: 2. Антиген или эпитоп может включать фрагмент длиной по меньшей мере 10 аминокислот (и вплоть до полноразмерного) из SEQ ID NO: 2 или варианта SEQ ID NO: 2.

Примером антигена является белок с полной SEQ ID NO: 2 или вариантная форма, обладающая по меньшей мере 80% идентичности последовательности относительно SEQ ID NO: 2, или фрагмент, включающий по меньшей мере 10 аминокислот из SEQ ID NO:2 или варианта SEQ ID NO: 2.

Антиген или эпитоп, описанные в этом документе, могут быть сшиты с носителем, таким как гемоцианин фиссуреллы (KHL), бычий сывороточный альбумин (БСА), овальбумин (OVA) или иным, с целью выработки антител и антиген-связывающих фрагментов.

Настоящее изобретение также направлено на создание эпитопа, расположенного в пределах аминокислот с 20 по 259 в SEQ ID NO: 2, для выработки антител и антиген-связывающих фрагментов, описанных в этом документе. Эпитоп может включать фрагмент размером по меньшей мере 10 аминокислот в пределах аминокислот с 20 по 259 в SEQ ID NO: 2 или соответствующей части варианта SEQ ID NO: 2.

Настоящее изобретение направлено на создание композиции для выработки антител к SEQ ID NO: 2 или к варианту SEQ ID NO: 2, при этом композиция может включать эпитоп из SEQ ID NO: 2, расположенный в пределах аминокислот с 20 по 259 в SEQ ID NO: 2 или соответствующей части варианта SEQ ID NO: 2, и носитель.

Примерами воплощений композиций служит фармацевтическая композиция для выработки антител против SEQ ID NO: 2 или против варианта SEQ ID NO:2. Фармацевтическая композиция может включать эпитоп из SEQ ID NO:2, расположенный в пределах аминокислот с 20 по 259 в SEQ ID NO:2 или соответствующей части варианта SEQ ID NO:2, и фармацевтически приемлемый носитель.

Еще одной особенностью изобретения является то, что оно направлено на создание способа выработки антител против SEQ ID NO:2 или против варианта SEQ ID NO:2. Способ может включать введение полипептида, содержащего эпитоп из SEQ ID NO:2, расположенный в пределах аминокислот с 20 по 259 в SEQ ID NO:2 или соответствующей части варианта SEQ ID NO:2.

Еще одной особенностью изобретения является то, что оно предлагает применение эпитопа из SEQ ID NO: 2, расположенного в пределах аминокислот с 20 по 259 в SEQ ID NO:2 или соответствующей части варианта SEQ ID NO:2, для выработки антител против SEQ ID NO: 2 или против варианта SEQ ID NO:2.

Примеры воплощений варианта SEQ ID NO: 2, имеющего 80% идентичности относительно SEQ ID NO: 2, включают, например, без ограничений, SEQ ID NO: 4, а также другие аналоги, которые опубликованы в базах данных под номерами доступа банка генов или в качестве референсной последовательности NCBI: AAY40743.1, XP_512109.2, XP_001089000.1, XP_601064.4, NP_001094508.1, XP_855238.1, XP_574176.2 и EAX01462.1.

Антитела и антиген-связывающие фрагменты, которые связываются с SEQ ID NO: 2 или с вариантом SEQ ID NO:2

Первоначально антитела изолировали из библиотек Fab-фрагментов на основании их специфичности в отношении представляющего интерес антигена. Сравнение аминокислотных последовательностей вариабельных доменов легких цепей или вариабельных доменов тяжелых цепей антител, демонстрирующих наилучшие характеристики, позволило вывести консенсусные последовательности в пределах областей CDR и в пределах вариабельных областей. Консенсусные последовательности для областей CDR представлены в SEQ ID NO: 148-158 и 197-210. Консенсусные последовательности для вариабельных областей представлены в SEQ ID NO: 191-196.

Вариабельные области, описанные в этом документе, могут быть сшиты с консервативными областями, принадлежащими нужному биологическому виду, что сделает возможным узнавание антитела эффекторными клетками, принадлежащими нужному биологическому виду. Консервативная область может происходить, например, из подтипов IgG1, IgG2, IgG3 или IgG4. Клонирование или синтез консервативной области в одной рамке считывания с вариабельной областью может быть легко осуществлено специалистом в данной области и может быть проведено, например, с помощью технологии рекомбинантных ДНК.

В некоторых воплощениях настоящего изобретения антитела, которые связываются с SEQ ID NO:2, могут принадлежать к подтипу IgG1, IgG2, IgG3 или IgG4. Более частные примеры воплощения изобретения относятся к антителу подтипа IgG1. Антитело может быть гуманизированным антителом подтипа IgG1, которое биологически активно в опосредовании антителозависимой клеточно-опосредованной цитотоксичности (АЗКЦ), комплемент-опосредованной цитотоксичности (CMC) или ассоциировано с иммунными комплексами. Типичная АЗКЦ включает активацию натуральных клеток-киллеров (NK) и зависит от узнавания покрытых антителами клеток рецепторами к Fc, расположенными на поверхности NK-клеток. Рецепторы к Fc узнают Fc-домен антител, такой как присутствует в IgG1, которые связываются с поверхностью клетки-мишени, в частности, клетки кости, которая экспрессирует антиген, такой как SEQ ID NO:2. После связывания рецептора к Fc с IgG1 NK-клетка высвобождает цитокины и цитотоксические гранулы, которые проникают в клетку-мишень и способствуют гибели клетки путем запуска процесса апоптоза.

Настоящее изобретение описывает набор антител, которые связываются с SEQ ID NO: 2. В некоторых воплощениях антитела могут быть выбраны из группы, состоящей из поликлональных антител, моноклональных антител, таких как химерные или гуманизированные антитела, фрагментов антител, таких как антиген-связывающие фрагменты, одноцепочечных антител, однодоменных антител и полипептидов с антиген-связывающей областью.

Следовательно, еще одной особенностью настоящего изобретения является то, что оно направлено на создание изолированного антитела или антиген-связывающего фрагмента, включающих вариабельный домен легкой цепи, имеющий:

a. последовательность CDRL1, выбранную из группы, состоящей из SEQ ID NO:69, SEQ ID NO:75, SEQ ID NO:81, SEQ ID NO:87, SEQ ID NO:93, SEQ ID NO:99, SEQ ID NO:105, SEQ ID NO:111, SEQ ID NO:173, SEQ ID NO:179 и SEQ ID NO:185;

б. последовательность CDRL2, выбранную из группы, состоящей из SEQ ID NO: 70, SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO: 88, SEQ ID NO: 94, SEQ ID NO: 100, SEQ ID NO: 106, SEQ ID NO: 112, SEQ ID NO: 174, SEQ ID NO: 180 и SEQ ID NO: 186 и/или;

в. последовательность CDRL3, выбранную из группы, состоящей из SEQ ID NO:71, SEQ ID NO:77, SEQ ID NO:83, SEQ ID NO:89, SEQ ID NO:95, SEQ ID NO:101, SEQ ID NO:107, SEQ ID NO:113, SEQ ID NO:175, SEQ ID NO:181 и SEQ ID NO:187.

Изолированное антитело или антиген-связывающий фрагмент также могут включать вариабельный домен тяжелой цепи, имеющий:

a. последовательность CDRH1, выбранную из группы, состоящей из SEQ ID NO: 72, SEQ ID NO: 78, SEQ ID NO: 84, SEQ ID NO: 90, SEQ ID NO: 96, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 114, SEQ ID NO: 176, SEQ ID NO: 182 и SEQ ID NO: 188;

б. последовательность CDRH2, выбранную из группы, состоящей из SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 91, SEQ ID NO: 97, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 115, SEQ ID NO: 177, SEQ ID NO: 183 и SEQ ID NO: 189 и/или;

в. последовательность CDRH3, выбранную из группы, состоящей из SEQ ID NO: 74, SEQ ID NO: 80, SEQ ID NO: 86, SEQ ID NO: 92, SEQ ID NO: 98, SEQ ID NO: 104, SEQ ID NO: 110, SEQ ID NO: 116, SEQ ID NO: 178, SEQ ID NO: 184 и SEQ ID NO: 190.

Дополнительной особенностью настоящего изобретения является то, что оно направлено на создание изолированного антитела или антиген-связывающего фрагмента, которые могут включать вариабельный домен легкой цепи, имеющий:

a) область CDRL1, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRL1, выбранной из группы, состоящей из SEQ ID NO: 148, SEQ ID NO: 69, SEQ ID NO: 75 и SEQ ID NO: 105;

б) область CDRL2, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRL2, выбранной из группы, состоящей из SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 76, SEQ ID NO: 82 и SEQ ID NO: 106, или;

в) область CDRL3, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRL3, выбранной из группы, состоящей из SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 77, SEQ ID NO: 83, SEQ ID NO: 95, SEQ ID NO: 107 и SEQ ID NO: 152.

Еще одной дополнительной особенностью настоящего изобретения является то, что оно направлено на создание изолированного антитела или антиген-связывающего фрагмента, при этом антитело содержит вариабельный домен тяжелой цепи, имеющий:

a) область CDRH1, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRH1, выбранной из группы, состоящей из SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 84, SEQ ID NO: 96 и SEQ ID NO: 102;

б) область CDRH2, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRH2, выбранной из группы, состоящей из SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 97, SEQ ID NO: 103 и SEQ ID NO: 109, или;

в) область CDRH3, которая может обладать, по меньшей мере, 80% идентичности по отношению к последовательности CDRH3, выбранной из группы, состоящей из SEQ ID NO: 158, SEQ ID NO: 74, SEQ ID NO: 98, SEQ ID NO: 104, SEQ ID NO: 110 и SEQ ID NO: 116.

В одном примере воплощения антитело или антиген-связывающий фрагмент могут включать любую единичную область CDR или комбинацию CDR1, CDR2 и/или CDR3 вариабельной области легкой цепи. В частности, может быть выбрана область CDR3. Комбинация может включать, например, CDRL1 и CDRL3; CDRL1 и CDRL2; CDRL2 и CDRL3 и; CDRL1, CDRL2 и CDRL3.

В еще одном примере воплощения антитело или антиген-связывающий фрагмент могут включать любую единичную область CDR или комбинацию CDR1, CDR2 и/или CDR3 вариабельной области тяжелой цепи. В частности, может быть выбрана область CDR3. Комбинация может включать, например, CDRH1 и CDRH3; CDRH1 и CDRH2; CDRH2 и CDRH3 и; CDRH1, CDRH2 и CDRH3.

В соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут включать, по меньшей мере, две области CDR из CDRL1, CDRL2 или CDRL3.

Также в соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут включать одну CDRL1, одну CDRL2 и одну CDRL3.

Дополнительно, в соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут включать:

a. по меньшей мере, две области CDR из CDRL1, CDRL2 или CDRL3 и;

б. по меньшей мере, две области CDR из CDRH1, одной CDRH2 или одной CDRH3.

Антитело или антиген-связывающий фрагмент могут, более предпочтительно, включать одну CDRL1, одну CDRL2 и одну CDRL3.

Антитело или антиген-связывающий фрагмент могут также, более предпочтительно, включать одну CDRH1, одну CDRH2 и одну CDRH3.

Еще одной особенностью настоящего изобретения является то, что оно направлено на создание изолированного антитела или антиген-связывающего фрагмента, включающих вариабельный домен тяжелой цепи, имеющий:

a. последовательность CDRH1, выбранную из группы, состоящей из SEQ ID NO: 72, SEQ ID NO:78, SEQ ID NO: 84, SEQ ID NO: 90, SEQ ID NO: 96, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 114, SEQ ID NO: 176, SEQ ID NO: 182 и SEQ ID NO: 188;

б. последовательность CDRH2, выбранную из группы, состоящей из SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 91, SEQ ID NO: 97, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 115, SEQ ID NO: 177, SEQ ID NO: 183 и SEQ ID NO: 189 и/или;

в. последовательность CDRH3, выбранную из группы, состоящей из SEQ ID NO:74, SEQ ID NO:80, SEQ ID NO:86, SEQ ID NO: 92, SEQ ID NO:98, SEQ ID NO: 104, SEQ ID NO:110, SEQ ID NO:116, SEQ ID NO:178, SEQ ID NO:184 и SEQ ID NO:190.

В соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут включать одну CDRH1, одну CDRH2 и одну CDRH3.

В соответствии с настоящим изобретением, антитело или антиген-связывающий фрагмент могут также включать одну CDRH1, одну CDRH2 и одну CDRH3.

Когда имеется только один вариабельный домен легкой цепи или вариабельный домен тяжелой цепи, антитело или антиген-связывающий фрагмент можно воссоздать путем скрининга библиотеки комплементарных вариабельных доменов, применяя методы, известные специалистам в данной области (Portolano et al. The Journal of Immunology (1993) 150:880-887, Clarkson et al., Nature (1991) 352:624-628).

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, одну консервативную аминокислотную замену в, по меньшей мере, одной из областей CDR, описанной в этом документе.

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, одну консервативную аминокислотную замену в, по меньшей мере, двух областях CDR.

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, одну консервативную аминокислотную замену в 3 областях CDR.

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, две консервативные аминокислотные замены, по меньшей мере, в, по меньшей мере, одной из областей CDR.

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, две консервативные аминокислотные замены, в по меньшей мере, двух областях CDR.

Настоящее изобретение также включает полипептиды или антитела, содержащие вариабельные цепи, имеющие, по меньшей мере, две консервативные аминокислотные замены в 3 областях CDR.

Еще одной особенностью настоящего изобретения является то, что оно относится к полипептиду, антителу или антиген-связывающему фрагменту, включающему (на одной полипептидной цепи или на разных полипептидных цепях), по меньшей мере, одну область, определяющую комплементарность, из вариабельного домена легкой цепи и, по меньшей мере, одну область, определяющую комплементарность, из вариабельного домена тяжелой цепи одного из антител или антиген-связывающего фрагмента, описанных в этом документе.

Еще одной особенностью настоящего изобретения является то, что оно относится к антителам, которые могут включать (на одной полипептидной цепи или на разных полипептидных цепях) все шесть областей, определяющих комплементарность (CDR), антитела или антиген-связывающего фрагмента, описанных в этом документе.

Антитела или антиген-связывающий фрагмент по настоящему изобретению могут дополнительно включать добавочные аминокислоты, фланкирующие амино- и/или карбоксильную область последовательности(ей) CDR. Эти добавочные аминокислоты могут быть идентичны каркасным областям соответствующих антител, описанных в этом документе, или могут включать, например, консервативную аминокислотную замену.

В соответствии с воплощением настоящего изобретения, антитело или антиген-связывающий фрагмент могут содержать последовательность CDRL1, содержащую или состоящую из последовательности формулы:

RSX1aX2aSLLHSNGX3aTYLY (SEQ ID NO: 148),

где X1a может являться, например, нейтральной гидрофильной аминокислотой;

где X2a может являться, например, лизином или глутаминовой кислотой;

где X3a может являться, например, гидрофобной аминокислотой или аспарагином.

В более конкретном примере воплощения X1a может являться, например, серином.

В более конкретном примере воплощения X2a может являться, например, лизином.

В частности X3a может являться, например, изолейцином или валином.

В более конкретном примере воплощения X3a может являться изолейцином.

В соответствии с еще одним вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL1, содержащую или состоящую из последовательности формулы: RASXa10NIXb10Xc10YLA (SEQ ID NO: 197),

где Ха10 может являться любой аминокислотой или, например, G или E;

Xb10 может являться любой аминокислотой или, например, Y или H, и;

Xc10 может являться любой аминокислотой или, например, S или N.

В соответствии с еще одним вариантом воплощения настоящего изобретения, антитело или антиген-связывающий фрагмент могут включать последовательность CDRL1, содержащую или состоящую из последовательности формулы: CDRL1 формулы RSSX1xSLLHSNGX2xTYLY (SEQ ID NO: 201), где X1x и X2x - как указано в этом документе.

В соответствии с еще одним вариантом воплощения настоящего изобретения, антитело или антиген-связывающий фрагмент могут содержать последовательность CDRL1, содержащую или состоящую из последовательности формулы: CDRL1 формулы RSXa6KSLLHSNGNTYLY (SEQ ID NO: 202), где Xa6 - как указано в этом документе.

Антитело или антиген-связывающий фрагмент могут также включать, например, последовательность CDRL1, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 75, SEQ ID NO: 69, SEQ ID NO: 105 и других CDRL1, перечисленных в Таблице 3 или Таблице 5B.

В соответствии с еще одним вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL2, содержащую или состоящую из последовательности формулы:

X1bMSNLAS (SEQ ID NO: 149),

где X1b может являться, например, основной аминокислотой.

В частности, X1b может являться, например, глутамином или аспарагином.

В более конкретном примере воплощения X1b может являться глутамином.

В соответствии с еще одним вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL2, содержащую или состоящую из последовательности формулы:

RX1cSNLX2cS (SEQ ID NO: 150),

где X1c может являться, например, метионином или треонином, и где X2c может являться, например, гидрофобной аминокислотой.

В частности, X2c может являться, например, аланином или валином.

В более конкретном примере воплощения X1c может являться, например, метионином.

В более конкретном примере воплощения X2c может являться, например, аланином.

В соответствии с еще одним вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL2, содержащую или состоящую из последовательности формулы:

NAKTLXa11Xb11 (SEQ ID NO: 198)

Xa11 может являться любой аминокислотой или, например, P или A, и;

Xb11 может являться любой аминокислотой или, например, кислотной аминокислотой, такой как E или D.

Антитело или антиген-связывающий фрагмент могут также включать, например, последовательность CDRL2, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO: 106 и других CDRL2, перечисленных в Таблице 3 или Таблице 5B.

В соответствии с еще одним вариантом воплощения, антитело или антиген-связывающий фрагмент могут включать последовательность CDRL3, содержащую или состоящую из последовательности формулы:

X1dQX2dLEX3dPX4dT (SEQ ID NO: 151),

где X1d может являться, например, гидрофобной аминокислотой;

где X2d может являться, например, основной аминокислотой;

где X3d может являться, например, тирозином или лейцином и;

где X4d может являться, например, ароматической аминокислотой.

В частности, X1d может являться, например, метионином или аланином. В более конкретном примере воплощения X1d может являться, например, метионином.

В частности, X2d может являться, например, гистидином или аспарагином. В более конкретном примере воплощения X2d может являться, например, гистидином.

В более конкретном примере воплощения X3d может являться, например, тирозином.

В частности, X4d может являться, например, тирозином или фенилаланином. В более конкретном примере воплощения X4d может являться, например, тирозином.

В соответствии с дополнительным вариантом воплощения, антитело или антиген-связывающий фрагмент могут включать последовательность CDRL3, содержащую или состоящую из последовательности формулы:

QQWSSNPX1eT (SEQ ID NO: 152),

где X1e является пролином или лейцином.

В соответствии с еще одним вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL3, содержащую или состоящую из последовательности формулы:

QHYGXa12PLT (SEQ ID NO: 199),

Xa12 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, A или V.

В соответствии с дополнительным вариантом воплощения настоящего изобретения, антитело или антиген-связывающий фрагмент могут включать последовательность CDRL3, содержащую или состоящую из последовательности формулы: Xa8QXb8LEXc8PYT (SEQ ID NO: 203), где Xa8, Xb8 и Xc8 - как указано в этом документе.

В соответствии с еще одним дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRL3, содержащую или состоящую из последовательности формулы: QHHYGXa4PLT (SEQ ID NO: 204), где Xa4 - как указано в этом документе.

Антитело или антиген-связывающий фрагмент могут также включать, например, последовательность CDRL3, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 77, SEQ ID NO: 83, SEQ ID NO:95, SEQ ID NO: 107, SEQ ID NO: 152 и других CDRL3, перечисленных в Таблице 3 или Таблице 5B.

В соответствии с дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH1, содержащую или состоящую из последовательности формулы:

GYTFX1fX2fYX3fMX4f (SEQ ID NO: 153),

где X1f может являться, например, треонином или аспарагином;

где X2f может являться, например, треонином, аргинином, серином или аспарагиновой кислотой;

где X3f может являться, например, триптофаном или аспарагином, аспарагиновой кислотой или глутаминовой кислотой и;

где X4f может являться, например, тирозином, гистидином или аспарагиновой кислотой.

В более конкретном примере воплощения X1f может являться, например, треонином.

В более конкретном примере воплощения X2f может являться, например, серином.

В более конкретном примере воплощения X3f может являться, например, триптофаном.

В более конкретном примере воплощения X4f может являться, например, гистидином.

В соответствии с еще одним дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH1, содержащую или состоящую из последовательности формулы:

GYTFTDYX5fMH (SEQ ID NO: 154),

где X5f может являться, например, кислотной аминокислотой.

В частности, X5f может являться, например, глутаминовой кислотой или аспарагиновой кислотой. В более конкретном примере воплощения X5f может являться, например, аспарагиновой кислотой.

В соответствии с дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH1, содержащую или состоящую из последовательности формулы: GYTFTX1lYWMH (SEQ ID NO: 205), где Х1l - как указано в этом документе.

В соответствии с еще одним дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH1, содержащую или состоящую из последовательности формулы: GYTFTDYX1sMH (SEQ ID NO: 208), где X1s - как указано в этом документе.

Антитело или антиген-связывающий фрагмент могут также включать, например, последовательность CDRH1, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 84, SEQ ID NO: 96, SEQ ID NO: 102 и других CDRH1, перечисленных в Таблице 3 или Таблице 5A.

В соответствии с дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы:

LINPX1gNX2gRX3gN (SEQ ID NO: 155),

где X1g может являться, например, нейтральной гидрофильной аминокислотой;

где X2g может являться, например, аланином или глицином и;

где X3g может являться, например, пролином или треонином.

В частности, X1g может являться, например, серином или треонином. В более конкретном примере воплощения X1g может являться, например, треонином.

В более конкретном примере воплощения X2g может являться, например, глицином.

В более конкретном примере воплощения X3g может являться, например, треонином.

В соответствии с еще одним дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы:

X1hIDPETGGTA (SEQ ID NO: 156),

где X1h может являться, например, аланином или треонином.

В соответствии с более конкретным примером воплощения X1h может являться, например, треонином.

В соответствии с еще одним дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы:

EIX1iPX2iX3iSX4iX5iN (SEQ ID NO: 157),

где X1i может являться, например, аспарагиновой кислотой или аспарагином;

где X2i может являться, например, аспарагиновой кислотой или серином;

где X3i может являться, например, аспарагиновой кислотой или серином;

где X4i может являться, например, тирозином или треонином и;

где X5i может являться, например, треонином или изолейцином.

В соответствии с еще одним вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы:

AXa13YPGNGDSR (SEQ ID NO: 200),

где Xa13 может являться любой аминокислотой или гидрофобной аминокислотой, такой как I или V.

В соответствии с дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы: X1tIDPETGGTA (SEQ ID NO: 206), где X1t - как указано в этом документе.

В соответствии с еще одним дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы:LINPX1mNX2mRX3mN (SEQ ID NO: 207), где X1m, X2m и X3m - как указано в этом документе.

В соответствии с дополнительным вариантом воплощения настоящего изобретения, антитело или антиген-связывающий фрагмент могут включать последовательность CDRH2, содержащую или состоящую из последовательности формулы: X1tIDPETGGTA (SEQ ID NO: 209), где X1t - как указано в этом документе.

Антитело или антиген-связывающий фрагмент могут также включать, например, последовательность CDRH2, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 97, SEQ ID NO: 103 и SEQ ID NO: 109 и других CDRH2, перечисленных в Таблице 3 или Таблице 5A.

В соответствии с дополнительным вариантом воплощения антитело или антиген-связывающий фрагмент могут содержать последовательность CDRH3, содержащую или состоящую из последовательности формулы:

TX1jFYYX2jX3jX4jNYDVGFAY (SEQ ID NO: 158),

где X1j может являться, например, нейтральной гидрофильной аминокислотой;

где X2j может являться, например, нейтральной гидрофильной аминокислотой;

где X3j может являться, например, тирозином или гистидином и;

где X4j может являться, например, тирозином или серином.

В частности, X1j может являться, например, серином или треонином. В более конкретном примере воплощения X1j может являться, например, серином.

В частности, X2j может являться, например, серином или треонином. В более конкретном примере воплощения X2j может являться, например, треонином.

В более конкретном примере воплощения X3j может являться, например, тирозином. В более конкретном примере воплощения X4j может являться, например, серином.

В соответствии с дополнительным вариантом воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать последовательность CDRH3, содержащую или состоящую из последовательности формулы: TX1vFYYX2vX3vX4vNYDVGFAY (SEQ ID NO: 210), где X1v, X2v, X3v и X4v - как указано в этом документе.

Антитело или антиген-связывающий фрагмент могут включать, например, последовательность CDRH3, выбранную из последовательностей, содержащих или состоящих из SEQ ID NO: 74, SEQ ID NO: 98, SEQ ID NO: 104, SEQ ID NO: 110, SEQ ID NO: 116 и других CDRH3, перечисленных в Таблице 3 или Таблице 5A.

Каркасная область тяжелых и/или легких цепей, описанных в этом документе, может происходить от одной или нескольких каркасных областей, приведенных в этом документе для иллюстрации. Таким образом, антитело или антиген-связывающий фрагмент могут включать одну или несколько из CDR, описанных в этом документе (например, выбранных из последовательностей специфичных CDR или консенсусных CDR SEQ ID Nos: 148-158 и 197-210), и каркасные области, происходящие из вариабельных областей легких или тяжелых цепей, приведенных в этом документе для иллюстрации.

В одном из вариантов воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут содержать вариабельную область (или фрагмент) тяжелой цепи, имеющую последовательность формулы:

X1kX2kQX3kQQX4kX5kX6kEX7kVX8kPGASVKLSCKASGYTFTX1lYWMHVWKQRPGQGL EWIGLINPX1m NX 2mRX3mNYNEX1nFX2nX3nKATLTVDKSSSTAYMX4nLSSLTSEDSAV YYCARGGDGDYFDYWGQGTTLTVSS (SEQ ID NO: 191),

где X1k может являться, например, Q или E;

X2k может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например V или I;

X3k может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например V или L;

X4k может являться любой аминокислотой или, например, P или S;

X5k может являться любой аминокислотой или, например, R или G;

X6k может являться любой аминокислотой или, например, A или T;

X7k может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например L или I;

X8k может являться любой аминокислотой или основной аминокислотой, такой как, например R или K;

X1l может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например S или T;

X1m может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например T или S.

X2m может являться любой аминокислотой или, например, G или A;

X3m может являться любой аминокислотой или, например, P или T;

X1n может являться любой аминокислотой или основной аминокислотой, такой как, например K или R;

X2n может являться любой аминокислотой или основной аминокислотой, такой как, например N или K;

X3n может являться любой аминокислотой или, например, N или нейтральной гидрофильной аминокислотой, такой как S или T и;

X4n может являться любой аминокислотой или основной аминокислотой, такой как, например Q или H.

В другом варианте воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут включать вариабельную область (или фрагмент) тяжелой цепи, имеющую последовательность формулы:

X1oVX2oLQQSGAELARPGASVKFSCKASGYTFTRNWIQWVKQRPGQGLEWIGAXa13 YPGNGDSRYTQKFKGKATLTADKSSX1qTAYMQLX2qX3qLX4qSEDSAVYYCARLAGN YAYYFDYWGQGTALTVSS (SEQ ID NO: 192),

где Х1o может являться, например, Q или D;

X2o может являться любой аминокислотой или основной аминокислотой, такой как, например K или Q;

Xa13 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например I или V;

X1q может являться любой аминокислотой или, например, S или N;

X2q может являться любой аминокислотой или, например, S или N;

X3q может являться любой аминокислотой или, например, G или S, и;

X4q может являться любой аминокислотой или, например, A или S.

В еще одном варианте воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут включать вариабельную область (или фрагмент) тяжелой цепи, имеющую последовательность формулы:

X1rX2rX3rLQQSGX4rELVRPGASVTLSCKASGYTFTDYX1sMHWVKQTPVHGLEWIGX1tIDPETGGTAYNQKFKGKATLTADX1uSSX2uTAYMELSSLTSEDSAVYYCTX1vFYYX2v X3vX4vNYDVGFAYWGQGTLVTVSA (SEQ ID NO: 193),

где X1r может являться, например, E или Q;

X2r может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, A или I;

X3r может являться любой аминокислотой или, например, Y или Q;

X4r может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, A или V;

X1s может являться любой аминокислотой или кислотной аминокислотой, такой как, например, D или E;

X1t может являться любой аминокислотой или, например, A или T;

X1u может являться любой аминокислотой или основной аминокислотой, такой как, например, K или R;

X2u может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например, S или T;

X1v может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например, S или T;

X2v может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например, T или S;

X3v может являться любой аминокислотой или, например, Y или H, и;

X4v может являться любой аминокислотой или, например, S или Y.

В дополнительном варианте воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут включать вариабельную область (или фрагмент) легкой цепи, имеющую последовательность формулы:

DIVMTX1wAX2wFSNPVX3wLGTX4wASISCRSSX1xSLLHSNGX2xTYLYWYLQKPGQSP QLLIYQMSNLASGVPDRFSX1ySGSGTX2yFTLRISRVEAEDVGVYYCXa8QXb8LEXc8P YTFGXa9GTKLEIK (SEQ ID NO: 194),

где X1w может являться любой аминокислотой или основной аминокислотой, такой как, например Q или H;

X2w может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например V или A;

X3w может являться любой аминокислотой или, например, T или I;

X4w может являться любой аминокислотой или, например, S или P;.

X1x может являться любой аминокислотой или, например, E или K;

X2x может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например V или I;

X1y может являться любой аминокислотой или, например, S или G;.

X2y может являться любой аминокислотой или, например, D или A;

Xa8 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, M или A;

Xb8 может являться любой аминокислотой или основной аминокислотой, такой как, например, N или H;

Xc8 может являться любой аминокислотой или, например, Y или L, и;

Xa9 может являться любой аминокислотой или, например, G или S.

В дополнительном варианте воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут включать вариабельную область (или фрагмент) легкой цепи, имеющую последовательность формулы:

X1zIQMTQSPASLSASVGETVTITCRASX a10 NIX b10 X c10 YLAWYQQKQGKSPQLLVYNAK TLX a11 X b11GVXa3Xb3RFSGSGSGTQXc3SLKINXd3LQPEDFGSYXe3 CQHHYGX a4 PLTFGXa5GTKXb5ELK (SEQ ID NO:195),

где X1z может являться любой аминокислотой или, например, D или N;

Xa10 может являться любой аминокислотой или, например, E или G;.

Xb10 может являться любой аминокислотой или, например, Y или H;

Xc10 может являться любой аминокислотой или, например, S или N;

Xa11 может являться любой аминокислотой или, например, P или A;

Xb11 может являться любой аминокислотой или кислотной аминокислотой, такой как, например, E или D;

Xa3 может являться любой аминокислотой или, например, P или S;

Xb3 может являться любой аминокислотой или, например, V или S;

Xc3 может являться любой аминокислотой или ароматической аминокислотой, такой как, например F или Y;

Xd3 может являться любой аминокислотой или, например, N или S;

Xe3 может являться любой аминокислотой или, например, H или Y;

Xa4 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, A или V;

Xa5 может являться любой аминокислотой или, например, S или A, и;

Xb5 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например, V или L.

В еще одном дополнительном варианте воплощения изобретения антитело или антиген-связывающий фрагмент по настоящему изобретению могут включать вариабельную область (или фрагмент) легкой цепи, имеющую последовательность формулы:

DIVMTQAAPSVPVTPGESVSISCRSXa6KSLLHSNGNTYLYWFLQRPGQSPQLLIYR MSNLASGVPDRFSGSGSGTAFTLRXa7SRVEAEDVGVYYCMQHLEYPFTFGGGTKLEIK (SEQ ID NO: 196),

где Xa6 может являться любой аминокислотой или нейтральной гидрофильной аминокислотой, такой как, например, S или T, и;

Xa7 может являться любой аминокислотой или гидрофобной аминокислотой, такой как, например I или L.

Антитела, связывающиеся с сиглеком-15

В некоторых воплощениях настоящего изобретения антитела, которые связываются с сиглеком-15, принадлежат к подтипу IgG1, IgG2, IgG3 или IgG4. В предпочтительном варианте воплощения антитело является антителом подтипа IgG2. В настоящем воплощении антитело является гуманизированным антителом подтипа IgG2, которое обладает биологической активностью в блокировании биологической активности, необходимой для нормальной функции сиглека-15 на поверхности остеокластов. Такая блокировка может, например, предотвращать ассоциацию сиглека-15 с его субстратами, его лигандами, с самим сиглеком-15 или другими белками на соседних клетках.

Настоящее изобретение раскрывает набор антител, которые связываются с сиглеком-15. В некоторых воплощениях антитела состоят из моноклональных антител и их иммунологически функциональных фрагментов, таких как химерные и гуманизированные моноклональные антитела, фрагменты антител, одноцепочечные антитела, доменные антитела и полипептиды с антиген-связывающей областью.

Типичный антиген-связывающий сайт включает вариабельные области, образованные при спаривании легкой цепи иммуноглобулина и тяжелой цепи иммуноглобулина. Структура вариабельных областей антитела очень стабильна и очень схожа у разных представителей вариабельных областей. Эти вариабельные области в типичном случае включают относительно гомологичные каркасные области (FR), между которыми расположены три гипервариабельные области, называемые областями, определяющими комплементарность (CDR). Хотя общая связывающая активность антиген-связывающего фрагмента обусловлена последовательностью областей CDR, FR играют критическую роль в правильном позиционировании и выравнивании в трехмерном пространстве областей CDR для оптимального связывания антигена.

В Таблице 1 раскрыты последовательности нуклеотидов и аминокислот, соответствующие полным легким и тяжелым цепям иммуноглобулинов, представляющих собой конкретные примеры антител против сиглека-15.

Таблица 1.
Полные последовательности легких и тяжелых цепей иммуноглобулинов, которые связываются с сиглеком-15
Обозначение антитела Тип цепи Нуклеотидная последовательность Аминокислотная последовательность
(SEQ ID NO:) (SEQ ID NO:)
25A1 Легкая (L) 5 6
25A1 Тяжелая (H) 7 8
25B4 Легкая 9 10
25B4 Тяжелая 11 12
25B8 Легкая 13 14
25B8 Тяжелая 15 16
25C1 Легкая 17 18
25C1 Тяжелая 19 20
25D8 Легкая 21 22
25D8 Тяжелая 23 24
25E5 Легкая 25 26
25E5 Тяжелая 27 28
25E6 Легкая 29 30
25E6 Тяжелая 31 32
25E9 Легкая 33 34
25E9 Тяжелая 35 36

Антитело, которое может связываться с сиглеком-15, может включать любую одну L цепь и любую одну H цепь иммуноглобулинов, перечисленную в таблице 1. В некоторых воплощениях легкая цепь антитела 25A1 может быть скомбинирована с тяжелой цепью 25A1 или тяжелой цепью 25B4 с образованием полного антитела, обладающего активностью связывания с сиглеком-15. В примерах воплощения настоящего изобретения 25A1 L цепь может быть скомбинирована с 25A1 H цепью, 25B4 L цепь может быть скомбинирована с 25B4 H цепью, 25B8 L цепь может быть скомбинирована с 25B8 H цепью, 25C1 L цепь может быть скомбинирована с 25C1 H цепью, 2D8 L цепь может быть скомбинирована с 25D8 H цепью, 25E5 L цепь может быть скомбинирована с 25E5 H цепью, 25E6 L цепь может быть скомбинирована с 25E6 H цепью или 25E9 L цепь может быть скомбинирована с 25E9 H цепью. Дополнительно, некоторые примеры антител или антиген-связывающего фрагмента могут состоять из любой комбинации двух L цепей и любых двух H цепей из списка антител, перечисленных в таблице 1.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25A1 показаны в SEQ ID NO: 5 и 7, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25A1 показаны в SEQ ID NO: 6 и 8, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 6, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 8. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25A1, содержащие SEQ ID NO: 6, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25A1, содержащие SEQ ID NO: 8, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25B4 показаны в SEQ ID NO: 9 и 11, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25B4 показаны в SEQ ID NO: 10 и 12, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 10, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 12. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25B4, содержащие SEQ ID NO: 10, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25B4, содержащие SEQ ID NO: 12, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25B8 показаны в SEQ ID NO:3 и 15, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25B8 показаны в SEQ ID NO:14 и 16, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 14, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 16. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25B8, содержащие SEQ ID NO: 14, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25B8, содержащие SEQ ID NO: 16, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25C1 показаны в SEQ ID NO: 17 и 19, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25C1 показаны в SEQ ID NO: 18 и 20, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 18, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 20. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25C1, содержащие SEQ ID NO: 18, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25C1, содержащие SEQ ID NO: 20, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25D8 показаны в SEQ ID NO: 21 и 23, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25D8 показаны в SEQ ID NO: 22 и 24, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 22, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 24. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25D8, содержащие SEQ ID NO: 22, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25D8, содержащие SEQ ID NO: 24, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E5 показаны в SEQ ID NO: 25 и 27, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E5 показаны в SEQ ID NO: 26 и 28, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 26, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 28. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25E5, содержащие SEQ ID NO: 26, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25E5, содержащие SEQ ID NO: 28, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E6 показаны в SEQ ID NO: 29 и 31, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E6 показаны в SEQ ID NO: 30 и 32, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 30, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 32. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25E6, содержащие SEQ ID NO: 30, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25E6, содержащие SEQ ID NO: 32, или их вариант.

Полные нуклеотидные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E9 показаны в SEQ ID NO: 33 и 35, соответственно, и соответствующие аминокислотные последовательности легких и тяжелых цепей иммуноглобулинов антитела 25E9 показаны в SEQ ID NO: 34 и 36, соответственно. Таким образом, в примере воплощения антитело, которое связывается с сиглеком-15, может включать аминокислотную последовательность легкой цепи, показанную в SEQ ID NO: 34, в комбинации с аминокислотной последовательностью тяжелой цепи, показанной в SEQ ID NO: 36. В другом варианте воплощения антитело может включать две идентичные или в существенной степени идентичные легкие цепи из 25E9, содержащие SEQ ID NO: 34, или их вариант, и две идентичные или в существенной степени идентичные тяжелые цепи из 25E9, содержащие SEQ ID NO: 36, или их вариант.

Также сюда относятся варианты других антител или антиген-связывающих фрагментов против сиглека-15, образованных комбинацией легких и/или тяжелых цепей иммуноглобулинов, которые могут, каждый независимо, иметь, по меньшей мере, 80%, 85%, 90%, 95%, 97% или 99% идентичности к аминокислотным последовательностям, перечисленным в Таблице 1. В некоторых воплощениях варианты антител могут включать, по меньшей мере, одну легкую цепь и одну тяжелую цепь. В других примерах варианты антител могут включать две идентичные или в существенной степени идентичные легкие цепи и две идентичные или в существенной степени идентичные тяжелые цепи. В соответствии с настоящим изобретением, область вариаций может быть расположена в консервативной области или в вариабельной области. Также в соответствии с настоящим изобретением, область вариаций может быть расположена в каркасной области.

Настоящее изобретение также включает антитела, содержащие легкую цепь, включающую одну из вариабельных областей легкой цепи с последовательностью, приведенной в Таблице 1, или ее вариантом, и тяжелую цепь, включающую одну из вариабельных областей тяжелой цепи с последовательностью, приведенной в Таблице 1, или ее вариантом. Легкая цепь и тяжелая цепь могут включать консервативный домен. Комбинации легких цепей и тяжелых цепей из Таблицы 1 также включены в настоящее изобретение.

Антитела или антиген-связывающие фрагменты, которые содержат вариабельные области легкой цепи и тяжелой цепи, также включены в настоящее изобретение. Дополнительно, некоторые воплощения включают антиген-связывающие фрагменты, варианты и производные этих вариабельных областей легких и тяжелых цепей.

Другие примеры воплощений изобретения включают изолированное антитело или антиген-связывающий фрагмент, способные специфично связываться с SEQ ID NO: 2 или с ее вариантом, антитело, содержащее:

a. вариабельный домен легкой цепи, заданный в SEQ ID NO: 38, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 40;

б. вариабельный домен легкой цепи, заданный в SEQ ID NO: 42, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 44;

в. вариабельный домен легкой цепи, заданный в SEQ ID NO: 46, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 48;

г. вариабельный домен легкой цепи, заданный в SEQ ID NO: 50, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 52;

д. вариабельный домен легкой цепи, заданный в SEQ ID NO: 54, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 56;

е. вариабельный домен легкой цепи, заданный в SEQ ID NO: 58, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 60;

ж. вариабельный домен легкой цепи, заданный в SEQ ID NO: 62, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 64;

з. вариабельный домен легкой цепи, заданный в SEQ ID NO: 66, и вариабельный домен тяжелой цепи, заданный в SEQ ID NO: 68.

Также в этом документе подразумевается, что вариабельная область легкой цепи из специфичной комбинации, приведенной выше, может быть заменена на любую другую вариабельную область легкой цепи (в частности, таковую, указанную в Таблице 2). Схожим образом, вариабельная область тяжелой цепи из специфичной комбинации, приведенной выше, может быть заменена на любую другую вариабельную область тяжелой цепи (в частности, таковую, указанную в Таблице 2).

Антитела, которые содержат вариабельные области легкой цепи и тяжелой цепи, также включены в настоящее изобретение. Дополнительно, некоторые воплощения включают антиген-связывающие фрагменты, варианты и производные этих вариабельных областей легких и тяжелых цепей. Примеры последовательностей, присутствующих в этих вариабельных областях легких и тяжелых цепей, раскрыты в таблице 2.

Таблица 2.
Последовательности вариабельных областей легких и тяжелых цепей, которые связываются с сиглек-15
Обозначение антитела Тип цепи Нуклеотидная последовательность (SEQ ID NO:) Аминокислотная последовательность (SEQ ID NO:)
25A1 Легкая (L) 37 38
25A1 Тяжелая (H) 39 40
25B4 Легкая 41 42
25B4 Тяжелая 43 44
25B8 Легкая 45 46
25B8 Тяжелая 47 48
25C1 Легкая 49 50
25C1 Тяжелая 51 52
25D8 Легкая 53 54
25D8 Тяжелая 55 56
25E5 Легкая 57 58
25E5 Тяжелая 59 60
25E6 Легкая 61 62
25E6 Тяжелая 63 64
25E9 Легкая 65 66
25E9 Тяжелая 67 68
25B02 Легкая 161 162
25B02 Тяжелая 163 164
25D11 Легкая 165 166
25D11 Тяжелая 167 168
25E10 Легкая 169 170
25E10 Тяжелая 171 172

Следовательно, антитела и антиген-связывающие фрагменты, которые связываются с сиглеком-15, могут включать одну вариабельную область легкой цепи и одну вариабельную область тяжелой цепи так же, как у обозначенного антитела или в любых комбинациях. Например, в примере воплощения антитело или антиген-связывающий фрагмент против сиглека-15 могут включать вариабельную область легкой цепи из 25A1 (SEQ ID NO: 38) и вариабельную область тяжелой цепи из 25A1 (SEQ ID NO: 40). В соответствии с другим вариантом воплощения антитело или антиген-связывающий фрагмент против сиглека-15 могут включать вариабельную область легкой цепи из 25A1 (SEQ ID NO: 38) и вариабельную область тяжелой цепи из 25B4 (SEQ ID NO: 44). В другом варианте воплощения антитела против сиглека-15 могут включать две идентичные или в существенной степени идентичные вариабельные области легкой цепи и две идентичные или в существенной степени идентичные области тяжелой цепи. В другом варианте воплощения антитела против сиглека-15 могут включать две различные вариабельные области легкой цепи и две различные области тяжелой цепи.

Также сюда относятся варианты других антител против сиглека-15, образованные комбинацией вариабельных областей легких и/или тяжелых цепей, каждая из которых может иметь, по меньшей мере, 70%, 75%, 80%, 85%, 90%, 95%, 97% или 99% идентичности с аминокислотным последовательностям, перечисленным в Таблице 2, таблицах 5A и 5B. Специалисту в данной области также будет понятно, что варианты антител против сиглека-15 могут включать консервативные аминокислотные изменения, аминокислотные замены, делеции или вставки в составе аминокислотных последовательностей вариабельных областей легких и/или тяжелых цепей, перечисленных в Таблице 2.

Таблица 3.
Последовательности CDR легких и тяжелых цепей
Обозначение антитела Тип цепи CDR SEQ ID NO: Аминокислотная последовательность
25A1 Легкая (L) CDR1 69 SASSSVSYMY
25A1 Легкая CDR2 70 RTSNLAS
25A1 Легкая CDR3 71 QQWSSNPLT
25A1 Тяжелая (H) CDR1 72 GYTFTRYWMD
25A1 Тяжелая CDR2 73 EIDPSDSYTN
25A1 Тяжелая CDR3 74 ARSGAYSSDYSYDGFAY
25B4 Легкая CDR1 75 RSSKSLLHSNGITYLY
25B4 Легкая CDR2 76 QMSNLAS
25B4 Легкая CDR3 77 MQHLEYPYT
25B4 Тяжелая CDR1 78 GYTFTSYWMH
25B4 Тяжелая CDR2 79 LINPTNGRTN
25B4 Тяжелая CDR3 80 ARGGDGDYFDY
25B8 Легкая CDR1 81 RSTKSLLHSNGNTYLY
25B8 Легкая CDR2 82 RMSNLAS
25B8 Легкая CDR3 83 MQHLEYPFT
25B8 Тяжелая CDR1 84 GYTFTDYDMH
25B8 Тяжелая CDR2 85 TIDPETGGTA
25B8 Тяжелая CDR3 86 TTFYYSHYNYDVGFAY
25C1 Легкая CDR1 87 RSSKSLLHSNGNTYLY
25C1 Легкая CDR2 88 RMSNLAS
25C1 Легкая CDR3 89 MQHLEYPFT
25C1 Тяжелая CDR1 90 GYTFTDYEMH
25C1 Тяжелая CDR2 91 AIDPETGGTA
25C1 Тяжелая CDR3 92 TSFYYTYYNYDVGFAY
25D8 Легкая CDR1 93 RSSKSLLHSNGITYLY
25D8 Легкая CDR2 94 QMSNLAS
25D8 Легкая CDR3 95 AQNLELPYT
25D8 Тяжелая CDR1 96 GYTFTSYWMH
25D8 Тяжелая CDR2 97 LINPSNARTN
25D8 Тяжелая CDR3 98 ARGGDGDYFDY
25E5 Легкая CDR1 99 SASSSVSYMY
25E5 Легкая CDR2 100 RTSNLVS
25E5 Легкая CDR3 101 QQWSSNPPT
25E5 Тяжелая CDR1 102 GFDFSKDWMS
25E5 Тяжелая CDR2 103 EINPDSSTIN
25E5 Тяжелая CDR3 104 SRLEDYEDWYFDV
25E6 Легкая CDR1 105 KASQSVSNAVA
25E6 Легкая CDR2 106 YTSNRYT
25E6 Легкая CDR3 107 QQDYTSPWT
25E6 Тяжелая CDR1 108 GYTFNTYNMY
25E6 Тяжелая CDR2 109 GIDPSNGDTK
25E6 Тяжелая CDR3 110 TSHTY
25E9 Легкая CDR1 111 RSTKSLLHSNGNTYLY
25E9 Легкая CDR2 112 RMSNLAS
25E9 Легкая CDR3 113 MQHLEYPFT
25E9 Тяжелая CDR1 114 GYTFTDYDMH
25E9 Тяжелая CDR2 115 TIDPETGGTA
25E9 Тяжелая CDR3 116 TSFYYTYSNYDVGFAY
25B02 Легкая CDR1 173 RASENIYSYLA
25B02 Легкая CDR2 174 NAKTLPE
25B02 Легкая CDR3 175 HHYGVPLT
25B02 Тяжелая CDR1 176 GYTFTRNWIQ
25B02 Тяжелая CDR2 177 AIYPGNGDSR
25B02 Тяжелая CDR3 178 ARLAGNYAYYFDY
25D11 Легкая CDR1 179 RASGNIHNYLA
25D11 Легкая CDR2 180 NAKTLPE
25D11 Легкая CDR3 181 QHHYGVPLT
25D11 Тяжелая CDR1 182 GYTFTRNWIQ
25D11 Тяжелая CDR2 183 AIYPGNGDSR
25D11 Тяжелая CDR3 184 ARLAGNYAYYFDY
25E10 Легкая CDR1 185 RASGNIHNYLA
25E10 Легкая CDR2 186 NAKTLAD
25E10 Легкая CDR3 187 QHHYGAPLT
25E10 Тяжелая CDR1 188 GYTFTRNWIQ
25E10 Тяжелая CDR2 189 AVYPGNGDSR
25E10 Тяжелая CDR3 190 ARLAGNYAYYFDY

В некоторых вариантах воплощения настоящего изобретения антитела или антиген-связывающие фрагменты против сиглека-15 могут включать последовательности CDR, представленные в Таблице 3, или иметь существенную степень идентичности последовательности относительно последовательностей CDR из Таблицы 3. В одном из примеров воплощения антитело против сиглека-15 25A1 может включать вариабельную область легкой цепи, включающую CDR1, 2 и 3, которые кодируются SEQ ID NO: 68, 69 и 70, соответственно, и/или вариабельную область тяжелой цепи, включающую CDR1, 2 и 3, которые кодируются SEQ ID NO: 71, 72 и 73, соответственно. В других вариантах воплощения присутствия области CDR3 может быть достаточно для обеспечения связывания антигена. По существу, полипептиды, содержащие CDRL3 или CDRH3, или одновременно и CDRL3, и CDRH3, включены в настоящее изобретение.

Дополнительно, антитела или антиген-связывающие фрагменты против сиглека-15 могут включать любую комбинацию областей CDR, перечисленных в Таблице 3. Например, антитела или антиген-связывающие фрагменты могут включать CDR3 легкой цепи и CDR3 тяжелой цепи. При этом понимается, что области CDR, которые содержатся в антителах или антиген-связывающих фрагментах против сиглека-15, могут являться вариантами областей CDR с 80%, 85%, 90% или 95% идентичности последовательности относительно последовательностей CDR, представленных в Таблице 3. Специалисту в данной области также будет понятно, что варианты могут включать консервативные аминокислотные изменения, аминокислотные замены, делеции или вставки в составе последовательностей CDR, перечисленных в Таблице 3.

Другие примеры воплощения настоящего изобретения включают изолированное антитело или антиген-связывающий фрагмент, способный специфично связываться с SEQ ID NO: 2 или с ее вариантом (при этом вариант обладает, по меньшей мере, 80% идентичности относительно аминокислот в положениях с 20 по 259 или относительно аминокислот в положениях 49-165 в составе SEQ ID NO: 2), антитело, содержащее:

a. 3 области CDR вариабельного домена легкой цепи, перечисленные в Таблице 5B, и 3 области CDR вариабельного домена тяжелой цепи, перечисленные в Таблице 5A;

б. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 194, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 191;

в. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 195, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 192;

г. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 196, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 193;

д. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 38, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 40;

е. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 42, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 44;

ж. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 46, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 48;

з. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 50, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 52;

и. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 54, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 56;

к. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 58, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 60;

л. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 62, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 64;

м. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 66, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 68;

н. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 162, и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 164;

о. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 166 и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 168, или

п. 3 области CDR вариабельного домена легкой цепи, заданного в SEQ ID NO: 170 и 3 области CDR вариабельного домена тяжелой цепи, заданного в SEQ ID NO: 172.

Дополнительной особенностью настоящего изобретения является то, что оно относится к изолированному антителу или антиген-связывающему фрагменту, способному специфично связываться с сиглеком-15 или с его вариантом (при этом вариант обладает, по меньшей мере, 80% идентичности относительно аминокислот в положениях с 20 по 259 или относительно аминокислот в положениях 49-165 в составе SEQ ID NO: 2), антителу, содержащему:

a) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичности последовательности относительно последовательности, приведенной в Таблице 5B, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно последовательности, приведенной в Таблице 5A;

б) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 194, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 191;

в) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 195, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 192;

г) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 196, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 193;

д) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 38, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 40;

е) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO:42, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 44;

ж) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 46, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 48;

з) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 50, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 52;

и) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 54, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 56;

к) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 58, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 60;

л) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 62, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 64;

м) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 66, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 68;

н) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 162, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 164;

о) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 166, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 168, и

п) вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 170, и вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (75%, 80%, 85%, 90%, 95%, 100%) идентичностью последовательности относительно SEQ ID NO: 172.

И снова, вариабельная область легкой цепи из специфичной комбинации, приведенной выше, может быть заменена на любую другую вариабельную область легкой цепи, описанную в этом документе. Схожим образом, вариабельная область тяжелой цепи из специфичной комбинации, приведенной выше, может быть заменена на любую другую вариабельную область тяжелой цепи, описанную в этом документе.

Вариант антител и антиген-связывающих фрагментов

Настоящее изобретение также включает варианты антител или антиген-связывающих фрагментов, описанных в этом документе. Включенные варианты антител или антиген-связывающих фрагментов - это варианты, имеющие вариации в аминокислотной последовательности. Например, включенные варианты антител или антиген-связывающих фрагментов - это таковые, имеющие, по меньшей мере, одну вариантную область CDR (две, три, четыре, пять, шесть и вплоть до двенадцати вариантных областей CDR), вариантный вариабельный домен легкой цепи, вариантный вариабельный домен тяжелой цепи, вариантную легкую цепь и/или вариантную тяжелую цепь. Варианты антител или антиген-связывающих фрагментов, включенные в настоящее изобретение, - это варианты, обладающие, например, схожей или улучшенной аффинностью связывания, по сравнению с исходным антителом или антиген-связывающим фрагментом.

При использовании в этом документе термин «вариант» относится к любой последовательности, описанной в этом документе, и включает, например, вариант CDR (любой из CDRL1, CDRL2, CDRL3, CDRH1, CDRH2 и/или CDRH3), вариант вариабельного домена легкой цепи, вариант вариабельного домена тяжелой цепи, вариант легкой цепи, вариант тяжелой цепи, вариант антитела, вариант антиген-связывающего фрагмента и вариант последовательности SEQ ID NO: 2.

Варианты антител или антиген-связывающих фрагментов, включенные в настоящее изобретение, - это варианты, которые могут включать вставку, делецию или аминокислотную замену (консервативную или не консервативную). Эти варианты могут включать, по меньшей мере, один аминокислотный остаток в своей аминокислотной последовательности, который был удален и на его место был вставлен другой остаток.

Сайты, представляющие наибольший интерес для мутагенеза с заменами, включают гипервариабельные области (CDR), но также предполагаются модификации в каркасной области или даже в консервативной области. Консервативные замены могут быть произведены путем обмена аминокислоты (в CDR вариабельной цепи, антителе и т.д.) из одной из групп, перечисленных ниже (группы с 1 по 6) на другую аминокислоту из той же группы.

В общем случае, мутации в областях CDR могут оказывать более существенное влияние на антиген-связывающую активность антитела или антиген-связывающего фрагмента, чем мутации в каркасной области. Варианты антител или антиген-связывающих фрагментов, включенные в настоящее изобретение, - это варианты, которые обладают в существенной степени идентичной антиген-связывающей способностью (включая схожую, идентичную или немного пониженную) относительно таковой, представленной в этом документе, или обладают лучшей антиген-связывающей способностью, чем таковая, представленная в этом документе.

Другие примеры воплощений консервативных замен показаны в Таблице 1A в колонке «Предпочтительные замены». Если такие замены приводят к появлению нежелательного свойства, то могут быть внесены более существенные изменения, названные «Примеры замен» в таблице 1A, или, как дополнительно описано ниже, со ссылкой на классы аминокислот, и продукты подвергнуты скринингу.

Специалистам в данной области известно, что варианты могут быть получены с применением мутагенеза с заменами, и они сохраняют биологическую активность полипептидов по настоящему изобретению. Эти варианты содержат, по меньшей мере, один аминокислотный остаток в аминокислотной последовательности, который был удален и на его место был вставлен другой остаток. Например, один сайт, представляющий интерес для мутагенеза с заменами, может включать сайт, в котором конкретные остатки, полученные из разных биологических видов, являются идентичными. Примеры замен, обозначенных как «консервативные замены», приведены в Таблице 1A. Если такие замены приводят к нежелательному изменению, то могут быть внесены замены другого типа, названные «Примеры замен» в Таблице 1A, или, как дополнительно описано в этом документе, со ссылкой на классы аминокислот, и продукты подвергнуты скринингу.

Существенные модификации функции или иммунологической идентичности достигают путем выбора замен, которые в существенной степени отличаются по своему влиянию на сохранение (a) структуры полипептидного остова в области замены, например, такой как конформация бета-слоя или спирали, (b) заряда или гидрофобности молекулы в целевом сайте или (c) объема боковой цепи. Встречающиеся в природе остатки разделяют на группы на основании общих свойств боковых цепей:

(группа 1) гидрофобные: норлейцин, метионин (Met), аланин (Ala), валин (Val), лейцин (Leu), изолейцин (Ile)

(группа 2) нейтральные гидрофильные: цистеин (Cys), серин (Ser), треонин (Thr)

(группа 3) кислотные: аспарагиновая кислота (Asp), глутаминовая кислота (Glu)

(группа 4) основные: аспарагин (Asn), глутамин (Gln), гистидин (His), лизин (Lys), аргинин (Arg)

(группа 5) остатки, которые влияют на ориентацию цепи: глицин (Gly), пролин (Pro); и

(группа 6) ароматические: триптофан (Trp), тирозин (Tyr), фенилаланин (Phe) Неконсервативные замены повлекут за собой обмен члена одного из этих классов на члена другого класса.

Таблица 1A.
Аминокислотная замена
Исходный остаток Примеры замен Консервативная замена
Ala (A) Val, Leu, Ile Val
Arg (R) Lys, Gln, Asn Lys
Asn (N) Gln, His, Lys, Arg, Asp Gln
Asp (D) Glu, Asn Glu
Cys (C) Ser, Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp, Gln Asp
Gly (G) Ala Ala
His (H) Asn, Gln, Lys, Arg, Arg
Ile (I) Leu, Val, Met, Ala, Phe, норлейцин Leu
Leu (L) Норлейцин, Ile, Val, Met, Ala, Phe Ile
Lys (K) Lys, Gln, Asn Arg
Met (M) Leu, Phe, Ile Leu
Phe (F) Leu, Val, Ile, Ala, Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Ser Ser
Trp (W) Tyr, Phe Tyr
Tyr (Y) Trp, Phe, Thr, Ser Phe
Val (V) Ile, Leu, Met, Phe, Ala, норлейцин Leu

Вариация в аминокислотной последовательности варианта антитела или антиген-связывающего фрагмента может включать добавление, делецию, инсерцию, замену аминокислот и т.д., одну или несколько модификаций остова или боковых цепей одной или нескольких аминокислот, или добавление группы или другой молекулы к одной или нескольким аминокислотам (к боковым цепочкам или к остову).

Вариант антитела или антиген-связывающего фрагмента может обладать существенным сходством последовательности и/или идентичностью последовательности его аминокислотной последовательности, по сравнению с таковой аминокислотной последовательностью исходного антитела или антиген-связывающего фрагмента. Степень сходства между двумя последовательностями основана на процентной доле идентичности (идентичных аминокислот) и консервативных замен.

В общем случае, степень сходства и идентичности между различными цепями определены в этом документе с применением программы Blast2 sequence (Tatiana A. Tatusova, Thomas L. Madden (1999), "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett. 174:247-250) с установками по умолчанию, т.е. программой blastp, матрицы BLOSUM62 (штраф за внесение пропуска 11 и за удлинение пропуска 1; снижение gapx 50, ожидание 10,0, размер «слова» 3) и с активированными фильтрами.

Следовательно, процент идентичности будет показателем аминокислот, которые идентичны, при сравнении с исходным пептидом, и которые могут занимать такое же или схожее положение.

Процент сходства будет показателем аминокислот, которые идентичны и которые заменены в результате консервативной аминокислотной замены, при сравнении с таким же или схожим положением исходного пептида.

Варианты (т.е. аналоги) настоящего изобретения (включая варианты VL, варианты VH, варианты CDR, варианты антител, варианты полипептидов и т.д.), следовательно, включают таковые, которые могут обладать, по меньшей мере, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентичностью последовательности относительно исходной последовательности или части исходной последовательности.

В соответствии с настоящим изобретением вариант SEQ ID NO:2 включает полипептид, содержащий область с, по меньшей мере, 80% идентичностью относительно аминокислот 49-165 или аминокислот с 20 по 259 в составе SEQ ID NO: 2. Варианты SEQ ID NO:2 также включают полипептиды, обладающие, по меньшей мере, 80% идентичностью последовательности относительно SEQ ID NO: 2.

Примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 81% идентичностью последовательности относительно последовательности, описанной в этом документе, и 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Другими примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 82% идентичностью последовательности относительно последовательности, описанной в этом документе, и 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Дополнительными примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 85% идентичностью последовательности относительно последовательности, описанной в этом документе, и 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Другими примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 90% идентичностью последовательности относительно последовательности, описанной в этом документе, и 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Дополнительными примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 95% идентичностью последовательности относительно последовательности, описанной в этом документе, и 95%, 96%, 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Также дополнительными примерами воплощения вариантов служат таковые, обладающие, по меньшей мере, 97% идентичностью последовательности относительно последовательности, описанной в этом документе, и 97%, 98%, 99% или 100% сходством последовательности относительно исходной последовательности или части исходной последовательности.

Для краткости заявитель приводит в этом документе Таблицу 1B, иллюстрирующую примеры воплощений отдельных вариантов, включенных в настоящее изобретение и обладающих заданным % идентичности последовательности и % сходства последовательности. Каждый значок «X» следует толковать как указывающий на данный вариант.

Таблица 1B Процент (%) идентичности последовательности
Процент (%) сходства последовтельности 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100
80 X
81 X X
82 X X X
83 X X X X
84 X X X X X
85 X X X X X X
86 X X X X X X X
87 X X X X X X X X
88 X X X X X X X X X
89 X X X X X X X X X X
90 X X X X X X X X X X X
91 X X X X X X X X X X X X
92 X X X X X X X X X X X X X
93 X X X X X X X X X X X X X X
94 X X X X X X X X X X X X X X X
95 X X X X X X X X X X X X X X X X
96 X X X X X X X X X X X X X X X X X
97 X X X X X X X X X X X X X X X X X X
98 X X X X X X X X X X X X X X X X X X X
99 X X X X X X X X X X X X X X X X X X X X
100 X X X X X X X X X X X X X X X X X X X X X

При использовании в этом документе термин «идентичный» означает, что последовательность обладает 100% идентичностью последовательности с другой последовательностью.

При использовании в этом документе термин «в существенной степени идентичный» означает, что последовательность обладает 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичностью последовательности с другой последовательностью или с частью другой последовательности.

Настоящее изобретение включает области CDR, вариабельные домены легких цепей, вариабельные домены тяжелых цепей, легкие цепи, тяжелые цепи, антитела и/или антиген-связывающие фрагменты, которые обладают, по меньшей мере, 80% идентичностью с последовательностью, описанной в этом документе.

Примерами воплощений антитела или антиген-связывающего фрагмента по настоящему изобретению являются таковые, содержащие вариабельный домен легкой цепи, включающий последовательность, выбранную из группы, состоящей из последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO:38, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO:42, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 46, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 50, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO:54, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 58, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 62, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе, по меньшей мере, 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 66, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе, по меньшей мере, 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 162, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе, по меньшей мере, 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 166 и последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе, по меньшей мере, 80%, 85%, 90%, 95% и 100% идентичностью) относительно SEQ ID NO: 170.

Эти вариабельные домены легких цепей могут включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 69, последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO: 70, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 71.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 69.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 69.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 70.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO: 70.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 71.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO: 71.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 75, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:76, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 77.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 75.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 75.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 76.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO: 76.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 77.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO: 77.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 81, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:82, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 83.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 81.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO:81.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 82.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO: 82.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:83.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO:83.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 87, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:88, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 89.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:87.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO:87.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 88.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO: 88.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 89.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO: 89.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO:93, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO: 94, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 95.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 93.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 93.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 94.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:94.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 95.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO:95.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 99, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO: 100, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO:101.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:99.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO:99.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:100.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:100.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:101.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO: 101.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO:105, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:106, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 107.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:105.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO:105.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:106.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:106.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:107.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть на 100% идентична последовательности SEQ ID NO:107.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO:111, и последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:112, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO:113.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:111.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 111.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:112.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO: 112.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 113.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 100% идентична последовательности SEQ ID NO:113.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO: 173, последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:174 и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO:175.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:173.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 173.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 174

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:174.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:175.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 100% идентична последовательности SEQ ID NO:175.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO:179, последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:180, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO: 181.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:179.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO:179.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:180.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:180.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:181.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 100% идентична последовательности SEQ ID NO: 181.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRL1, по меньшей мере, на 80% идентичную SEQ ID NO:185, последовательность CDRL2, по меньшей мере, на 80% идентичную SEQ ID NO:186, и последовательность CDRL3, по меньшей мере, на 80% идентичную SEQ ID NO:187.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:185.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL1, которая может быть на 100% идентична последовательности SEQ ID NO: 185.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:186.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL2, которая может быть на 100% идентична последовательности SEQ ID NO:186.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:187.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRL3, которая может быть, по меньшей мере, на 100% идентична последовательности SEQ ID NO:187. В примерах воплощения настоящего изобретения антитело или антиген-связывающий фрагмент могут включать вариабельный домен тяжелой цепи, включающий последовательность, выбранную из группы, состоящей из последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:40, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80% идентичностью) относительно SEQ ID NO:44, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%,85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:48, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:52, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%,85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:56, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:60, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:64, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:68, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:164, последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:168 и последовательности, обладающей, по меньшей мере, 70% идентичностью (в том числе 80%, 85%, 90%, 95%, 100% идентичностью) относительно SEQ ID NO:172.

Эти вариабельные домены тяжелых цепей могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:72, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:73, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:74.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:72.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:72.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:73.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:73.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:74.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO: 74.

Вариабельный домен тяжелой цепи, приведенный выше, может включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:78, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:79 и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:80.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:78.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO: 78.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:79.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:79.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:80.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:80.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:84, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:85, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:86.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:84.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:84.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:85.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:85.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 86.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:86.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:90, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:91, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:92.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:90.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:90.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:91.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:91.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:92.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:92.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:96, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:97, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:98.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:96.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO: 96.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:97.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:97.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:98.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может содержать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:98.

Вариабельный домен легкой цепи, приведенный выше, может включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO: 102, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:103, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:104.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:102.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO: 102.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:103.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO: 103.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:104.

В еще одном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO: 104.

Эти вариабельные домены тяжелых цепей могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:108, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:109 и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:110. В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:108.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO: 108.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 109.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:109.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 110.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:110.

Эти вариабельные домены тяжелых цепей могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:114, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO: 115 и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:116.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:114.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:114.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:115.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:115.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:116.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:116.

Эти вариабельные домены тяжелых цепей могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:176, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:177 и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:178.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:176.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:176.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:177.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO: 177.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:178.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:178.

Эти вариабельные домены тяжелой цепи могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:182, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:183, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:184.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 182.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:182.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:183.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO:183.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO:184.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:184.

Эти вариабельные домены тяжелой цепи могут включать последовательность CDRH1, по меньшей мере, на 80% идентичную SEQ ID NO:188, последовательность CDRH2, по меньшей мере, на 80% идентичную SEQ ID NO:189, и последовательность CDRH3, по меньшей мере, на 80% идентичную SEQ ID NO:190.

В примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть по меньшей мере на 90% идентична последовательности SEQ ID NO:188.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH1, которая может быть на 100% идентична последовательности SEQ ID NO:188.

В другом примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть по меньшей мере на 90% идентична последовательности SEQ ID NO:189.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH2, которая может быть на 100% идентична последовательности SEQ ID NO: 189.

В еще одном дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть, по меньшей мере, на 90% идентична последовательности SEQ ID NO: 190.

В дополнительном примере воплощения настоящего изобретения любое из антител, представленных в этом документе, может включать последовательность CDRH3, которая может быть на 100% идентична последовательности SEQ ID NO:190.

Продукция антител в клетках

Антитела, описанные в этом документе, могут быть получены с применением различных методов, известных специалисту в данной области, таких как гибридомная методология, или методами рекомбинантных ДНК.

В примере воплощения изобретения антитела могут быть продуцированы с помощью стандартной гибридомной технологии, при которой мышь иммунизируют антигеном, клетки селезенки изолируют и сливают с клетками миеломы, в которых отсутствует экспрессия ГГФТ, и гибридные клетки отбирают с помощью среды, содержащей гипоксантин, аминоптерин и тимин (HAT).

В дополнительном примере воплощения изобретения антитела могут быть продуцированы с применением методов рекомбинантных ДНК.

Для экспрессии антител нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут быть вставлены в экспрессионный вектор, т.е. вектор, который содержит элементы для транскрипционного и трансляционного контроля вставленной кодирующей последовательности в конкретном хозяине. Эти элементы могут включать регуляторные последовательности, такие как энхансеры, конститутивные и индуцибельные промоторы и 5'- и 3'-нетранслируемые области. Для конструирования таких экспрессионных векторов могут применяться методы, хорошо известные специалистам в данной области. Эти методы включают методики рекомбинантных ДНК in vitro, синтетические методики и генетическую рекомбинацию in vivo.

Множество систем экспрессионных векторов/клеток-хозяев, известных специалистам в данной области, могут применяться для экспрессии полипептида или РНК, происходящих от нуклеотидных последовательностей, способных кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе. Сюда относятся, в качестве неограничивающих примеров, микроорганизмы, такие как бактерии, трансформированные экспрессионными векторами, представленными рекомбинантным бактериофагом, плазмидной или космидной ДНК; дрожжи, трансформированные дрожжевыми экспрессионными векторами; системы на основе клеток насекомых, инфицированных бакуловирусными векторами; системы на основе клеток растений, трансформированные вирусными или бактериальными экспрессионными векторами; или системы на основе клеток животных. Для длительной продукции рекомбинантных белков в системах на основе клеток млекопитающих может применяться стабильная экспрессия в клеточных линиях. Например, нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут быть трансформированы в клеточные линии с применением экспрессионных векторов, которые могут содержать вирусные ориджины репликации и/или эндогенные элементы регуляции экспрессии и ген селектируемого или визуально различимого маркера на одном и том же или на разных векторах. Изобретение не может быть ограничено применяемыми вектором или клеткой-хозяином. В некоторых воплощениях настоящего изобретения нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут быть каждая по отдельности лигированы в отдельный экспрессионный вектор, и при этом каждая цепь экспрессируется независимо. В другом воплощении как легкая, так и тяжелая цепи, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут быть лигированы в один и тот же экспрессионный вектор и экспрессироваться одновременно.

В соответствии с другим вариантом, РНК и/или полипептид могут экспрессироваться с вектора, включающего нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, с применением системы транскрипции in vitro или объединенной системы транскрипции/трансляции in vitro, соответственно.

В общем случае, клетки-хозяева, которые содержат нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, и/или те, которые экспрессируют полипептид, кодируемый нуклеотидными последовательностями, способными кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, или его часть, могут быть идентифицированы с помощью различных методик, известных специалистам в данной области. Эти методики включают, в качестве неограничивающих примеров, ДНК/ДНК или ДНК/РНК гибридизацию, ПЦР-амплификацию и методики определения биологической активности белка или иммуноанализа белка, которые включают методики, проводимые на мембранах в растворе или на чипах, для детекции и/или количественного определения нуклеиновой кислоты и аминокислотных последовательностей. Специалистам в данной области известны иммунологические методы детекции и измерения экспрессии полипептидов с применением специфичных поликлональных либо моноклональных антител. Примеры таких методик включают твердофазный иммуноферментный анализ (ELISA), радиоиммуноанализ (РИА) и флуоресцентно-активированный клеточный сортинг (FACS). Специалист в данной области легко может адаптировать эти методики для целей настоящего изобретения.

Клетки-хозяева, содержащие нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут, таким образом, культивироваться в условиях, пригодных для транскрипции соответствующих РНК (мРНК, siPHK, shPHK и т.д.) и/или экспрессии полипептида в культуре клеток. Полипептид, продуцируемый клеткой, может секретироваться или может сохраняться внутри клетки, в зависимости от применяемых последовательности и/или вектора. В примере воплощения экспрессионные векторы, содержащие нуклеотидные последовательности, способные кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе, могут быть сконструированы так, чтобы они содержали сигнальные последовательности, которые обусловливают секрецию полипептида через мембрану прокариотической или эукариотической клетки.

Из-за свойственной генетическому коду вырожденности другие последовательности ДНК, кодирующие ту же, в существенной степени ту же или функционально эквивалентную аминокислотную последовательность, могут быть продуцированы и применены, например, для экспрессии полипептида, кодируемого нуклеотидными последовательностями, способными кодировать любую из легких и тяжелых цепей иммуноглобулинов, описанных в этом документе. Нуклеотидные последовательности по настоящему изобретению могут быть сконструированы с применением методов, общеизвестных специалистам в данной области, так, чтобы изменить нуклеотидные последовательности для достижения различных целей, включая, в качестве неограничивающих примеров, модификацию клонирования, процессинга и/или экспрессии продукта гена. Пересортировка ДНК с помощью случайной фрагментации и восстановления фрагментов генов и синтетических олигонуклеотидов посредством ПЦР может применяться для создания нуклеотидных последовательностей. Например, опосредованный олигонуклеотидами, сайт-направленный мутагенез можно применять для внесения мутаций, которые создают новые сайты рестрикции, изменяют характер гликозилирования, изменяют предпочтение кодонов, создают сплайс-варианты и т.д.

Кроме того, линию клеток-хозяев можно выбрать по ее способности модулировать экспрессию внедренных последовательностей или процессировать экспрессированный полипептид нужным образом. Такие модификации полипептида включают в качестве неограничивающих примеров ацетилирование, карбоксилирование, гликозилирование, фосфорилирование, присоединение липидов и ацилирование. В примере воплощения могут быть необходимы антитела, содержащие конкретные структуры или особенности гликозилирования. Пост-трансляционный процессинг, при котором от полипептида отщепляется «препро»-последовательность, также может применяться для задания специфичного нацеливания, фолдинга и/или активности. Различные клетки-хозяева, имеющие специфичные клеточные механизмы и характерные механизмы для пост-трансляционных активностей (например, CHO, HeLa, MDCK, HEK293 и W138), доступны для приобретения и в Американской коллекции типовых культур (ATCC) и могут быть выбраны для обеспечения правильной модификации и процессинга экспрессируемого полипептида.

Так как гибридомные клетки являются гибридными клетками мыши, их применяют строго для продукции антител мыши. Понятно, что гликозильные боковые цепи таких антител мыши могут существенно отличаться от характера гликозилирования, наблюдаемого в клетках человека. Различия характера фосфорилирования между клетками человека и гибридомами также могут влиять на активность антитела. Дополнительно, введение антител мыши человеку обычно индуцирует иммунный ответ против этого антитела, который потенциально способен нейтрализовать любую биологическую активность, которой может обладать антитело мыши.

Для минимизации распознавания антител мыши иммунной системой человека или для улучшения характеристик биологической активности антител в организме человека антитела мыши, преимущественно, превращают в частично (например, в случае химерных антител) или полностью гуманизированные антитела. Таким образом, рекомбинантная форма легкой цепи и тяжелой цепи (частично или полностью) гуманизированного антитела может быть внедрена в экспрессионную систему на основе клеток млекопитающих, отличных от гибридомных клеток (таких как клетки 293, CHO или иные). Экспрессионная система на основе клеток млекопитающих может давать преимущество в том, что характеристики получаемого в результате гликозилирования ближе к таковым, наблюдаемым в природных условиях у антител человека.

Например, в случае литических антител IgG1 правильное гликозилирование иммуноглобулиновых цепей необходимо для эффекторных функций. Биологические функции моноклональных антител IgG1 включают антителозависимую клеточно-опосредованную цитотоксичность (АЗКЦ) и комплемент-зависимую цитотоксичность (КЗЦ), на обе из которых будет оказывать существенное влияние тип гликозильных боковых цепей, которые присоединены к аминокислотам в ходе экспрессии в клетках млекопитающих.

Кроме того, оптимизированные экспрессионные системы на основе клеток млекопитающих часто будут обеспечивать секрецию существенно большего количества антител, по сравнению с гибридомами. Следовательно, имеется практический и, возможно, экономический смысл для адаптации клеток человека к продукции.

Специалист в данной области согласится, что природные, модифицированные или рекомбинантные последовательности нуклеиновых кислот могут быть лигированы в гетерологичную последовательность, что приведет к трансляции химерного полипептида, содержащего фрагменты гетерологичного полипептида, в любой из вышеупомянутых систем клеток-хозяев. Такие фрагменты гетерологичного полипептида могут облегчать очистку химерных полипептидов с применением доступных для приобретения матриксов для аффинной очистки. Такие фрагменты включают, в качестве неограничивающих примеров, глутатион-S-трансферазу (GST), мальтозо-связывающий белок, тиоредоксин, кальмодулин-связывающий белок, 6-His (His), FLAG, c-myc, гемагглютинин (HA) и эпитопы антител, такие как эпитопы моноклональных антител.

Еще одной особенностью настоящего изобретения является то, что оно относится к полинуклеотиду, который может включать нуклеотидную последовательность, кодирующую химерный белок. Химерный белок может включать партнера для сшивки (например, HA, Fc и т.д.), сшитого с полипептидом (например, полноразмерной легкой цепью, полноразмерной тяжелой цепью, вариабельными областями, CDR и т.д.), описанным в этом документе.

Специалисту в данной области также будет очевидно, что последовательности нуклеиновой кислоты и полипептида могут быть синтезированы, полностью или частично, с применением химических или ферментативных способов, хорошо известных специалистам в данной области. Например, пептидный синтез может быть осуществлен с применением различных твердофазных методик, и для автоматизации синтеза могут применяться приборы, такие как пептидный синтезатор ABI 431A (PE Biosystems). Если это необходимо, аминокислотная последовательность может быть изменена в ходе синтеза и/или скомбинирована с последовательностями из других белков с целью получения вариантного белка.

Конъюгаты антител

Хотя в этом не всегда есть необходимость, для детекции или с терапевтическими целями, антитело или антиген-связывающий фрагмент по настоящему изобретению могут быть конъюгированы с детектируемым фрагментом (т.е. для детекции или с диагностическими целями) или с терапевтическим фрагментом (с терапевтическими целями).

Для целей детекции неконъюгированное антитело (первичное антитело) может применяться для связывания с антигеном, и может быть добавлено вторичное антитело, несущее детектируемый фрагмент и способное связываться с первичным антителом. Однако, как указано выше, антитело против сиглека-15 может быть конъюгировано с детектируемой меткой, и такое вторичное антитело может не требоваться.

«Детектируемый фрагмент» - это фрагмент, который может быть детектирован спектроскопическим, фотохимическим, биохимическим, иммунохимическим, химическим и/или другими физическими способами. Детектируемый фрагмент может быть соединен непосредственно и/или опосредованно (например, через линкер, такой как, в частности, линкеры DOTA или NHS) с антителами и их антиген-связывающими фрагментами по настоящему изобретению с применением способов, хорошо известных специалистам в данной области. Может применяться большое разнообразие детектируемых фрагментов, при этом выбор зависит от необходимого уровня чувствительности, простоты конъюгации, требований к стабильности и доступного оборудования. Пригодный детектируемый фрагмент включает, в качестве неограничивающих примеров, флуоресцентную метку, радиоактивную метку (например, без ограничений, 125I, In111, Tc99, I131 и включая позитронно-активные изотопы для ПЭТ-сканеров и т.д.), метку, для ядерного магнитного резонанса, люминесцентную метку, хемилюминесцентную метку, хромофорную метку, ферментативную метку (например, в частности, пероксидазу хрена, щелочную фосфатазу и т.д.), квантовые точки и/или наночастицу. Детектируемый фрагмент может вызывать и/или продуцировать детектируемый сигнал, тем самым делая возможным детекцию сигнала от детектируемого фрагмента.

В еще одном примере воплощения изобретения антитело или его антиген-связывающий фрагмент могут быть соединены (модифицированы) с терапевтическим фрагментом (например, лекарством, цитотоксическим фрагментом).

В некоторых случаях, для терапевтических целей, неконъюгированное антитело может само быть способно изолировать антиген, может блокировать важное взаимодействие между антигеном и другим партнером для связывания, может привлекать эффекторные клетки и т.д. Однако, как указано выше, антитело может быть конъюгировано с терапевтическим фрагментом.

В примере воплощения изобретения антитела и антиген-связывающие фрагменты могут включать химиотерапевтический или цитотоксический агент. Например, антитело или антиген-связывающие фрагменты могут быть конъюгированы с химиотерапевтическим или цитотоксическим агентом. Такие химиотерапевтические или цитотоксические агенты включают, в качестве неограничивающих примеров, иттрий-90, скандий-47, рений-186, йод-131, йод-125, и многие другие, известные специалистам в данной области (например, лютеций (например, Lu177), висмут (например, Bi213), медь (например, Cu67)). В других примерах химиотерапевтический или цитотоксический агент может включать, среди прочих, известных специалистам в данной области, 5-фторурацил, адриамицин, иринотекан, таксаны, эндотоксин псевдомонаса, рициа и другие токсины.

В соответствии с другим вариантом, для выполнения способов по настоящему изобретению, и как известно специалистам в данной области, антитело или антиген-связывающий фрагмент по настоящему изобретению (конъюгированные или нет) могут применяться в сочетании со второй молекулой (например, вторичным антителом и т.д.), которая способна специфично связываться с антигеном или антиген-связывающим фрагментом по настоящему изобретению и которая может нести необходимый детектируемый, диагностический или терапевтический фрагмент.

Фармацевтические композиции антител и их применение

Фармацевтические композиции антител (конъюгированных или нет) также включены в настоящее изобретение. Фармацевтическая композиция может включать антитело или антиген-связывающий фрагмент и может также содержать фармацевтически приемлемый носитель.

Другие особенности изобретения относятся к композиции, которая может включать антитело или антиген-связывающий фрагмент, описанные в этом документе, и носитель.

Дополнительные особенности изобретения относятся к применению изолированного антитела или антиген-связывающего фрагмента, описанных в этом документе, для лечения или диагностики заболеваний костей или онкологического заболевания.

В дополнение к активным ингредиентам, фармацевтическая композиция может содержать фармацевтически приемлемые носители, включающие воду, фосфатно-солевой буфер (PBS), солевые растворы, желатины, масла, спирты и другие вспомогательные вещества и добавки, которые облегчают приготовление из активных соединений препаратов, которые могут применяться для фармацевтических целей. В других примерах такие препараты могут быть стерильными.

При использовании в этом документе «фармацевтическая композиция» обычно содержит терапевтически эффективные количества агента, а также фармацевтически приемлемые разбавители, консерванты, агенты, повышающие растворимость, эмульгирующие агенты, адъюванты и/или носители. При использовании в этом документе термина «терапевтически эффективное количество» он означает количество, которое обеспечивает терапевтический эффект в случае данного состояния и режима введения. Такие композиции являются жидкостями или лиофилизированными или иным способом высушенными лекарственными формами и включают разбавители с различными содержанием буферов (например, трис-HCl, ацетатного, фосфатного), pH и ионной силой, добавками, такими как альбумин или желатин для предотвращения абсорбции на поверхностях, детергентами (например, Tween 20, Tween 80, Pluronic F68, солями желчных кислот). Солюбилизирующие агенты (например, глицерин, полиэтиленглицерин), антиоксиданты (например, аскорбиновая кислота, метабисульфит натрия), консерванты (например, тимеросал, бензиловый спирт, парабены), объемообразующие агенты или модификаторы тонуса (например, лактоза, маннитол), ковалентное присоединение полимеров, такое как присоединение полиэтиленгликоля к белку, комплексообразование с ионами металлов или внедрение материала в или на конкретные препараты полимерных соединений, таких как полимолочная кислота, полигликолевая кислота, гидрогели и т.д., или на липосомы, микроэмульсии, мицеллы, однослойные или многослойный везикулы, тени эритроцитов или сферопласты. Такие композиции будут оказывать влияние на физическое состояние, растворимость, стабильность, скорость высвобождения in vivo и скорость клиренса in vivo. Композиции с контролируемым или пролонгированным высвобождением включают готовые лекарственные формы в виде липофильных препаратов пролонгированного действия (например, с применением жирных кислот восков, масел). Также в изобретение включены конкретные композиции, имеющие покрытие из полимеров (например, полоксамеров или полоксаминов). Другие воплощения композиций по изобретению включают отдельные формы защитного покрытия оболочкой, ингибиторы протеаз или вещества, облегчающие проникновение, для различных способов введения, включая парентеральный, легочный, интраназальный, пероральный, вагинальный, ректальный способы. В одном из вариантов воплощения фармацевтическую композицию вводят парентерально, в область опухоли, трансмукозально, трансдермально, внутримышечно, внутривенно, внутрикожно, подкожно, интраперитонеально, интравентрикулярно, интракраниально и внутрь опухоли.

Дополнительно, используемые в этом документе термины «фармацевтически приемлемый носитель» или «фармацевтической носитель» известны специалистам в данной области и включают в качестве неограничивающих примеров 0,01-0,1 М или 0,05 М фосфатный буфер или 0,8% раствор натрия хлорида. Дополнительно, такие фармацевтически приемлемые носители могут быть водными или неводными растворами, суспензиями и эмульсиями. Примерами неводных растворителей являются пропиленгликоль, полиэтиленгликоль, растительные масла, такие как оливковое масло, и инъекционные органические сложные эфиры, такие как этилолеат. Водные носители включают воду, спиртоводные растворы, эмульсии или суспензии, в том числе раствор натрия хлорида и буферные среды. Парентеральные носители включают раствор натрия хлорида, декстрозу в растворе Рингера, декстрозу и натрия хлорид, раствор Рингер-лактата или нелетучие масла. Внутривенные носители включают жидкие среды и агенты, компенсирующие питательные вещества, агенты, компенсирующие электролиты, такие как агенты на основе декстрозы в растворе Рингера и т.п. Также могут присутствовать консерванты и другие добавки, такие как, например, антимикробные агенты, антиоксиданты, упорядочивающие агенты, инертные газы и т.п.

Для любого соединения терапевтически эффективная доза может быть вычислена первоначально либо в исследованиях на клеточных культурах, либо в животных моделях, таких как мыши, крысы, кролики, собаки или свиньи. Животная модель также может применяться для определения диапазона концентраций и способа введения. Такая информация может далее применяться для определения полезных доз и способов введения для человека. Эти методики хорошо известны специалистам в данной области, и терапевтически эффективная доза означает то количество активного ингредиента, которое уменьшает интенсивность симптомов или степень тяжести состояния. Терапевтическая эффективность и токсичность могут быть определены с помощью стандартных фармацевтических методик в культурах клеток или у экспериментальных животных, например, путем вычисления и сопоставления статистики по показателям ED50 (дозы, терапевтически эффективной для 50% популяции) и LD50 (дозы, летальной для 50% популяции). Любая из терапевтических композиций, описанных выше, может применяться для любого субъекта, которому необходима такая терапия, включая в качестве неограничивающих примеров млекопитающих, таких как собаки, кошки, коровы, лошади, кролики, обезьяны и люди.

Фармацевтические композиции, применяемые в этом изобретении, могут быть введены любым количеством способов, включая в качестве неограничивающих примеров пероральный, внутривенный, внутримышечный, внутриартериальный, интрамедуллярный, интратекальный, интравентрикулярный, трансдермальный, подкожный, интраперитонеальный, интраназальный, энтеральный, местный, подъязычный или ректальный способы.

Термин «лечение» для целей настоящего раскрытия означает как терапевтическое лечение, так и профилактические или превентивные меры, при этом целью является предотвращение или замедление (уменьшение) целевого патологического состояния или нарушения. Те, кто нуждается в лечении, включают тех, у кого уже имеется нарушение, а также тех, кто имеет склонность к приобретению нарушения, или тех, у кого нарушение следует предотвратить.

Антитела или антиген-связывающие фрагменты могут иметь терапевтическое применение при лечении различных заболеваний, связанных с потерей костной массы, или онкологического заболевания. В примере воплощения антитела или фрагменты могут иметь терапевтическое применение при потере костной массы, связанной с заболеваниями костей, такими как состояния, при которых наблюдается повышение активности остеокластов по деградации костей. В некоторых примерах антитела или антиген-связывающие фрагменты могут взаимодействовать с клетками, которые экспрессируют SEQ ID NO: 2, и индуцировать иммунологическую реакцию, опосредуя АЗКЦ. В других примерах антитела или антиген-связывающие фрагменты могут блокировать взаимодействие SEQ ID NO: 2 с ее белковыми партнерами.

Антитела или антиген-связывающие фрагменты против сиглека-15 могут иметь терапевтическое применение при лечении потери костной массы в контексте различных связанных с костями заболеваний, включая в качестве неограничивающих примеров остеопороз, остеопению, остеомаляцию, гиперпаратиреоз, гипотиреоз, гипертиреоз, гипогонадизм, тиреотоксикоз, системный мастоцитоз, гипофосфатазию взрослых, гиперадренокортицизм, несовершенный остеогенез, болезнь Педжета, болезнь/синдром Иценко-Кушинга, синдром Тернера, болезнь Гоше, синдром Элерса - Данлоса, синдром Марфана, синдром Менкеса, синдром Фанкони, множественную миелому, гиперкальциемию, гипокальцинемию, поражения кожи ревматического или подагрического происхождения, заболевание периодонта, рахит (включая витамин D-зависимый, I и II типа, и связанный с X-хромосомой гипофосфатемический рахит), несовершенный фиброгенез кости, остеосклеротические нарушения, такие как пикнодизостоз и повреждение, вызванное макрофаг-опосредованными воспалительными процессами. В предпочтительном воплощении антитела и фрагменты имеют терапевтическое применение при состояниях, при которых преобладает тяжелая степень потери костной массы, в частности, при метастатическом раке костей. В некоторых случаях антитела и фрагменты против сиглека-15 могут взаимодействовать с клетками, такими как остеокласты, которые экспрессируют сиглек-15. В других примерах антитела или антиген-связывающие фрагменты против сиглека-15 могут блокировать взаимодействие сиглека-15 с его белковыми партнерами.

Антитела против сиглека-15 и их антиген-связывающие фрагменты могут иметь терапевтическое применение при лечении онкологического заболевания или потери костной массы, вызванной или связанной с различными нарушениями ремоделирования кости. В частности, антитела против сиглека-15 и их иммунологически функциональные фрагменты могут иметь терапевтическое применение при состояниях, при которых остеокласты гиперактивны и вносят вклад в деградацию поверхности кости. В некоторых примерах антитела против сиглека-15 и их антиген-связывающие фрагменты могут быть введены одновременно в комбинации с другими лечебными препаратами, применяемыми для того же состояния. По существу, антитела могут быть введены с антирезорптивными агентами (например, бисфосфонатами), которые известны специалистам в данной области. Дополнительно, антитела могут быть введены с антимитотическими агентами (например, таксанами), агентами на основе платины (например, цисплатином), повреждающими ДНК агентами (например, доксорубицином) и другими цитотоксическими лекарственными препаратами, известными специалистам в данной области. В других примерах антитела против сиглека-15 и их иммунологически функциональные фрагменты могут быть введены с другими терапевтическими антителами. Сюда включают, в качестве неограничивающих примеров, антитела, которые нацелены на RANKL, EGFR, CD-20 и Her2.

В некоторых примерах антитела и их антиген-связывающие фрагменты могут быть введены одновременно в комбинации с другими лечебными препаратами, применяемыми для того же состояния. По существу, антитела могут быть введены с антимитотическими агентами (например, таксанами), агентами на основе платины (например, цисплатином), повреждающими ДНК агентами (например, доксорубицином) и другими противораковыми лекарственными препаратами, известными специалистам в данной области. В других примерах антитела и их антиген-связывающие фрагменты могут быть введены с другими терапевтическими антителами. Сюда включают, в качестве неограничивающих примеров, антитела, которые нацелены на EGFR, CD-20 и Her2.

Дополнительной особенностью настоящего изобретения является то, что оно относится к способу ингибирования роста клеток, экспрессирующих SEQ ID NO: 2, или клеток, экспрессирующих вариант SEQ ID NO: 2, способу, который может включать контактирование клетки с эффективным количеством антитела или антиген-связывающего фрагмента, описанных в этом документе.

Настоящее изобретение также включает способ лечения онкологического заболевания или потери костной массы, или ингибирования роста клеток, экспрессирующих SEQ ID NO: 2, или клеток, экспрессирующих вариант SEQ ID NO: 2, у млекопитающего, при этом способ может включать введение антитела или антиген-связывающего фрагмента, описанных в этом документе, млекопитающему, которому это необходимо.

Настоящее изобретение также направлено на создание способа ингибирования роста раковой клетки, выбранной из группы, состоящей из клеток рака яичников, клеток рака почки, раковых клеток центральной нервной системы, клеток рака простаты, клеток меланомы, клеток рака молочной железы, клеток рака легких и клеток рака толстой кишки. Способ может включать доставку в раковую клетку нуклеиновой кислоты, способной подавлять экспрессию полипептида, по меньшей мере, на 80% идентичного SEQ ID NO: 2, или имеющего область, по меньшей мере, на 80% идентичную аминокислотам с 20 по 259 или аминокислотам с 49 по 165 в составе SEQ ID NO: 2. Раковая клетка может экспрессировать полипептид, по меньшей мере, на 80% идентичный SEQ ID NO: 2, или имеющий область, по меньшей мере, на 80% идентичную аминокислотам с 20 по 259 или аминокислотам с 49 по 165 в составе SEQ ID NO: 2.

В соответствии с настоящим изобретением, нуклеиновая кислота может являться, например, siPHK или антисмысловой последовательностью.

Настоящее изобретение также включает способ детекции онкологического заболевания или потери костной массы или детекции клеток, экспрессирующих SEQ ID NO: 2, или клеток, экспрессирующих вариант SEQ ID NO: 2, у млекопитающего, при этом способ может включать введение антитела или антиген-связывающего фрагмента, описанных в этом документе, млекопитающему, которому это необходимо.

Еще одной особенностью настоящего изобретения является то, что оно относится к способу детекции клеток, экспрессирующих SEQ ID NO: 2, или клеток, экспрессирующих вариант SEQ ID NO: 2, при этом способ может включать контактирование клетки с антителом или антиген-связывающим фрагментом, описанными в этом документе, и детекцию комплекса, образованного антителом с клетками, экспрессирующими SEQ ID NO: 2, или с клетками, экспрессирующими вариант SEQ ID NO: 2.

Еще одна особенность изобретения относится к способу детекции SEQ ID NO: 2, варианта, обладающего, по меньшей мере, 80% идентичностью последовательности с аминокислотами 20-259 или аминокислотами 49-165 в составе SEQ ID NO: 2, при этом способ может включать контактирование клеток, экспрессирующих SEQ ID NO: 2, или ее вариант, или пробы биопсии, сыворотки, плазмы, мочи и т.д.), которая включает или, подозревается, что включает, SEQ ID NO: 2 или ее вариант, с антителом или антиген-связывающими фрагментами, описанными в этом документе, и измерение связывания.

Связывание антитела с антигеном вызовет увеличение ожидаемой молекулярной массы антигена. Следовательно, при специфичном связывании антитела или антиген-связывающего фрагмента с антигеном происходит физическое изменение.

Такие изменения могут быть детектированы с применением, например, электрофореза с последующим вестерн-блотом и окраской геля или блота, масс-спектрометрии, ВЭЖХ, сопряженной с компьютерным анализом и т.д. Устройства, способные вычислять сдвиг молекулярной массы, известны специалистам в данной области и включают, например, Phosphorimager™.

Когда антитело содержит, например, детектируемую метку, комплекс антиген-антитело может быть детектирован по флуоресценции, испускаемой меткой, радиоактивному испусканию метки, ферментативной активности метки при добавлении ее субстратов и т.д.

Детекция и/или измерение связывания между антителом или антиген-связывающим фрагментом и антигеном могут быть осуществлены различными способами, известными специалистам в данной области. Связывание между антителом или антиген-связывающим фрагментом и антигеном можно измерять с применением устройств, способных детектировать сигнал, испускаемый детектируемой меткой (испускание радиационного излучения, флуоресценцию, измерение цвета и т.д.) Такие устройства обеспечивают получение данных, свидетельствующих о том, что связывание имело место, и также могут давать показания относительно количества антитела, связанного с антигеном. Устройства (обычно соединенные с компьютером) также могут быть способны вычислять разность между фоновым сигналом (например, сигналом, полученным в отсутствие связывания антиген-антитело) или фоновым шумом и сигналом, полученным при специфичном связывании антитело-антиген. Такие устройства могут, таким образом, обеспечить пользователя показаниями и выводами относительно того, произошла ли детекция антигена или нет.

Проба может быть получена от млекопитающего (например, человека), у которого может быть онкологическое заболевание или заболевание костей, или может быть подозрение на наличие онкологического заболевания или заболевания костей, или оно может испытывать потерю костной массы, или относительно него может быть подозрение на наличие потери костной массы. Проба может являться пробой ткани, полученной от млекопитающего или супернатантом культуры клеток.

В соответствии с изобретением проба может представлять собой пробу сыворотки, пробу плазмы, пробу крови или асцитическую жидкость, полученные от млекопитающего. Антитело или антиген-связывающий фрагмент, описанные в этом документе, могут, предпочтительно, детектировать SEQ ID NO: 2.

Способ может включать количественное определение комплекса, образованного антителом или антиген-связывающим фрагментом, связанным с SEQ ID NO: 2 или с вариантом SEQ ID NO: 2.

Антитело или антиген-связывающий фрагмент по настоящему изобретению могут, в частности, применяться для детекции, диагностики или лечения заболевания костей или онкологического заболевания.

Дополнительные особенности изобретения относятся к наборам, которые могут включать один или несколько контейнеров, содержащих одно или несколько антител или антиген-связывающих фрагментов, описанных в этом документе.

Нуклеиновые кислоты, векторы и клетки

Антитела обычно продуцируют в клетках, позволяющих проводить экспрессию легкой цепи и тяжелой цепи, экспрессируемых с вектора(ов), включающего последовательность нуклеиновой кислоты, которая кодирует легкую цепь и тяжелую цепь.

Следовательно, настоящее изобретение включает нуклеиновые кислоты, способные кодировать любую из областей CDR (включая варианты CDR), вариабельные домены легкой цепи (включая варианты вариабельных доменов легкой цепи), вариабельные домены тяжелой цепи (включая варианты вариабельных доменов тяжелой цепи), легкие цепи (включая варианты легких цепей), тяжелые цепи (включая варианты тяжелых цепей), описанные в этом документе.

Примеры воплощений нуклеиновых кислот по настоящему изобретению включают нуклеиновые кислоты, кодирующие вариабельный домен легкой цепи, включающий:

a. последовательность CDRL1, выбранную из группы, состоящей из SEQ ID NO: 69, SEQ ID NO: 75, SEQ ID NO: 81, SEQ ID NO: 87, SEQ ID NO: 93, SEQ ID NO: 99, SEQ ID NO: 105 и SEQ ID NO: 111;

b. последовательность CDRL2, выбранную из группы, состоящей из SEQ ID NO: 70, SEQ ID NO: 76, SEQ ID NO: 82. SEQ ID NO: 88. SEQ ID NO: 94, SEQ ID NO: 100, SEQ ID NO: 106 и SEQ ID NO: 112, и/или;

c. последовательность CDRL3, выбранную из группы, состоящей из SEQ ID NO: 71, SEQ ID NO: 77, SEQ ID NO: 83, SEQ ID NO: 89, SEQ ID NO: 95, SEQ ID NO: 101, SEQ ID NO: 107 и SEQ ID NO: 113.

В соответствии с настоящим изобретением, нуклеиновая кислота может кодировать вариабельный домен легкой цепи, который может включать, по меньшей мере, две области CDR из CDRL1, CDRL2 или CDRL3.

Также в соответствии с настоящим изобретением, нуклеиновая кислота может кодировать вариабельный домен легкой цепи, который может включать одну область CDRL1, одну область CDRL2 и одну область CDRL3.

Настоящее изобретение также относится к нуклеиновой кислоте, кодирующей вариабельный домен тяжелой цепи, включающий:

a. последовательность CDRH1, выбранную из группы, состоящей из SEQ ID NO: 72, SEQ ID NO: 78, SEQ ID NO: 84, SEQ ID NO: 90, SEQ ID NO: 96, SEQ ID NO: 102, SEQ ID NO: 108 и SEQ ID NO: 114;

b. последовательность CDRH2, выбранную из группы, состоящей из SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 91, SEQ ID NO: 97, SEQ ID NO: 103, SEQ ID NO: 109 и SEQ ID NO: 115, и/или

c. последовательность CDRH3, выбранную из группы, состоящей из SEQ ID NO: 74, SEQ ID NO: 80, SEQ ID NO: 86, SEQ ID NO: 92, SEQ ID NO: 98, SEQ ID NO: 104, SEQ ID NO: 110 и SEQ ID NO: 116.

Дополнительной особенностью настоящего изобретения является то, что оно направлено на создание нуклеиновой кислоты, кодирующей вариабельный домен легкой цепи, который может включать:

a) последовательность CDRL1, выбранную из группы, состоящей из SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 84, SEQ ID NO: 96 и SEQ ID NO: 102;

b) последовательность CDRL2, выбранную из группы, состоящей из SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 76, SEQ ID NO: 82 и SEQ ID NO: 106, или

c) последовательность CDRL3, выбранную из группы, состоящей из SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 77, SEQ ID NO: 83, SEQ ID NO: 95, SEQ ID NO: 107 и SEQ ID NO: 152.

Еще одной дополнительной особенностью настоящего изобретения является то, что оно направлено на создание нуклеиновой кислоты, кодирующей вариабельный домен тяжелой цепи, который может включать:

a) последовательность CDRH1, выбранную из группы, состоящей из SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 84, SEQ ID NO: 96 и SEQ ID NO: 102;

b) последовательность CDRH2, выбранную из группы, состоящей из SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85, SEQ ID NO: 97, SEQ ID NO: 103 и SEQ ID NO: 109, или

c) последовательность CDRH3, выбранную из группы, состоящей из SEQ ID NO: 158, SEQ ID NO: 74, SEQ ID NO: 98, SEQ ID NO: 104, SEQ ID NO: 110 и SEQ ID NO: 116.

В соответствии с настоящим изобретением, нуклеиновая кислота может кодировать вариабельный домен тяжелой цепи, который может содержать, по меньшей мере, две области CDR из CDRH1, CDRH2 или CDRH3.

В соответствии с настоящим изобретением, нуклеиновая кислота может кодировать вариабельный домен тяжелой цепи, который может включать одну область CDRH1, одну область CDRH2 и одну область CDRH3.

Также настоящее изобретение включает нуклеиновые кислоты, кодирующие варианты антител, содержащие, по меньшей мере, одну консервативную аминокислотную замену.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, одну консервативную аминокислотную замену.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, одну консервативную аминокислотную замену в составе, по меньшей мере, двух областей CDR.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, одну консервативную аминокислотную замену в составе 3 областей CDR.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, две консервативные аминокислотные замены в составе, по меньшей мере, одной из областей CDR.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, две консервативные аминокислотные замены в составе, по меньшей мере, двух областей CDR.

В соответствии с настоящим изобретением нуклеиновая кислота может кодировать область CDR, включающую, по меньшей мере, две консервативные аминокислотные замены в составе 3 областей CDR.

Другие особенности изобретения относятся к нуклеиновой кислоте, кодирующей вариабельный домен легкой цепи, обладающий, по меньшей мере, 70% (включая, по меньшей мере, 80%) идентичностью последовательности относительно последовательности, выбранной из группы, состоящей из SEQ ID NO: 37, SEQ ID NO: 41, SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 53, SEQ ID NO: 57, SEQ ID NO: 61 и SEQ ID NO: 65.

Дополнительные особенности изобретения относятся к нуклеиновой кислоте, кодирующей вариабельный домен тяжелой цепи, обладающий, по меньшей мере, 70% (включая, по меньшей мере, 80%) идентичностью последовательности относительно последовательности, выбранной из группы, состоящей из SEQ ID NO: 39, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 51, SEQ ID NO: 55, SEQ ID NO: 59, SEQ ID NO: 63 и SEQ ID NO: 67.

Еще одной особенностью настоящего изобретения является то, что оно относится к вектору, включающему нуклеиновую кислоту, описанную в этом документе.

В соответствии с настоящим изобретением вектор может являться экспрессионным вектором.

Вектор, который содержит элементы для транскрипционного и трансляционного контроля вставленной кодирующей последовательности в конкретном хозяине, известны специалистам в данной области. Эти элементы могут включать регуляторные последовательности, такие как энхансеры, конститутивные и индуцибельные промоторы и 5'- и 3'-нетранслируемые области. Для конструирования таких экспрессионных векторов могут применяться методы, хорошо известные специалистам в данной области. Эти методы включают методики рекомбинантных ДНК in vitro, синтетические методики и генетическую рекомбинацию in vivo.

Еще одной особенностью настоящего изобретения является то, что оно относится к изолированной клетке, которая может включать нуклеиновую кислоту, описанную в этом документе.

Изолированная клетка может включать нуклеиновую кислоту, кодирующую вариабельный домен легкой цепи, и нуклеиновую кислоту, кодирующую вариабельный домен тяжелой цепи, либо в разных векторах, либо в одном и том же векторе. Изолированная клетка может также включать нуклеиновую кислоту, кодирующую легкую цепь, и нуклеиновую кислоту, кодирующую тяжелую цепь, либо в разных векторах, либо в одном и том же векторе.

В соответствии с настоящим изобретением клетка может быть способна экспрессировать, собирать и/или секретировать антитело или его антиген-связывающий фрагмент.

В соответствии с другой особенностью настоящее изобретение направлено на создание клетки, которая может включать и/или может экспрессировать антитело, описанное в этом документе.

В соответствии с изобретением клетка может включать нуклеиновую кислоту, кодирующую вариабельный домен легкой цепи, и нуклеиновую кислоту, кодирующую вариабельный домен тяжелой цепи.

Клетка может быть способна экспрессировать, собирать и/или секретировать антитело или его антиген-связывающий фрагмент.

Представленные ниже примеры приведены для дополнительного описания особенностей настоящего изобретения.

Примеры воплощений скринингового исследования

Дополнительной особенностью настоящего изобретения является то, что оно направлено на создание способов идентификации соединения, способного ингибировать рост клеток рака яичников, клеток рака почки, раковых клеток центральной нервной системы, клеток рака простаты, клеток меланомы, клеток рака молочной железы, клеток рака легких или клеток рака толстой кишки. Способ может включать добавление к полипептиду, содержащему область, по меньшей мере, на 80% идентичную аминокислотам с 20 по 259 в SEQ ID NO:2, или к клеткам, экспрессирующим указанный полипептид, кандидатного соединения и измерение активности или экспрессии полипептида. Пониженная активность или экспрессия полипептида может свидетельствовать в пользу пригодности ингибиторного соединения.

В соответствии с настоящим изобретением кандидатное соединение может специфично связываться с полипептидом.

В соответствии с настоящим изобретением кандидатное соединение может являться, например, антителом или антиген-связывающим фрагментом.

В соответствии с настоящим изобретением кандидатное соединение может являться, например, siPHK или антисмысловой последовательностью.

Могут проводиться исследования других типов, которые также будут включены в объем изобретения.

ПРИМЕРЫ

Пример 1

Данный пример описывает характер экспрессии гена сиглек-15 в остеокластах и пробах РНК из тканей человека.

Один из наиболее многообещающих идентифицированных генов, названный AB-0326, кодирует мембранный белок клеточной поверхности I типа, сиглек-15. Эта кандидатная молекула первоначально была изолирована из библиотеки остеокластов человека, и схожая RANKL-зависимая активация была подтверждена с помощью ОТ-ПЦР в первичных остеокластах мыши, а также в клетках RAW 264.7 мыши, по сравнению с клетками-предшественниками (Sooknanan et al. 2007). Профиль экспрессии сиглека-15 в тканях оценили для определения специфичности экспрессии, критерия, который применяли ко всем целевым молекулам, которые были выбраны для оценки. Мононуклеарные клетки периферической крови (МКПК) получали от 6 человек, выступивших в роли доноров, и культивировали в среде для дифференцировки остеокластов (М-КСФ и RANKL) в течение, по меньшей мере, 14 дней. Суммарную РНК изолировали из клеток-предшественников (без обработки RANKL (фигура 1, верхняя панель, -) или в промежуточных временных интервалах (фигура 1, верхняя панель, ). Один микрограмм РНК из каждой пробы превращали в одноцепочечную кДНК с применением обратной транскриптазы Thermoscript (Invitrogen, Берлингтон, Онтарио, Канада) согласно рекомендациям производителя, разводили в 200 раз и применяли в реакции ПЦР, ранее оптимизированной для специфичной амплификации фрагмента транскрипта сиглека-15. Последовательности олигонуклеотидов, применяемых в реакции ПЦР, приведены в SEQ ID NO: 117 и 118. Как показано на фиг. 1, верхняя панель, дифференцирующиеся остеокласты), транскрипт сиглека-15 экспрессировался на гораздо более низком уровне в клетках-предшественниках, по сравнению с дифференцирующимися остеокластами. Кроме того, уровень транскрипта сиглека-15 повышался в ходе прогрессирования дифференцировки. Для сравнения, известный маркерный ген остеокластов, катепсин К (CATK на фиг. 1, дифференцирующиеся остеокласты) также активировался во время дифференцировки остеокластов. Олигонуклеотиды, применявшиеся для амплификации матричной РНК CATK, показаны в SEQ ID NO: 119 и 120. В качестве контроля реакции ПЦР проводили с теми же пробами, с праймерами, которые обеспечивают специфичную амплификацию гена домашнего хозяйства - глицеральдегид-3-фосфатдегидрогеназы (GAPDH, см. нижнюю панель на фиг. 1, дифференцирующиеся остеокласты). Последовательности GAPDH-специфичных праймеров, применяемых в реакции ПЦР, показаны в SEQ ID NO: 121 и 122. Эта последняя реакция демонстрирует, что в каждой пробе присутствовало одинаковое количество исходной РНК. Суммарную РНК из нормальных тканей человека приобрели у коммерческого поставщика (Clontech, Маунтин-Вью, Калифорния, США). Как показано на фиг. 1 (верхняя панель, нормальные ткани), сиглек-15 слабо детектировался в одной ткани (легкие, дорожка 9) и полностью отсутствовал в пробах всех остальных тканей. Это подчеркивает эффективность примененного заявителем нового способа исследования для идентификации мишеней, присутствие которых в существенной степени ограничено дифференцирующимися остеокластами. Номера дорожек на фиг. 1 соответствуют следующим тканям. Дорожки соответствуют следующим тканям: дорожка 1. надпочечник; 2. молочная железа; 3. тощая кишка; 4. трахея; 5. печень; 6. плацента; 7. аорта; 8. мозг; 9. легкие; 10. кора надпочечников; 11. пищевод; 12. толстая кишка; 13. яичник;14. почка; 15. простата; 16. тимус; 17. скелетная мышца; 18. полая вена; 19. желудок; 20. тонкая кишка; 21. сердце; 22. фаллопиева труба; 23 селезенка; 24 мочевой пузырь; 25. шейка матки; 26. поджелудочная железа; 27. подвздошная кишка; 28. двенадцатиперстная кишка; 29. щитовидная железа; 30. семенник; на пустых дорожках между дорожками 10 и 11 и дорожками 20 и 21 представлены отрицательные контроли (без кДНК). Наши результаты свидетельствуют, что сиглек-15 активируется в дифференцирующихся остеокластах, отсутствует практически во всех нормальных тканях человека, и это предполагает, что антитело против сиглека-15 будет в значительно меньшей степени взаимодействовать с нецелевыми тканями.

Дополнительное исследование профиля экспрессии было проведено для определения экспрессии сиглека-15 при онкологическом заболевании. Специалисту в данной области будет ясно, что антитела, описанные в данном изобретении, могли бы найти применение в случае онкологического заболевания, если бы было обнаружено, что ген сиглека-15 экспрессируется при таких типах заболеваний. Для исследования этого вопроса адаптировали метод на основе ПЦР для определения характера экспрессии транскрипта сиглека-15 в линиях раковых клеток, изолированных у пациентов с девятью типами рака. Типы рака, представленные клеточными линиями - это лейкемия, рак центральной нервной системы, молочной железы, толстой кишки, легких, меланома, рак яичников, простаты и почки (см. Таблицу 4). Пробы РНК получали в рамках Программы разработки методов терапии в Национальном институте рака/Национальных институтах здравоохранения (NCI/NIH). Используя те же пробы RAMP РНК, которые были амплифицированы из проб суммарной РНК, полученных из NCI, 500 нг РНК конвертировали в одноцепочечную кДНК как описано выше. Реакцию с кДНК-продуктом разбавили так, чтобы использовать 1/200 реакции для каждого эксперимента с ПЦР. ПЦР проводили в 96-луночном планшете, используя Hot-Start Taq-полимеразу от компании Qiagen (Миссиссога, Онтарио, Канада) в циклере DNA Engine Tetrad от компании MJ Research. Половину реакционной смеси нанесли на 1,2% агарозный гель с этидиумом бромидом и визуализировали ампликоны в УФ свете. Для проверки того, что в каждой реакции использовались равные количества РНК, уровень РНК контролировали по экспрессии GAPDH.

Таблица 4
Список линий раковых клеток из панели NCI-60
Клеточная линия Тип рака
K-562 Лейкемия
MOLT-4 Лейкемия
CCRF-CEM Лейкемия
RPMI-8226 Лейкемия
HL-60(TB) Лейкемия
SR Лейкемия
SF-268 ЦНС
SF-295 ЦНС
SF-539 ЦНС
SNB-19 ЦНС
SNB-75 ЦНС
U251 ЦНС
BT-549 молочной железы
HS 578T молочной железы
MCF7 молочной железы
NCI/ADR-RES молочной железы
MDA-MB-231 молочной железы
MDA-MB-435 молочной железы
T-47D молочной железы
COLO 205 толстой кишки
HCC-2998 толстой кишки
HCT-116 толстой кишки
HCT-15 толстой кишки
HT29 толстой кишки
KM12 толстой кишки
SW-620 толстой кишки
A549/ATCC немелкоклеточный легких
EKVX немелкоклеточный легких
HOP-62 немелкоклеточный легких
HOP-92 немелкоклеточный легких
NCI-H322M немелкоклеточный легких
NCI-H226 немелкоклеточный легких
NCI-H23 немелкоклеточный легких
NCI-H460 немелкоклеточный легких
NCI-H522 немелкоклеточный легких
LOX IMVI Меланома
M14 Меланома
MALME-3M Меланома
SK-MEL-2 Меланома
SK-MEL-28 Меланома
SK-MEL-5 Меланома
UACC-257 Меланома
UACC-62 Меланома
IGROV-1 Яичников
OVCAR-3 Яичников
OVCAR-4 Яичников
OVCAR-5 Яичников
OVCAR-8 Яичников
SK-OV-3 Яичников
DU-145 Простаты
PC-3 Простаты
786-0. почки
A498 почки
ACHN почки
CAKI-1 почки

Как показано на фиг. 2, было обнаружено, что сиглек-15 экспрессируется при нескольких типах рака, в частности, при раке яичников, раке почки, раке центральной нервной системы и раке простаты. Фактически, сиглек-15 был детектирован практически при всех типах рака, представленных этими пробами, за исключением лейкемии. Этот результат предполагает, что антитела против сиглека-15 могут иметь применение при онкологических заболеваниях.

Антитела, описанные в примере 2 (см. ниже) также могут применяться для детекции сиглека-15 в клеточных лизатах методом иммуноблоттинга. Полноразмерная открытая рамка считывания кДНК сиглека-15 человека была клонирована в экспрессионный вектор для клеток млекопитающих под промотор CMV (pCDNA-Siglec-15). Эту конструкцию или контрольный пустой вектор, который не кодирует сиглек-15, трансфецировали в клетки меланомы A375, которые имеют низкий эндогенный уровень экспрессии сиглека-15. Пул стабильно трансфецированных клеток изолировали отбором с помощью G418. Клеточные лизаты их трансфецированных сиглеком-15 (+) и контрольных (-) клеток A375 проанализировали иммуноблоттингом с моноклональным антителом E6. Как показано на фиг. 13A, антитело детектирует одиночную линию размером 35 кДа в клетках, трансфецированных сиглеком-15, но не в контрольных клетках. Это в существенной степени соответствует предсказанной молекулярной массе сиглека-15 (35,62 кДа), исходя из первичной аминокислотной последовательности (http://www.bioinformatics.org/sms/prot_mw.html). Лизаты также проанализировали иммуноблоттингом с антителом против β-актина для демонстрации того, что на каждую дорожку было нанесено приблизительно одинаковое суммарное количество лизата. Эти результаты демонстрируют, что при иммуноблоттинге антитело E6 распознает, с высокой специфичностью, сверхэкспрессируемый сиглек-15 в лизатах из клеток, трансфецированных клонированной кДНК сиглека-15.

Для подтверждения того, что повышенные уровни мРНК сиглека-15 в дифференцированных МКПК человека (фиг. 1) соответствуют повышенным уровням белка сиглека-15, приготовили лизаты из МКПК человека, обработанных только М-КСФ (недифференцированные, C) или М-КСФ и RANKL (дифференцированные, Δ) (фиг. 13B). Были также приготовлены лизаты из клеток RAW 264.7, необработанных (недифференцированные, C) или обработанных RANKL (дифференцированные, Δ) (фиг. 13C). Ранее было показано, что в клетках RAW 264.7 уровень мРНК сиглека-15 повышается при индукции дифференцировки остеокластов под действием RANKL (Sooknanan, 2007). Анализ этих лизатов иммуноблоттингом с антителом E9 демонстрирует, что, как это было предсказано исследованиями с ОТ-ПЦР, имеется существенное повышение уровней белка сиглека-15 как в МКПК, так и в клетках RAW 264.7, при дифференцировке в остеокласты (фиг. 13B и 13C).

ОТ-ПЦР анализ мРНК из панели NCI60 (фиг. 2) показал, что, в частности, высокая доля линий раковых клеток, происходящих из центральной нервной системы, экспрессируют список-15, при этом недавно проведенное исследование на микрочипах обнаружило, что небольшой набор линий раковых клеток, в том числе линия глиобластомы U87, которая не входит в состав панели NCI60, экспрессируют мРНК сиглека-15 на очень высоком уровне (Shankavaram, 2007). Поэтому было проведено исследование того, возможно ли провести детекцию эндогенной экспрессии сиглека-15 на уровне белка в клетках U87. И действительно, белок с размером как у сиглека-15, детектируется иммуноблоттингом в лизатах клеток U87. Для подтверждения подлинности этого белка клетки U87 трансфецировали набором малых интерферирующих РНК (siPHK), нацеленных на сиглек-15 (SIGLEC15 siGENOME SMARTpool, Dharmacon) (+), или набором контрольных, ненацеленных siPHK (-, фиг. 13D), и выращивали в течение 72ч перед лизисом клеток. Свидетельствуя в пользу идентификации белка, как сиглек-15, обработка нацеленными siPHK привела к снижению экспрессии этого белка, по сравнению с контролем без нацеливания (фиг. 13D). Чтобы проверить, обнаруживается ли сиглек-15 на клеточной поверхности в раковых клетках, проанализировали обработанные siPHK клетки U87 методом проточной цитометрии. Живые клетки поместили на лед и покрасили с помощью антитела против сиглека-15 - E9 (см. пример 2) или контрольного антитела с тем же изотипом в условиях, которые способствуют связыванию антитела с внеклеточными, но не с внутриклеточными антигенами. Обработка нацеленной siPHK привела к снижению связывания антитела E9, но не повлияла на связывание контрольного антитела (фиг. 13E). В целом, эти результаты демонстрируют, что сиглек-15 может экспрессироваться в раковых клетках, и что он доступен для связывания с антителом на поверхности клетки.

Пример 2

В данном примере даны подробные характеристики, касающиеся семейства моноклональных антител, которые связываются с сиглеком-15.

Для выработки моноклональных антител продуцировали рекомбинантный сиглек-15 человека в клетках 293E, применяя технологию крупномасштабной временной трансфекции (Durocher et al., 2002; Durocher, 2004). кДНК, кодирующую аминокислоты с 20 по 259 в SEQ ID NO: 2 (см. SEQ ID NO: 123), амплифицировали с помощью ПЦР, применяя прямой праймер, имеющий внедренный сайт рестрикции для BamHI (SEQ ID NO: 124), и обратный праймер, имеющий внедренный сайт рестрикции для NotI (SEQ ID NO: 125). Полученный в результате продукт ПЦР расщепили с помощью BamHI и NotI и лигировали фрагмент в экспрессионный вектор pYD5 (SEQ ID NO: 126), который был расщеплен схожим образом с помощью тех же ферментов рестрикции, с образованием вектора, названного pYD5-0326. Экспрессионная плазмида pYD5 содержит кодирующую последовательность для домена Fc человека, что позволяет вырабатывать химерные белки, а также последовательность, кодирующую сигнальный пептид из IgG1, что делает возможной секрецию химерного белка в культуральную среду. Из расчета на каждый миллилитр клеток, один микрограмм экспрессионного вектора, названного pYD5-032620-259, трансфецировали в клетки 2936E, выращенные в суспензии до плотности 1,5-2,0 млн. клеток/мл. В качестве реагента для трансфекции применяли полиэтиленимин (ПЭИ) (линейный, с молекулярной массой 25000, кат. No23966, Polysciences, Inc., Уоррингтон, Пенсильвания, США), который добавляли в соотношении ДНК:ПЭИ, равном 1:3. Рост клеток продолжался в течение 5 дней, после чего собрали культуральную среду для очистки рекомбинантного химерного белка Fc-032620-259. Белок очищали с применением агарозы с белком A согласно рекомендациям производителя (Sigma-Aldrich Canada Ltd., Оуквилл, Онтарио, Канада). Образец полиакриламидного геля, демонстрирующий пробу очищенного белка Fc-032620-259 (обозначенного как Fc-сиглек-1520-259) приведен на фиг. 3.

Антитела, которые связываются с сиглеком-15, вырабатывали с применением методики фагового дисплея компании Biosite. Подробное описание методики и способов выработки этих антител можно найти в патенте США No 6057098. Коротко, в методологии применяют «пэннинг»-метод в жестких условиях в отношении фаговых библиотек, которые экспонируют антиген-связывающие фрагменты (Fab). После нескольких раундов «пэннинга» получили библиотеку, названную Omniclonal («содержащая все клоны»), которая была обогащена рекомбинантными Fab-фрагментами, содержащими вариабельные области легкой и тяжелой цепи, которые связываются с сиглеком-15 с высокой аффинностью и специфичностью. Из этой библиотеки, более точно названной Omniclonal AL0025Z1, приготовили 96 индивидуальных рекомбинантных моноклональных Fab-фрагментов с применением клеток E. coli и испытали их связывание с сиглеком-15.

Для измерения относительного связывания каждого индивидуального моноклонального антитела рекомбинантный Fc-сиглек-1520-259 человека продуцировали в клетках 293E, применяя технологию крупномасштабной временной трансфекции (Durocher et al., 2002; Durocher, 2004). Эталонный 96-луночный планшет препаратов моноклональных молекул содержал различные концентрации очищенных Fab-фрагментов против сиглека-15 в каждой лунке. Второй стоковый эталонный планшет приготовили разведением Fab-фрагментов до конечной концентрации 10 мкг/мл и из этого планшета производили все последующие разведения для измерений методом ELISA. Для проведения связывания Fc-сиглека-15 с препаратами моноклональных молекул белок Fc-сиглек-1520-259 биотинилировали с применением NHS-биотина (Pierce, Рокфорд, Иллинойс, США) и внесли из расчета 10 нг/лунку на 96-луночный планшет со стрептавидиновым покрытием. Один нанограмм каждого препарата моноклональных Fab-фрагментов добавили в каждую лунку и инкубировали при комнатной температуре в течение 30 мин. Связанное антитело детектировали с помощью конъюгированного с пероксидазой хрена антитела мыши против каппа-легкой цепи в присутствии жидкого субстрата ТМБ (Sigma-Aldrich Canada Ltd., Оуквилл, Онтарио, Канада) и проводили считывание при 450 нм в ридере для титрационных микропланшетов. Как показано на фиг. 4A, в сумме 53 (выделены темно-серым цветом) моноклональных антител продемонстрировали существенное связывание при данном анализе (>0,2 условных единиц OD450). Антитела специально разбавили до 1 нг/лунку, чтобы выделить те антитела, которые связываются с сиглеком-15 с наибольшей аффинностью. Так как антитела были выработаны с применением только Fc-химерного белка, моноклональные молекулы также тестировали методом ELISA с применением только биотинилированного Fc-домена. Как показано на фиг. 4B, 17 антител взаимодействовали с фрагментом Fc в составе Fc-сиглек-1520-259 (выделены светло-серым цветом). Значения, выделенные жирным шрифтом (см. фиг. 4), представляют примеры антител 25A1, 25B4, 25B8, 25C1, 25D8, 25E5, 25E6 и 25E9. Эти данные также выявили, что связывание антител варьировало от лунки к лунке, свидетельствуя о том, что они имеют разные уровни аффинности в отношении сиглека-15.

Заявитель заметил, что антитело или антиген-связывающий фрагмент по настоящему изобретению может эффективно связываться с антигеном, фактически, было обнаружено, что 1 нг антитела способен связаться с менее чем 500 нг SEQ ID NO: 2.

Специфичность этих антител к сиглеку-15 оценивали, испытывая их связывание с двумя другими членами семейства сиглеков, CD33 и сиглек-2. CD33 (номер доступа в GeneBank™ NM_001772.3) является прототипом CD33-родственного семейства сиглеков: среди белков человека эти сиглеки имеют наибольшее сходство аминокислотной последовательности с сиглеком-15 (примерно 29% идентичности последовательности между двумя их соответствующими N-концевыми Ig-подобными доменами). Сиглек-2 (номер доступа в GeneBank™ NM_001771.3) имеет меньшее сходство (23% идентичность последовательности), но как и сиглек-15, и в отличие от большинства других сиглеков, он обладает существенным предпочтением связывания с α2-6-сшитыми конъюгатами сиаловых кислот (Angata 2007, Blixt 2003). Последовательности, включающие V-подобные и N-концевые C2-подобные Ig домены сиглека-2 и CD33 (соответствующие области сиглека-15, примененной в качестве антигена для выработки антител), клонировали из библиотеки кДНК МКПК человека в вектор pYD5. Супернатанты от клеток 293-6E, трансфецированных этими конструкциями, а также от нетрансфецированных клеток 293-6E или клеток, трансфецированных pYD5-сиглек-15 или вектором pYD5 без вставки, проанализировали иммуноблоттингом с применением антитела против Fc для оценки уровней экспрессии (фиг. 14A). Трансфекция этими конструкциями привела к экспрессии Fc-меченных белков с ожидаемым размером (фиг. 14A). Аликвоты этих супернатантов адсорбировали на мембране ПВДФ с помощью вакуумного дот-блоттинга (прибор Bio-dot компании Bio-Rad), и оценили связывание выбранных для примера моноклональных антител против сиглека-15 (вестерн-блот не применяли, так как многие антитела реагируют только с нативной, неденатурированной формой сиглека-15). В качестве контролей использовали антитела против Fc и против сиглека-15, содержащиеся во всех клонах (omniclonal), которые реагировали со всеми четырьмя Fc-меченными белками (фиг. 14B). В противоположность этому, моноклональные антитела D8 и E9 не демонстрируют детектируемого связывания с Fc отдельно, сиглеком-2 или CD33, что свидетельствует о том, что они высокоспецифичны в отношении сиглека-15.

Пример 3

В этом примере раскрыты способы, примененные для конвертации Fab в полноразмерные химерные моноклональные антитела IgG2-типа. Схема методологии показана на фиг. 5.

Для проведения исследований in vitro и in vivo с целью оценки биологической функции антигена, вариабельные области легкой и тяжелой цепей, содержащиеся в Fab-фрагментах, перенесли в полноразмерный каркас антитела с образованием химерных IgG2 мышь-человек. Экспрессионные векторы для легких и тяжелых цепей иммуноглобулина сконструировали таким образом, чтобы i) заменить исходную последовательность бактериального сигнального пептида перед Fab-экспрессионными векторами на сигнальные пептиды млекопитающих и ii) заменить консервативные области легких и тяжелых цепей в антителах мыши на консервативные области человека. В способах осуществления такого переноса применяли стандартные методики молекулярной биологии, известные специалистам в данной области. Краткое описание методологии приведено в этом документе (см. фиг. 5).

Экспрессионный вектор для легкой цепи - существующая экспрессионная плазмида для клеток млекопитающих, называемая pTTVH8G (Durocher et al., 2002), сконструированная для применения в системе временной трансфекции в клетках 293E, была модифицирована таким образом, чтобы она содержала вариабельную область легкой цепи антитела мыши. Полученная в результате химерная легкая цепь мышь-человек содержала вариабельную область антитела мыши, за которой следовал каппа-консервативный домен антитела человека. Последовательность кДНК, кодирующую каппа-консервативный домен антитела человека, амплифицировали с помощью ПЦР с праймерами OGS1773 и OGS1774 (SEQ ID NO: 127 и 128, соответственно). Нуклеотидная последовательность и соответствующая аминокислотная последовательность каппа-консервативной области антитела человека показаны в SEQ ID NO: 129 и 130, соответственно. Полученный в результате продукт ПЦР размером 321 п.н. лигировали в pTTVH8G непосредственно после последовательности сигнального пептида из гена человека VEGF A (NM_003376). В ходе этого этапа клонирования также были внесены уникальные сайты для эндонуклеаз рестрикции, что позволило произвести точное позиционирование кДНК, кодирующих вариабельные области легкой цепи антитела мыши. Последовательность полученной в результате экспрессионной плазмиды, названной pTTVK1, показана в SEQ ID NO: 131. На основании последовательностей, раскрытых в таблице 2, были сконструированы праймеры для ПЦР, специфичные к вариабельным областям легких цепей антител 25A1, 25B4, 25B8, 25C1, 25D8, 25E5, 25E6 и 25E9 (SEQ ID NO: 37, 41, 45, 49, 53, 57, 61 и 65, соответственно), которые содержали на своем 5'-конце последовательность, идентичную последним 20 п.н. последовательности, кодирующей сигнальный пептид из VEGF A. Последовательности этих праймеров показаны в SEQ ID NO: 132 для 25A1; SEQ ID NO: 133 для 25B4, 25B8, 25C1, 25D8 и 25E9; SEQ ID NO: 134 для 25E5 и SEQ ID NO: 135 для 25E6, соответственно. Один и тот же обратный праймер применяли для амплификации всех четырех последовательностей вариабельных областей легкой цепи, так как их 3'-концы, идентичны. В этом праймере (SEQ ID NO: 136) на его 3'-конце вставлена последовательность, идентичная первым 20 п.н. каппа-консервативного домена антитела человека. Как ПЦР-фрагменты, так и расщепленную pTTVK1 обработали с помощью 3'-5'-экзонуклеазной активности T4 ДНК-полимеразы, получив в результате комплементарные концы, которые соединили путем отжига. Продукты реакций отжига перенесли в компетентные клетки E. coli, и провели верификацию экспрессионных плазмид с помощью секвенирования, чтобы удостовериться в том, что вариабельные области легкой цепи антитела мыши были правильно вставлены в экспрессионный вектор pTTVK1. Специалисту в данной области будет ясно, что способ, примененный для конструирования экспрессионных плазмид для легких цепей, применим ко всем антителам против сиглека-15, содержащимся в исходной библиотеке Fab-фрагментов.

Экспрессионный вектор для тяжелой цепи - экспрессионный вектор, продуцирующий тяжелые цепи иммуноглобулинов, был сконструирован способом, схожим с описанным выше для pTTVK1, для продукции легких цепей иммуноглобулинов. В случае химерных антител против сиглека-15 был необходим изотип IgG2, который является предпочтительным типом для стабильных, блокирующих антител. С этой целью консервативные области (CH1, CH2 и CH3) иммуноглобулина человека IgG2 амплифицировали и лигировали в созданный ранее экспрессионный вектор для IgG1, и подробное описание способов приведено в этом документе. Плазмиду pYD11 (Durocher et al., 2002), которая содержит последовательность сигнального пептида из IgGK человека, а также области CH2 и CH3 из Fc-домена IgG1 человека, модифицировали лигированием последовательности кДНК, кодирующей консервативную область CH1 антитела человека. Праймеры для ПЦР OGS1769 и OGS1770 (SEQ ID NO: 137 и 138), сконструированные таким образом, чтобы они содержали уникальные сайты для эндонуклеаз рестрикции, применяли для амплификации области CH1 из IgG1 человека, содержащей нуклеотидную последовательность и соответствующую аминокислотной последовательности, показанным в SEQ ID NO: 139 и 140. После лигирования фрагмента размером 309 п.н. области CH1 антитела человека непосредственно после последовательности сигнального пептида из IgGK провели расщепление полученной плазмиды ферментами рестрикции ApaI и NsiI. Эти ферменты, которые расщепляют кДНК консервативных областей как из IgG1, так и из IgG2 в одинаковых положениях, и это позволяет заместить консервативную область из IgG1 на последовательность из IgG2 человека в экспрессионном векторе. кДНК, кодирующую консервативные области из IgG2 человека, получили из коммерческого источника (Open Biosystems, Хантсвилл, Алабама, США). Окончательный вариант плазмиды, примененный для экспрессии тяжелой цепи иммуноглобулина IgG2, был назван pYD19, и ее последовательность показана в SEQ ID NO: 141. При лигировании выбранной вариабельной области тяжелой цепи в этот вектор полученная плазмида кодирует полноразмерную тяжелую цепь иммуноглобулина IgG2 с консервативными областями антитела человека. На основании последовательностей, раскрытых в таблице 2, были сконструированы праймеры для ПЦР, специфичные к вариабельным областям тяжелых цепей антител 25A1, 25B4, 25B8, 25C1, 25D8, 25E5, 25E6 и 25E9 (SEQ ID NO: 39, 43, 47, 51, 55, 59, 63 и 67, соответственно), которые содержали на своем 5'-конце последовательность, идентичную последним 20 п.н. последовательности, кодирующей сигнальный пептид из IgGK. Последовательности этих праймеров показаны в SEQ ID NO: 142 для 25A1; SEQ ID NO: 143 для 24B4 и 25D8, SEQ ID NO: 144 для 25B8, 25C1 и 25E9; SEQ ID NO: 145 для 25E5 и SEQ ID NO: 146 для 25E6, соответственно. Один и тот же обратный праймер применяли для амплификации всех четырех последовательностей вариабельных областей тяжелой цепи, так как их 3'-концы идентичны. В этом праймере (SEQ ID NO: 147) на его 3'-конце вставлена последовательность, идентичная первым 20 п.н. консервативного домена CH1 антитела человека. Как ПЦР-фрагменты, так и расщепленную pYD19 обработали с помощью 3'-5'-экзонуклеазной активности T4 ДНК-полимеразы, получив в результате комплементарные концы, которые соединили путем отжига. Продукты реакций отжига перенесли в компетентные клетки E. coli, и провели верификацию экспрессионных плазмид с помощью секвенирования, чтобы удостовериться в том, что вариабельные области тяжелой цепи антитела мыши были правильно вставлены в экспрессионный вектор pYD19. Специалисту в данной области будет ясно, что способ, примененный для конструирования экспрессионных плазмид для тяжелых цепей, применим ко всем антителам против сиглека-15, содержащимся в исходной библиотеке Fab-фрагментов.

Экспрессия IgG2 человека в клетках 293E - Экспрессионные векторы, приготовленные как описано выше, которые кодировали легкие и тяжелые цепи иммуноглобулинов, экспрессировали в клетках 293E, применяя систему временной трансфекции (Durocher et al., 2002). Благодаря сигнальным пептидам, вставленным в амино-концы обеих цепей иммуноглобулинов, зрелый IgG2 выделяли из бессывороточной культуральной среды клеток. Способы, применяемые для ко-трансфекции экспрессионных векторов для легкой и тяжелой цепей, были описаны в этом документе. Из расчета на каждый миллилитр клеток, один микрограмм комбинации экспрессионных плазмид для легкой и тяжелой цепей трансфецировали в клетки 293E, выращенные в суспензии до плотности 1,5-2,0 млн. клеток/мл. Соотношение плазмид для легкой и тяжелой цепей оптимизировали так, чтобы достичь наибольшего выхода антитела в культуральной среде, и было обнаружено, что это соотношение равно 9:1 (L:H). В качестве реагента для трансфекции применяли полиэтиленимин (ПЭИ) (линейный, с молекулярной массой 25000, кат. NO 23966, Polysciences, Inc., Уоррингтон, Пенсильвания, США), который добавляли в соотношении ДНК:ПЭИ, равном 1:3. Рост клеток продолжался в течение 5 дней, после чего собрали культуральную среду для очистки химерных моноклональных антител IgG2. Белок очищали с применением агарозы с белком A согласно рекомендациям производителя (Sigma-Aldrich Canada Ltd., Оуквилл, Онтарио, Канада).

Для более точного определения относительной аффинности связывания выбранных моноклональных молекул инкубировали возрастающие концентрации Fab-фрагментов с биотинилированным белком Fc-сиглек-1520-259. Десять нанограмм биотинилированного белка Fc-сиглек-1520-259 нанесли в титрационный микропланшет со стрептавидиновым покрытием и добавили возрастающие количества либо Fab-фрагментов, либо химерных моноклональных IgG2: 25B4, 25B8, 25C1, 25D8, 25E6 и 25E9, как указано на фиг. 6. Как изображено на фиг. 6, связывание химерных моноклональных IgG2: 25B4, 25B8, 25C1, 25D8, 25E6 и 25E9 было очень схоже с таковым в случае Fab-фрагментов. Этот результат демонстрирует, что перенос вариабельных доменов из Fab-фрагментов антител мыши в каркасную структуру IgG2 человека не оказал существенного влияния на способность вариабельных областей легкой и тяжелой цепей осуществлять связывание сиглека-15.

Пример 4

Данный пример описывает применение антител против сиглека-15 для ингибирования дифференцировки остеокластов.

МКПК человека (AHCells, Эмеривилл, Калифорния, США) поместили в соответствующую культуральную среду на 24 ч при 37°C в атмосфере 5% CO2. Клетки рассеяли в 96-луночные планшеты при плотности клеток 100000 клеток/мл и обработали возрастающими концентрациями (0,01 мкг/мл - 100 мкг/мл) химерных моноклональных антител IgG2 против сиглека-15 в присутствии 35 нг/мл М-КСФ и 30 нг/мл RANKL. Недифференцированные клетки-предшественники обрабатывали только М-КСФ. В контрольные лунки добавляли IgG2, не связывающиеся с сиглеком-15. Клетки фиксировали, окрашивали TRAP и производили подсчет и фотографирование многоядерных клеток (при 40X увеличении). Как показано на фиг. 7, моноклональные антитела, нацеленные на сиглек-15, были способны эффективно ингибировать дифференцировку остеокластов человека дозозависимым образом. Ингибирование дифференцировки остеокластов наблюдали в различной степени у каждого протестированного в качестве примера антитела против сиглека-15, но наиболее активными моноклональными антителами были 25B8, 25E6 и 25E9. Клетки, обработанные контрольным химерным IgG2, не ингибировались (см. нижнюю правую панель на фиг. 8, контрольный IgG2). Этот результат полностью согласуется с экспериментами, описанными Сокнананом (Sooknanan et al., 2007), в которых было показано, что нокдаун экспрессии сиглека-15 с помощью РНК-интерференции вызывал ингибирование дифференцировки остеокластов человека.

Биологическая функция дифференцированных остеокластов заключается в резорбции кости, и, таким образом, активность остеокластов также должна ингибироваться антителами, нацеленными на сиглек-15. Для проверки этого предположения МКПК человека посеяли на диски с синтетическим субстратом фосфата кальция (BD BioCoatТМ OsteologicТМ MultiTest Slides) и культивировали в условиях, схожих с описанными выше. Клетки-предшественники обрабатывали М-КСФ и RANKL в присутствии либо IgG для контроля изотипа, либо антител против сиглека-15: 25D8 или 25E9. Антитела присутствовали в концентрации 1 мкг/мл или 10 мкг/мл. В контрольных лунках без обработки присутствовали полностью созревшие остеокласты. Клетки соскребали с дисков, и оставшийся костный субстрат окрашивали с применением стандартного окрашивания по ван Коссу, при котором минеральный кальций приобретает коричневый цвет. Как показано на фиг. 12, лунки, содержащие недифференцированные остеокласты (верхняя левая панель, М-КСФ) не демонстрировали признаки деградации субстрата, которые проявляются как белые пятна на поверхности (деградационные ямки). Как и ожидалось, клетки, обработанные RANKL, имели признаки существенной деградации, и на поверхности присутствовали многочисленные ямки (нижняя левая панель, М-КСФ + RANKL). Схожим образом, остеокласты, обработанные контрольным IgG, также могли деградировать костный субстрат, что демонстрировало тот факт, что данные контрольные антитела не ингибировали неспецифично активность остеокластов. Когда дифференцирующиеся остеокласты обработали антителами против сиглека-15, кандидатное антитело 25E9 эффективно ингибировало деградацию кости при данном анализе (фиг. 12, правые панели). В противоположность этому, антитело 25D8 не ингибировало деградацию при данном анализе (см. фиг. 12, средние панели справа). Обобщая, эти результаты (фиг. 7 и фиг. 12) демонстрируют, что антитела против сиглека-15 ингибируют дифференцировку остеокластов и активность по деградации кости.

В параллельном эксперименте МКПК мыши обрабатывали схожим образом. Как показано на фиг. 8, химерные антитела против сиглека-15 были способны ингибировать дифференцировку остеокластов мыши, как было показано на примере химерных моноклональных антител, обозначенных 25B8, 25E6 и 25D8. Этот результат подтверждает, что моноклональные антитела, которые были выработаны против ортологичного сиглека-15 человека, также обладают перекрестной реактивностью в отношении белка сиглека-15 мыши. Это было экспериментально подтверждено с помощью ELISA. Амплифицировали фрагмент кДНК сиглека-15 мыши, соответствующий аминокислотам 21-256, применяя олигонуклеотиды, содержащие последовательности, показанные в SEQ ID NO: 159 и 160. Этот ПЦР-фрагмент лигировали в экспрессионный вектор pYD5, как было описано для фрагмента сиглека-15 человека, для экспрессии в клетках 293-6E. Рекомбинантные Fc-сиглек мыши-15 очистили с применением аффинной хроматографии на смоле с белком-A.

Выбранный в качестве примера моноклональный Fab-фрагмент против сиглека-15, обозначенный 25C8, инкубировали либо с Fc-сиглек человека (h)-1520-259, либо с Fc-сиглек мыши (m)-1521-256. Результаты (см. фиг. 9) свидетельствуют, что активность связывания антител, выработанных против сиглека-15 человека, также дает перекрестную реакцию с ортологичным сиглеком-15 мыши.

Описанные выше результаты ясно демонстрируют важность сиглека-15 в остеокластогенезе. Ослабление экспрессии сиглека-15 в клетках-предшественниках остеокластов приводит к образованию клеток, у которых в существенной степени снижена способность образовывать многоядерные зрелые остеокласты. Таким образом, нацеливание на сиглек-15 ингибитора, в частности, терапевтического моноклонального антитела, обеспечило бы в высокой степени селективный путь для нацеливания на те клетки, которые непосредственно отвечают за деградацию костей во время острой фазы метастатического рака кости или хронического остеопороза.

Пример 5

Данный пример относится к способности антител против сиглека-15 блокировать связывание сиглека-15 с конъюгатами сиаловых кислот (SA).

Образование сиалированных гликобелков необходимо для правильного остеокластогенеза (Takahata et al., 2007). Сиглек-15 связывается с сиаловой кислотой, и это связывание зависит от аминокислотного остатка R143 (Angata 2007). Один из механизмов, с помощью которого антитела против сиглека-15 могли бы ингибировать образование остеокластов, может включать создание помех для мишени при осуществлении ею функции по связыванию с сиаловыми кислотами посредством взаимодействий с эпитопом, содержащим R143. Для проверки этой возможности провели анализ на основе ELISA для испытания способности антител против сиглека-15 блокировать связывание рекомбинантного белка Fc-сиглек-15 с конъюгатом Neu5Aca2-6-GalNAc-ПАА-биотин (Glycotech, Роквилл, Мэриленд, США), который является предпочтительным содержащим сиаловые кислоты партнером для связывания для сиглека-15 (Angata 2007). Белок Fc-сиглек-15 иммобилизовали на титрационном микропланшете с покрытием из белка A, и затем добавляли различные антитела против сиглека-15. После инкубации и удаления несвязанного антитела добавляли Neu5Aca2-6-GalNAc-ПАА-биотин. Этот биотинилированный зонд должен образовывать комплекс с сиглеком-15 только тогда, когда антитело не блокирует сайт связывания с сиаловой кислотой. Присутствие биотинилированного зонда детектировали с применением стандартных методов с конъюгатом стрептавидин-пероксидаза хрена. Как показано на фиг. 15, препарат, содержащий все клоны антител против сиглека-15 (omniclonal) и антитела 25D8 ингибируют связывание с сиаловой кислотой, при сравнении с не нацеленным, контрольным антителом. Антитело E6 также обладает явным, но менее выраженным, эффектом. Антитело E9 обладает слабым эффектом, что свидетельствует о том, что его эпитоп не перекрывается с сайтом связывания с сиаловыми кислотами. Добавление контрольного антитела (фиг. 15, см. контрольный IgG2) не предотвращало связывание фрагмента сиаловой кислоты с сиглеком-15. Способ имел высокую степень зависимости от присутствия сиглека-15, так как не было детектировано связывания при нанесении на планшеты только Fc, а также не наблюдалось связывания в отсутствии сиаловых кислот (фиг. 15, см. без сиаловой кислоты, Fc + сиаловая кислота и только Fc). Обобщая, эти результаты демонстрируют, что моноклональные антитела против сиглека-15 могут препятствовать, в различной степени, функции связывания с сиаловыми кислотами сиглека-15, вероятно, благодаря взаимодействиям поблизости от R143. Это свойство может оказаться важным для их воздействия на остеокластогенез.

СПИСОК ЦИТИРУЕМОЙ ЛИТЕРАТУРЫ

Frost H.M., 1964 Dymanics of Bone Remodelling. In: Bone Biodynamics, Little and Brown, Boston, MA, USA pp.315;

Baron, R., Anatomy and Biology of Bone Matrix and Cellular Elements, In: Primer on the Metabolic Bone Diseases and Disorders of Mineral Metabolism, Fifth Edition 2003, American Society for Bone and Mineral Research, Washington DC, pp.1-8;

Jilka, R. L. et al., "Increased Osteoclast Development After Estrogen Loss: Mediation by Interleukin-6", Science 257: 88-91 (1992).

Poli, V. et al., "Interleukin-6 deficient mice are protected from bone loss caused by estrogen depletion", EMBO J 13: 1189-1196 (1994).

Srivastava, S. et al., "Estrogen Blocks M-CSF Gene Expression and Osteoclast Formation by Regulating Phosphorylation of Egr-1 and Its Interaction with Sp-1", J Clin Invest 102: 1850-1859 (1998).

de Vernejoul, M. C., "Dynamics of Bone Remodelling: Biochemical and Pathophysiological Basis", Eur J Clin Chem Clin Biochem 34: 729-734 (1996).

McMillan, S.J. and P.R. Crocker, “CD33-related sialic-acid-binding immunoglobulin-like lectins in health and disease”, Carbohydr Res, 343(12): p. 2050-6 (2008).

Crocker, P.R., J.C. Paulson, and A. Varki, Siglecs and their roles in the immune system. Nat Rev Immunol, 7(4): p. 255-66 (2007).

Angata, T., et al., Siglec-15: an immune system Siglec conserved throughout vertebrate evolution. Glycobiology, 17(8): p. 838-46 (2007).

Sooknanan, R. R., “Polynucleotides and polypeptide sequences involved in the process of bone remodelling”, PCT/CA2007/000210 (2007).

Takahata, M., et al., Sialylation of cell surface glycoconjugates is essential for osteoclastogenesis. Bone, 41(1): p. 77-86 (2007).

Ellis, G. K. et al., “Randomized Trial of Denosumab in Patients Receiving Adjuvant Aromatase Inhibitors for Nonmetastatic Breast Cancer”, J Clin Oncol 26: 4875-4882 (2008).

Buechler J, Valkirs G, Gray J. “Polyvalent display libraries”. U.S. 6,057,098 (2000).

Durocher Y, Kamen A, Perret S, Pham PL. “Enhanced production of recombinant proteins by transient transfection of suspension-growing mammalian cells”. Canadian patent application No. CA 2446185 (2002).

Durocher Y. “Expression vectors for enhanced transient gene expression and mammalian cells expressing them”. U.S. patent application No. 60/662,392 (2004).

Shankavaram, U. T. et al., “Transcript and protein expression profiles of the NCI-60 cancer panel: an integromic microarray study”, Mol Cancer Ther 6: 820-832 (2007).

Blixt O. et al., “Sialoside specificity of the siglec family assessed using novel multivalent probes”, J Biol Chem, 278, 31007-31019.

1. Выделенное антитело или его антиген-связывающий фрагмент, которые специфически связываются с сиалосвязывающим лектином суперсемейства иммуноглобулинов 15 (Siglec-15; SEQ ID NO: 2), где антитело или его антиген-связывающий фрагмент содержит:
вариабельную область легкой цепи, содержащую три гипервариабельные области с последовательностями SEQ ID NO: 111; SEQ ID NO: 112 и SEQ ID NO: 113, и
вариабельную область тяжелой цепи, содержащую три гипервариабельные области с последовательностями SEQ ID NO: 114; SEQ ID NO: 115 и SEQ ID NO: 116.

2. Выделенное антитело или его антиген-связывающий фрагмент по п. 1, где вариабельная область легкой цепи представляет собой SEQ ID NO: 66, а вариабельная область тяжелой цепи представляет собой SEQ ID NO: 68.

3. Выделенное антитело или его антиген-связывающий фрагмент по п. 1, где вариабельная область легкой цепи по меньшей мере на 70% идентична последовательности SEQ ID NO: 66, а вариабельная область тяжелой цепи по меньшей мере на 70% идентична последовательности SEQ ID NO: 68.

4. Выделенное антитело или его антиген-связывающий фрагмент, которое специфично связывается с Siglec-15, где антитело или его антиген-связывающий фрагмент содержит:
а) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 38 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 40;
b) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 42 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 44;
c) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 46 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 48;
d) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 50 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 52;
e) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 54 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 56;
f) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 58 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 60;
g) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 62 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 64;
h) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 66 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 68;
i) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 162 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 164;
j) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 166 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 168;
k) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 170 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 172, или
l) три гипервариабельные области легкой цепи с последовательностью SEQ ID NO: 50 и три гипервариабельные области тяжелой цепи с последовательностью SEQ ID NO: 68.

5. Выделенное антитело или его антиген-связывающий фрагмент по п. 4, где указанное антитело или его антиген-связывающий фрагмент содержит:
a) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 194 и содержит три аминокислотных последовательности трех гипервариабельных областей вариабельного домена легкой цепи последовательности SEQ ID NO: 54, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 191 и содержит три аминокислотных последовательности трех гипервариабельных областей вариабельного домена тяжелой цепи последовательности SEQ ID NO: 56;
b) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 196, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 193, и
i) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 66 и три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 68,
ii) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 50 и три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 52,
iii) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 46 и три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 48, или
iv) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 50 и три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 68;
c) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 38, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 40;
d) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 42, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 44;
e) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 46, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 48;
f) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 50, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 52;
g) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 54, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 56;
h) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 58, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 60;
i) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 62, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 64;
j) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 66, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 68;
k) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 162, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 164;
l) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 166, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 168; или
m) вариабельный домен легкой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 170, и вариабельный домен тяжелой цепи, который по меньшей мере на 70% идентичен последовательности SEQ ID NO: 172.

6. Выделенное антитело или его антиген-связывающий фрагмент по п. 5, отличающийся тем, что содержит:
a) вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 66, и вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 68;
b) вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 54, и вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 56; или
c) вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 62, и вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 64.

7. Выделенное антитело или его антиген-связывающий фрагмент по п. 4, где антитело или его антиген-связывающий фрагмент содержит:
a) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 46, где указанные гипервариабельные области включают аминокислотные последовательности SEQ ID NO: 81; SEQ ID NO: 82 и SEQ ID NO: 83, и
b) три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 48, где указанные гипервариабельные области включают аминокислотные последовательности SEQ ID NO: 84; SEQ ID NO: 85 и SEQ ID NO: 86.

8. Выделенное антитело или его антиген-связывающий фрагмент по п. 4, где антитело или его антиген-связывающий фрагмент содержит:
a) три гипервариабельные области вариабельного домена легкой цепи с последовательностью SEQ ID NO: 50, где указанные гипервариабельные области включают аминокислотные последовательности SEQ ID NO: 87; SEQ ID NO: 88 и SEQ ID NO: 89, и
b) три гипервариабельные области вариабельного домена тяжелой цепи с последовательностью SEQ ID NO: 52, где указанные гипервариабельные области включают аминокислотные последовательности SEQ ID NO: 90; SEQ ID NO: 91 и SEQ ID NO: 92.

9. Конъюгат, содержащий антитело или его антиген-связывающий фрагмент, содержащие вариабельный домен легкой цепи, содержащий три гипервариабельные области с последовательностями SEQ ID NO: 111, SEQ ID NO: 112 и SEQ ID NO: 113, и вариабельный домен тяжелой цепи, содержащий три гипервариабельные области с последовательностями SEQ ID NO: 114, SEQ ID NO: 115 и SEQ ID NO: 116, где указанный конъюгат способен к нацеливанию на остеокластные клетки и содержит группу, способную к детекции, или цитотоксическую группу для уничтожения или ингибирования остеокластных клеток.

10. Конъюгат по п. 9, где вариабельный домен легкой цепи представляет собой последовательность SEQ ID NO: 66, а вариабельный домен тяжелой цепи представляет собой последовательность SEQ ID NO: 68.

11. Нуклеиновая кислота, кодирующая вариабельный домен легкой цепи антитела или его антиген-связывающего фрагмента по любому из пп. 1-8 для экспрессии или кодирования антитела или его антиген-связывающего фрагмента по любому из пп. 1-8.

12. Нуклеиновая кислота, кодирующая вариабельный домен тяжелой цепи антитела или его антиген-связывающего фрагмента по любому из пп. 1-8 для экспрессии или кодирования антитела или его антиген-связывающего фрагмента по любому из пп. 1-8.

13. Нуклеиновая кислота, кодирующая вариабельный домен легкой цепи и вариабельный домен тяжелой цепи антитела или его антиген-связывающего фрагмента по любому из пп. 1-8.

14. Вектор экспрессии, содержащий нуклеиновую кислоту по любому из пп. 11-13 для экспрессии или кодирования антитела или его антиген-связывающего фрагмента по любому из пп. 1-8.

15. Выделенная клетка для продукции антитела, содержащая нуклеиновую кислоту по любому из пп. 11-13, вектор экспрессии по п. 14 или содержащая или экспрессирующая антитело или его антиген-связывающий фрагмент по любому из пп. 1-8.

16. Фармацевтическая композиция для лечения потери костной массы или детекции остеокластов, содержащая терапевтически эффективное количество по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-3, 9 или 10 и фармацевтически приемлемый носитель.

17. Композиция для лечения потери костной массы или детекции остеокластов, содержащая терапевтически эффективное количество по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-3, 9 или 10 и фармацевтически приемлемый носитель.

18. Применение по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-3, 9 или 10 для получения лекарственного препарата для лечения потери костной массы.

19. Применение по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-3, 9 или 10 для лечения потери костной массы или рака.

20. Применение по п. 18 или 19, где потеря костной массы связана с раком.

21. Применение по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-10 для диагностики потери костной массы.

22. Применение по п. 21, где потеря костной массы связана с раком.

23. Способ лечения потери костной массы, где способ включает введение по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-3, 9 или 10 млекопитающему, если необходимо.

24. Способ по п. 23, где потеря костной массы связана с раком.

25. Способ детекции потери костной массы, где способ включает введение по меньшей мере одного антитела или его антиген-связывающего фрагмента по любому из пп. 1-10 млекопитающему, если необходимо.

26. Способ по п. 25, где потеря костной массы связана с раком.



 

Похожие патенты:

Настоящее изобретение относится к области иммунологии. Предложено выделенное антитело и его антигенсвязывающий фрагмент, которые специфически связываются с индуцируемым глюкокортикоидами рецептором TNF (GITR) человека; а также композиции, в том числе фармацевтическая композиция, и способ усиления иммунного ответа у человека.

Изобретение относится к области биотехнологии и иммунологии Описаны выделенные антитела и их фрагменты, которые связываются с опухолевыми антигенами. Также описаны композиции и агенты для доставки, которые включают раскрываемые антитела; клетки, которые продуцируют эти антитела; способы продуцирования этих антител; способы применения этих антител, нацеливания на опухоли и/или метастатические клетки, образуемые ими, и/или опухолевые стволовые клетки, и лечение опухолей и/или метастатических клеток, образуемых ими, и/или опухолевых стволовых клеток; и способы прогнозирования рецидива рака у субъекта.

Изобретение относится к области биотехнологии и клеточной инженерии. Предложен способ получения выделенного терапевтического рекомбинантного биологического полипептида или белка для лечения заболевания.

Настоящие изобретения относятся к области ветеринарных вакцин, в частности к области векторных вакцин для домашних птиц, основанных на рекомбинантном непатогенном вирусе болезни Марека (npMDV).

Изобретение относится к области биотехнологии, конкретно к антагонистам Wnt, и может быть использовано в медицине. С использованием сигнальной последовательности получают Wnt-связывающие полипептиды на основе домена Fri из FZD8 человека и Fc-фрагмента.

Изобретение относится к области биохимии. Заявлено антитело, связывающееся с рецептором клеточной поверхности DR5.

Изобретение относится к биотехнологии. Предложено выделенное антитело, которое специфически связывается по меньшей мере с одним из собачьего интерлейкина-31 (IL-31) или кошачьего IL-31.

Группа изобретений относится к области культивирования клеток. Предложена пластина, выполненная с возможностью переворачивания для образования висячих капель для культивирования клеток, комплект пластин для переноса трехмерных клеточных совокупностей и способ тестирования вещества на токсичность по отношению к клеткам.

Настоящее изобретение относится к области иммунологии. Предложено выделенное биспецифическое антитело, которое связывается с двумя различными областями белка 6 рецептора липопротеинов низкой плотности (LRP6).

Данное изобретение относится к области иммунологии. Предложено выделенное моноклональное антитело к FcRH5 человека, охарактеризованное последовательностями гипервариабельных участков (HVR), и его антигенсвязывающий фрагмент.

Настоящее изобретение относится к области иммунологии. Предложено выделенное антитело и его антигенсвязывающий фрагмент, которые специфически связываются с индуцируемым глюкокортикоидами рецептором TNF (GITR) человека; а также композиции, в том числе фармацевтическая композиция, и способ усиления иммунного ответа у человека.

Настоящее изобретение относится к биотехнологии, конкретно к новым аллергенам собаки, и может быть использовано в медицине. Рекомбинантным путем получают аллерген Can f 4.

Изобретение относится к области биохимии. Заявлено антитело, связывающееся с рецептором клеточной поверхности DR5.

Изобретение относится к области биотехнологии, в частности к рекомбинантной плазмидной ДНК, созданной при помощи новых праймеров CTTCCATATGGAACGAAGGCGTTTGTG и TGTGGATCCAGCTAGTTAGGCATGAAA. Указанная рекомбинантная плазмидная ДНК используется для получения рекомбинантного белка PRAME-F, состоящего из пептида MGSSHHHHHHSSGLVPRGSH слитого с последовательностью природного белка PRAME, путём её экспрессии в бактериальных клетках.

Изобретение относится к биотехнологии и касается способа производства препарата «Мобилан (M-VM3)». Изобретение оптимизирует стадии производства, повышая его рентабельность, делая оптимальным соотношение время производства/количество полученного препарата/количество средств, затраченных на производство.

Изобретение относится к биохимии. Описана молекула нуклеиновой кислоты для генетической терапии мукополисахаридозов.

Изобретение относится к биохимии. Описана конструкция триплетного антигена Treponema pallidum, которая включает три антигена к Treponema pallidum (TP15, TP17 и TP47), а также лидерную последовательность из десяти аминокислот (метка 261) и медь-цинк содержащую супероксиддисмутазу (hSOD) человека.

Группа изобретений относится к области вирусологии и биотехнологии. Бакуловирусный вектор для переноса содержит структуру, в которую встроены сдвоенный промотор и слитая ДНК.

Изобретение относится к биотехнологии. Предложено выделенное антитело, которое специфически связывается по меньшей мере с одним из собачьего интерлейкина-31 (IL-31) или кошачьего IL-31.

Изобретение относится к биотехнологии и представляет собой пептид, который имеет аминокислотную последовательность, состоящую из смежных аминокислот, полученных из белка WT1, и индуцирует WT1-специфические хелперные Т-клетки связыванием с молекулой МНС класса II.

Настоящее изобретение относится к области иммунологии. Предложено выделенное биспецифическое антитело, которое связывается с двумя различными областями белка 6 рецептора липопротеинов низкой плотности (LRP6).
Наверх