Гибридные белки-носители пептидов в качестве вакцин от аллергии



Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии
Гибридные белки-носители пептидов в качестве вакцин от аллергии

 


Владельцы патента RU 2630652:

БИОМЕЙ АГ (AT)

Изобретение относится к области биотехнологии, конкретно к полипептидам для лечения или предотвращения аллергий на аллергены пыльцы трав Ph1P1, пыльцы березы Betv1 и клеща домашней пыли Derp2, что может быть использовано в медицине. Полученные рекомбинантным путем полипептиды с SEQ ID NO: 14-19 и 149-152 используют в вакцинных композициях, предназначенных для лечения или предотвращения аллергии на соответствующий аллерген. Изобретение позволяет уменьшить количество побочных эффектов при вакцинации аллергенами Ph1P1, Betv1 и Derp2. 15 н. и 18 з.п. ф-лы, 20 ил., 7 табл., 27 пр.

 

Настоящее изобретение имеет отношение к новым полипептидам и их применению.

Аллергия I типа представляет собой опосредованное IgE состояние гиперчувствительности, поражающее почти 25% популяции. Она основывается на распознавании неопасных, присутствующих в воздухе или пищевых аллергенов, аллергенов насекомых и ядов животного происхождения, а также антигенов контактных аллергенов, происходящих по существу от безопасных источников антигенов, таких как пыльца, белки насекомых, грибов и животных, специфическим иммуноглобулином. Сшивание эффекторных связанных с клетками IgE антител приводит к высвобождению медиаторов воспаления (например, гистамина, лейкотриенов) и таким образом к симптомам, непосредственно связанным с аллергией (например, риноконъюнктивит, астма, дерматит, анафилактическая реакция). Активация Т-клеток через IgE-зависимый, а также IgE-независимый механизмы способствует хроническому аллергическому воспалению.

Единственным возможным видом лечения аллергии является аллерген-специфическая иммунотерапия, которая основывается на повторном введении увеличивающихся количеств экстрактов аллергенов в случае большинства источников. Многочисленные клинические исследования документально подтвердили клиническую эффективность инъекционной иммунотерапии, и имеются данные, указывающие на некоторые иммунологические механизмы, лежащие в основе этого лечения. Вследствие трудности приготовления экстрактов аллергенов высокого качества для некоторых источников аллергенов и того факта, что введение аллергенов пациентам может вызвать тяжелые побочные эффекты, аллерген-специфическая иммунотерапия может быть рекомендована только для некоторых групп пациентов и при определенных проявлениях болезни. Особенно трудно лечить пациентов с одновременной сенсибилизацией к нескольким разным источникам аллергенов и пациентов, страдающих от тяжелых проявлений болезни, таких как аллергическая астма. Аллергическая астма является одним из наиболее сильных проявлений аллергии, поскольку она существенно влияет на качество повседневной жизни, является частой причиной госпитализации и может проявляться в серьезных, угрожающих жизни формах, требующих интенсивного лечения пациентов.

Экстракты аллергенов, полученные из природных источников аллергенов являются неочищенными по природе, и нет возможности влиять на качество и количества отдельных аллергенов в таких препаратах с помощью технических средств. Они также содержат многочисленные неидентифицированные неаллергенные компоненты, причем некоторые последние исследования показывают плохое качество таких экстрактов и подтверждают их большую неоднородность.

За последнее десятилетие были получены колоссальные успехи в области молекулярной характеристики аллергенов с использованием метода рекомбинантных ДНК. Большое количество наиболее важных, вызывающих болезнь аллергенов охарактеризовано вплоть до молекулярного уровня, и были получены рекомбинантные аллергены, имитирующие эпитопную сложность экстрактов природных аллергенов. Более того, некоторые группы исследователей использовали знания относительно структур аллергенов для разработки новых вакцин от аллергии. Для уменьшения аллергической активности новых вакцин и, таким образом, величины вызванных лечением побочных эффектов, используется генная инженерия, синтетическая химия пептидов и конъюгация аллергенов с иммуностимулирующими ДНК-последовательностями. Были проведены первые обнадеживающие клинические исследования с такими производными аллергенов. Интересно заметить, что хотя IgE-реактивность генетически созданных рекомбинантных аллергенов и происходящих из аллергенов синтетических, содержащих Т-клеточный эпитоп пептидов могла быть сильно снижена или даже устранена, эти производные все еще могли вызывать системные побочные эффекты, появляющиеся через несколько часов после инъекции. Например, сообщалось, что содержащие Т-клеточный эпитоп пептиды основного кошачьего аллергена, Fel d 1, вызывали астму и гиперреактивность бронхов через несколько часов после подкожной инъекции, причем существует строгое доказательство, что этот эффект опосредуется Т-клетками и ограничивается МНС.

Эти результаты показывают, что устранение IgE-реактивности уменьшает побочные эффекты, опосредованные IgE, так как не было зарегистрировано аллергических реакций немедленного типа в ходе этих иммунотерапевтических исследований. Однако, аллерген-специфические Т-клеточные эпитопы, сохранившиеся в рекомбинантных производных аллергена, а также в пептидных смесях, являются ответственными за поздние побочные эффекты (например, очень проблематичный или атопический дерматит, хронические аллергические проявления на коже, опосредованные Т-клетками). Побочные эффекты, вызванные в случае рекомбинантных производных аллергенов, были относительно слабыми, и в случае Т-клеточных пептидных вакцин могут преодолеваться путем соответствующего подбора дозы. Соответственно, оба этих новых подхода кажутся весьма перспективными для иммунотерапии аллергических риноконъюнктивитов, но могут иметь ограничения, когда дело доходит до лечения некоторых форм аллергической астмы, поскольку индукция поздних побочных эффектов в легких может быть весьма проблематичной.

Для введения и соответственно для возбуждения эффективного иммунного ответа против пептидов, полипептидов и белков регулярно используют адъюванты (вспомогательные вещества) и/или носители. Например, одним из наиболее доступных адъювантов является полный адъювант Фрейнда (CFA). Существует необходимость в вакцинных композициях, способных вызывать сильные иммунные ответы против пептидов и полипептидов, происходящих от аллергенов и, разумеется, от других антигенов с применением или без применения полного адъюванта Фрейнда. В дополнение к этому, в то время как BSA успешно используется в качестве носителя на животных моделях, он может не подходить для применения в вакцинных композициях для человека из-за риска побочных реакций, таких как риск передачи прионной болезни (вариантная болезнь Крейтцфельдта-Якоба). Дополнительной проблемой для разработки эффективной вакцины против аллергенов является необходимость в иммунном ответе, способном быстро понижать аллергены у индивидуума или животного. Следовательно, необходимы высокие концентрации в крови аллерген-специфических антител, которые представляют собой в основном подтип IgG. На слизистых поверхностях также очень важными являются IgA антитела.

Холерный токсин, известный в данной области техники белок-носитель, также регулярно используется в качестве адъюванта. Однако, холерный токсин увеличивает уровень общих и специфических IgE антител и приводит к воспалительным реакциям, связанным с IgE.

Вследствие побочных эффектов, вызываемых большой частью белков-носителей, используемых для вакцинации, существует необходимость в системах-носителях, способных возбуждать иммунные ответы против аллергенов или других антигенов без использования токсических адъювантов, без использования плохо переносимых белков-носителей и в некоторых ситуациях без стимулирования потенциально патологических иммунных ответов. Новые системы-носители, соответствующие этим требованиям, могут использоваться с целью формирования новых конъюгатов и композиций, подходящих для лечения или предотвращения болезней, подобных аллергическим заболеваниям.

В работе Bohle В. et al. (J. Immunol. 172 (11) (2004): 6642-6648) описан рекомбинантный гибридный белок, содержащий фрагмент белка S-слоя и фрагмент Bet v 1. Эта молекула содержит нативный Bet v 1 аллерген, включающий Bet v 1-специфические Т-клеточные эпитопы.

WO 2004/004761 имеет отношение к вирусоподобным частицам, которые соединены с иммуногеном и могут использоваться для иммунизации.

В работе WO 2004/003143 раскрывается использование гибридных белков, содержащих вирусоподобную частицу и аллергенную молекулу в качестве иммуногена для вакцинации.

В WO 2007/140505 и Edlmayr et al. (J. Immunol. 182 (10) (2009) 6298-6306) описано использование гибридных белков, содержащих различные молекулы-носители, соединенные с полученными от аллергенов пептидами, для индуцирования аллерген-специфических IgG антител, однако, эти конструкты не проявляют иммуномодулирующего эффекта, который может считаться благоприятным для пациентов с аллергией, такого как индукция IL-10 или Th1-иммунитета. Фиг.4 (Edlmayr et al) показывает, что KLH-слитые пептиды индуцируют Th2 цитокин IL-5, a VP1 гибридные белки не индуцируют IL-10 или IFN-гамма.

В Niespodziana et al (J. Allergy Clin. Immunol. 127 (6) (2011) 1562-1570) описано использование гибридных белков, каждый из которых содержит PreS, происходящий от вируса гепатита В, и два пептида, полученные от основного кошачьего аллергена Fel d 1, для индуцирования аллерген-специфических IgG антител. Однако, не описан режим, подходящий для вакцинации людей, и пептиды, содержащие аллерген-специфические Т-клеточные эпитопы.

Цель настоящего изобретения - предоставить медикаменты и носители, которые преодолевают вышеупомянутые проблемы и дают возможность проведения вакцинации аллергеном с уменьшенными побочными эффектами.

Следовательно, настоящее изобретение имеет отношение к полипептиду, содержащему, по меньшей мере, три пептидных фрагмента, состоящих из 10-50 последовательных аминокислотных остатков, по меньшей мере, одного аллергена дикого типа, соединенного с N- и С-концами поверхностного полипептида вируса семейства гепаднавирусов или, по меньшей мере, одним фрагментом указанного поверхностного полипептида, или содержащему поверхностный полипептид вируса семейства гепаднавирусов или, по меньшей мере, один его фрагмент, соединенный на N- и/или С-концах, по меньшей мере, с тремя пептидами, полученными, по меньшей мере, от одного аллергена дикого типа.

Для того чтобы вызвать повышенный иммунный ответ против молекулы, в частности против аллергенной или гипоаллергенной молекулы, согласно настоящему изобретению, по меньшей мере, три пептидных фрагмента, полученные, по меньшей мере, от одного аллергена дикого типа, соединяются (с помощью генной инженерии) с поверхностным полипептидом вируса из семейства гепаднавирусов, предпочтительно вируса гепатита В, более предпочтительно полипептидом PreS гепатита В, или, по меньшей мере, одним его фрагментом. Неожиданно оказалось, что в противоположность обычно и постоянно используемым белкам-носителям, подобным KLH (гемоцианин лимфы морского брюхоногого моллюска), поверхностный полипептид вируса семейства гепаднавирусов, предпочтительно вируса гепатита В, более предпочтительно полипептид PreS гепатита В, или его фрагменты приводят к повышенному образованию антител, направленных на эти пептиды и связывающихся с ними.

Более того, оказалось, что аллерген-специфические IgG антитела, индуцированные иммунизацией более, чем тремя, соответствующим образом подобранными, происходящими от аллергена пептидными фрагментами, соединенными с полипептидом PreS гепатита В, лучше нацеливаются на IgE эпитопы аллергена, в то время как иммунизация аллергеном дикого типа дает в результате IgG, направленный на все части аллергена - также и те, которые не являются IgE-реактивными. В эксперименте, нормализованном относительно титров IgG, это приводит к лучшей блокирующей способности PreS/пептида, индуцированного IgG, по сравнению с индуцированным аллергеном дикого типа (фиг. 12).

Также очень неожиданно оказалось, что в культурах человеческих РВМС гибридные белки из пептидных фрагментов, полученных от аллергена, с полипептидом PreS гепатита В сильно индуцировали цитокины IL-10 и IFN-гамма, которые относятся к положительным индикаторам успешной иммунотерапии аллергии. В противоположность этому, индукция IL-10 и IFN-гамма была значительно ниже при использовании аллергена дикого типа, отдельных пептидных фрагментов, полученных от аллергена, или PreS в отдельности (фиг. 10).

"Соединенный с N- и С-концом", при использовании в описании, означает, что, по меньшей мере, один пептид соединяется с N-концом поверхностного полипептида вируса из семейства гепаднавирусов, или, по меньшей мере, одним фрагментом указанного поверхностного полипептида, и, по меньшей мере, один пептид соединяется с С-концом поверхностного полипептида вируса из семейства гепаднавирусов или, по меньшей мере, одним фрагментом указанного поверхностного полипептида. В наиболее простом варианте осуществления настоящего изобретения поверхностный полипептид вируса из семейства гепаднавирусов или, по меньшей мере, один фрагмент указанного поверхностного полипептида, может содержать на N-конце один пептид и на С-конце два пептида или наоборот.

Полипептид настоящего изобретения предпочтительно содержит, по меньшей мере, четыре, более предпочтительно, по меньшей мере, пять, даже более предпочтительно, по меньшей мере, шесть пептидных фрагментов, предпочтительно связывающих В-клетки пептидов, происходящих от аллергена, при этом четыре пептида являются наиболее предпочтительными.

Согласно особенно предпочтительному варианту осуществления настоящего изобретения белок-носитель является полипептидом PreS гепатита В со следующей последовательностью аминокислот (SEQ ID No. 21):

Возможно использование фрагментов PreSl гепатита В или PreS2 гепатита В полипептида PreS гепатита В. Фрагмент полипептида PreS гепатита В предпочтительно содержит или состоит, по меньшей мере, из 30, предпочтительно, по меньшей мере, 40, более предпочтительно, по меньшей мере, 50, последовательных аминокислотных остатков SEQ ID No. 21.

Использованный в описании термин "гипоаллергенный" относится к молекулам с пониженным аллергенным потенциалом или без него (т.е. IgE-реактивностью, определенной с помощью анализа связывания IgE, известного в данной области техники). Такие молекулы обладают пониженной способностью вызывать аллергические реакции у индивидуума по сравнению с белком дикого типа, от которого получены эти молекулы.

По меньшей мере, три, предпочтительно, по меньшей мере, четыре, более предпочтительно, по меньшей мере, пять, даже более предпочтительно, по меньшей мере, шесть пептидных фрагментов, соединенных с N- и С-концом поверхностного полипептида вируса семейства гепаднавирусов, или, по меньшей мере, один фрагмент указанного поверхностного полипептида состоит из или содержит 10-50 последовательных аминокислот, более предпочтительно от 15 до 50 последовательных аминокислот, в частности, 20-50 последовательных аминокислот, по меньшей мере, одного аллергена дикого типа и демонстрирует предпочтительно пониженную IgE-реактивность по сравнению с аллергеном дикого типа, из которого получены данные пептидные фрагменты. Эти пептидные фрагменты предпочтительно создаются так, чтобы исключить аллерген-специфические Т-клеточные эпитопы, которые могут вызвать опосредованные Т-клетками побочные эффекты. Т-клеточные эпитопы и молекулы, демонстрирующие уменьшенный Т-клеточный ответ, могут быть определены и идентифицированы с помощью методов, известных специалистам в данной области техники (например, Bercovici N. et al. Clin Diagn Lab Immunol. (2000) 7:859-864).

По меньшей мере, три пептидных фрагмента, состоящие из или содержащие от 10 до 50 последовательных аминокислот, более предпочтительно от 15 до 50 последовательных аминокислот, в частности 20-50 последовательных аминокислот, по меньшей мере, одного аллергена дикого типа, могут быть получены от одного и того же аллергена. Если два или более фрагментов происходят от одного и того же аллергена, эти два или более фрагментов не являются расположенными рядом (по соседству) в аллергене дикого типа и/или имеют порядок в полипептиде настоящего изобретения, который не соответствует порядку в аллергене дикого типа.

Использованный в описании термин "пептидный фрагмент" означает часть/фрагмент гипоаллергенного полипептида или гибридного белка изобретения, который происходит из первичной структуры аллергена дикого типа и содержит или состоит из 10-50 последовательных аминокислот, более предпочтительно 15-50 последовательных аминокислот, в частности 20-50 последовательных аминокислот, этого аллергена дикого типа.

Использованные в описании термины "происходящий от (полученный из) аллергена" и "происходящий от (полученный из), по меньшей мере, одного аллергена дикого типа" означают, что пептидные фрагменты согласно настоящему изобретению получают непосредственно из аллергена путем фрагментации или укорачивания. Аминокислотная последовательность этих пептидных фрагментов является предпочтительно, по меньшей мере, на 80% идентичной, более предпочтительно, по меньшей мере, на 90% идентичной, наиболее предпочтительно, по меньшей мере, на 95% идентичной, в частности, на 100% идентичной, с аминокислотным фрагментом аллергена дикого типа, из которого получены данные пептидные фрагменты. Однако, пептиды, не являющиеся на 100% идентичными фрагментам аллергена дикого типа, должны быть способны к связыванию, по меньшей мере, с 60%, предпочтительно, по меньшей мере, 70%, более предпочтительно, по меньшей мере, 80%, наиболее предпочтительно, по меньшей мере, 90% силой с антителом или антителами, предпочтительно IgG антителами, направленными на указанные фрагменты аллергена дикого типа. "По меньшей мере, один аллерген дикого типа" означает, что полипептид настоящего изобретения может содержать пептиды, связывающие В-клетки, более чем одного, предпочтительно двух, более предпочтительно трех, разных аллергенов дикого типа (т.е. источников) (например, один пептид, полученный от Bet v 1, один от Amb а 1 и один от Phl p 1 или два пептида, полученных от Bet v 1, и один от Amb a 1).

Степень идентичности первой аминокислотной последовательности со второй аминокислотной последовательностью может определяться путем прямого сравнения между обеими аминокислотными последовательностями с использованием определенных алгоритмов. Например, такие алгоритмы включены в различные компьютерные программы (например, "BLAST 2 SEQUENCES (blastp)" (Tatusova et al. (1999) FEMS Microbiol. Lett. 174:247-25; Corpet F, Nucl. Acids Res. (1988) 16:10881-10890).

Полипептиды настоящего изобретения могут быть получены рекомбинатными методами или с помощью химического синтеза. Альтернативно, также возможно получение молекул путем ферментативного или химического расщепления аллергена дикого типа или в виде полипептида/белка «укрывающего» (несущего) представляющую интерес молекулу.

Неожиданно было обнаружено, что гибридные белки-носители пептидов с улучшенными свойствами могут быть получены путем использования поверхностных белков от вирусов класса гепаднавирусов, конкретнее, вируса гепатита В человека. От одного до 20, предпочтительно от 3 или 4 до 20, более предпочтительно от 3 или 4 до 15, даже более предпочтительно от 3 или 4 до 10 (т.е. 3, 4, 5, 6, 7, 8, 9, 10), пептидных фрагментов, предпочтительно гипоаллергенных пептидных фрагментов, может быть соединено с С-концом и N-концом поверхностного полипептида вируса семейства гепаднавирусов, или, по меньшей мере, одним фрагментом указанного поверхностного полипептида. Предпочтительным вариантом осуществления текущего изобретения являются, следовательно, гибридные белки, состоящие, по меньшей мере, из 3-6 гипоаллергенных пептидных фрагментов, с белком-носителем, полученным из поверхностных антигенов вируса гепатита В человека. Согласно особенно предпочтительному варианту осуществления настоящего изобретения такие гибридные белки используют preS белок в качестве носителя. Наиболее предпочтительным вариантом осуществления этого изобретения являются гибридные белки, в которых 4 гипоаллергенных пептидных фрагмента соединены с preS белком-носителем или его фрагментом. (Гипоаллергенные) пептидные фрагменты могут быть одинаковыми или разными и могут происходить от одного или нескольких аллергенных белков, а местоположением пептидов в гибридном белке является С-конец и N-конец белка-носителя. От одного до трех (гипоаллергенных) пептидных фрагментов может быть соединено с каждым из С-конца и N-конца, так что сумма (гипоаллергенных) пептидных фрагментов, будет составлять, например, от трех или четырех до шести. Термины "слитый" или "гибридный белок" относятся к предпочтительному варианту осуществления изобретения, означая, что неаллергенный белок-носитель и (гипоаллергенные) пептидные фрагменты на С- и N-концах носителя экспрессируются и изготавливаются (получаются) в виде одной отдельной цепи рекомбинантного полипептида.

Наиболее предпочтительным вариантом осуществления текущего изобретения являются гибридные белки preS-белка вируса гепатита В, которые несут (гипоаллергенные) пептидные фрагменты, полученные от специфического аллергена, так что один или два, предпочтительно два, пептидных фрагмента соединяются (каждый) с С-концом и N-концом носителя. Для иллюстрации, предпочтительные полипептиды текущего изобретения могут иметь общую молекулярную структуру, представленную следующими типичными структурами:

Структура 1. Общий принцип создания предпочтительных вариантов осуществления

Структура 2. Общий принцип построения предпочтительных вариантов осуществления

Структура 3. Общий принцип построения предпочтительных вариантов осуществления

Понятно, что пептиды А, В, С и D могут быть одинаковыми или разными и могут быть получены от одного и того же аллергена для каждого отдельного гибридного белка или от различных антигенов.

Пептиды (гипоаллергенные) для соединения с N- и С-концом поверхностного полипептида вируса семейства гепаднавирусов или, меньшей мере, одним фрагментом указанного поверхностного полипептида, предпочтительно preS-белка или его фрагмента, предпочтительно выбирают из группы, состоящей из основных аллергенов березовой пыльцы, в частности Bet v 1 и Bet v 4, основных аллергенов пыльцы тимофеевки, в частности Phl р 1, Phl р 2, Phl р 5, Phl р 6 и Phl р 7, основных аллергенов клещей домашней пыли, в частности Der р 1, Der р 2, Der р 5, Der р 7, Der р 21 и Der р 23, основного кошачьего аллергена Fel d 1, основного аллергена амброзии Amb а 1, основных аллергенов криптомерии японской Cry j 1 и Cry j 2, основных аллергенов пчел, основных аллергенов ос, профилинов, в частности, Phl p 7, Phl р 12.

Другие подходящие для использования согласно настоящему изобретению аллергены могут быть получены из следующей таблицы, без ограничения указанной таблицей.

1 Marsh, D.G., и L.R. Freidhoff. 1992. ALBE, an allergen database. IUIS, Baltimore, MD, Edition 1.0.

2 Marsh, D.G. et al. 1986. Allergen nomenclature. Bull WHO 64:767-770.

3 King, T.P. et al. 1964. Biochemistry 3:458-468.

4 Lowenstein, H. 1980. Allergy 35:188-191.

5 Aukrust, L. 1980. Allergy 35:206-207.

6 Demerec, M. et al. 1966. Genetics 54:61-75.

7 Bodmer, J. G. et al. 1991. Immunogenetics 33:301-309.

8 Griffith, I. J. et al. 1991. Int. Arch. Allergy Appl. Immunol. 96:296-304.

9 Roebber, M. et al. 1985. J. Immunol. 134:3062-3069.

10 Metzler, W. J. et al. 1992. Biochemistry 31:5117-5127.

11 Metzler, W. J. et al. 1992. Biochemistry 31:8697-8705.

12 Goodfriend, L. et al. 1979. Fed. Proc. 38:1415.

13 Ekramoddoullah, А. K. M. et al. 1982. Mol. Immunol. 19:1527-1534.

14 Ansari, A. A. et al. 1987. J. Allergy Clin. Immunol. 80:229-235.

15 Morgenstern, J.P. et al. 1991. Proc. Natl. Acad. Sci. USA 88:9690-9694.

16 Griffith, I.J. et al. 1992. Gene 113:263-268.

17 Weber, A. et al. 1986. Biochem. Physiol. 83B:321-324.

18 Weber, A. et al. 1987. Allergy 42:464-470.

19 Stanworth, D. R. et al. 1990. Bulletin WHO 68:109-111.

20 Rafnar, T. et al. 1991. J. Biol. Chem. 266: 1229-1236.

21 Rogers, B.L. et al. 1991. J. Immunol. 147:2547-2552.

22 Klapper, D.G. et al. 1980. Biochemistry 19:5729-5734.

23 Ghosh, B. et al. 1993. J. Immunol. 150:5391-5399.

24 Roebber, M. et al. 1983. J. Immunol. 131:706-711.

25 Lubahn, В., и D.G. Klapper. 1993. J. Allergy Clin. Immunol. 91:338.

26 Roebber, M., и D.G. Marsh. 1991. J. Allergy Clin. Immunol. 87:324.

27 Goodfriend L. et al. Mol Immunol 22: 899-906, 1985.

28 Himly M. et al. FASEB J 17: 106-108, 2003.

28A Nilsen, B. M. et al. 1991. J. Biol. Chem. 266:2660-2668.

29 Wopfner N. et al. Biol Chem 383: 1779-1789, 2002.

29A Jimenez A. et al. 1994. Int Arch Allergy Immunol 105:297-307.

29B Barderas R. et al. Int Arch Allergy Immunol 127: 47-54, 2002.

29C J. et al. Allergy 56, Supplement 68: 274, 2001.

29D Giuliani A. et al. Allergy 42: 434-440, 1987.

30 Smith,P.M. et al. 1996. J. Allergy Clin. Immunol. 98:331-343.

31 Suphioglu,C. et al. 1997. FEBS Lett. 402:167-172.

31a Asturias J.A. et al. 1997. Clin Exp Allergy 27:1307-1313.

32 Mecheri, S. et al. 1985. Allergy Appl. Immunol. 78:283-289.

33 Roberts, A.M. et al. 1993. Allergy 48:615-623.

33a Guerin-Marchand,C. et al. 1996. Mol. Immunol. 33:797-806.

34 Klysner, S. et al. 1992. Clin. Exp.Allergy 22: 491-497.

35 Perez, M. et al. 1990. J. Biol. Chem. 265:16210-16215.

36 Griffith, I. J. et al. 1991. FEBS Letters 279:210-215.

37 Ansari, A. A. et al. 1989. J. Biol. Chem. 264:11181-11185.

37a Sidoli,A. etal. 1993. J. Biol. Chem. 268:21819-21825.

38 Ansari, A. A. et al. 1989. Biochemistry 28:8665-8670.

39 Singh, M. B. et al. 1991. Proc. Natl. Acad. Sci. 88:1384-1388.

39a van Ree R. et al. 1995. J Allergy Clin Immunol 95:970-978.

40 Suphioglu, C. и Singh, M.B. 1995. Clin. Exp.Allergy 25:853-865.

41 Dolecek, C. et al. 1993. FEBS Lett. 335:299-304.

41A Fischer S. et al. 1996. J Allergy Clin Immunol 98:189-198.

42 Matthiesen, F., и H. Lowenstein. 1991. Clin. Exp.Allergy 21:297-307.

43 Petersen, A. et al. 1995. Int. Arch. Allergy Immunol. 108:55-59.

43A Marknell De Witt A. et al. Clin Exp Allergy 32: 1329-1340, 2002.

44 Valenta, R. et al. 1994. Biochem. Biophys. Res. Commun. 199:106-118.

46 Esch, R. E., и D. G. Klapper. 1989. Mol. Immunol. 26:557-561.

47 Olsen, E. et al. 1991. J. Immunol. 147:205-211.

48 Avjioglu, A. et al. 1993. J. Allergy Clin. Immunol. 91:340.

52 Kos T. et al. 1993. Biochem Biophys Res Commun 196:1086-92.

53 Diaz-Perales A. et al. 2000. Clin Exp Allergy 30:1403-1410.

54 Ipsen, H., и O.C. Hansen. 1991. Mol. Immunol. 28: 1279-1288.

55 Taniai, M. et al. 1988. FEBS Lett. 239:329-332.

56 Griffith, I.J. etal. 1993. J. Allergy Clin. Immunol. 91:339.

57 Sakaguchi, M. et al. Allergy 45: 309-312, 1990.

57A Yokoyama M. et al. Biochem Biophys Res Commun 275: 195-202, 2000.

57B Midoro-Horiuti T. et al. J Immunol 164: 2188-2192, 2000.

57C Tinghino R. et al. J. Allergy Clin. Immunol. 101: 772-777, 1998.

58 Gross GN et al. Scand J Immunol 8: 437-441, 1978.

58A Obispo ТМ et al. Clin Exp Allergy 23: 311-316, 1993.

58B Midoro-Horiuti T. et al. Clin Exp Allergy 31: 771-778, 2001.

59 Lombardero M. et al. Clin. Exp.Allergy 24: 765-770, 1994.

60 Villalba, M. et al. Eur. J. Biochem. 216: 863-869, 1993.

60A Asturias JA et al. J Allergy Clin Immunol 100: 365-372, 1997.

60B Batanero Ε. et al. Eur J Biochem 241: 772-778, 1996.

60C Batanero Ε. et al. FEBS Lett. 410: 293-296, 1997.

60D Tejera ML et al. J Allergy Clin Immunol 104: 797-802, 1999.

60E Ledesma A. et al. FEBS Lett 466: 192-196, 2000.

60F Barral P. et al. J Immunol 172: 3644-3651, 2004.

61 Yi FC et al. Clin Exp Allergy 32: 1203-1210, 2002.

61A Ramos JD et al. Int Arch Allergy Immunol 126: 286-293, 2001.

62 Chua, K. Y. et al. J. Exp. Med. 167: 175-182, 1988.

62A Chua, K. Y. et al. Int. Arch. Allergy Appl. Immunol. 91: 118-123, 1990.

62B Smith AM et al. Int Arch Allergy Immunol 124: 61-63, 2001.

62C Smith AM et al. J Allergy Clin Immunol 107: 977-984, 2001.

63 Smith WA, Thomas WR. Int Arch Allergy Immunol 109: 133-140, 1996.

64 Lake, F.R. et al. J. Allergy Clin. Immunol. 87: 1035-1042, 1991.

65 Tovey, E. R. et al. J. Exp.Med. 170: 1457-1462, 1989.

66 Yasueda, H., T. Shida, T. Ando, S. Sugiyama, и H. Yamakawa. 1991. Allergenic и proteolytic properties of fourth allergens from Dermatophagoides mites. In: "Dust Mite Allergens и Asthma. Report of the 2nd international workshop" A. Todt, Ed., UCB Institute of Allergy, Brussels, Belgium, pp. 63-64.

67 Shen, H.-D. et al. Clin. Exp.Allergy 23: 934-940, 1993.

67A O'Neil GM et al. Biochim Biophys Acta,1219: 521-528, 1994.

67B King C. et al. J Allergy Clin Immunol 98: 739-747, 1996.

68 Lind P. et al. J. Immunol. 140: 4256-4262, 1988.

69 Dilworth, R. J. et al. Clin. Exp.Allergy 21: 25-32, 1991.

70 Nishiyama, C. et al. Int. Arch. Allergy Immunol. 101: 159-166, 1993.

70A Trudinger, M. et al. Clin. Exp.Allergy 21: 33-38, 1991.

71 Shen HD et al. Clin Exp Allergy 25: 1000-1006, 1995.

71A Tategaki A. et al. ACI International suppl. 1: 74-76, 2000.

72 Aki T. et al. J Allergy Clin Immunol 96: 74-83, 1995.

72A Tsai L. et al. Clin Exp Allergy 29: 1606-1613, 1999.

72B Gafvelin G. et al. J Allergy Clin Immunol 107: 511-518, 2001.

73 van Hage-Hamsten. et al. J. Allergy Clin. Immunol. 91:353, 1993.

74 Varela J. et al. Eur J Biochem 225: 93-98, 1994.

74A Schmidt M. et al. FEBS Lett 370: 11-14, 1995.

75 Eriksson TLJ et al. Eur. J. Biochem. 268: 287-294, 2001.

75A Saarne T. et al. Int Arch Allergy Immunol 130: 258-265, 2003.

75B Eriksson TL et al. Eur. J. Biochem. 251 (1-2), 443-447, 1998.

76 Rautiainen J, Rytkonen M, Pelkonen J, Pentikainen J, Perola O, Virtanen T, Zeiler T, Mantyjarvi R. BDA20, a major bovine dander allergen characterised at the sequence level is Bos d 2. Submitted.

77 Gjesing B, Lowenstein H. Ann Allergy 53:602, 1984.

78 de Groot, H. et al. J. Allergy Clin. Immunol. 87:1056-1065, 1991.

79 Konieczny, A. Personal communication; Immunologic Pharmaceutical Corp.

79A Bulone, V. Eur J Biochem 253: 202-211, 1998.

79B Swiss-Prot асе. P81216, P81217.

79C Dandeu J. P. et al. (1993). J. Chromatogr. 621:23-31.

79D Goubran Botros H. et al. 1998. J. Chromatogr. В 710:57-65.

79E Hilger C. et al. Allergy 52: 179-187; и Hilger С.et al. Gene 169:295-296, 1996.

79F Ichikawa K. et al. Clin Exp Allergy, In Press 2001.

80 Fahlbusch B. et al. Allergy 57: 417-422, 2002.

81 McDonald, B. et al. 1988. J. Allergy Clin. Immunol. 83:251.

81A Clarke, A. J. et al. 1984. EMBO J 3:1045-1052.

82 Longbottom, J. L. 1983. Characterisation of allergens from the urines of experimental animals. McMillan Press, London, pp. 525-529.

83 Laperche, Y. et al. 1983. Cell 32:453-460.

83A Bush RK et al. 1999. J Allergy Clin Immunol 104:665-671.

83B Aukrust L, Borch SM. 1979. Int Arch Allergy Appl Immunol 60:68-79.

83C Sward-Nordmo M. et al. 1988. Int Arch Allergy Appl Immunol 85:288-294.

84 Shen, et al. J. Allergy Clin. Immunol. 103:S157, 1999.

84A Crameri R. Epidemiology и molecular basis of the involvement of Aspergillus fumigatus allergic diseases. Contrib. Microbiol. Vol.2, Karger, Basel (in press).

84B Shen, et al. (manuscript submitted), 1999

84C Shen HD et al. Vacuolar serine proteinase: A major allergen of Aspergillus fumigatus. 10 International Congress of Immunology, Abstract, 1998.

85 Kumar A. et al. 1993. J. Allergy Clin. Immunol. 91:1024-1030.

85A Saxena S. et al. 2003. Clin Exp Immunol 134:86-91.

85В Baur X. et al. Allergy 57: 943-945, 2002.

86A Shen HD et al. 1996. Clin Exp Allergy 26:444-451.

86B Shen, et al. Abstract; The XVIII Congress of the European Academy of Allergology и Clinical Immunology, Brussels, Belgium, 3-7 July 1999.

87 Shen HD et al. Clin Exp Allergy 29: 642-651, 1999.

87A Shen HD et al. Clin Exp Allergy 25: 350-356, 1995.

87B Shen HD et al. J Lab Clin Med 137: 115-124, 2001.

88 Woodfolk JA et al. 1998. J Biol Chem 273:29489-96.

88A Deuell, B. et al. 1991. J. Immunol. 147:96-101.

89 Shen, H.D. et al. 1991. Clin. Exp.Allergy 21:675-681.

89A Horner WE et al. 1995. Int Arch Allergy Immunol 107:298-300.

89B Chang CY et al. J Biomed Sci 9: 645-655, 2002.

90 Yasueda H. et al. Biochem Biophys Res Commun 248: 240-244,1998. NB:strain TIMM2782 (Teikyo University Institute for Medical Mycology) equal to strain CBS 1878 (Central Bureau von Schimmelkulturen).

90A Onishi Y. et al. Eur J Biochem 261: 148-154, 1999. NB: strain TIMM2782 (Teikyo University Institute for Medical Mycology) equal to strain CBS 1878 (Central Bureau von Schimmelkulturen).

91 Schmidt M. et al. Eur J Biochem 246:181-185, 1997. NB: strain ATCC no. 42132 (American Type Culture Collection).

91A Rasool O. et al. Eur J Biochem 267: 4355-4361, 2000. NB: strain ATCC no. 42132 (American Type Culture Collection).

91B NB:; strain 4625 (Indian Agricultural Research Institute, PUSA; New Delhi, India).

92 Kuchler, K. et al. 1989. Eur. J. Biochem. 184:249-254.

93 Gmachl, M., и G. Kreil. 1993. Proc. Natl. Acad. Sci. USA 90:3569-3573.

93A Hoffman DR. 1977. J Allergy Clin. Immunol. 59:364-366.

94 Habermann, E. 1972. Science 177:314-322.

95 Hoffman DR, Jacobson RS. 1996. J. Allergy Clin. Immunol. 97:812-821.

95A Hoffman DR, El-Choufani AE, Smith MM, de Groot H. 2001. Occupational allergy to bumblebee venom: Allergens of Bombus terrestris. J Allergy Clin Immunol In press. 95B Helm R. et al. 1996. J Allerg Clin Immunol 98:172-180.

95C Pomes A. et al. 1998. J Biol Chem 273:30801-30807.

96 Arruda LK et al. J Biol Chem 270:19563-19568, 1995.

97 Arruda LK et al. J Biol Chem 270:31196-31201, 1995.

98 Arruda LK et al. Int Arch Allergy Immunol 107:295-297, 1995.

98А Wu CH et al. 1998. J Allergy Clin Immunol 101:832-840.

98B Melen E. et al. 1999. J Allergy Clin Immunol 103:859-64.

98C Wu CH et al. J Biol Chem 271:17937-17943, 1996.

98D Wu CH et al. Molecular Immunol 34:1-8, 1997.

98E Santos ABR et al. 1999. J Allergy Clin Immunol 104:329-337.

98F Asturias JA et al. 1999. J Immunol 162:4342-4348.

99 Mazur, G. et al. 1990. Monog. Allergy 28:121-137.

99A Moneo I. et al. Allergy 58: 34-37, 2003.

100 Soldatova, L. et al. 1993. FEBS Letters 320:145-149.

101 Lu, G. et al. 1994. J. Allergy Clin. Immunol. 93:224.

102 Fang, K. S. F. et al. 1988. Proc. Natl. Acad. Sci., USA 85:895-899.

103 King, T. P. et al. 1990. Prot. Seq. Data Anal. 3:263-266.

104 Lu, G. et al. 1993. J. Immunol. 150: 2823-2830.

105 King, T. P. и Lu, G. 1997. Unpublished data.

105A King TP et al. 1996. J. Allergy Clin. Immunol. 98:588-600.

106 Hoffman, D.R. 1993. J. Allergy Clin. Immunol. 92:707-716.

107 Hoffman DR. 1992. Unpublished data.

108 Hoffman DR. J. Allergy Clin. Immunol. 91:187, 1993.

109 Jacobson RS et al. J. Allergy Clin. Immunol. 89:292, 1992.

110 Hoffman DR. J. Allergy Clin. Immunol 91: 71-78, 1993.

111 Schmidt M. et al. FEBS Letters 319: 138-140, 1993.

111A Paddock CD et al. J Immunol 167: 2694-2699, 2001.

112 Elsayed S, Bennich H. Scand J Immunol 3: 683-686, 1974.

113 Elsayed S. et al. Immunochemistry 9: 647-661, 1972.

114 Hoffman, D. R. 1983. J. Allergy Clin. Immunol. 71: 481-486.

115 Langeland, T. 1983. Allergy 38:493-500.

116 Daul CB, Slattery M, Morgan JE, Lehrer SB. 1993. Common crustacea allergens: identification of В cell epitopes with the shrimp specific monoclonal antibodies. In: "Molecular Biology и Immunology of Allergens" (D. Kraft и A. Sehon, eds.). CRC Press, Boca Raton, pp. 291-293.

116A Shanti KN et al. J. Immunol. 151:5354-5363, 1993.

117 Yu CJ et al. J Immunol 170: 445-453, 2003.

117A Miyazawa M et al. J. Allergy Clin. Immunol. 98: 948-953, 1996.

117B Asturias JA et al. Int Arch Allergy Immunol 128: 90-96, 2002.

117C Lopata AL et al. J. Allergy Clin. Immunol. 100: 642-648, 1997.

117D Hoffmann-Sommergruber K. et al. Clin. Exp.Allergy 29: 840-847, 1999.

118 Monsalve RI et al. Biochem. J. 293: 625-632 1993.

118A. Monsalve RI et al. 1997. Clin Exp Allergy 27:833-841.

119 Mena, M. et al. Plant Molec. Biol. 20: 451-458, 1992.

119A Palosuo K. et al. J. Allergy Clin. Immunol. 108: 634-638, 2001.

119B Xu H. et al. Gene 164: 255-259, 1995.

119C Pastorello EA et al. J. Allergy Clin. Immunol. 94: 699-707, 1994.

119D Diaz-Perales A. et al. J Allergy Clin Immunol 110: 790-796, 2002.

119E Galleguillos F, Rodriguez JC. Clin Allergy 8: 21-24, 1978.

119F Baur X. Clin Allergy 9: 451-457, 1979.

119G Gailhofer G. et al. Clin Allergy 18: 445-450, 1988.

120 Menendez-Arias, L. et al. 1988. Eur. J. Biochem. 177:159-166.

120A Gonzalez R. et al. Lancet 346:48-49, 1995.

120B Kleine-Tebbe J. et al. J Allergy Clin Immunol 110: 797-804, 2002.

120C Sanchez-Monge R. et al. J. Allergy Clin. Immunol. 106: 955-961, 2000.

121 Gavrovic-Jankulovic M. et al. J Allergy Clin Immun ol 110: 805-810, 2002.

121A Pastorello EA et al. J. Chromatogr. В Biomed. Sci. Appl. 756: 85-93, 2001.

121B Moneo I. et al. J. Allergy Clin. Immunol. 106: 177-182, 2000.

121C Asturias JA et al. 2000. Allergy 55:898-890.

122 Christie, J. F. et al. 1990. Immunology 69:596-602.

122A Baur X. et al. Clin Allergy 12: 9-17, 1982.

122B Onisuka R. et al. Int Arch Allergy Immunol 125: 135-143, 2001.

123 Czuppon AB et al. J Allergy Clin Immunol 92:690-697, 1993.

124 Attanayaka DPSTG et al. 1991. Plant Mol Biol 16:1079-1081.

125 Chye ML, Cheung KY. 1995. Plant Mol Biol 26:397-402.

126 Alenius H. et al. 1993. Int Arch Allergy Immunol 102:61-66.

127 Yeang HY, Cheong KF, Sunderasan E, Hamzah S, Chew NP, Hamid S, Hamilton RG, Cardosa MJ. 1996. The 14.6 kD (REF, Hev b 1) и 24 kD (Hev b 3) rubber particle proteins are recognised by IgE from Spina Bifida пациентз with Latex allergy. J Allerg Clin Immunol in press.

128 Sunderasan E. et al. 1995. J nat Rubb Res 10:82-99.

129 Swoboda I. et al. 2002. J Immunol. 168:4576-84.

130 Vrtalaetal., 2007. J Immunol. 179:1731-1739.

131 Valenta и Niederberger, 2007. J Allergy Clin Immunol. 119(4):826-830.

Согласно особенно предпочтительному варианту осуществления настоящего изобретения, по меньшей мере, один, предпочтительно, по меньшей мере, два, более предпочтительно, по меньшей мере, три, в частности все, по меньшей мере, из трех пептидов полученных, по меньшей мере, из одного аллергена дикого типа, представляет собой пептид, связывающий В-клетки.

"Пептиды, связывающие В-клетки," пригодные для вакцинации против аллергии согласно изобретению, получают из или рядом с IgE-связывающими участками аллергенов, однако сами по себе они демонстрируют отсутствие или минимальную IgE-реактивность по сравнению с аллергеном дикого типа (Focke M et al. Clinical & Experimental Allergy 40(2010):385-397). Требованиями в отношении их получения и отбора являются знание первичной последовательности аллергена и рассмотрение IgE-связывающих участков. После иммунизации, пептиды, связывающие В-клетки, соединенные с подходящим иммуногенным носителем, способны индуцировать выработку аллерген-специфического IgG, который может препятствовать связыванию IgE с аллергеном. Может ли индуцированный с помощью гибридного белка IgG распознавать аллерген, можно определить, например, путем проверки IgG на реакционную способность с полным аллергеном. Подходящие способы включают ELISA, дот-блот-анализ или вестерн-блоттинг. Предпочтительными являются пептиды, которые индуцируют IgG, препятствующий связыванию IgE пациентов с аллергеном.

Настоящее изобретение показывает, что использование пептидов, связывающих В-клетки, в частности, когда три или более соединяются с подходящим носителем согласно настоящему изобретению, обеспечивает возможность индукции IgG ответов, которые лучше нацеливаются на IgE-эпитопы, чем ответы, вызванные иммунизацией даже полным аллергеном. Более того, изобретение показывает, что комбинация соответствующих пептидов и их количеств с подходящим носителем может направить аллерген-специфический иммунный ответ по направлению к благоприятному антиаллергическому иммунному ответу (отличающемуся индукцией преимущественно аллерген-специфического IgG-ответа и отсутствием IgE-ответа и толерогенных (вызывающих иммунную толерантность) (IL-10) и Th1 (интерферон гамма) цитокиновых ответов.

Более того, неожиданно оказалось, что (несмотря на то, что они утратили аллерген-специфические Т-клеточные эпитопы) полипептиды согласно изобретению, содержащие 3 или более пептидов, связывающих В-клетки, соединенные с иммуногенным носителем, являются способными уменьшить аллерген-специфические Т-клеточные реакции. Об этом свидетельствует тот факт, что наличие аллерген-специфического IgG, индуцированного терапевтической вакцинацией гипоаллергенными полипептидами настоящего изобретения, уменьшает аллерген-специфическую Т-клеточную активацию, вызванную IgE-облегченной презентацией антигена в РВМС (мононуклеарных клетках периферической крови), полученных от вакцинированных людей-аллергиков (фиг.16).

Согласно предпочтительному варианту осуществления настоящего изобретения, по меньшей мере, один, по меньшей мере, из трех указанных пептидов демонстрирует отсутствие или уменьшенную IgE-связывающую способность по сравнению с аллергеном дикого типа.

Согласно другому предпочтительному варианту осуществления настоящего изобретения, по меньшей мере, один, предпочтительно, по меньшей мере, два, более предпочтительно, по меньшей мере, три, из указанных, по меньшей мере, трех пептидов, связывающих В-клетки, демонстрирует отсутствие или в основном отсутствие Т-клеточной реактивности.

Наличие аллерген-специфических Т-клеточных эпитопов может вызывать нежелательные побочные эффекты, опосредованные Т-клетками. Поэтому, особенно предпочтительно использовать пептиды, демонстрирующие отсутствие или в основном отсутствие Т-клеточной реактивности, для того чтобы получить полипептиды настоящего изобретения.

Однако, при этом фрагменты аллергена, содержащие, по меньшей мере, один Т-клеточный эпитоп могут использоваться в полипептиде в соответствии с настоящим изобретением.

"Демонстрирующие уменьшенную IgE-связывающую способность", при использовании в описании, означает, что молекулы согласно настоящему изобретению показывают значительно уменьшенную IgE-связывающую способность или активность (по меньшей мере, связывающую способность на 50% меньше, предпочтительно, по меньшей мере, на 70% меньше, более предпочтительно, по меньшей мере, на 80% меньше, даже более предпочтительно, по меньшей мере, на 90% меньше, наиболее предпочтительно, по меньшей мере, на 95% меньше, по сравнению с аллергеном дикого типа) или даже отсутствие IgE-связывания вообще.

IgE-связывающая активность/способность молекул, подобных пептидам и белкам, может быть определена, например, с помощью твердофазного иммуноферментного анализа (ELISA) с использованием, например, сыворотки, полученной от субъекта (т.е. субъекта с аллергией), который ранее подвергался действию аллергена дикого типа. Коротко, предназначенный для проверки пептид наносят на лунки титрационного микропланшета. После промывки и блокировки, в лунках инкубируют раствор антител, включающий плазму субъекта с аллергией, который подвергался воздействию тестируемого пептида или белка, из которого пептид был получен. В лунки добавляют вторичные меченые антитела и инкубируют. Затем определяется количество IgE-связывания и сравнивается с количеством IgE, связанного очищенным аллергеном дикого типа.

Альтернативно, связывающая активность пептида может определяться с помощью вестерн-блоттинга. Например, предназначенный для проверки пептид «прогоняют» на полиакриламидном геле, используя SDS-PAGE. Затем пептид переносят на нитроцеллюлозу, а потом инкубируют с сывороткой, полученной от субъекта с аллергией. После инкубации с мечеными вторичными антителами определяют количество связанного IgE.

Другим способом анализа, который может использоваться для определения IgE-связывающей активности пептида, является конкурентный анализ ELISA. Коротко, пул IgE-антител получают путем объединения плазмы от субъектов с аллергией, которые (как было показано прямым методом ELISA) являются IgE-реагирующими с аллергеном дикого типа. Этот пул используют в конкурентном методе анализа ELISA для сравнения IgE-связывания с аллергеном дикого типа относительно исследуемого пептида. Определяют и количественно выражают IgE-связывание для аллергена дикого типа и исследуемого пептида.

"Т-клеточный эпитоп" означает белок, пептид или полипептид (например, аллерген) или его фрагмент, для которого на Т-клетке имеется антиген-специфический участок связывания, результатом связывания указанных участков связывания является активация Т-клетки. Использованный в описании термин "проявляющий уменьшенную Т-клеточную реактивность" относится к молекулам, демонстрирующим Т-клеточную реактивность, которая значительно уменьшена по сравнению со стимуляцией, вызванной аллергеном дикого типа, из которого получена гипоаллергенная молекула при использовании эквимолярных количеств в стандартных способах анализа, известных в данной области техники (уменьшенная Т-клеточная реактивность означает уменьшение, по меньшей мере, на 30%, предпочтительно, по меньшей мере, на 50%, более предпочтительно, по меньшей мере, на 70%, наиболее предпочтительно, по меньшей мере, на 90%, стимулирования гипоаллергенных молекул по сравнению с аллергеном дикого типа в эквимолярных количествах). В отдельном предпочтительном варианте осуществления этого изобретения молекулы могут "утратить" Т-клеточные эпитопы, благодаря этому молекула проявляет уменьшенную Т-клеточную реактивность у индивидуума(ов), которого необходимо лечить (т.е. который должен получить эпитоп-представляющую валентную молекулу-платформу). Возможно, что, например, молекула, происходящая от аллергена может утратить Т-клеточный эпитоп(ы) в отношении индивидуума или группы индивидуумов, и в то же время сохраняя Т-клеточный эпитоп(ы) в отношении другого индивидуума(ов). Способы обнаружения наличия Т-клеточного эпитопа известны в данной области техники и включают способы анализа, которые обнаруживают Т-клеточную пролиферацию (такие как включение тимидина). Иммуногены, которые не в состоянии вызвать статистически значимое включение тимидина выше фонового уровня (т.е. в основном p меньше чем 0,05, при использовании стандартных статистических методов), как правило, рассматриваются как утратившие Т-клеточные эпитопы, хотя следует понимать, что количественно оцениваемая величина включения тимидина может варьировать в зависимости от тестируемого иммуногена (См., например, Zhen L. et al. (Infect Immun. (2003) 71:3920-3926)). В общем, индекс стимулирования ниже примерно 2-3, более предпочтительно меньше чем примерно 1, указывает на отсутствие Т-клеточной реактивности и эпитопов. Наличие Т-клеточных эпитопов также может быть определено измерением секреции произведенных Т-клетками лимфокинов с помощью стандартных методов. Индекс стимулирования (SI) может быть вычислен делением скорости пролиферации (поглощение тимидина) стимулированных клеток на скорость пролиферации нестимулированных клеток в одной только среде. SI=1 означает отсутствие стимуляции, и SI>1 указывает на стимуляцию клеток. Местоположение и общее количество Т-клеточных эпитопов, если они имеются, может определяться эмпирически.

В дополнение к стимуляции Т-клеток может определяться секреция цитокинов. Например, IFN-гамма и IL-10, как биомаркеры повышенной активности регуляторных Т-клеток, были признаны цитокинами, сопровождающими успешную иммунотерапию аллергии.

Фрагменты пептидов настоящего изобретения предпочтительно состоят из или содержат от 151 до 177, от 87 до 117, от 1 до 30, от 43 до 70 или от 212 до 241 аминокислот Phl p 1, от 1 до 33, от 8 до 39, от 34 до 65 или от 66 до 96 аминокислот Phl p 2, от 93 до 128, от 98 до 128, от 26 до 53, от 26 до 58, от 132 до 162, от 217 до 246, от 252 до 283 или от 176 до 212 аминокислот Phl p 5, от 23 до 54, от 56 до 90, от 73 до 114 или от 95 до 127 аминокислот Phl p 6, от 1 до 34 или 35 до 70 аминокислот цепи 1 Fel d 1, от 1 до 34, от 35 до 63 или от 64 до 92 аминокислот цепи 2 Fel d 1, от 30 до 59, от 50 до 79, от 75 до 104, от 30 до 74 или от 60 до 104 аминокислот Bet v 1, от 1 до 30, от 52 до 84 или от 188 до 222 аминокислот Der p 1, от 1 до 33, от 21 до 51, от 42 до 73, от 62 до 103 или от 98 до 129 аминокислот Der p 2, от 1 до 30, от 20 до 50, от 50 до 80, от 90 до 125, от 125 до 155 или от 165 до 198 аминокислот Der p 7, 1-35, 36-70, 71-110, 111-145, 140-170, 175-205, 210-250 или 250-284 аминокислот Der р 10, от 1 до 35, от 35 до 72, от 70 до 100 или от 90 до 122 аминокислот Der р 21, от 1 до 32, от 15 до 48 или от 32 до 70, от 32 до 60, от 52 до 84, от 32 до 70 (Cys->Ser) аминокислот Der р 23, от 19 до 58, от 59 до 95, от 91 до 120 или от 121 до 157 аминокислот Alt а 1, от 31 до 60, от 45 до 80, от 60 до 96 или от 97 до 133 аминокислот Par j 2, от 1 до 40, от 36 до 66, от 63 до 99, от 86 до 120 или от 107 до 145 аминокислот Ole е 1, от 25 до 58, от 99 до 133, от 154 до 183, от 277 до 307, от 334 до 363, от 373 до 402, от 544 до 573, от 579 до 608, от 58 до 99, от 125 до 165, от 183 до 224, от 224 до 261, от 252 до 289, от 303 до 340, от 416 до 457, от 460 до 500 или от 501 до 542 аминокислот Fel d 2, от 19 до 58, от 52 до 91, от 82 до 119, от 106 до 144 или от 139 до 180 аминокислот Can f 2, от 19 до 56, от 51 до 90, от 78 до 118, от 106 до 145 или 135-174 аминокислот Can f 1, от 27 до 70, от 70 до 100 или от 92 до 132 аминокислот Art v 1, от 31 до 70, от 80 до 120, от 125 до 155, от 160 до 200, от 225 до 263, от 264 до 300, от 305 до 350 или от 356 до 396 аминокислот Amb а 1, от 1 до 34, от 35 до 74, от 74 до 115, от 125 до 165, от 174 до 213, от 241 до 280, от 294 до 333, от 361 до 400 или от 401 до 438 аминокислот Alt а 6, от 1 до 40, от 41 до 80, от 81 до 120, от 121 до 160 аминокислот Alt а 2 или их фрагменты или варианты последовательности.

Специфическими последовательностями аминокислот вышеуказанных, происходящих от аллергенов молекул, являются (представленные в следующей таблице пептиды, имеющие N- и/или С-концевые остатки цистеина (С), при использовании в полипептиде настоящего изобретения могут утратить указанный остаток цистеина):

Термины „их фрагменты" и „варианты их последовательности" относятся к пептидам, которые получены из раскрытых в описании молекул, происходящих от аллергена, и демонстрируют биохимические свойства (например, способность предотвращать связывание IgE с аллергеном, от которого происходят эти молекулы), сравнимые или идентичные указанным молекулам, происходящим от аллергена. Фрагменты настоящего изобретения содержат, по меньшей мере, 5, предпочтительно, по меньшей мере, 7, более предпочтительно, по меньшей мере, 10, и/или максимум 95%, предпочтительно максимум 90%, более предпочтительно не более 80% последовательных аминокислотных остатков молекулы, происходящей от аллергена. Термин „изменение последовательности" включает модификации пептидов, такие как фрагментация (смотри выше), аминокислотные замены (в частности, остатки цистеина или метионина могут быть заменены серином, аланином или другими природными или искусственными аминокислотами или производными аминокислот), делеции или вставки. «Изменение последовательности» также имеет отношение к указанным (в таблице выше) молекулам, происходящим от аллергена, в которых, по меньшей мере, 1, предпочтительно, по меньшей мере, 2, более предпочтительно по меньшей мере, 3, даже более предпочтительно по меньшей мере, 4 (5, 6, 7, 8, 9, 10, 15, 20) аминокислотных остатков добавляется к С- и/или N-концу.

Отметим, что аллерген, называемый в описании "аллерген клона 30", представляет собой аллерген, происходящий от клеща домашней пыли Dermatophagoides pteronyssinus и состоит из следующей последовательности:

MANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT (SEQ ID No. 140; смотри также WO 2007/124524). В то же время за аллергеном Der p 23 было закреплено название аллерген клона 30. Это означает, что Der p 23 и аллерген клона 30 являются синонимами.

Согласно настоящему изобретению также рассматриваются пептиды, которые являются, по меньшей мере, на 80%, предпочтительно на 90% идентичными аминокислотным последовательностям, раскрытым выше.

Согласно предпочтительному варианту осуществления настоящего изобретения поверхностный полипептид вируса семейства гепаднавирусов или, по меньшей мере, один его фрагмент содержит, по меньшей мере, два связывающих В-клетки пептидных фрагмента, происходящих, по меньшей мере, от одного аллергена дикого типа, соединенного с его N-концом, и, по меньшей мере, два связывающих В-клетки пептидных фрагмента, происходящих, по меньшей мере, от одного аллергена дикого типа, соединенного с его С-концом.

В особенно предпочтительном варианте осуществления настоящего изобретения, по меньшей мере, два из указанных, по меньшей мере, трех связывающих В-клетки пептидов являются одинаковыми.

Полипептид настоящего изобретения может использоваться в качестве вакцины при лечении или предотвращении аллергии у человека или животного.

Полипептид предпочтительно вводится животному в количестве от 0,01 микрограмма на килограмм веса тела до 5 мг/кг веса тела, предпочтительно от 0,1 микрограмма на килограмм веса тела до 10 микрограмм на килограмм веса тела.

Согласно особенно предпочтительному варианту осуществления настоящего изобретения полипептиды настоящего изобретения вводятся индивидууму в количестве, по меньшей мере, 10 мкг, предпочтительно, по меньшей мере, 20 мкг на полипептид. Максимальное количество полипептидов, предназначенное для введения, может варьировать, однако составляет предпочтительно менее 100 мкг, более предпочтительно менее 50 мкг, даже более предпочтительно 40 мкг или менее на полипептид.

Количество полипептидов, которое может быть объединено с эксципиентами для получения отдельной лекарственной формы может варьировать в зависимости от хозяина, которого лечат, и конкретного способа введения. Доза вакцины может изменяться в соответствии с такими факторами, как состояние болезни, возраст, пол и вес индивидуума, и способность антитела вызывать желательный ответ у индивидуума. Режим дозирования может быть отрегулирован для достижения максимального терапевтического ответа. Например, ежедневно может быть введено несколько дробных доз, или доза может быть пропорционально уменьшена в соответствии с потребностями терапевтической ситуации. Кроме того, доза может изменяться с целью обеспечения оптимального профилактического эффекта дозы в зависимости от обстоятельств. Например, полипептиды и вакцина настоящего изобретения могут вводиться индивидууму с интервалами в несколько дней, одну или две недели или даже месяцев, всегда в зависимости от уровня аллерген-специфической IgG индукции.

В предпочтительном варианте осуществления настоящего изобретения полипептид/вакцина применяется от 2 до 10, предпочтительно от 2 до 7, даже более предпочтительно до 5 и наиболее предпочтительно до 3 раз. В особенно предпочтительном варианте осуществления интервал времени между последовательными вакцинациями выбирают так, чтобы он составлял от 2 недель до 5 лет, предпочтительно от 1 месяца и до 3 лет, более предпочтительно от 2 месяцев и до 1,5 лет. Повторное введение пептида/вакцины настоящего изобретения может максимально увеличивать окончательный эффект терапевтической вакцинации.

Согласно особенно предпочтительному варианту осуществления настоящего изобретения три или более пептидов, связывающих В-клетки, выбранных из группы, состоящей из SEQ ID No. 1, SEQ ID No. 2, SEQ ID No. 5, SEQ ID No. 9, SEQ ID No. 137, SEQ ID No. 139, SEQ ID No. 142 и SEQ ID No. 10, связываются на Ν- и С-концах с поверхностным полипептидом вируса семейства гепаднавирусов, предпочтительно полипептидом PreS гепатита или его фрагментами.

Полипептиды настоящего изобретения, содержащие, по меньшей мере, три пептида, связывающих В-клетки, происходящих, по меньшей мере, от одного аллергена дикого типа, выбирают из группы, состоящей из SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16, SEQ ID No. 17, SEQ ID No. 18 и SEQ ID No. 19.

Другой аспект настоящего изобретения имеет отношение к молекуле нуклеиновой кислоты, кодирующей полипептид согласно настоящему изобретению.

Другой аспект настоящего изобретения имеет отношение к вектору, содержащему молекулу нуклеиновой кислоты согласно настоящему изобретению.

Указанный вектор предпочтительно является вектором экспрессии.

Вектор, содержащий молекулу нуклеиновой кислоты настоящего изобретения, может использоваться с целью клонирования или для получения векторов экспрессии. Указанный вектор может быть плазмидой, космидой, вирусом, бактериофагом или любым другим вектором, обычно используемым в генной инженерии, и может включать, в дополнение к молекуле нуклеиновой кислоты изобретения, эукариотические и прокариотические элементы для контроля экспрессии, например, регуляторные последовательности для инициации и терминации транскрипции и/или трансляции, энхансеры, промоторы, сигнальные последовательности и тому подобное.

Согласно предпочтительному варианту осуществления настоящего изобретения вектор является бактериальным, грибковым, вирусным вектором или вектором насекомого или млекопитающего.

Вектор настоящего изобретения предпочтительно может использоваться с целью клонирования и экспрессии у разных хозяев, таких как бактерии, дрожжи, мицелиальные грибы, клетки млекопитающих, клетки насекомых, клетки растений или любые другие прокариотические или эукариотические клетки. Поэтому, указанный вектор содержит кроме нуклеиновой кислоты, кодирующей гипоаллергенную молекулу или гибридный белок согласно настоящему изобретению, специфические для хозяина регуляторные последовательности.

Другой аспект настоящего изобретения имеет отношение к хозяину, содержащему молекулу нуклеиновой кислоты или вектор согласно настоящему изобретению.

Молекула нуклеиновой кислоты и вектор согласно настоящему изобретению могут быть введены подходящему хозяину. Указанная молекула может быть встроена в геном хозяина. Вектор может существовать внехромосомно и в цитоплазме или может быть встроен в хромосому хозяина.

Еще один аспект настоящего изобретения имеет отношение к антителу, направленному на гипоаллергенную молекулу, гипоаллергенный гибридный белок или гибридный белок согласно настоящему изобретению.

Другой аспект настоящего изобретения имеет отношение к вакцинной композиции, содержащей, по меньшей мере, один, предпочтительно, по меньшей мере, два, более предпочтительно, по меньшей мере, три, даже более предпочтительно, по меньшей мере, 4, полипептида согласно настоящему изобретению.

В особенно предпочтительном варианте осуществления настоящего изобретения вакцина содержит, по меньшей мере, один, предпочтительно, по меньшей мере, два, предпочтительно, по меньшей мере, три, предпочтительно, по меньшей мере, четыре, предпочтительно, по меньшей мере, 5, полипептидов, имеющих аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16, SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ IDNo. 149, SEQ ID No. 150, SEQ ID No. 151 и SEQ ID No. 152.

В зависимости от композиции такая вакцина может использоваться для лечения и/или предотвращения аллергии на пыльцу трав, аллергии на пыльцу березы, аллергии на клеща домашней пыли или комбинации этих видов аллергии у индивидуумов, страдающих от таких видов аллергии или имеющих риск испытывать такую аллергию.

Использованный в описании термин "предотвращение" включает не только меры предотвращения появления болезни, такие как уменьшение фактора риска, но также задержку ее прогрессирования и уменьшение ее последствий, после того как она установлена. "Предотвращение" означает также предотвращение сенсибилизации индивидуума, имеющего риск развития аллергии.

Использованный в описании термин "лечение" или грамматические эквиваленты включает улучшение и/или купирование симптомов болезни (например, аллергии). Соединение, вызывающее улучшение любого параметра, связанного с болезнью, при использовании в методах скрининга текущего изобретения, таким образом, может называться терапевтическим соединением. Термин "лечение" относится и к терапевтическому лечению и к профилактическим или предупредительным мерам.

Согласно одному из наиболее предпочтительных вариантов осуществления настоящего изобретения вакцина содержит полипептиды, имеющие аминокислотную последовательность SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID No. 17.

Согласно другому предпочтительному варианту осуществления настоящего изобретения вакцина содержит полипептиды, имеющие аминокислотную последовательность SEQ ID No. 18 и/или SEQ ID No. 19.

Согласно особенно предпочтительному варианту осуществления настоящего изобретения вакцина содержит полипептиды настоящего изобретения, включающие фрагменты аллергена, происходящие от аллергенов клеща домашней пыли. В частности, предпочтительными являются аминокислотные остатки от 1 до 33, от 21 до 51, от 42 до 73, от 62 до 103 или от 98 до 129 Der p 2, аминокислотные остатки от 1 до 30, от 20 до 50, от 50 до 80, от 90 до 125, от 125 до 155 или от 165 до 198 Der p 7, аминокислотные остатки от 1 до 35, от 35 до 72, от 70 до 100 или от 90 до 122 Der p 21, аминокислотные остатки от 1 до 32, от 15 до 48 или от 32 до 70, от 32 до 60, от 52 до 84, от 32 до 70 (Цистеин->Серин) Der p 23, аминокислотные остатки от 1 до 30, от 1 до 41, от 27 до 57, от 42 до 82, от 52 до 84, от 85 до 115, от 99 до 135, от 145 до 175, от 155 до 187, от 175 до 208 или от 188 до 222 Der p 1. Наиболее предпочтительно вакцина содержит, по меньшей мере, один из полипептидов SEQ ID No. 149-152 (показанных на фиг. 18A-D).

В особенно предпочтительном варианте осуществления полипептид/вакцина настоящего изобретения вводится 4 раза за год лечения в течение общего периода лечения от 1 до 5 лет, предпочтительно в течение от 2 до 3 лет. Из указанных 4 ежегодных введений 3 проводятся в течение периода 6-12, предпочтительно 8, недель с интервалом от 3 до 6 недель, предпочтительно 4 недель, между введением 1 и 2, а другое от 3 до 6 недель, предпочтительно 4 недель, между введением 2 и 3. Четвертое введение осуществляется через 3-7 месяцев после третьего введения. Если общий период лечения превышает 1 год, тот же самый режим дозирования применяется в следующие годы лечения.

Для лечения сезонных аллергий (например, пыльцевых аллергий, таких как аллергия на пыльцу трав или аллергия на пыльцу березы) введения 1, 2 и 3 предпочтительно планируются до соответствующего сезона, когда происходит воздействие аллергена (сезон пыления), а четвертое введение планируется после сезона.

Вакцинная композиция согласно настоящему изобретению может быть создана известным в данной области техники способом и обязательно должна быть адаптирована к способу введения указанной вакцинной композиции.

Предпочтительные пути введения вакцинной композиции (настоящего изобретения) включают все стандартные режимы введения, описанные и предложенные для вакцинации вообще и, в частности, для иммунотерапии аллергии (пероральное, чрескожное, внутривенное, интраназальное, через слизистую, ректальное введения и т.д.). Однако, особенно предпочтительно вводить молекулы и белки согласно настоящему изобретению подкожно или внутримышечно.

Вакцинная композиция согласно настоящему изобретению может содержать только вирусный капсидный белок или его фрагменты члена рода гепаднавирусов.

Предпочтительно указанная композиция дополнительно содержит, по меньшей мере, один адъювант, фармацевтически приемлемый эксципиент и/или консервант.

Для того чтобы увеличить иммуногенность гипоаллергенных молекул согласно настоящему изобретению, в медикаменте согласно настоящему изобретению могут использоваться, например, адъюванты. Адъювант согласно настоящему изобретению представляет собой вспомогательное вещество, которое при введении совместно с или параллельно с антигеном увеличивает иммуногенность и/или влияет на качество иммунного ответа. Следовательно, адъювант может, например, оказывать существенное влияние на гуморальный или клеточный иммунный ответ. Общепринятыми адъювантами являются, например, соединения алюминия, липид-содержащие соединения или инактивированные микобактерии.

Как правило, адъюванты могут иметь различные формы, при условии, что они пригодны для введения людям. Дополнительными примерами таких адъювантов являются масляные эмульсии минерального или растительного происхождения, минеральные соединения, такие как фосфат или гидроксид алюминия, или фосфат кальция, бактериальные продукты и производные, такие как Р40 (полученный из клеточной стенки Corynebacterium granulosum), монофосфорил липид A (MPL, производное LPS) и производные мурамил пептида и его конъюгаты (производные компонентов микобактерий), квасцы, неполный адъювант Фрейнда, липосин, сапонин, сквален и т.д. (смотри, например, Gupta R. K. et al. (Vaccine 11:293-306 (1993)) и Johnson A. G. (Clin. Microbiol. Rev. 7:277-289). Наиболее предпочтительно, что медикамент настоящего изобретения в качестве адъюванта содержит квасцы.

Другим предпочтительным вариантом осуществления настоящего изобретения является комбинация более, чем одного гибридного белка, содержащая гипоаллергенные пептиды и белок preS гепатита В. Эти комбинации могут быть получены из пептидов от одного аллергена или от разных аллергенов одного и того же источника аллергена или от нескольких разных источников аллергена.

Предпочтительный вариант осуществления настоящего изобретения имеет отношение к смеси из четырех гибридных белков, содержащих гипоаллергенные пептиды от Phl p 1, Phl p 2, Phl p 5, и Phl p 6 и белка preS вируса гепатита В.

Другой предпочтительный вариант осуществления настоящего изобретения имеет отношение к гибридному белку или смеси из 2 гибридных белков, содержащих гипоаллергенные пептиды от Bet v 1 и белка preS вируса гепатита В.

Еще один предпочтительный вариант осуществления настоящего изобретения имеет отношение к смеси, по меньшей мере, из 2 гибридных белков, содержащих гипоаллергенные пептиды из аллергенов клеща домашней пыли, наиболее предпочтительно выбранные из Der p 1, Der p 2, Der p 5, Der p 7, Der p 21 и Der p 23 и белка preS вируса гепатита В. Наиболее предпочтительно смесь содержит 3 гибридных белка, содержащие гипоаллергенные пептиды, происходящие от Der p 1, Der p 2, и Der p 23. Особенно предпочтительным является, что смесь содержит, по меньшей мере, один, предпочтительно, по меньшей мере, два, более предпочтительно, по меньшей мере, три, из полипептидов, показанных в SEQ ID No. 149-152 (см. также фиг. 18A-D).

В общем, специфические вакцинные композиции согласно настоящему изобретению могут быть получены для лечения или предотвращения различных видов аллергии путем комбинации гипоаллергенных полипептидов изобретения, представляющих клинически значимые аллергены источника аллергена. Методы определения клинически значимых аллергенов источника аллергенов известны в данной области техники и описаны ранее (Valenta и Niederberger, 2007, J Allergy Clin Immunol, 119 (4): 826-830). В предпочтительном варианте осуществления гипоаллергенные полипептиды указанной специфической вакцинной композиции адсорбируются на адъюванте, который может применяться на людях (например, гидроксид алюминия), а данная смесь вводится 3-4 раза в год в течение 1-3 лет, при этом в вакцинной композиции присутствует более, чем 10 мкг, каждого полипептида, на дозу.

Согласно другому предпочтительному варианту осуществления настоящего изобретения указанные композиции содержат от 10 нг до 1 г, предпочтительно от 100 нг до 10 мкг, в частности, от 0,5 мкг до 200 мкг указанной гипоаллергенной молекулы или антитела.

Другой аспект настоящего изобретения имеет отношение к использованию гипоаллергенного белка или антитела согласно настоящему изобретению для производства медикамента, предназначенного для лечения или предотвращения вирусной инфекции и/или аллергии у человека или животного.

Предпочтительно, указанный медикамент дополнительно содержит, по меньшей мере, один адъювант, фармацевтически приемлемый эксципиент и/или консервант.

Медикамент согласно настоящему изобретению может использоваться для активной (введение гипоаллергенного белка и/или молекул изобретения), а также для пассивной иммунизации (антитела, направленные на гипоаллергенный белок и/или молекулы изобретения).

Согласно предпочтительному варианту осуществления настоящего изобретения указанный медикамент содержит от 10 нг до 1 г, предпочтительно от 100 нг до 10 мг, в частности, от 0,5 мкг до 200 мкг указанной гипоаллергенной молекулы, молекулы нуклеиновой кислоты, вектора, хозяина или антитела.

Медикамент предпочтительно вводится индивидууму в количестве от 0,01 мкг/кг веса тела до 5 мкг/кг веса тела, предпочтительно от 0,1 мкг/кг веса тела до 10 мкг/кг веса тела.

В особенно предпочтительном варианте осуществления медикамент вводится в дозировке, содержащей в абсолютном значении 5-200 мкг, более предпочтительно 10-80 мкг, наиболее предпочтительно 20-40 мкг каждого включенного гипоаллергенного полипептида.

Конкретный режим дозирования, т.е. доза, время введения и повторение, будет зависеть от отдельного индивидуума и истории болезни индивидуума. Эмпирические соображения, такие как период полувыведения, в большинстве случаев будут способствовать определению дозировки. Частота введения может определяться и регулироваться в ходе терапии.

Наиболее предпочтительно режим дозирования медикамента будет состоять из 4 ежегодных подкожных введений одной и той же дозы в течение общего периода лечения от 2 до 3 лет. Из указанных 4 ежегодных подкожных инъекций 3 применяются в пределах периода от 6 до 12, предпочтительно 8, недель, имеющих интервалы от 3 до 6 недель, предпочтительно 4 недель, между инъекцией 1 и 2, а еще одна в пределах от 3 до 6 недель, предпочтительно 4 недель, между инъекцией 2 и 3. Четвертая инъекция применяется через 4-6 месяцев после третьего введения. Такой же режим дозирования применяется в последующие годы лечения.

Для лечения сезонных аллергий (например, пыльцевых аллергий, таких как аллергия на пыльцу трав или аллергия на пыльцу березы) введения 1, 2 и 3 предпочтительно планируются до соответствующего сезона, когда происходит воздействие аллергена (сезон пыления), а четвертое введение планируется после сезона.

Индивидуум, которому вводится медикамент согласно настоящему изобретению, предпочтительно является индивидуумом или животным, у которого есть аллергия или имеется риск развития аллергии.

Субъекты, имеющие аллергию или риск развития аллергии, аллергическое состояние, аллергическое нарушение или аллергическое заболевание включают субъектов с существующим аллергическим состоянием или известным или предполагаемым предрасположением к развитию симптома, связанного с или вызванного аллергическим состоянием. Таким образом, субъект может иметь активное хроническое аллергическое состояние, нарушение или заболевание, случай острой аллергии или латентное аллергическое состояние, нарушение или заболевание. Некоторые аллергические состояния связаны с сезонными или географическими факторами окружающей среды. Таким образом, субъекты, находящиеся в группе риска, включают субъектов с повышенным риском испытать такое состояние, исходя из предшествующей собственной истории болезни или семейного анамнеза, сезона или физического местоположения, причем в настоящее время данное состояние или симптом, связанный с данным состоянием, не проявляется у субъекта.

Введение медикамента согласно настоящему изобретению, содержащего, по меньшей мере, одну гипоаллергенную молекулу, как описано в описании, индивидууму может предотвратить сенсибилизацию указанного индивидуума или может вызывать соответствующий иммунный ответ на аллергены. Если медикамент настоящего изобретения используется для предотвращения сенсибилизации, его следует вводить индивидууму до первого контакта с указанным аллергеном. Поэтому, предпочтительным является введение медикамента согласно настоящему изобретению новорожденным и детям. Отсюда вытекает, что введение медикамента согласно настоящему изобретению беременным индивидуумам будет вызывать образование антител, направленных против аллергенов у нерожденного ребенка. Особенно полезно использовать для таких видов лечения гипоаллергенные молекулы согласно настоящему изобретению, так как вследствие отсутствия аллерген-специфических Т-клеточных эпитопов, побочные эффекты, появляющиеся в ходе аллерген-иммунотерапии, могут быть значительно снижены или даже их можно полностью избежать.

Другой аспект настоящего изобретения имеет отношение к использованию вирусного капсидного белка от вируса семейства гепаднавирусов в качестве носителя в медикаментах или вакцинах.

Одним из преимуществ такого носителя является то, что не только антиген, соединенный или конъюгированный с ним, может подвергаться воздействию иммунной системы, но также индуцируется иммунный ответ против капсидного белка гепаднавируса. В результате, такая вакцинация может приводить к предотвращению и/или лечению заболеваний, вызванных гепаднавирусами. Предпочтительно вирус представляет собой вид вируса гепатита В человека.

Другой аспект настоящего изобретения имеет отношение к гипоаллергенной молекуле, полученной от Phl p 5 (Genbank Nr. Х7435), имеющей укорочение на С- и/или N-конце и по существу утратившей IgE-связывающую способность. Пыльца трав является одним из наиболее активных, находящихся вне дома, сезонных источников аллергенов в воздухе, ответственных за аллергический ринит (сенная лихорадка) и аллергическую астму.

Более чем 40% индивидуумов с аллергией демонстрируют IgE-реактивность на аллергены пыльцы трав, которые подразделяются более, чем на 11, групп. Более чем 80% пациентов с аллергией на пыльцу трав вступают в реакцию с аллергенами группы 5.

Аллергены группы 5 представляют собой негликозилированные, высокогомологичные белки с молекулярным весом в пределах 25-33kD. Несколько аллергенов группы 5 были клонированы и/или имуннологически охарактеризованы.

Попытка уменьшить аллергенную активность путем введения точковых мутаций, мутаций нескольких аминокислот последовательно или делеций не показала результата (Schramm G, et al. J Immunol 1999; 162: 2406-1435). Уже описаны IgE-связывающие участки Phl p 5 (Flicker S, et al. J Immunol 2000; 165: 3849-3859) и трехмерная структура (Maglio О, et al. 2002. Protein Eng. 15:635-642).

Оказалось, в частности, что Phl p 5 пептиды согласно настоящему изобретению, являющиеся укороченными на С- и/или N-конце и утратившие IgE-связывающую способность, могут использоваться для активной вакцинации индивидуумов.

Согласно предпочтительному варианту осуществления настоящего изобретения укороченная молекула по существу утрачивает Т-клеточные эпитопы и, таким образом, утрачивает Phl p 5-специфическую Т-клеточную реактивность.

Как уже отмечалось выше, побочные эффекты аллерген-иммунотерапии могут быть существенно уменьшены или даже их можно избежать, в том случае, если гипоаллергенные молекулы в основном утратили аллерген-специфические Т-клеточные эпитопы.

Укороченные молекулы Phl p 5, утратившие Т-клеточные эпитопы состоят из аминокислот 93-128, 98-128, 26-53, 26-58 или 252-283 Phl p 5 или фрагментов или вариантов их последовательности.

В частности, эти укороченные молекулы в основном показывают низкую или отсутствие аллерген-специфической Т-клеточной реактивности и являются, тем не менее, способными вызывать соответствующий иммунный ответ, направленный против аллергена дикого типа.

Согласно другому предпочтительному варианту осуществления настоящего изобретения гипоаллергенный укороченный Phl p 5 состоит из аминокислот 132-162, 217-246 или 176-212 Phl p 5 или вариантов их последовательности.

Эти гипоаллергенные молекулы содержат один или более Т-клеточных эпитопов, но утрачивают IgE-связывающую способность.

Другим предпочтительным вариантом осуществления настоящего изобретения являются укороченные Phl p 1 молекулы, утратившие Т-клеточные эпитопы, которые состоят из аминокислот 1-30, 43-70, 87-117, 151-171 или 214-241 Phl p 1 или вариантов их последовательности, соединенные с вирусным белком-носителем, предпочтительно белком preS гепатита В.

Другим предпочтительным вариантом осуществления настоящего изобретения являются укороченные Phl p 2 молекулы, утратившие Т-клеточные эпитопы, которые состоят из аминокислот 1-33, 8-39, 34-65 или 66-96 Phl p 2 или вариантов их последовательности, соединенные с вирусным белком-носителем, предпочтительно белком preS гепатита В.

Другим предпочтительным вариантом осуществления настоящего изобретения являются укороченные Phl p 6 молекулы, утратившие Т-клеточные эпитопы, которые состоят из аминокислот 23-54, 56-90, 73-114 или 95-127 Phl p 6 или вариантов их последовательности, соединенные с вирусным белком-носителем, предпочтительно белком preS гепатита В.

Другой предпочтительный вариант осуществления настоящего изобретения имеет отношение к укороченным Bet v 1 молекулам, утратившим Т-клеточные эпитопы, которые состоят из аминокислот 30-59, 50-79, 75-104, 30-74 или 60-104 Bet v 1.

Другим предпочтительным вариантом осуществления настоящего изобретения являются комбинации или смеси укороченных молекул Phleum pratense, утративших Т-клеточные эпитопы, соединенные с вирусным белком-носителем, предпочтительно белком preS гепатита В, как описано выше.

Предпочтительным вариантом осуществления настоящего изобретения являются комбинации или смеси укороченных молекул Phleum pratense, утративших Т-клеточные эпитопы, которые состоят из каждого такого гибридного белка от укороченных Phl p 1, Phl p 2, Phl p 5 и Phl p 6, как описано выше.

Другой аспект настоящего изобретения имеет отношение к гипоаллергенной молекуле, полученной от Fel d 1 (Genbank Nr. X62477 и X62478), имеющей укорочение на С- и/или N-конце и утратившей IgE-связывающую способность.

Аллергия на животных затрагивает до 40% пациентов с аллергией. В частности, в условиях домашней обстановки широко распространена и связана с непрерывными симптомами аллергия к самым популярным домашним животным, собакам и кошкам. Аллергены животных присутствуют в перхоти, эпителии, слюне, сыворотке или моче. Воздействие этих аллергенов может происходить или путем прямого контакта с кожей или путем вдыхания частиц, несущих аллергены. Показано, что основные аллергены кошек и собак распространены повсеместно и даже могут быть обнаружены в жилых помещениях людей, не являющихся владельцами домашних питомцев, и в публичных местах, например, школах. Это может объясняться высоким и растущим количеством домашних хозяйств, содержащих домашних животных, в промышленно развитых странах (около 50%) и высокой стабильностью аллергенов, которые выносятся наружу и распространяются.

Fel d 1 был установлен как основной кошачий аллерген, который распознается более чем 90% пациентов с аллергией на кошек. Fel d 1 представляет собой кислый гликопротеин 38 kDa с неизвестной биологической функцией. Он состоит из двух идентичных нековалентно связанных гетеродимеров, которые, в свою очередь, состоят из двух полипептидных цепей, антипараллельно связанных тремя дисульфидными связями. Цепь 1 и цепь 2 кодируются разными генами, каждый из которых состоит из 3 экзонов. Рекомбинантный Fel d 1 (rFel d 1), экспрессированный как цепь 2 к цепи 1 гибридного белка, был получен в Е. coll. Этот рекомбинантный Fel d 1 способен полностью повторять иммунологические свойства аллергена дикого типа.

Пептиды, полученные из основного кошачьего аллергена Fel d 1 и утратившие IgE-связывающую способность, являются пригодными, например, для иммунотерапии и профилактической вакцинации от аллергии. Синтетические пептиды, происходящие от Fel d 1, подобные Phl p5, и пептиды, полученные из аллергена, раскрытые в описании, способны индуцировать IgG ответ, т.е. выработку так называемых "блокирующих антител" или "защитных антител". Эти антитела предотвращают IgE-связывание с аллергеном Fel d 1. Таким образом, может быть достигнуто значительное уменьшение симптомов аллергии.

Согласно предпочтительному варианту осуществления настоящего изобретения укороченная молекула демонстрирует уменьшенную Т-клеточную реактивность.

Для того чтобы избежать или значительно уменьшить поздние побочные эффекты, гипоаллергенная молекула, полученная из Fel d 1, проявляет уменьшенную Т-клеточную реактивность, как определено в настоящем изобретении.

Укороченный Fel d 1 предпочтительно состоит из аминокислот 1-34 или 35-70 цепи 1 Fel d 1, аминокислот 1-34, 35-63 или 64-92 цепи 2 Fel d 1 или вариантов их последовательностей.

Другой аспект настоящего изобретения имеет отношение к гипоаллергенным молекулам, содержащим или состоящим из аминокислот 1-33, 21-51, 42-73, 62-103 или 98-129 Der p 2, аминокислот 1-30, 20-50, 50-80, 90-125, 125-155 или 165-198 Der p 7, аминокислот 1-35, 35-72, 70-100 или 90-122 Der p 21, аминокислот 1-32, 15-48 или 32-70, 32-60, 52-84, 32-70 (цистеин->серин) Der p 23, аминокислот 19-58, 59-95, 91-120 или 121-157 Alt а 1, аминокислот 31-60, 45-80, 60-96 или 97-133 Par j 2, аминокислот 1-40, 36-66, 63-99, 86-120 или 107-145 Ole е 1, аминокислот 25-58, 99-133, 154-183, 277-307, 334-363, 373-402, 544-573, 579-608, 58-99, 125-165, 183-224, 224-261, 252-289, 303-340, 416-457, 460-500 или 501-542 Fel d 2, аминокислот 19-58, 52-91, 82-119, 106-144 или 139-180 Can f 2, аминокислот 19-56, 51-90, 78-118, 106-145 или 135-174 Can f 1, аминокислот 27-70, 70-100 или 92-132 Art v 1, аминокислот 31-70, 80-120, 125-155, 160-200, 225-263, 264-300, 305-350 или 356-396 Amb а 1, аминокислот 1-34, 35-74, 74-115, 125-165, 174-213, 241-280, 294-333, 361-400 или 401-438 Alt а 6, аминокислот 1-40, 41-80, 81-120, 121-160 Alt а 2, или фрагментам или вариантам их последовательностей.

Способы получения гибридных белков хорошо известны в данной области техники и могут быть найдены в классических молекулярно-биологических работах, таких как Sambrook et al. (Molecular Cloning, 2nd ed., Cold Spring Harbor Laboratory Press, 1989) и Ausubel et al. (Short Protocols in Molecular Biology, 3rd ed; Wiley и Sons, 1995). В общем, гибридный белок получают сначала путем конструирования гибридного гена, который вставляется в подходящий вектор экспрессии, который, в свою очередь, используется для трансфицирования подходящей клетки-хозяина. В общем, рекомбинантные гибридные конструкты получают с помощью серии расщеплений рестрикционными ферментами и реакций лигирования, которые дают в результате желательные последовательности, будучи встроенными в плазмиду. Если подходящие сайты рестрикции недоступны, могут использоваться синтетические олигонуклеотидные адаптеры или линкеры, как известно специалистам в данной области техники и описано в приведенных выше ссылках. Полинуклеотидные последовательности, кодирующие аллергены и нативные белки, могут быть собраны до вставки в подходящий вектор, или последовательность, кодирующая аллерген, может быть вставлена рядом с последовательностью, кодирующей нативную последовательность, уже присутствующую в векторе. Вставка последовательности в вектор должна происходить внутри рамки, так чтобы последовательность могла быть транскрибирована в белок. Специалистам понятно, что необходимые определенные рестрикционные ферменты, линкеры и/или адапторы, а также точные условия реакции будут варьироваться в зависимости от используемых последовательностей и клонирующих векторов. Однако, сборка ДНК-конструктов является обычной в данной области техники и может быть легко выполнена специалистом в данной области техники.

Особым и неожиданным преимуществом является то, что гибридные белки, полученные из укороченных молекул гипоаллергенного аллергена и белка preS гепатита В человека, могут воспроизводимо экспрессироваться в стандартных системах экспрессии и легко могут быть изготовлены промышленным способом с высоким выходом в стандартных системах экспрессии, известных специалистам в данной области техники, в частности, при использовании Escherichia coli в качестве экспрессирующей системы. Такой процесс производства, как правило, включает экспрессию молекул согласно изобретению путем культивирования клеток в биореакторе (например, в ферментере, встряхиваемой колбе), последующего сбора клеток (например, фильтрованием, центрифугированием и т.д.) и разрушения клеток (например, путем гомогенизации под высоким давлением, обработки ультразвуком, циклов замораживания/размораживания, ферментативного или химического лизиса клеток и т.д.), очистки молекул (например, с помощью хроматографии, фильтрования, преципитации, ультра/диафильтрации и т.д.) и образования конечного продукта. Для получения высокого выхода молекул согласно изобретению предпочтительно используются процессы культивирования с высокой плотностью клеток с применением периодической ферментации с добавлением субстрата.

Другой аспект настоящего изобретения имеет отношение к молекуле нуклеиновой кислоты, кодирующей гипоаллергенную молекулу, и гибридному белку согласно настоящему изобретению.

Молекула нуклеиновой кислоты настоящего изобретения может использоваться, например, для получения указанных молекул рекомбинантным путем.

Согласно другому аспекту настоящего изобретения указанная молекула нуклеиновой кислоты может быть включена в вектор.

Этот вектор предпочтительно является вектором экспрессии.

Далее настоящее изобретение иллюстрируется с помощью следующих фигур и примеров, однако, без ограничения.

Фиг. 1А представляет схематичное описание вектора HBV_Phlpl_4xP5.

Фиг. 1В представляет схематичное описание вектора HBV_Phlp2_4xP3.

Фиг. 1С представляет схематичное описание вектора HBV_Phlp5_V2.

Фиг. 1D представляет схематичное описание вектора HBV_Phlp6_4xPl.

Фиг. 2А показывает первичную последовательность гибридного белка HBV_PhlP1_4xP5 (ВМ321, последовательность ID Nr. 14)

Фиг. 2В показывает первичную последовательность гибридного белка HBV_Phlp2_4xP3 (ВМ322, последовательность ID Nr. 15).

Фиг. 2С показывает первичную последовательность гибридного белка HBV_Phlp5_V2 (ВМ325, последовательность ID Nr. 16).

Фиг. 2D показывает первичную последовательность гибридного белка HBV_Phlp6_4xP1 (В326, последовательность ID Nr. 17).

Фиг. 2Е показывает первичную последовательность гибридного белка HBV_Betv1_4PA (ВМ31а, последовательность ID Nr. 18).

Фиг. 2F показывает первичную последовательность гибридного белка HBV_Betv1_2PA2PB (ВМ31, последовательность ID Nr. 19).

Фиг. 2G показывает первичную последовательность гибридного белка HBV_Phlp5_V1 (последовательность ID No. 20).

Фиг. 3А показывает окрашенный кумасси синим 12% SDS Page-гель, содержащий очищенный гибридный белок HBV_Phlp1_4xP5 (ВМ 321, дорожка 1 и 10: 5 мкг молекулярного маркера, дорожка 2, 3, 11 и 12 5 мкг ВМ321, дорожка 4 и 13 2 мкг ВМ321, дорожка 5 и 14 1 ug ВМ321, дорожка 6 и 15 0,5 мкг ВМ321, дорожка 7 и 16 0,25 мкг ВМ321, дорожка 8 и 17 0,1 мкг ВМ 321, дорожка 9 и 18 0,05 мкг ВМ321). Дорожки 1-9 в условиях восстановления и дорожки 10-18 при невосстановительных условиях.

Фиг. 3В показывает окрашенный кумасси синим 12% SDS Page-гель, содержащий очищенный гибридный белок HBV_Phlp2_4xP3 (ВМ 322, дорожка 1 и 10: 5 мкг молекулярного маркера, дорожка 2, 3, 11 и 12 5 мкг ВМ322, дорожка 4 и 13 2 мкг ВМ322, дорожка 5 и 14 1 мкг ВМ322, дорожка 6 и 15 0,5 мкг ВМ322, дорожка 7 и 16 0,25 мкг ВМ322, дорожка 8 и 17 0,1 мкг ВМ 322, дорожка 9 и 18 0,05 мкг ВМ322). Дорожки 1-9 в условиях восстановления и дорожки 10-18 при невосстановительных условиях.

Фиг. 3С показывает окрашенный кумасси синим 12% SDS Page-гель, содержащий очищенный гибридный белок HBV_Phlp5_V2 (ВМ325, дорожка 1 и 10: 5 мкг молекулярного маркера, дорожка 2, 3, 11 и 12 5 мкг ВМ325, дорожка 4 и 13 2 мкг ВМ325, дорожка 5 и 14 1 мкг ВМ325, дорожка 6 и 15 0,5 мкг ВМ325, дорожка 7 и 16 0,25 мкг ВМ325, дорожка 8 и 17 0,1 мкг ВМ 325, дорожка 9 и 18 0,05 мкг ВМ325). Дорожки 1-9 в условиях восстановления и дорожки 10-18 при невосстановительных условиях.

Фиг. 3D показывает окрашенный кумасси синим 12% SDS Page гель, содержащий очищенный гибридный белок HBV_Phlp6_4xP1 (ВМ326, дорожка 1 и 10: 5 мкг молекулярного маркера, дорожка 2, 3, 11 и 12 5 мкг ВМ326, дорожка 4 и 13 2 мкг ВМ326, дорожка 5 и 14 1 мкг ВМ326, дорожка 6 и 15 0,5 мкг ВМ326, дорожка 7 и 16 0,25 мкг ВМ326, дорожка 8 и 17 0,1 мкг ВМ 326, дорожка 9 и 18 0,05 мкг ВМ326). Дорожки 1-9 в условиях восстановления и дорожки 10-18 при невосстановительных условиях.

Фиг. 4 показывает потерю IgE-реактивности гибридных пептидов, полученных от аллергенов пыльцы трав. IgE-связывание гибридных белков по сравнению с полным аллергеном было проверено с помощью IgE дот-блот-анализа. Сыворотку от указанного количества пациентов с аллергией на пыльцу трав инкубировали с нанесенными капельно белками и определяли связанный IgE с помощью 125I-меченого античеловеческого IgE. Ни для одного из четырех гибридных белков, несущих пептид, не было обнаружено связывание IgE. а) показывает результаты дот-блот-анализа с использованием HBV_Phlp1_4XP5 (ВМ321); b) показывает результаты дот-блот-анализа с использованием HBV_Phlp2_4xP3 (ВМ322); с) показывает результаты дот-блот-анализа с использованием HBV_Phlp5_V2 (ВМ325); d) показывает результаты дот-блот-анализа с использованием HBV_Phlp6_4xP1 (BM326).

Фиг. 5 показывает низкую аллергенную активность гибридного белка, полученного из аллергена пыльцы трав HBV_Phlp1_4xP5 (ВМ321), как определено с помощью CD203c экспрессии на базофилах пациентов с аллергией. РВМС, полученные от пациентов с аллергией на пыльцу трав, инкубировали с серийными разведениями Phl p 1 (светло-серые столбики) или ВМ321 (темно-серые столбики). Индукция CD203c была измерена как среднее значение интенсивности флуоресценции, при этом на оси у показаны вычисленные индексы стимулирования.

Фиг. 6 показывает низкую аллергенную активность гибридного белка, полученного из аллергена пыльцы трав HBV_Phlp6_4xP1 (ВМ326) как определено с помощью CD203c экспрессии на базофилах пациентов с аллергией. РВМС, полученные от пациентов с аллергией на пыльцу трав, инкубировали с серийными разведениями Phl p 6 (светло-серые столбики) или ВМ326 (темно-серые столбики). Индукция CD203c была измерена как среднее значение интенсивности флуоресценции, при этом на оси y показаны вычисленные индексы стимулирования.

Фиг. 7 показывает специфические IgG1-ответы на аллерген пыльцы травы тимофеевки у мышей. Группу из 4 мышей иммунизировали 20 мкг гибридных белков (отдельные гибридные белки и комбинация из 4 гибридных белков) и 10 мкг каждого (Phl p1 и 5) или 5 мкг каждого (Phl р2 и 6) из аллергенов дикого типа на неделе исследования 0 и 3, с последующей бустер-иммунизацией на неделе исследования 17. Антигены вводили подкожно в участок на спине животных. Образцы крови собирали на неделе исследования 0, 3, 6, 9, 12, 17, 20 и 22 из хвостовой вены мышей. На неделе с проведением иммунизации кровь собирали за день до иммунизации. Антисыворотку исследовали на наличие аллерген-специфического IgG1 с помощью ELISA. Преантисыворотки до первой иммунизации были отрицательными у всех животных. Отдельные гибридные белки сравнили с применением смеси гибридных белков.

a) Иммунный ответ против rPhl p 1 антигена HBV_Phlp1_4xP5 (ВМ321 как отдельный компонент), ВМ321 в смеси с ВМ322, ВМ325 и ВМ326 и rPhl p 1 иммунизированной мыши.

b) Иммунный ответ против rPhl p 2 антигена HBV_Phlp2_4xP3 (ВМ321 как отдельный компонент), ВМ322 в смеси с ВМ321, ВМ325 и ВМ326, и rPhl p 2 иммунизированной мыши.

c) Иммунный ответ против rPhl p 5 антигена HBV_Phlp5_V2 (ВМ325 как отдельный компонент), ВМ325 в смеси с ВМ321, ВМ322 и ВМ326, и rPhl p 5 иммунизированной мыши.

d) Иммунный ответ против rPhl p 6 антигена HBV_Phl p6_4xP1 (ВМ326 как отдельный компонент), ВМ326 в смеси с ВМ321, ВМ322 и ВМ325, и rPhl p 6 иммунизированной мыши.

Фиг. 8 показывает молекулярную и иммунологическую характеристику рекомбинантных гибридных белков. А. Кумасси-окрашенный SDS-PAGE показывает четыре PreS гибридных белка с пептидами, полученными от Bet v1, (дорожка 1: 2хРА-PreS, дорожка 2: 2xPB-PreS, дорожка 3: 4xPA-PreS, дорожка 4: 2xPA2xPB-PreS) и носитель PreS (дорожка 5). В. Нанесенные точками на нитроцеллюлозу рекомбинантные гибридные белки и PreS исследовали с помощью кроличьей анти-PreS сыворотки (дорожка 1), кроличьей неиммунной сыворотки (дорожка 3) буферного контроля для кроличьих антител (дорожка 3) и моноклональных антител, направленных против пептида Р2', полученного от Bet v 1 (mAb2), (дорожка 4) и Р4' (mAb12) (дорожка 5) и буферный контроль для моноклональных мышиных антител (дорожка 6).

Фиг. 9А показывает IgE-реактивность rBet v 1 и рекомбинантных гибридных белков PreS с пептидами, полученными из Bet v 1. Образцы сыворотки от пациентов с аллергией на пыльцу березы, образцы от контролей без аллергии и только буфер были протестированы в отношении их реактивности методом дот-блот к rBet v 1, четырем рекомбинантным гибридным белкам (2PA-PreS, 2PB-PreS, 4PA-PreS, 2PA2PB-PreS) и PreS в отдельности. Связанные IgE человека были обнаружены с помощью 125I-меченых античеловеческих IgE антител. Число импульсов в минуту (cpm), соответствующее связанному IgE, измеряли с помощью γ-счетчика и указывали на оси y. Коробчатые диаграммы показывают результаты 50 пациентов с аллергией на пыльцу березы.

Фиг. 9В показывает активацию базофилов с помощью rBet v1 и четырех PreS гибридных белков, как измерено с помощью повышающей регуляции CD 203с. Образцы крови от пациентов с аллергией на пыльцу березы подвергали воздействию увеличивающихся концентраций (0,001-1 мкг/мл) антигенов, анти-IgE буферного контроля (Со). Показаны результаты одного типичного пациента. Экспрессия CD 203с была определена с помощью FACS-анализа и представлена в виде индекса стимулирования (SI) (ось y). Показаны средние значения из трех измерений, указаны стандартные отклонения.

Фиг. 10 показывает лимфопролиферативные ответы и выработку цитокинов РВМС пациентов с аллергией на пыльцу березы. РВМС от пациентов с аллергией на пыльцу березы стимулировали эквимолярными количествами rBet v 1, полученными от Bet v 1 пептидов РА и PB, PreS в отдельности и PreS гибридных белков (т.е. 2PA-PreS, 2PB-PreS, 4PA-PreS, 2PAPB-PreS). Показаны индексы стимулирования (SI) (ось y).

(A) Показаны SI при самой высокой концентрации (5 мкг/лунку Bet v 1 и эквимолярные количества пептидов, PreS и PreS гибридных белков) шести (6) пациентов с аллергией на пыльцу березы в виде коробчатых диаграмм, где 50% значений находятся внутри прямоугольников, а между столбиками (bars) имеются диапазоны без выброса. Линии внутри прямоугольников показывают срединные значения.

(B) Показаны SI для четырех концентраций (1=5 мкг/лунку, 2=2,5 мкг/лунку, 3=1,25 мкг/лунку, 4=0,63 мкг/лунку rBet v1 и эквимолярных количеств пептидов, PreS и PreS гибридных белков) для одного типичного пациента.

(C) Была измерена выработка цитокинов в культуральных средах (супернатантах) РВМС 6 пациентов с аллергией на пыльцу березы, стимулированных 2,5 мкг/мл rBet v 1 и эквимолярными количествами пептидов РА и PB, PreS и четырьмя PreS гибридными белками. Наблюдаемые концентрации (пг/мл) (оси y) после стимулирования антигенами показаны на коробчатых диаграммах, где 50% значений находятся внутри прямоугольников, а между столбиками (bars) имеются диапазоны без выброса. Линии внутри прямоугольников показывают срединные значения.

Фиг. 11 показывает индукцию IgG антител, специфических для rBet v 1 и Bet v 1 гомологичных аллергенов после подкожной иммунизации PreS гибридными белками у кроликов.

(А) Кроликов иммунизировали с помощью алюмгидроксид-адсорбированных (Alum) (сверху) или адсорбированных полным адъювантом Фрейнда (CFA) (внизу) гибридных белков (2PA-PreS, 2PB-PreS, 4PA-PreS, 2PAPB-PreS) и rBet v 1. Измеряли кроличий IgG, специфический для rBet v 1, средние значения оптической плотности (OD) из двукратных измерений показаны (оси y) для разных разведений кроличьей антисыворотки (оси x).

(B1) Несколько выравниваний последовательностей Bet v 1 и Bet v 1-гомологичных аллергенов ольхи (Aln g 1), ореха (лещины) (Cor а 1) и яблони (Mal d 1). Одни и те же аминокислоты указаны как точки, пропуски указаны как тире. Процент идентичности Bet v 1 гомологичных аллергенов относительно Bet v 1 показан справа. Bet v 1-полученный пептид А (РА, пунктирная линия) и пептид В (PB, сплошная линия) заключены в рамки.

(B2) IgG антитела антикроличьих сывороток (rab α-2PA-PreS, rab α-2PB-PreS, rab α-4PA-PreS, rab α-2PAPB-PreS), направленные против rBet v 1, rAln g 1, rCor a 1 и rMal d 1 (оси x), были измерены с помощью ELISA. Показаны средние значения двух измерений. Показана оптическая плотность (OD), соответствующая аллерген-специфическому IgG в кроличьих сыворотках (post), в сравнении с соответствующими преиммунными сыворотками (pre) (оси y).

(С) IgG антитела кроликов, иммунизированных rBet v 1 и рекомбинантными гибридными белками (2PA-PreS, 2PB-PreS, 4PA-PreS, 2PAPB-PreS), направленными против шести Bet м 1-полученных пептидов (Р1'-Р6') (оси x) были измерены с помощью ELISA. Показаны средние значения оптической плотности (OD) из двух измерений (оси y).

Фиг. 12 показывает ингибирование анти-2xPA2xPB-PreS кроличьей сыворотки против IgE пациентов с аллергией по сравнению с кроличьей сывороткой против полного rBet v 1. Процент ингибирования IgE-связывания с rBet v 1 (оси x), полученный с помощью анти-2xPA2xPB-PreS и анти-rBet v 1 кроличьих сывороток, был определен способом ингибиторного ELISA и показан на коробчатых диаграммах, где 50% значений находятся внутри прямоугольников, а между столбиками (bars) имеются диапазоны без выброса. Линии внутри прямоугольников показывают срединные значения. Показаны результаты 21 пациента с аллергией на пыльцу березы.

Фиг. 13 показывает титрацию кроличьего IgG, увеличенного после иммунизации PreS-гибридными белками, содержащими 2 или 4 копии Phl p 6-полученного пептида. Для проверки иммуногенности кроликов (белые новозеландские кролики) иммунизировали с помощью различных гибридных белков с использованием гидроксида алюминия в качестве адьюванта. Индукцию специфических антител контролировали с помощью анализа ELISA. Результаты показывают, что гибридные белки, содержащие 4 пептида, являются более иммуногенными, чем гибридные белки, содержащие 2 пептида.

Фиг. 14 показывает индукцию сильного IgG ответа, направленного на аллергены пыльцы трав Phl p 1 (A), Phl p2 (В), Phl p 5 (С) и Phl p 6 (D) после подкожной иммунизации аллергиков с аллергией на пыльцу трав с использованием вакцинной композиции (ВМ32), содержащей смесь из 4 гипоаллергенных гибридных белков SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID NO. 17. Определение IgG проводили с помощью ELISA. Уровни IgG до лечения (pre) сравнивают с уровнями IgG после лечения (post).

Фиг. 15 показывает результаты анализа пролиферации Т-клеток, проведенного на Т-клетках от пациентов с аллергией на пыльцу трав, после иммунизации вакцинной композицией, состоящей из смеси 4 гипоаллергенных гибридных белков с SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID NO. 17. Т-клеточная реактивность является сильно уменьшенной или отсутствует при сравнении с пыльцой трав. На оси y представлен индекс стимулирования.

Фиг. 16 показывает, что IgG, индуцированный терапией вакцинной композицией (ВМ32), содержащей смесь из 4 гипоаллергенных гибридных белков SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16, и SEQ ID NO. 17, уменьшает лимфопролиферативные ответы на аллергены пыльцы трав в человеческих PBMCs. (а) постановка эксперимента, (b) результаты исследования Т-клеточной пролиферации, выполненного при отсутствии (+ сыворотка до) и присутствии (+ сыворотка после) индуцированного лечением IgG. Ось y графика отражает индекс стимулирования. Р1-Р5 показывают результаты, полученные от разных участников исследования.

Фиг. 17 показывает постановку клинического исследования, проведенного на 69 индивидуумах с аллергий на пыльцу трав с использованием вакцинной композиции ВМ32, содержащей смесь из 4 гипоаллергенных гибридных белков с SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID NO. 17.

Фиг. 18А показывает первичную последовательность гибридного белка HBV Der р2-2хР2-2хР4 (последовательность ID Nr. 149).

Фиг. 18В показывает первичную последовательность гибридного белка HBV Der р2-3хР2-3хР4 (последовательность ID Nr. 150).

Фиг. 18С показывает первичную последовательность гибридного белка HBV Der р23-2хР4-2хР5 (последовательность ID Nr. 151).

Фиг. 18D показывает первичную последовательность гибридного белка HBV Der р23-4хР6 (последовательность ID Nr. 152).

Фиг. 19А показывает изменение назальных симптомов, вызванное лечением тремя (3) подкожными инъекциями вакцинной композиции ВМ32, содержащей смесь из 4 гипоаллергенных гибридных белков с SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID NO. 17. Черные столбики: до лечения, серые столбики: после лечения.

Фиг. 19B показывает изменение средней площади волдыря (аллергической папулы) между титрованной скарификационной пробой до и после лечения вакцинной композицией ВМ32. Титрованную скарификационную пробу проводили, используя 8 серийных разведений экстракта пыльцы (от неразбавленной до 1:128).

Фиг. 20 показывает IgE связывание пептидов, полученных от Der p 2, по сравнению с полным аллергеном, исследованное с помощью IgE дот-блот-анализа. Сыворотку от 26 пациентов с аллергией к клещу домашней пыли инкубировали с нанесенными точечно KLH-конъюгированными пептидами и определяли связанный IgE с помощью 125I-меченого античеловеческого IgE. Не наблюдалось IgE-связывание для любого из 5 пептидов, как в примере 26.

Примеры

Пример 1. Создание экспрессионной плазмиды для HBV_Phlp1_4хР5 (BM321)

Синтетический ВМ321 ген был собран из синтетических олигонуклеотидов и/или ПЦР-продуктов и клонирован в соответствующий стандартный вектор (pMK-RQkanR). Плазмида была очищена из трансформированного штамма K 12 Е. coli (DH10B-T1R), а концентрация была определена с помощью УФ-спектроскопии. Окончательная синтетическая и кодон-оптимизированная ВМ321 ДНК-последовательность была дополнительно клонирована в вектор экспрессии pET28b(+) с использованием соответствующих сайтов рестрикции (NcoI сайт на 5'-конце и EcoRI на 3'-конце). Плазмидная ДНК была очищена из трансформированной Е. coli K12 DH10B (dam+ dcm+), концентрацию определяли с помощью УФ-спектроскопии. Окончательный конструкт был проверен секвенированием вставки. Краткое изложение данных плазмиды и карты плазмиды окончательного вектора экспрессии "рВМ-321" показано ниже.

Изложение ВМ321 последовательности, клонированной в окончательный вектор экспрессии рЕТ-28b(+).

Пример 2. Перенос экспрессируюшей плазмиды хозяину для экспрессии HBV_Phlp1_4хР5 (ВМ321)

Химически компетентные клетки Е. coli BL21(DE3) были трансформированы экспрессирующей плазмидой методом теплового шока. Трансформированные клетки высевали на чашечки с LB агаром, содержащие 0,5% хлорида натрия 1% пептона сои, 0,5% дрожжевого экстракта, 1,5% агар и 50 мкг/мл канамицина для селекции. Клетки на LB-агаре выращивали культивированием в течение ночи при 37°С. Отдельные колонии трансформированных клеток BL21(DE3) Е. coli изолировали, культивировали в LB-среде и отбирали для роста и экспрессии ВМ321. Самый лучший клон был отобран для дальнейшей закладки в главный клеточный банк.

Пример 3. Подготовка главного клеточного банка для HBV_Phlp1_4хР5 (ВМ321)

Аликвоту выбранного клона использовали для посева в 150 мл культуральной среды (состав: 0,5% хлорида натрия, 1% пептона сои, 0,5% дрожжевого экстракта, 50 мкг/мл канамицина). Культуру главного клеточного банка (МСВ) инкубировали при 37°С при постоянном помешивании при 200 об/мин до достижения оптической плотности культуры OD600=1-2. Добавили глицерин, чтобы получить окончательную концентрацию глицерина 15% об/об, и МСВ разделили на аликвоты во флаконы 1 мл и хранили в морозильном устройстве для глубокого замораживания при -75±10°С.

Пример 4. Периодическая ферментаиия с добавлением субстрата с высокой плотностью клеток HBV_PhlP1_4хР5 (ВМ321)

В синтетическую культуральную среду (100 мл, рН=6,8; соли и элементы в следовых количествах, 10 г/л глюкозы в качестве источника углерода) инокулировали 1 мл культуры из главного клеточного банка (Е. coli BL21(DE3)/pBM321) и культивировали во встряхиваемой колбе (37°С, 200 об/мин) до достижения целевого значения оптической плотности OD=1. Для проведения периодической ферментации с добавлением субстрата использовали ферментер (22 л) из нержавеющей ткани. Дозатор был запрограммирован для автоматической и повторяемой регулируемой подачи питания, что позволяло заранее устанавливать определенную скорость роста, скорость подачи, продолжительность фазы загрузки и продолжительность экспоненциальной фазы подачи. Для увеличения скорости переноса кислорода ферментера контролировали избыточное давление, установленное 1 бар. Ферментер стерилизовали in situ вместе с синтетической культуральной средой, упомянутой выше, при этом ферментация начиналась инокуляцией прекультуры. После истощения глюкозы начинали экспоненциальную фазу подачи, чтобы сохранить определенную скорость роста μ=0,25 час-1. При OD=45 экспрессию рекомбинантного ВМ321 индуцировали болюсным добавлением IPTG (окончательная концентрация 0,8 мМ). Культуру собирали при OD600=73. Титр продукта ВМ321, полученного с помощью периодической ферментации с добавлением субстрата, составлял 1,2 г на л культуральной жидкости. Затем, бактериальную культуральную жидкость охладили до ≤20°С и центрифугировали при 7000 об/мин (5,500 г) при 4°С в течение 15 мин. Влажную клеточную биомассу делили на аликвоты и хранили при -75°С.

Пример 5. Разрушение и очищение клеток

Для разрушения клеток размораживали 748 грамм биомассы из примера 6, делили на аликвоты по 125 грамм и ресуспендировали в буфере для гомогенизации (20 мМ Трис, 1 мМ EDTA, 0,1% Тритон Х-100, рН 11,0) при механическом перемешивании при комнатной температуре в течение 30 мин. Для разрушения клеток использовали процедуру замораживания/оттаивания путем замораживания до -75°С и последующего оттаивания, с последующей механической гомогенизацией. Значение рН гомогената отрегулировали до рН=10,0. Сырой клеточный гомогенат центрифугировали при 7000 об/мин (5,500 г) при 4°С в течение 30 мин. Супернатанты были подвергнуты преципитации с PEI (полиэтиленимин) при механическом перемешивании. Нерастворенное вещество отделили с помощью последующей стадии центрифугирования. Далее очищенные супернатанты были подвергнуты хроматографии.

Пример 6. Очистка хроматографией HBV_Phlp1_4хР5 СВМ321)

Всего 1840 мл супернатанта, подвергнутого PEI-преципитации, из стадии очистки, как описано в примере 7, наносили на колонку Q-Sepharose FF 5×30 см и уравновешивали буфером А (Трис-HCl, EDTA). Несвязанный материал был удален промывкой буфером А, а затем промывкой буфером С (1 фосфат натрия, EDTA, рН 7,0). Элюирование фракции, содержащей продукт, проводили с использованием элюирования в линейном градиенте с 0-100% ВМ32 буфером Ε (фосфат натрия, EDTA, NaCl рН 7,0) в ВМ32 буфере С. Отбор продукт-содержащих фракций для объединения проводили согласно SDS-PAGE анализу путем денситометрической оценки чистоты фракции и по интенсивности полосы продукта. Смешанные фракции, полученные на стадии «захвата», регулировали до значения проводимости 115 мсек/см добавлением 2,5 M хлорида натрия, и этот сырьевой материал наносили на колонку Phenyl Sepharose HP, уравновешенную буфером D (фосфат натрия, EDTA, NaCl рН 7,0). Несвязанный материал был удален промывкой буфером D. Элюирование фракции, содержащей продукт, проводили градиентным элюированием 40-100% буфера С (фосфат натрия, EDTA, рН 7,0) в буфере D. Отбор продукт-содержащих фракций для объединения проводили с помощью SDS-PAGE электрофореза, путем денситометрической оценки чистоты фракции и по интенсивности полосы продукта. Смешанные фракции, полученные на промежуточной стадии, доводили до значения проводимости 80 мсек/см путем добавления 2,5 M хлорида натрия, и этот сырьевой материал загружали на колонку Toyopearl Butyl 650-S, уравновешенную буфером F (фосфат натрия, EDTA, NaCl рН 7,0). Несвязанный материал был удален градиентной промывкой 80-0% ВМ32 буфером F в буфере С (фосфат натрия, EDTA, рН 7,0). Элюцию данной фракции осуществляли с помощью градиентного элюирования из 0-1 буфера G (фосфат натрия, EDTA, изопропанол, рН 7,0) в буфер С. Отбор продукт-содержащих фракций для объединения проводили с помощью SDS-PAGE электрофореза, путем денситометрической оценки чистоты фракции и по интенсивности полосы продукта.

Пример 7. Выработка HBV_Phlp2_4хР3 (ВМ322). HBV_Phlp5_V2 (ВМ325). и HBV_Phlp6_4хР1 (ВМ326):

Для экспрессии и выработки рекомбинантных молекул согласно изобретению, а именно HBV_Phlp2_4xP3 (ВМ322), HBV_Phlp5_V2 (ВМ325) и HBV_Phlp6_4xP1 (ВМ326), в примере 2, примере 3, примере 4, примере 5 и примере 6 были использованы те же самые, подобные или сравнимые методы и процедуры, как описано в примере 1.

Пример 8. Получение инъекционной композиции, содержащей смесь HBV_PhlP1_4хР5 (ВМ321): HBV_PhlP2_4хР3 (ВМ322). HBV_PhlP5_V2 (BM325). и HBV_PhlP6_4хР1 (ВМ326)

Каждый из рекомбинантных очищенных белков был растворен в изотоническом буфере, содержащем 0,9% хлорид натрия и 2 мМ фосфат натрия, и к каждому раствору белка было добавлено соответствующее количество гидроксида алюминия. Была приготовлена смесь, содержащая равные части четырех полученных суспензий, и поделена на аликвоты в стерильных условиях в запаянные флаконы. Инъекционная композиция, полученная с помощью этого метода, содержала 0,4 мг/мл каждого HBV_PhlP1_4xP5; HBV_PhlP2_4xP3, HBV_PhlP5_V2 и HBV_PhlP6_4xP1.

Пример 9. Получение his-меченого HBV_Betv1_4хРА

Ген, кодирующий гибридные белки, состоящие из PreS, соединенного с Bet v 1-полученным пептидом РА дважды на Ν- и С-конце (т.е. 4PA-PreS), был синтезирован с помощью ATG:biosynthetics, Merzhausen, Германия и вставлен в NdeI/XhoI сайты вектора pET-17b (Novagen, Германия). Последовательности ДНК были подтверждены с помощью автоматического секвенирования обеих цепей ДНК (Microsynth, Balgach, Швейцария).

Гибридный белок экспрессировали в штамме Ε coli BL21 (DE3; Stratagene, Ла Хойя, Калифорния). Клетки выращивали в среде Luria Bertani, содержащей 50 мкг/мл канамицина, до OD 0,6. Экспрессию белка индуцировали добавлением изопропил-β-D-тиогалактопиранозида до окончательной концентрации 1 ммоль/л в течение ночи при 37°С. Клетки собирали центрифугированием при 3500 об/мин в течение 10 минут. Белковый продукт главным образом был обнаружен во фракции телец включения. Он был солюбилизирован в 6М GuHCl, 100 мМ NaH2PO4, 10 мМ TRIS, рН 8,0 в течение ночи. Гомогенат центрифугировали при 14000 g в течение 18 минут. Супернатанты инкубировали с 2 мл предварительно уравновешенной Ni-NTA смолы в течение 4 часов (Qiagen, Hilden, Германия), а потом суспензии наносили на колонку, промывали 2 объемами буфера для промывки (8 моль/л мочевины, 100 ммоль/л NaH2PO4 и 10 ммоль/л Трис-HCl [рН=6,1]) и элюировали тем же самым буфером (рН=3,5). Очищенный белок диализовали против воды.

Чистоту рекомбинантных белков исследовали с помощью кумасси-окрашенного SDS-PAGE (12,5%) при восстановительных условиях.

Идентичность гибридного белка была подтверждена с помощью дот-блот-анализа с использованием моноклональных антител, специфических для Bet v 1-полученных пептидов Р2' (mAb2) и Р4' (mAb12), и PreS-специфических кроличьих антител, а также соответствующих кроличьих неиммунных IgGs. Один мкг PreS гибридных белков, PreS и HSA (контроль) иммобилизовали на нитроцеллюлозе и инкубировали с моноклональной, а также кроличьей сывороткой, разведенной 1:1000 при 4°С. Связанные антитела обнаруживали с помощью йод125-меченого кроличьего антимышиного IgG (mAb2, mAb12) или 125I-козьего антикроличьего IgG (кроличьи анти-PreS, кроличья преиммунная) (Perkin-Elmer, Waltham, Массачусетс), разведенного 1:500 в течение 2 часов, и визуализировали с помощью авторадиографии. Кроме того, ELISA планшеты (Maxisorp, Nunc, Дания) сенсибилизировали 2 мкг PreS гибридного белка и PreS, разведенным в 0,1 моль/л карбонатного буфера, рН 9,6, промывали PBS, содержащим 0,05% об/об Твин 20 (PBST) 3 раза и блокировали в течение 2 часов 1% BSA-PBST. Затем планшеты инкубировали с mAb2, mAb12, анти-PreS кроличьей сывороткой и кроличьими анти-Bet v 1 антителами при разведении 1:5000 (буфер для разведения: 0,5% вес/об BSA в PBST) в течение ночи при 4°С. После промывки 5 раз, связанные IgG антитела обнаруживали с помощью HRP-меченых овечьих антимышиных антител (для mAb2, mAb12) или HRP-меченых ослиных антикроличьих антител (кроличьи сыворотки) (и то и другое от GE Healthcare, Uppsala, Швеция) и проводили цветную реакцию.

Пример 10. Получение his-меченого HBV_Betv1_2хРА2хРВ (ВМ31)

Ген, кодирующий гибридный белок, состоящий из PreS, соединенного дважды с Bet v 1-полученными пептидами на N- и С-концах 2xPA2xPB-PreS), был синтезирован с помощью GenScript Piscataway, Нью-Джерси, США, 2PAPB-Pres) и вставлен в NdeI/XhoI сайты вектора pET-17b (Novagen, Германия). Последовательности ДНК были подтверждены с помощью автоматического секвенирования обеих цепей ДНК (Microsynth, Balgach, Швейцария).

Рекомбинантные PreS гибридные белки экспрессировали в штамме Ε coli BL21 (DE3; Stratagene, Калифорния). Клетки выращивали в среде Luria Bertani, содержащей 50 мкг/мл канамицина, до OD 0,6. Экспрессию белка индуцировали добавлением изопропил-β-D-тиогалактопиранозида до окончательной концентрации 1 ммоль/л в течение ночи при 37°С. Клетки собирали центрифугированием при 3500 об/мин в течение 10 минут. Белки главным образом были обнаружены во фракции телец включения. Полученный белок был солюбилизирован в 6М GuHCl, 100 мМ NaH2PO4, 10 мМ TRIS, рН 8,0 в течение ночи. Гомогенат центрифугировали при 14000 g в течение 18 минут. Супернатанты инкубировали с 2 мл предварительно уравновешенной Ni-NTA смолы в течение 4 часов (Qiagen, Hilden, Германия), а потом суспензии наносили на колонку, промывали 2 объемами буфера для промывки (8 моль/л мочевины, 100 ммоль/л NaH2PO4 и 10 ммоль/л Трис-HCl [рН=6,1]) и элюировали тем же самым буфером (рН=3,5). Очищенный белок диализировали против воды.

Чистоту рекомбинантных белков исследовали с помощью кумасси-окрашенного SDS-PAGE (12,5%) при восстановительных условиях.

Идентичность гибридного белка была подтверждена с помощью дот-блот-анализа с использованием моноклональных антител, специфических для Bet v 1-полученных пептидов Р2' (mAb2) и Р4' (mAb12), и PreS-специфических кроличьих антител, а также соответствующих кроличьих неиммунных IgGs. Один мкг PreS гибридных белков, PreS и HSA (контроль) иммобилизовали на нитроцеллюлозе и инкубировали с моноклональной, а также кроличьей сывороткой, разведенной 1:1000 при 4°С. Связанные антитела обнаруживали с помощью йод125-меченого кроличьего антимышиного IgG (mAb2, mAb12) или 125I-козьего антикроличьего IgG (кроличьи анти-PreS, кроличья преиммунная) (Perkin-Elmer, Waltham, Массачусетс), разведенного 1:500 в течение 2 часов, и визуализировали с помощью авторадиографии. Кроме того, ELISA планшеты (Maxisorp, Nunc, Дания) сенсибилизировали 2 мкг PreS гибридного белка и PreS, разведенным в 0,1 моль/л карбонатного буфера, рН 9,6, промывали PBS, содержащим 0,05% об/об Твин 20 (PBST) 3 раза и блокировали в течение 2 часов 1% BSA-PBST. Затем планшеты инкубировали с mAb2, mAb12, анти-PreS кроличьей сывороткой и кроличьими анти-Bet v 1 антителами при разведении 1:5000 (буфер для разведения: 0,5% вес/об BSA в PBST) в течение ночи при 4°С. После промывки 5 раз, связанные IgG антитела обнаруживали с помощью HRP-меченых овечьих антимышиных антител (для mAb2, mAb12) или HRP-меченых ослиных антикроличьих антител (кроличьи сыворотки) (и то и другое от GE Healthcare, Uppsala, Швеция) и проводили цветную реакцию.

Пример 11. Определение IgE-реактивности гибридного белка HBV_Phlp1_4хР5 (ВМ321)

Было проверено IgE-связывание по сравнению с полным аллергеном с помощью IgE дот-блот-анализа. Сыворотку от пациентов с аллергией на пыльцу трав инкубировали с точечно нанесенными белками, при этом связанный IgE обнаруживали с помощью 125I-меченого античеловеческого IgE. Не было обнаружено IgE-связывания в отношении HBV_Phlp1_4xP5 (ВМ321), как показано на фиг. 4А.

Пример 12. Определение IgE-реактивности гибридного белка HBV_Phlp2_4хР3 (ВМ322)

Было проверено IgE-связывание по сравнению с полным аллергеном с помощью IgE дот-блот-анализа. Сыворотку от пациентов с аллергией на пыльцу трав инкубировали с точечно нанесенными белками, при этом связанный IgE обнаруживали с помощью 125I-меченого античеловеческого IgE. Не было обнаружено IgE-связывания в отношении HBV_Phlp2_4xP3 (ВМ321), как показано на фиг. 4В.

Пример 13. Определение IgE-реактивности гибридного белка HBV_Phlp5_V2 (ВМ325)

Было проверено IgE-связывание по сравнению с полным аллергеном с помощью IgE дот-блот-анализа. Сыворотку от пациентов с аллергией на пыльцу трав инкубировали с точечно нанесенными белками, при этом связанный IgE обнаруживали с помощью 125I-меченого античеловеческого IgE. Не было обнаружено IgE-связывания в отношении HBV_Phlp5_V2 (ВМ325), как показано на фиг. 4С.

Пример 14. Определение IgE-реактивности гибридного белка HBV_Phlp6_4хР1 (ВМ326)

Было проверено IgE-связывание по сравнению с полным аллергеном с помощью IgE дот-блот-анализа. Сыворотку от пациентов с аллергией на пыльцу трав инкубировали с точечно нанесенными белками, при этом связанный IgE обнаруживали с помощью 125I-меченого античеловеческого IgE. Не было обнаружено IgE-связывания в отношении HBV_Phlp1_4xP1 (ВМ326), как показано на фиг. 4D.

Пример 15. Определение IgE-реактивности гибридного белка HBV_etV1_4хРА и HBV_Betv1_2хРА2хРВ (ВМ31)

Было проверено IgE-связывание по сравнению с полным аллергеном с помощью IgE дот-блот-анализа. Сыворотку от пациентов с аллергией на пыльцу трав инкубировали с точечно нанесенными белками, при этом связанный IgE обнаруживали с помощью 125I-меченого античеловеческого IgE. Не было обнаружено IgE-связывания в отношении обоих гибридных белков, как показано на фиг. 5

Пример 16. Кроличьи анти-r89P5 антитела препятствуют связыванию IgE пациента с rPhl p 1

Для определения способности индуцированного пептидом кроличьего Ig ингибировать связывание IgE-антител пациента с аллергией с rPhl p 1, ELISΑ-планшеты сенсибилизировали 1 мкг/мл rPhl p 1, промывали и блокировали. Эти планшеты предварительно инкубировали с разведенным 1:100 кроличьим антипептидом (HBV_Phlp1_4хР5, KLHP5), кроличьим анти-rPhl p 1 и, в качестве контроля, с соответствующими преиммунными сыворотками. После промывки планшеты инкубировали с сыворотками от пациентов с аллергией на Phl p 1 (разведение 1:3), связанный IgE обнаруживали с помощью мышиного античеловеческого IgE (Pharmingen 1:1000) и затем с помощью РОХ-связанного овечьего антимышиного IgG (Amersham Bioscience) 1:2000. Процент ингибирования IgE-связывания, полученного путем предварительной инкубации с антипептидными антисыворотками, вычисляли следующим образом: 100-ODi/ODP × 100.

ODi и ODP представляют собой оптическую плотность после предварительной инкубации с кроличьей иммунной и преиммунной сыворотками, соответственно. Таблица 1 показывает способность анти-Phl p 1 пептид-антител ингибировать связывание IgE от 13 пациентов с аллергией с полным rPhl p 1. Антисыворотки с гибридным белком блокировали IgE-связывание в той же самой степени, как сыворотки против rPhl р 1 и KLHP5. Таблица 1 показывает ингибирование (%) всех 13 пациентов.

Пример 17. Кроличьи анти-HBV_Phlp2_4хР3 антитела препятствуют связыванию IgE патента с rPhl р 2

Для определения способности индуцированного пептидом кроличьего Ig ингибировать связывание IgE-антител пациента с аллергией с rPhl р 2, ELISA-планшеты сенсибилизировали 1 мкг/мл rPhl p 1, промывали и блокировали. Эти планшеты предварительно инкубировали с разведенным 1:100 кроличьим антипептидом (HBV_Phlp2_4хР3, KLHP3), кроличьим анти-rPhl p 2 и, в качестве контроля, с соответствующими преиммунными сыворотками. После промывки планшеты инкубировали с сыворотками от пациентов с аллергией на Phl p 2 (разведение 1:3), связанный IgE обнаруживали с помощью мышиного античеловеческого IgE (Pharmingen 1:1000) и затем с помощью РОХ-связанного овечьего антимышиного IgG (Amersham Bioscience) 1:2000. Процент ингибирования IgE-связывания, полученного путем предварительной инкубации с антипептидными антисыворотками, вычисляли следующим образом: 100-ODi/ODP × 100.

ODi и ODP представляют собой оптическую плотность после предварительной инкубации с кроличьей иммунной и преиммунной сыворотками, соответственно. Таблица 2 показывает способность анти-Phl p 2 пептид-антител ингибировать связывание IgE (от 19 пациентов с аллергией) с полным rPhl p 2. Антисыворотки с гибридным белком блокировали IgE-связывание в той же самой степени, как сыворотки против rPhl p 2 и KLHP3. Таблица 2 показывает ингибирование (%) всех 19 пациентов.

Пример 18. Кроличьи анти-HBV_Phlp5_V2 антитела препятствуют связыванию IgE патента с rPhl p 5

Для определения способности индуцированного пептидом кроличьего Ig ингибировать связывание IgE-антител пациента с аллергией с rPhl p 5, ELISA-планшеты сенсибилизировали 1 мкг/мл rPhl p 5, промывали и блокировали. Эти планшеты предварительно инкубировали с разведенным 1:100 кроличьим антипептидом (HBV_Phlp2_V2), кроличьим анти-rPhl p 5 и, в качестве контроля, с соответствующими преиммунными сыворотками. После промывки планшеты инкубировали с сыворотками от пациентов с аллергией на Phl p 5 (разведение 1:3), связаный IgE обнаруживали с помощью мышиного античеловеческого IgE (Pharmingen 1:1000) и затем с помощью РОХ-связанного овечьего антимышиного IgG (Amersham Bioscience) 1:2000. Процент ингибирования IgE-связывания, полученного путем предварительной инкубации с антипептидными антисыворотками, вычисляли следующим образом: 100-ODi/ODP × 100.

ODi и ODP представляют собой оптическую плотность после предварительной инкубации с кроличьей иммунной и преиммунной сыворотками, соответственно. Таблица 3 показывает способность анти-Phl p 5 пептид-антител ингибировать связывание IgE от 16 пациентов с аллергией с полным rPhl p 5. Антисыворотки с гибридным белком блокировали IgE-связывание в той же самой степени, как сыворотки против rPhl p 5, и лучше, чем KLH пептидная смесь. Таблица 3 показывает ингибирование (%) всех 16 пациентов.

Пример 19. Кроличьи анти-HBV_Phlp6_4хР1 антитела препятствуют связыванию IgE пациента с rPhl p 6

Для определения способности индуцированного пептидом кроличьего Ig ингибировать связывание IgE-антител пациента с аллергией с rPhl p 6, ELISA-планшеты сенсибилизировали 1 мкг/мл ePhl p 6, промывали и блокировали. Эти планшеты предварительно инкубировали с разведенным 1:100 кроличьим антипептидом (HBV_Phlp6_4хР1, KLHP1), кроличьим анти-rPhl p 6 и, в качестве контроля, с соответствующими преиммунными сыворотками. После промывки планшеты инкубировали с сыворотками от пациентов с аллергией на Phl p 6 (разведение 1:3), связанный IgE обнаруживали с помощью мышиного античеловеческого IgE (Pharmingen 1:1000) и затем с помощью РОХ-связанного овечьего антимышиного IgG (Amersham Bioscience) 1:2000. Процент ингибирования IgE-связывания, полученного путем предварительной инкубации с антипептидными антисыворотками, вычисляли следующим образом: 100-ODi/ODP × 100.

ODi и PDP представляют собой оптическую плотность после предварительной инкубации с кроличьей иммунной и преиммунной сыворотками, соответственно. Таблица 4 показывает способность анти-Phl p 6 пептид-антител ингибировать связывание IgE от 21 пациента с аллергией с полным rPhl p 6. Антисыворотки с гибридным белком блокировали IgE-связывание в той же самой степени, как сыворотки против rPhl p 6 и KLHP1. Таблица 4 показывает ингибирование (%) у 21 пациента.

Пример 20. IgE-реактивностъ PreS гибридных белков, определенная с помощью дот-блот-анализа и ELISA

Была проверена IgE-реактивность очищенного rBet v 1, рекомбинантных гибридных белков 4хРА-PreS, 2хРА2хРВ-PreS с помощью неденатурирующего дот-блот-анализа на основе RAST. Два мкг очищенных белков и, в качестве контроля, HSA были нанесены каплями на полоски из нитроцеллюлозы (Schleicher & Schuell, Dassel, Германия).

Полоски нитроцеллюлозы блокировали в буфере А (Vrtala, J Clin Invest, 1997) и инкубировали с сыворотками пациентов с аллергией на пыльцу беорезы (n=50), с сыворотками индивидуумов без аллергии (n=3) разбавленными 1:10, буферным контролем и положительным контролем (разведенная 1:1000 кроличья анти-rBet v 1 антисыворотка). Связанные IgE антитела обнаруживали с помощью 125I-меченых античеловеческих IgE антител (BSM Diagnostica, Vienna, Austria), связанные кроличьи антитела - с помощью 125I-меченой козьей антикроличьей антисыворотки (Perkin-Elmer) и визуализировали с помощью авторадиографии (Valenta et al., 1992). В дополнение к этому, планшеты ELISA сенсибилизировали rBet v 1 и очищенными PreS гибридными белками (5 мкг/мл). После промывки и блокирования, как описано выше, планшеты инкубировали с сыворотками пациентов с аллергией на пыльцу березы (n=21) и тремя неаллергическими контрольными сыворотками, разведенными 1:5. Связанный IgE обнаруживали с помощью очищенного мышиного античеловеческого IgE (BD Pharmingen), разведенного 1:1000 в течение ночи, и визуализировали с помощью HRP-меченого овечьего антимышиного IgG (GE Healthcare), разведенного 1:2000. После промывки проводили цветную реакцию, как описано выше.

Пример 21. Вызванная аллергеном повышенная регуляция CD203c в базофилах пациентов с аллергией

Гепаринизированные образцы крови были получены от пациентов с аллергией на пыльцу березы (после получения информированного согласия), образцы инкубировали с возрастающими концентрациями rBet v 1, 4PA-PreS, 2PAPB-PreS в пределах от 0,001 до 1 мг/мл, моноклональным анти-IgE антителом (Immunotech, Marseille, France) в качестве положительного контроля или PBS (отрицательный контроль) в течение 15 минут (37°С). Экспрессию CD 203с определяли, как описано выше.

Пример 22. Лимфопролиферативные ответы и индукция цитокинов в РВМС от пациентов с аллергией на пыльцу березы

РВМС от пациентов с аллергией на пыльцу березы (n=6) выделяли центрифугированием в градиенте плотности фиколла (Amersham Biosciences, Uppsala, Швеция). Затем РВМС ресуспендировали в среде AIM V (Life Technologies, Grand Island, Нью-Йорк) до окончательной концентрации 2×105 клеток/лунку и стимулировали уменьшенными дозами антигенов (эквимолярные количества 5 мкг/лунку rBet v 1, РА, PB, PreS, 2PA-PreS, 2PB-PreS, 4PA-PreS, 2PAPB-PreS), только средой (отрицательный контроль) или IL-2 (4 IE/лунку) (положительный контроль). Через 6 дней пролиферативные ответы измеряли с помощью включения [3Н] тимидина и выражали в виде индексов стимулирования (SI).

Кроме того, выработка 17 различных цитокинов (т.е. IL-1β, IL-2, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-12, IL-13, IL-17, IFN-γ, TNF-α, G-CSF, GM-CSF, MIP-1β, MCP-1) была измерена через 6 дней после стимулирования Bio-plex Pro Human Cytokine 17-Plex Panel (Bio-Rad Laboratories) согласно инструкциям производителя. Коротко, неразбавленные супернатанты были смешаны с антицитокин/хемокин мышиными моноклональными антителами, соединенными с различными гранулами, в качестве захватывающих антител (Bio-Rad). Стандартную кривую из 8 точек использовали для достижения нижнего предела чувствительности. После промывки, были добавлены антицитокин биотинилированные детекторные антитела. Реакция была визуализирована добавлением стрептавидин-меченого фикоэритрина (РЕ) и буфера для анализа (assay buffer). Образцы анализировали на приборе Luminex 100 (Biosource, Nivelles, Бельгия), данные были получены с помощью программного обеспечения Bio-Plex Manager 6.0. Все образцы анализировали в течение одного «пробега». Результаты показаны на фиг. 10.

Пример 23. Исследование кроличьей сыворотки, иммунизированной rBet v 1 и PreS гибридными белками, в отношении распознавания rBet v 1. Bet v 1 гомологичных аллергенов и Bet v 1-происходящих пептидов с помощью ELISA

Планшеты ELISA (Maxisorp, Nunc) сенсибилизировали или 1 мкг/мл rBet v 1 или гомологичными аллергенами ольхи (rAln g 1), ореха (лещины) (rCor а 1), яблони (rMal d1) и дополнительно несколькими пептидами, полученными из Bet v 1, в концентрации 1 мкг/мл в течение ночи при 4°С. После промывки и блокирования, как описано выше, сыворотки кроликов иммунизировали rBet v 1 и PreS гибридными белками, конъюгированными с квасцами (alum) или CFA, инкубировали в серийных разведениях 1:2 в пределах от 1:500 до 1:1280000 и в концентрации 1:1000. Связанный кроличий IgG обнаруживали с помощью HRP-меченых ослиных антикроличьих антител (GE Healthcare) и проводили цветную реакцию, как описано выше.

Пример 24. Ингибирование у пациентов с аллергией IgE-связывания с rBet v 1

Для изучения ингибирования связывания IgE пациентов с аллергией на пыльцу березы с rBet v 1 использовали ингибиторный ELISA анализ. ELISA планшеты сенсибилизировали rBet v 1 в концентрации 1 мкг/мл при 4°С на ночь. После промывки и блокирования планшеты предварительно инкубировали с кроличьими сыворотками, направленными против PreS гибридного белка 2PAPB-PreS и анти-Bet v 1 кроличьей сывороткой при разведении 1:80 и 1:160 в сравнении с кроличьей преиммунной сывороткой в течение ночи при 4°С. После дополнительной промывки добавили сыворотки от пациентов с аллергией на пыльцу березы, разбавленные 1:5, на ночь при 4°С, и связанный IgE человека обнаруживали с помощью разведенных 1:1000, конъюгированных со щелочной фосфатазой, мышиных моноклональных античеловеческих IgE антител (BD Pharmingen). Процент ингибирования IgE-связывания с rBet v 1 после предварительной инкубации с 2PAPB-PreS кроличьей антисывороткой и Bet v 1 кроличьей антисывороткой вычисляли, как указано далее: процент ингибирования = 100 - (ODi × 100/ODp). ODp и ODi представляют оптическую плотность после предварительного инкубирования со специфическим кроличьим IgG (ODi) или неиммунными сыворотками (ODp), соответственно (фиг. 12).

Пример 25. Применение вакцинной композиции, содержащей смесь из 4 гипоаллергенных гибридных белков, для лечения индивидуумов с аллергией на пыльцу трав

Инъекционная композиция гипоаллергенных гибридных белков SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID No. 17 с гидроксидом алюминия была приготовлена, как описано в примере 8. В ходе клинического исследования вакцину вводили подкожно (s.c.) 3 раза 69 людям с аллергией на пыльцу трав (фиг. 17).

Вакцинация вакцинной композицией приводила к сильному IgG иммунному ответу. Индукция аллерген-специфического IgG после подкожных инъекций 3 разных доз вакцины и плацебо была определена с помощью ELISA в сыворотке участников исследования до и после лечения тремя (3) подкожными инъекциями вакцинной композиции (фиг. 14).

С этой целью планшеты ELISA (Nunc Maxisorp, Roskilde, Дания) сенсибилизировали 5 мкг/мл антигенами Phl p 1, Phl p 2, Phl p 5 и Phl p 6 или человеческим сывороточным альбумином (HSA) в качестве контроля на ночь при 4°С. После промывки PBS, содержащим 0,5% Твин 20 (РТ) и блокирования с помощью 2% вес/об BSA в РТ, планшеты инкубировали с разведенными сыворотками (от 1:10 до 1:100) пациентов, сывороткой от индивидумов без аллергии или одним буфером в трех повторностях в течение ночи при 4°С. Связанные IgE антитела обнаруживали с помощью HRP-сцепленных античеловеческих IgE антител, разведенных в РТ, 0,5% вес/об BSA. Цветное проявление осуществляли путем добавления раствора ABTS (2,2'-азино-бис(3-этилбензтиазолин-6-сульфоновой кислоты) диаммониевой соли; Sigma-Aldrich, St.Louis, Missouri, США) (100 мкл/лунку). Оптическую плотность измеряли с помощью ELISA-ридера при 405 нм. Результаты оценки IgG показаны на фигуре 14.

Данная вакцина не вызывала какой-либо значимой Т-клеточной реактивности к гипоаллергенным гибридным белкам, присутствующим в вакцинной композиции, как определено с помощью in vitro анализа Т-клеточной пролиферации (фиг. 15), таким образом демонстрируя отсутствие Т-клеточной реактивности гипоаллергенных гибридных белков.

Анализ Т-клеточной пролиферации проводили, используя следующую методику: Мононуклеарные клетки периферической крови (РВМС) были выделены из гепаринизированных образцов крови пациентов с аллергией на пыльцу трав центрифугированием в градиенте плотности фиколла (Amersham Pharmacia Biotech, Little Chalfont, Великобритания). Затем РВМС (2×105), затем их культивировали в трех повторах в 96-луночных планшетах (Nunclone; Nalge Nunc International, Roskilde, Дания) в 200 мкл бессывороточной среды Ultra Culture medium (BioWhittaker, Rockland, ME) с добавлением 2 мМ L-глутамина (SIGMA, St. Louis, Миссури), 50 мкМ b-меркаптоэтанола (SIGMA) и 0,1 мг гентамицина на мл (SIGMA) при 37°С и 5% СО2 во влажной атмосфере. Клетки стимулировали смесью, содержащей 0,25 мкг каждого полипептидного компонента вакцины, и для сравнения эквимолярными концентрациями экстракта пыльцы трав или, с целью контроля, 4 U интерлейкином-2 на лунку (Boehringer Mannheim, Германия) или только средой. Через 6 дней культивирования добавили 0,5 μCi (микрокюри) на лунку [3Н]тимидина (Amersham Pharmacia Biotech) и через 16 часов после этого измеряли включенную радиоактивность с помощью метода жидкостно-сцинтилляционного счета, используя сцинтилляционный счетчик бета-частиц (Wallac ADL, Freiburg, Германия). Средние значения числа импульсов в минуту (cpm) вычисляли из трех повторов, а индексы стимулирования (SI) вычислили как соотношение cpm, полученного при стимулировании антигеном или интерлейкином-2, и нестимулированного контроля. Результаты исследований пролиферации представлены на фиг. 15.

Лечение вакциной индуцировало IgG антитела со способностью модулировать аллерген-специфический Т-клеточный ответ, что показано посредством уменьшенного пролиферативного ответа после стимулирования аллергеном пыльцы трав в присутствии индуцированного лечением IgG (фиг. 16).

С этой целью был проведен анализ Т-клеточной пролиферации с использованием РВМС, полученных от участников исследования после лечения, как описано выше, за исключением того, что стимулирование осуществляли смесью 4 аллергенов пыльцы трав Phl p 1, Phl p 2, Phl p 5 и Phl p 6 (0,25 мкг на аллерген) наряду с сывороткой, собранной от тех же самых участников до и после лечения. Постановка эксперимента и результаты показаны на фигуре 16.

У пациентов, получивших 3 инъекции, содержащие 20 мкг или 40 мкг каждого из 4 полипептидов, наблюдалось уменьшение назальных симптомов аллергии, вызванной провокацией в пыльцесодержащей камере, и уменьшение реактивности кожи, что было определено с помощью титрованной скарификационной пробы, тогда как после лечения дозами 10 мкг каждого полипептида не наблюдалось уменьшения этих показателей (см. фиг. 19).

Пример 26. Отбор пептидов, полученных из аллергена клеща домашней пыли Der p 2, и создание PreS гибридных белков с использованием этих пептидов

Был проведен скрининг 5 несвязывающих IgE пептидов, полученных из Der p 2, -Der р2 Pep1 (SEQ ID No.96), Der p2 Pep2 (SEQ ID No.97), Der p2 Рер3 (SEQ ID No. 98), Der p2 Pep4 (SEQ ID No. 99) и Der p2 Pep5 (SEQ ID No. 100) в отношении:

- их IgE связывающих свойств (дот-блот-анализ)

- их способности индуцировать Der p 2 специфические Т-клеточные реакции, и (анализ Т-клеточной пролиферации)

- их способности индуцировать Der p 2-специфические антитела, обладающие способностью препятствовать соединению IgE пациента с Der p 2. (ингибиторный ELISA с использованием кроличьего антипептида IgG)

Для этой цели каждый из данных пептидов был химически соединен с KLH. В этом отсеивающем эксперименте использовали KLH и химическое соединение пептидов, поскольку это общепринятая и простая в использовании модельная система, допускающая предварительное сравнение различных пептидов.

IgE-связывание пептидов, полученных из Der p 2, в сравнении с полным аллергеном проверяли с помощью IgE дот-блот-анализа. Сыворотку от 26 пациентов с аллергией к клещу домашней пыли инкубировали с точечно нанесенными KLH-конъюгированными пептидами, при этом связанный IgE определяли с помощью 125I-меченого античеловеческого IgE. Ни для одного из 5 пептидов не было обнаружено IgE-связывание, как показано ниже.

Чтобы установить пептиды, индуцирующие низкий лимфопролиферативный ответ в РВМС, полученных от пациентов с аллергией к клещу домашней пыли, РВМС, выделенные от 10 пациентов, стимулировали 5 пептидами, полученными из Der p 2, в отдельности, KLH-конъюгированными пептидами и Der p 2 дикого типа для сравнения.

РВМС от всех 10 пациентов стимулировали Der p 2 дикого типа, и не наблюдалась или наблюдалась только очень низкая пролиферация после стимулирования Der р2 Pep1, Der р2 Рер2, и Der р2 Рер4. Однако, стимуляция Der р2 Рер3 и Der р2 Рер5 приводила к значительной пролиферации PBMCs в 4 из 10 и 3 из 10 случаев, соответственно, указывая, что пептиды 3 и 5 содержат важные Т-клеточные эпитопы.

Чтобы установить способность пептидов вызывать блокирование IgG, кроликов иммунизировали 5 отдельными конъюгатами KLH-пептид. После этого, способность индуцированного пептидом кроличьего IgG ингибировать связывание IgE антител пациентов с аллергией с rDer p 2 была исследована с помощью ELISA. Планшеты ELISA сенсибилизировали 1 мкг/мл rDer p 2, промывали и блокировали. Планшеты предварительно инкубировали с разбавленным 1:100 кроличьим антипептидом (KLH-Р1, KLH-Р2, KLH-Р3, KLH-Р4, и KLH-Р5), кроличьим анти-rDer p 2 и, для контроля, с соответствующими преимунными сыворотками. После промывки планшеты инкубировали с сывороткой людей с аллергией к клещу домашней пыли, Der p 2 сенсибилизированных пациентов (разбавленной 1:3), при этом связаный IgE определяли с помощью мышиного античеловеческого IgE (Pharmingen 1:1000) и затем с помощью РОХ-связанного овечьего антимышиного IgG (Amersham Bioscience) 1:2000. Процент ингибирования IgE-связывания, полученный при инкубировании с антипептидной антисывороткой, вычисляли, как указано далее: 100-ODi/ODP × 100.

Таблица 5 показывает ингибирование (%) всех 20 пациентов.

Таблица 5. Ингибирование способности анти-Der p 2- пептид антител ингибировать связывание IgE 20 пациентов с аллергией с полным rDer p 2. Анти-KLH-пептид-сыворотки, индуцированные пептидами 2, 3 и 4, блокировали IgE-связывание в той же самой степени, как сыворотки против Der p 2 дикого типа (в %)

Пример 27. Выбор гипоаллергенных пептидов, полученных из Der p 1 Способность пептидов, полученных из Der p 1, индуцировать IgE-блокирующие IgG антитела, была определена с использованием кроличьего антипептида KLH антисывороток и сывороток от 6 пациентов с аллергией к клещу домашней пыли в ингибиторном анализе ELISA, как описано в примере 26, за исключением того, что ELISA планшеты были сенсибилизированы Der p 1 дикого типа вместо Der p 2.

Таблица 7 показывает ингибирование (%) 6 пациентов.

1. Полипептид для лечения или предотвращения аллергий на аллерген пыльцы трав PhlP1, имеющий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID No. 17.

2. Полипептид по п. 1, отличающийся тем, что его вводят индивидууму в количестве от 0,001 мг/кг веса тела до 5 мг/кг веса тела, предпочтительно от 0,003 мг/кг веса тела до 2 мг/кг веса тела.

3. Полипептид по п. 1, отличающийся тем, что он вызывает выработку IL-10 и IFN-гамма.

4. Полипептид по п. 1, отличающийся тем, что он вызывает IgG ответ, который направлен на IgE эпитопы аллергена дикого типа.

5. Полипептид для лечения или предотвращения аллергий на аллерген пыльцы березы Betv1, имеющий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID No. 18 или SEQ ID No. 19.

6. Полипептид по п. 5, отличающийся тем, что его вводят индивидууму в количестве от 0,001 мг/кг веса тела до 5 мг/кг веса тела, предпочтительно от 0,003 мг/кг веса тела до 2 мг/кг веса тела.

7. Полипептид по п. 5, отличающийся тем, что он вызывает выработку IL-10 и IFN-гамма.

8. Полипептид по п. 5, отличающийся тем, что он вызывает IgG ответ, который направлен на IgE эпитопы аллергена дикого типа.

9. Полипептид для лечения или предотвращения аллергий на аллерген клеща домашней пыли Derp2, имеющий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID No. 149, SEQ ID No. 150, SEQ ID No. 151 и SEQ ID No. 152.

10. Полипептид по п. 9, отличающийся тем, что его вводят индивидууму в количестве от 0,001 мг/кг веса тела до 5 мг/кг веса тела, предпочтительно от 0,003 мг/кг веса тела до 2 мг/кг веса тела.

11. Полипептид по п. 9, отличающийся тем, что он вызывает выработку IL-10 и IFN-гамма.

12. Полипептид по п. 9, отличающийся тем, что он вызывает IgG ответ, который направлен на IgE эпитопы аллергена дикого типа.

13. Молекула нуклеиновой кислоты, кодирующая полипептид по п. 1.

14. Молекула нуклеиновой кислоты, кодирующая полипептид по п. 5.

15. Молекула нуклеиновой кислоты, кодирующая полипептид по п. 9.

16. Экспрессирующий вектор, включающий молекулу нуклеиновой кислоты по п. 13.

17. Вектор по п. 16, отличающийся тем, что указанный вектор является бактериальным, грибковым вектором, вектором насекомого, вирусным вектором или вектором млекопитающего.

18. Экспрессирующий вектор, включающий молекулу нуклеиновой кислоты по п. 14.

19. Вектор по п. 18, отличающийся тем, что указанный вектор является бактериальным, грибковым вектором, вектором насекомого, вирусным вектором или вектором млекопитающего.

20. Экспрессирующий вектор, включающий молекулу нуклеиновой кислоты по п. 15.

21. Вектор по п. 20, отличающийся тем, что указанный вектор является бактериальным, грибковым вектором, вектором насекомого, вирусным вектором или вектором млекопитающего.

22. Клетка-хозяин, продуцирующая полипептид для лечения или предотвращения аллергий на аллерген пыльцы трав PhlP1, содержащий молекулу нуклеиновой кислоты по п. 13 или вектор по любому из пп. 16 или 17.

23. Клетка-хозяин, продуцирующая полипептид для лечения или предотвращения аллергий на аллерген пыльцы березы Betv1, содержащий молекулу нуклеиновой кислоты по п. 14 или вектор по любому из пп. 18 или 19.

24. Клетка-хозяин, продуцирующая полипептид для лечения или предотвращения аллергий на аллерген клеща домашней пыли Derp2, содержащий молекулу нуклеиновой кислоты по п. 15 или вектор по любому из пп. 20 или 21.

25. Вакцинная композиция, предназначенная для лечения или предотвращения аллергии на аллерген пыльцы трав PhlP1, содержащая эффективное количество смеси гипоаллергенных полипептидов, происходящих от аллергенов пыльцы трав, отличающаяся тем, что меньшей мере один из полипептидов выбирают из SEQ ID No. 14, SEQ ID No. 15, SEQ ID No. 16 и SEQ ID No. 17, и фармацевтически приемлемый эксципиент.

26. Композиция по п. 25, отличающаяся тем, что она содержит от 10 нг до 1 г, предпочтительно от 100 нг до 10 мг, предпочтительно от 0,5 мкг до 200 мкг указанного полипептида.

27. Композиция по п. 25 или 26, отличающаяся тем, что она дополнительно содержит по меньшей мере один адъювант и/или консервант.

28. Вакцинная композиция, предназначенная для лечения или предотвращении аллергии на аллерген пыльцы березы Betv1, содержащая эффективное количество по меньшей мере одного гипоаллергенного полипептида, выбранного из SEQ ID No. 18 или SEQ ID No. 19, и фармацевтически приемлемый эксципиент.

29. Композиция по п. 28, отличающаяся тем, что она содержит от 10 нг до 1 г, предпочтительно от 100 нг до 10 мг, предпочтительно от 0,5 мкг до 200 мкг указанного полипептида.

30. Композиция по п. 28 или 29, отличающаяся тем, что она дополнительно содержит по меньшей мере один адъювант и/или консервант.

31. Вакцинная композиция, предназначенная для лечения или предотвращении аллергии на аллерген клеща домашней пыли Derp2, содержащая эффективное количество по меньшей мере одного полипептида, происходящего от аллергенов клеща домашней пыли, отличающаяся тем, что по меньшей мере один полипептид выбирают из SEQ ID No. 149, SEQ ID No. 150, SEQ ID No. 151 и SEQ ID No. 152, и фармацевтически приемлемый эксципиент.

32. Композиция по п. 31, отличающаяся тем, что она содержит от 10 нг до 1 г, предпочтительно от 100 нг до 10 мг, предпочтительно от 0,5 мкг до 200 мкг указанного полипептида.

33. Композиция по п. 31 или 32, отличающаяся тем, что она дополнительно содержит по меньшей мере один адъювант и/или консервант.



 

Похожие патенты:

Изобретение относится к биотехнологии и медицине, а именно к способу выделения рекомбинантного белка, содержащего в своем составе последовательности миелопептидов и представленного последовательностью SEQ ID NO:1.

Изобретение относится к области биохимии. Предложен экспрессионный вектор, содержащий экспрессионную кассету легкой цепи антитела, экспрессионную кассету тяжелой цепи антитела и экспрессионную кассету маркера селекции.

Настоящая группа объектов изобретения относится к области биотехнологии. Предложен рекомбинантный мультимерный скаффолд на основе 3 домена FnIII тенасцина (Tn3), который специфически связывается с рецептором 2 TRAIL (TRAIL R2).

Изобретение относится к области биохимии. Предложено выделенное антитело или его функциональная часть, способное специфически связывать респираторно-синцитиальный вирус (РСВ).

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению белков, и может быть использовано для получения поверхностно-активных белков.

Изобретение относится к области биохимии, в частности к синтетическому конструкту двухцепочечной нуклеиновой кислоты для экспрессии множества гетерологичных генов в растительной клетке, характеризующемуся двунаправленным промотором, состоящему из первой цепи, содержащей элемент минимального корового промотора, и второй цепи, содержащей промотор бациллярного вируса сахарного тростника, а также к способу получения трансгенной растительной клетки или ткани, которые экспрессируют множество гетерологичных генов с его использованием.

Изобретение относится к биотехнологии. Предложен экзотоксин A Pseudomonas (РЕ), имеющий замену одного или нескольких аминокислотных остатков в положениях L423, F443 и L477.

Настоящая группа изобретений относится к биотехнологии и медицине. Предложены связывающая молекула, специфически связывающаяся с двумя различными эпитопами на HER2, и способ ее получения, а также кодирующая ее молекула нуклеиновой кислоты, экспрессирующий вектор, включающий эту молекулу нуклеиновой кислоты, клетка-хозяин для экспрессии связывающей молекулы, трансформированная экспрессирующим вектором, и фармацевтическая композиция для лечения рака, включающая связывающую молекулу, или молекулу нуклеиновой кислоты ее кодирующую, или экспрессирующий вектор.

Изобретение относится к области биохимии. Заявлено антитело, специфически связывающееся с PTK7 (протеинтирозинкиназа 7) человека, а также конъюгат указанного антитела с цитотоксическим агентом.

Изобретение относится к области биохимии. Заявлены связывающие белки, представляющие собой иммуноглобулины с двойными вариабельными доменами, которые связывают IL-1α и IL-1β.

Изобретение относится к биотехнологии и представляет собой способ получения вирусоподобных частиц, содержащих структурные антигены core, E1 и Е2 вируса гепатита С и способ очистки вирусоподобных частиц.

Изобретение относится к биотехнологии, а именно генной инженерии. Предложены способ получения рекомбинантного капсидного белка вируса гепатита E (rtHEV-ORF2) и рекомбинантная вакцина для профилактики вирусного гепатита E.

Изобретение относится к биотехнологии, а именно генной инженерии. Предложен штамм дрожжей Hansenula polymorpha - продуцент рекомбинантного капсидного белка вируса гепатита Е (HEV) генотипа 3.

Изобретение относится к области биотехнологии, в частности к набору из двух праймеров для амплификации нуклеиновой кислоты вируса гепатита А, к способу обнаружения вируса гепатита А в биологическом образце, а также к набору для обнаружения вируса гепатита А в биологическом образце.

Изобретение относится к молекулярной биологии, вирусологии и медицине. .

Вакцина // 2363492
Изобретение относится к области медицины, молекулярной биологии и генной инженерии. .

Изобретение относится к способам и композициям, полезным для предупреждения и лечения инфекций, вызванных вирусом гепатита С (HCV). .

Изобретение относится к области медицины и касается нового полипептида вируса гепатита С NS3/4A и его использования в вакцине. .

Изобретение относится к области медицины, а именно к диагностике гепатита С, и касается определения комплекса HCV-антиген/антитело и включает способ определения комплекса, образуемого между HCV-антикоровым антигеном и NS3/4a-антителом, который может распознавать как HCV антигены, так и антитела, присутствующие в образце, при использовании единой твердой основы, а также и твердые подложки для применения в иммуноанализе.

Группа изобретений относится к области биохимии. Предложен штамм бактерий Escherichia coli BL21 DE3 pClcRFP для детекции ионов меди, биосенсор и способ детекции ионов меди в анализируемой жидкой среде.
Наверх