Конъюгаты гаптен-носитель и их применение



Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение
Конъюгаты гаптен-носитель и их применение

 

C07K145 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2326693:

ЦИТОС БАЙОТЕКНОЛОДЖИ АГ (CH)

Группа изобретений относится к композициям, содержащим конъюгат гаптена с носителем в упорядоченной и повторяющейся матрице, и способам получения таких композиций. Предложен конъюгат гаптен-носитель для индукции иммунного ответа на лекарственный препарат, вызывающий привыкание или допускающий злоупотребление, содержащий коровую частицу, содержащую, по крайней мере, один первый сайт присоединения, где указанная коровая частица представляет собой вирусоподобную частицу РНК-содержащего фага и, по крайней мере, один гаптен никотина, по крайней мере, с одним вторым сайтом присоединения и где указанный второй сайт присоединения способен к ассоциации посредством, по крайней мере, одной ковалентной непептидной связи с указанным первым сайтом присоединения, образуя таким образом упорядоченный и повторяющийся конъюгат гаптена-носителя. Предложенные конъюгаты и композиции по данному изобретению могут включать вирусоподобные частицы, присоединенные к различным гаптенам, включая гормоны, токсины и препарат, особенно препараты, вызывающие зависимость, такие как никотин, и могут использоваться для индукции иммунного ответа против гаптенов в терапевтических, профилактических и диагностических целях. Группа изобретений обеспечивает создание композиций вакцин, способных вызывать устойчивые иммунные ответы против никотина без применения полного адъюванта Фрейнда и разработку эффективной вакцины против никотина, способной быстро снизить доступность никотина для абсорбирования мозгом. 7 н. и 24 з.п. ф-лы, 6 ил.

 

Предпосылки изобретения

Область изобретения

Настоящее изобретение относится к областям медицины, здравоохранения, иммунологии, молекулярной биологии и вирусологии.

Область техники

Расстройства, связанные со злоупотреблением наркотиков, влекут за собой большое число специфических, хорошо известных последствий как криминальной, так и экономической значимости. К ним относятся смерть, различные заболевания, насилие, преступность, потеря работы, снижение производительности, разрушение дружеских и семейных отношений и распространение ВИЧ и других заболеваний, передаваемых половым путем. Экономические издержки в Соединенных Штатах от злоупотребления наркотиками (исключая табак) оценивались в 98 миллиардов долларов в 1992 году, это последний год, для которого имеются достоверные данные («The economic costs of alcohol and drug abuse in the United States-1992», National Institute on Drug Abuse). Эти издержки включают в себя преступления (59,1 миллиардов долларов), раннюю смертность (14,6 миллиардов долларов), ухудшение производительности/аварии на производстве (14,2 миллиарда долларов), социальное обеспечение (10,4 миллиардов долларов), здравоохранение (5,5 миллиардов долларов) и автомобильные аварии. Эти затраты прежде всего затрагивают правительство (46%), наркоманов и их семьи (44%). Очевидно, что злоупотребление наркотиками остается серьезной проблемой в обществе. Через три года после исследования, проведенного в 1992 году, в 1995, расходы, связанные со злоупотреблением наркотиками, были оценены NIDA в 110 миллиардов долларов.

По существу, злоупотребление наркотиками может оказывать пагубное влияние на человека, который их употребляет. Тем не менее, понятно, что свойство этих препаратов вызывать привыкание, является не только главной проблемой, связанной с применением таких препаратов, но и лежит в основе несостоятельности как лечения больных с лекарственной зависимостью, так и снижения распространения злоупотребления наркотиками в обществе.

Самым широко используемым препаратом в мире, вызывающим привыкание, является табак. Никотин, алкалоид, получаемый из листьев табака, является основным компонентом табака, вызывающим привыкание. В 1999 году количество курильщиков составляло 46,5 миллионов взрослого населения Соединенных Штатов. Курение сигарет является единственной основной причиной ранней смертности в Соединенных Штатах. По данным Centers for Disease Control and Prevention (CDC) в Соединенных Штатах ежегодно от курения умирает 430000 человек. Рак легких, сердечно-сосудистые заболевания, хроническое легочное заболевание и инсульт являются основными причинами смерти. Курение не только вредит самому курильщику, но также приводит к огромным социальным затратам. Предполагаемая медицинская помощь курильщикам в 1993 году составляла более 50 миллиардов долларов, а расходы, связанные со снижением производительности и уменьшением заработной платы вследствие нетрудоспособности, связанной с курением, оценивалась в 47 миллиардов долларов в год. Таким образом, суммарные экономические расходы, связанные со злоупотреблением никотина, больше, чем все расходы, связанные со злоупотребление всех типов наркотиков.

Несмотря на новейшие достижения в поведенческом лечении и фармакологической терапии, огромное количество курильщиков, пытающихся бросить курить, не смогут этого сделать (в качестве обзора смотри Fiore et al. (2000) Treating tobacco use and dependence, clinical practice guideline, US Department of Health and Human Services, Public Health Service). Препараты никотин-замещающей терапии являются одними из современных применяемых лекарственных средств либо в форме никотиновой жевательной резинки, ингалятора, назального спрея, либо в форме трансдермальных пластырей. Эффективность применения только трансдермальных пластырей была поставлена под сомнение при проведении клинических испытаний с плацебо-контролем и двойным контрольным испытанием (Joseph et al., N. Engl. J. Med. (1999), 340:1157-1158; Jorenby et al., N. Engl. J. Med. (1999) 340:685-691). Более того, побочные действия никотиновой жевательной резинки, такие как раздражение слизистой оболочки полости рта, боли в жевательных мышцах, расстройство пищеварения, тошнота, икота, парестезия и зуд, эритема, нарушения сна, желудочно-кишечные расстройства, сонливость, нервозность, головокружение и потливость, наблюдались и при использовании никотинового пластыря. Лечение антидепрессантом бупропионом может увеличивать 12-месячные уровни абстиненции приблизительно на 30% (Jorenby et al., supra).

Очевидно, что необходимы новые подходы к лечению и профилактике пристрастия к никотину и к другим наркотическим средствам. Стратегии иммунизации для изменения влияния наркотиков на поведенческие реакции являются целью исследований с 1974. И активная иммунизация с помощью морфина-6-гемисукцината-BSA, и пассивная иммунизация полученными антителами снижали самовведение героина у резус-обезьян (Bonese, et al. Nature 252:708-710 (1974); Killian, et al Pharmacol. Biochem. Behav. 9:347-352 (1978).) Было доказано, что иммунизация также эффективна при пристрастии к кокаину. Активная иммунизация снижала последующее введение кокаина у крыс (Carrera et al Nature 379:727-730 (1995), и было показано, что и активная, и пассивная иммунизации прекращают самостоятельное введение препарата (Fox et al. Nature Med 2:1129-1132 (1996)). В последнее время иммунизация конъюгатом GNC-KLH прекращала самовведение у крыс с пристрастием к кокаину (Carrera et al Proc. Nat. Acad Sci USA 97:6202-62061992 (2000)) и как иммунизация конъюгатом GND-KLH, так и введение моноклональных антител против кокаина блокировали эффекты кокаина (Carrera et al. Proc. Nat. Acad Sci USA 98:1988-1992 (2001).

Против фенциклидина (PCP) возникали антитела, и они демонстрируют эффективность в отношении снижения уровней PCP в мозге, уменьшая поведенческие реакции, и показывают подобную способность блокировать физиологические эффекты аналогов PCP (Hardin et al. J Pharmacol Exp Ther 285:1113-1122 (1998); Proksch et al. J. Pharmacol Exp Ther. 292:831-837 (2000)). У крыс также успешно возникали антитела против метамфетамина (Byrnes-Blake et al. Int Immunopharmacol 1:329-338 (2001)). В патенте США № 5256409 описана вакцина, содержащая белковый носитель, присоединенный к одному гаптену из класса препаратов десипрамина/имипрамина и другому гаптену из класса препаратов нортриптилина/амитриптилина.

Следовательно, в отношении наркотических препаратов могут возникать иммунные ответы, антитела могут блокировать действие наркотического средства, и на животных моделях было показано, что вакцинация эффективна в качестве общего подхода к лечению наркотической зависимости и пристрастия к наркотикам. Полагают, что возникновение иммунного ответа может блокировать действие лекарственного препарата путем предотвращения его проникновения в центральную нервную систему (Carrera et al. Nature 379:727-730 (1995). Уменьшая эйфорию, связанную с применением наркотического препарата, человек с пристрастием к наркотику больше не мотивирован на его употребление.

Так как эффект привыкания к наркотическим препаратам вызван их действием на головной мозг, антитела в сыворотке должны быть способны снижать поступление препарата в мозг. Cerny (WO 92/03163) была описана вакцина и иммуносыворотка для использования при злоупотреблении наркотиками. Вакцина состояла из гаптена, присоединенного к белковому носителю. Также было описано получение антител против наркотических средств и применение этих антител при детоксикации наркоманов.

Никотин, кокаин, героин и большинство препаратов, вызывающих наркозависимость, представляют собой гаптены, которые не являются иммуногенными. Присоединение гаптенов к белковым носителям обычно увеличивает их иммуногенность.

Было описано несколько различных никотиновых гаптенов, носителей и способов присоединения. Matsushita et al. (Biochem. Biophys. Res. Comm. (1974) 57, 1006-1010) и Castro et al. (Eur. J. Biochem. (1980) 104, 331-340) получили никотиновые гаптены, конъюгированные с альбумином бычьей сыворотки (БСА) через линкер в 6-положении никотина. С другой стороны, Castro et al. (Biochem. Biophys. Res. Commun. (1975) 67, 583-589) описали два никотин-альбуминовых конъюгата: N-сукцинил-6-амино-(+/-)-никотин-БСА и 6-(сигма-аминокапрамидо)-(+/-)-никотин-БСА. Noguchi et al. (Biochem. Biophys. Res. Comm. (1975) 83, 83-86) был получен никотин-БСА конъюгат с никотином, конъюгированным в 1-положении никотина. Langone et al. (Biochemistry (1973) 12, 5025-5030 и Meth. Enzymol. (1982) 84, 628-635) получили производное гаптена, O-сукцинил-3'-гидроксиметил-никотин, и конъюгировали его с альбумином бычьей сыворотки и гемоцианином лимфы моллюска. В соответствии с этими способами Langone et al. (supra), Abad et al, (Anal. Chem. (1993) 65, 3227-3231) синтезировали никотиновый гаптен, 3'-(гидроксиметил)никотин гемисукцинат, и присоединяли его к альбумину бычьей сыворотки для иммунизации мышей с получением моноклональных антител к никотину. Isomura et al. (J. Org. Chem. (2001) 66, 4115-4121) предложили способы синтеза никотиновых конъюгатов, присоединенных в 1'-положении никотина, которые связывали с гемоцианином лимфы моллюсков (KLH) и БСА. Конъюгат с KLH использовали для иммунизации мышей и для получения моноклональных антител против никотина. Svensson et al. (WO 99/61054) описали никотин-гаптены, конъюгированные посредством пиридинового кольца, и дополнительно описали никотин-гаптен, конъюгированный с KLH, и индукцию никотин-специфических IgG антител, используя такие конъюгаты. Если введение проводили в присутствии полного адъюванта Фрейнда, то измеренные никотин-специфические ELISA титры составляли от 1:3000 до 1:15500, тогда как в отсутствии адъюванта Фрейнда измеренные титры были от 1:500 до 1:3000. Ennifar et al. (патент США № 6232082) описали никотиновые гаптены, присоединенные посредством пирролидинового кольца, и описали никотин-гаптен, конъюгированный с рекомбинантным экзотоксином A Psuedomonas aeruginosa (rEPA), и индукцию никотин-специфических IgG антител при введении конъюгатов в присутствии полного адъюванта Фрейнда. Swain et al. (патент США № 5876727) описали присоединение никотинового гаптена к БСА и индукцию никотин-специфических IgG антител у мышей при введение конъюгатов в смеси с полным адъювантом Фрейнда.

Осуществление вакцинации против никотина было показано в принципе (Hieda et al., J. Pharm. Exp. Ther. (1997) 288, 1076-1081; Hieda et al., Psychopharm. (1999), 143, 150-157; Hieda et al., Int. J. Immunopharm. (2000) 22, 809-819; Pentel et al., Pharm. Biochem. Behav. (2000), 65, 191-198, Malin et al., Pharm. Biochem. Behav. (2001), 68, 87-92). Ковалентные конъюгаты никотина и KLH или rEPA получали и вводили мышам или крысам в присутствии полного адъюванта Фрейнда, и индуцировали никотин-специфические IgG антитела. Эффективность вакцинации была показана несколькими различными путями. После введения никотина наибольшее количество никотина оставалось связанным в сыворотке, и концентрации никотина были ниже в мозге крыс из групп, иммунизированных никотином-KLH или никотином-rEPA, по сравнению с контрольной группой, иммунизированной только носителем. Иммунизация также снижала психофармакологическую активность, связанную с никотином, поскольку иммунизированные животные также были менее восприимчивы к действию никотина на локомоторную активность, высвобождение допамина (Svensson et al. WO 99/61054) и наблюдалось уменьшение симптомов отмены никотина.

Вышеописанный уровень техники демонстрирует эффективность композиций вакцин, содержащих полный адъювант Фрейнда, для индукции иммунных ответов против никотина. Полный адъювант Фрейнда является одним из наиболее сильных доступных адъювантов, однако из-за своих побочных эффектов он не разрешен к применению у человека. Таким образом, существует необходимость в создании композиций вакцин, способных вызывать устойчивые иммунные ответы против никотина без применения полного адъюванта Фрейнда. Более того, так как БСА успешно использовался в качестве носителя на животных моделях, он может не подходить для применения в композициях вакцин человека из-за риска возникновения побочных эффектов, таких как риск передачи прионного заболевания (вариантом является болезнь Крейтцфельда-Якоба). Другой проблемой разработки эффективной вакцины против никотина является необходимость в иммунном ответе, способном быстро снизить доступность никотина для абсорбирования мозгом. Никотин сигарет поглощается на поверхности слизистой оболочки, особенно рта и легких и переносится кровью в мозг. Если никотин-специфические антитела успешно снижают передачу никотина в мозг, они должны будут компенсировать очень высокую артериальную концентрацию никотина, которая передается в мозг в течение нескольких секунд при вдохе (Hieda et al., 1999, supra). Следовательно, необходимы высокие концентрации никотин-специфических антител в крови, которые, главным образом, представляют собой подтип IgG. На поверхности слизистой оболочки в основном находятся антитела подтипа IgA. Таким образом, кроме антител в крови, никотин-специфические антитела подтипа IgA в легких могли бы быть эффективными для нейтрализации никотина, вдыхаемого во время курения до начала его циркулирования в крови.

Холерный токсин, известный в данной области как белковый носитель, может индуцировать антитела IgA, в частности, после интраназального введения. Холерный токсин также может действовать как адъювант, устраняя необходимость в полном адъюванте Фрейнда в композиции вакцины. Однако при введении холерного токсина в качестве адъюванта слизистой он преимущественно стимулирует иммунный ответ TH2-типа, увеличивая уровни интерлейкина-4 и объединяя увеличения до уровней общих и специфических IgE антител (Yamamoto et al., (1997) Proc. Natl. Acad. Sci USA 94, 5267-5272). После назальной иммунизации в присутствии холерного токсина в легких мышей развиваются IgE-связанные воспалительные реакции (Simecka et al., (2000) Infect. Immunol. 68, 672-679, Hodge et al., (2001) Infect. Immunol., 69, 2328-2338). Несмотря на перспективу назальной иммунизации в присутствии холерного токсина, также существует возможность развития побочных иммунопатологических реакций, характеризующихся воспалением дыхательных путей (Hodge et al., (2001) Infect. Immunol., 69, 2328-2338).

Следовательно, существует необходимость в системе носителей, способной стимулировать иммунные ответы против гаптена, не используя токсические адъюванты, не используя недостаточно толерантные белковые носители и, в определенных ситуациях, не стимулируя потенциально патологические TH2 иммунные ответы. Новые системы носителей, удовлетворяющие этим требованиям, могут применяться для создания новых конъюгатов и композиций, подходящих для лечения наркомании, наряду с другими состояниями, крайняя необходимость в которых существует в настоящее время.

Краткое описание изобретения

Заявителями было обнаружено, что гаптены, присоединенные к коровым частицам, что ведет к образованию высокоупорядоченных и повторяющихся гаптеновых матриц, неожиданно являются эффективными для индукции иммунных ответов, в частности антител против гаптенов. Коровые частицы, содержащие первый сайт присоединения, и гаптены, содержащие второй сайт присоединения, связаны посредством указанного первого и второго сайтов присоединения с образованием указанных упорядоченных и повторяющихся гаптеновых матриц. Взаимодействие между первым и вторым сайтами может быть непосредственным или может вовлекать, по крайней мере, одну другую молекулу, например линкер.

В первом варианте осуществления первый сайт присоединения коровых частиц является природным. Альтернативно, первый сайт присоединения вводят путем химической реакцией присоединения или с помощью рекомбинантных способов. Предпочтительные первые сайты присоединения включают в себя аминогруппы, карбоксильные группы или сульфгидрильные группы. Предпочтительные аминокислотые, составляющие первый сайт присоединения, выбраны из лизина, аргинина, цистеина, аспартата, глутамата, тирозина и гистидина. Особенно предпочтительными являются лизиновые остатки.

Подходящие вторые сайты присоединения на гаптенах представляют собой амины, амиды, карбоксильные и сульфгидрильные группы. Существует большое разнообразие соединений, которые были разработаны для создания перекрестных связей пептидов/белков или конъюгации белка для модификации молекул путем образования ковалентной связи с реакционно-способной группой белковой молекулы коровой частицы.

Коровые частицы с первым сайтом присоединения по данному изобретению включают в себя любую частицу, подходящую для образования упорядочных повторяющихся матриц. В некоторых вариантах осуществления такие коровые частицы включают в себя вирусоподобные частицы (VLP), бактериофаги, вирусоподобные частицы бактериофагов, фимбрии и тому подобное. В конкретных вариантах осуществления ими являются VLP HbcAg, VLP бактериофага и фимбрии типа I. Данное изобретение также относится к различным формам коровых частиц, которые сохраняют способность образовывать упорядоченные повторяющиеся структуры. Различные формы включают в себя рекомбинантные, и природные формы, и мутантные формы коровых частиц. В определенных вариантах осуществления мутантные формы коровых частиц включают в себя такие формы, у которых тип первого сайта присоединения или число указанных сайтов отличается от родительского. Особенно предпочтительным является изменение числа лизиновых остатков на коровой частице.

В определенных вариантах осуществления конъюгаты по данному изобретению включают в себя гаптены, способные индуцировать иммунный ответ против различных молекул, включая, но ими не ограничиваясь, токсины, гормоны и препараты. Более предпочтительными являются препараты, и еще более предпочтительным являются препараты, вызывающие привыкание, или наркотики. Гаптены по данному изобретению содержат второй сайт присоединения для присоединения к первому сайту присоединения коровой частицы либо непосредственно, либо посредством, по крайней мере, одной связывающей молекулы. В одном из вариантов осуществления гаптен способен индуцировать иммунные ответы против кокаина, например сукцинилированного норкокаина.

Предпочтительными вариантами осуществления данного изобретения являются никотин-гаптеновые конъюгаты. Никотиновые гаптены, которые могут применяться в конъюгатах по настоящему изобретению, могут иметь, по крайней мере, одну и предпочтительно одну боковую цепь, присоединенную к любому положению либо на пиридиновом, либо на пирролидиновом кольце никотина. Специалисту в данной области известно, как получить подходящие производные никотиновых гаптенов. Например, никотин может быть химически модифицирован с получением гидроксильной группы в 3'-положении, которая подходит для взаимодействия с агентами, такими как ангидрид янтарной кислоты с получением O-сукцинил-3'-гидроксиметилникотина. Это производное никотина можно присоединить к аминокислотам коровых частиц, таким как лизин, используя активирующий агент EDC. В дополнительном предпочтительном варианте осуществления, О-сукцинил-3'-гидроксиметилникотин может быть активирован с помощью EDC, и полученная активированная карбоксильная группа стабилизирована с помощью N-гидроксисукцинимида. В других вариантах воплощения гаптены получают путем ацилирования норникотина с помощью ангидрида янтарной кислоты в метиленхлориде в присутствии двух эквивалентов диизопропилэтиламина. Такой никотиновый гаптен затем присоединяют к коровым частицам по настоящему изобретению с помощью активирующего агента, например HATU. В данном изобретении представлены другие способы и методы синтеза гаптенов, применяемых в конъюгатах и композициях по данному изобретению.

Настоящее изобретение относится к композициям, содержащим коровую частицу и гаптен, которые могут применяться для индукции иммунных ответов. Композиции по данному изобретению включают в себя композиции вакцин, вместе или в отсутствие дополнительных фармацевтически приемлемых наполнителей или адъювантов. Также представлены способы иммунизации. Более предпочтительно способы интраназальной иммунизации.

Композиции по данному изобретению индуцируют иммунные ответы, включая продукцию антител. Следовательно, в еще одном варианте осуществления данное изобретение относится к способу получения указанных антител против таких гаптенов. Такие антитела по данному изобретению могут быть эффективны при лечении или профилактике заболеваний и для определения гаптенов, например, в способах диагностики заболеваний или заболеваний, связанных с присутствием одного или несколько гаптенов в тканях или в циркулирующих жидкостях у животных.

В связанном варианте осуществления данное изобретение может использоваться для профилактики или лечения заболеваний, расстройств или состояний, которые включают в себя, но ими не ограничиваются, отравление токсинами, патологическое нарушение уровней гормонов, интоксикацию лекарственными средствами или наркоманию и тому подобное. Иммунизация конъюгатами гаптен-носитель по данному изобретению приводит к иммунному ответу против гаптена, так что иммунные молекулы, в частности антитела, связывают гаптены. Пассивный перенос антител также может использоваться для лечения и профилактики заболеваний. Лечение наркомании также может использоваться для лечения других заболеваний и состояний, связанных с наркоманией.

Заявителями было обнаружено, что конъюгаты никотин-гаптен, присоединенные к вирусоподобным частицам, индуцируют высокие титры никотин-специфических антител IgG. Настоящее изобретение, следовательно, относится к терапии никотинозависимости, основанной на упорядоченном и повторяющемся конъюгате VLP-никотин. При этом лечении способны индуцироваться высокие титры антител против никотина у вакцинированных животных. Высокие титры антител индуцируются даже в отсутствие адъювантов и содержат не только IgG, но также подтипы IgA. Более того, это лечение неожиданно не связано с индукцией потенциально патологических иммунных ответов, таких как воспаление. Терапевтические композиции по данному изобретению включают в себя, по крайней мере, одну молекулу никотинового гаптена и VLP, или, по крайней мере, один никотиновый гаптен и другую коровую частицу, такую как HbcAg или фимбрию.

Таким образом, данное изобретение относится к способам лечения и профилактики, которые заключаются в применении конъюгатов и композиций по данному изобретению. Такие способы могут использоваться для лечения и профилактики заболеваний, расстройств и состояний, связанных с препаратами, гормонами и токсинами.

В дополнительном варианте осуществления данного изобретения фармацевтическая композиция предназначена для лечения никотиновой зависимости, уменьшения симптомов отмены никотина, облегчения отвыкание от курения или препятствует рецидиву и включает терапевтически эффективное сочетание композиции вакцины по данному изобретению и дополнительного агента. В одном из вариантов осуществления дополнительный агент выбран из группы, состоящей из: антидепрессанта; модулятора рецептора никотина; антагониста каннабиноидного рецептора; антагониста опиоидного рецептора; ингибитора моноаминоксидазы; анксиолитика или любого сочетания этих агентов.

Другими вариантами осуществления данного изобретения являются наборы, которые могут использоваться для диагностики и скрининга, в которых применяются конъюгаты, композиции и способы по настоящему изобретению. Другие варианты осуществления настоящего изобретения будут понятны специалисту в свете знаний в данной области, нижеследующих рисунков и описания данного изобретения и формулы изобретения.

Краткое описание рисунков

На фиг.1 изображена картина электрофореза в полиакриламидном геле с додецилсульфатом натрия и анализ Вестернблот конъюгатов Nic-Qβ. Производное никотина Suc-Nic присоединяли к Qβ при различных концентрациях (1x, 5x, 50x, 100x и 500x молярный избыток). Аликвоты реакционных растворов помещали на 16% полиакриламидный гель с додецилсульфатом натрия и окрашивали Кумасси синим (A). Из параллельных дорожек геля белки переносили на нитроцеллюлозу и определяли, используя антисыворотку против никотин-холерного токсина и затем козлиные антитела, конъюгированные с HRPO, направленные против мышиных IgG, регистрацию ECL (B). Маркеры молекулярной массы даны на левом крае.

На фиг.2 показан титр никотин-специфических IgG. Сыворотку вакцинированных мышей исследовали на реакционную способность против никотина, присоединенного к БСА, с помощью ELISA. Оптическую плотность при 450 нм получали для каждой серии разведений. Титры были рассчитаны из разведений, которые давали половину максимальной оптической плотности. Показано среднее значение для трех мышей в каждой группе.

На фиг.3 показаны никотин-специфические IgG подтипы. Сыворотку вакцинированных мышей исследовали на реакционную способность против никотина, присоединенного к БСА, с помощью ELISA и обнаруживали с помощью вторичных антител, специфичных для IgG подтипов IgG1 (A), IgG2a (B), IgG2b (C) и IgG3 (D). Показана оптическая плотность при 450 нм, полученная для каждой серии разведений. Показано среднее значение для трех мышей в каждой группе.

На фиг.4 показаны никотин-специфические IgE антитела. Сыворотку вакцинированных мышей исследовали на реакционную способность против никотина, присоединенного к БСА, с помощью ELISA и обнаруживали с помощью вторичных антител, специфичных для подтипа IgE. Показана оптическая плотность при 450 нм, полученная для каждой серии разведений. Показано среднее значение для трех мышей в каждой группе.

На фиг.5 показаны никотин-специфические антитела IgA. Сыворотку вакцинированных мышей исследовали на реакционную способность против никотина, присоединенного к БСА, с помощью ELISA и обнаруживали с помощью вторичных антител, специфичных для подтипа IgA. Показана оптическая плотность при 450 нм, полученная для каждой серии разведений. Показано среднее значение для трех мышей в каждой группе.

На фиг.6 A и B показана эффективность никотин-VLP вакцинации. Мышей иммунизировали никотин-VLP и концентрации никотина в сыворотке и мозге измеряли после инъекции 3H-никотина. Показано среднее значение для трех мышей в каждой группе.

Подробное описание изобретения

Следует учесть, что как вышеуказанное общее описание, так и нижеследующее подробное описание приведены только в качестве примера и пояснения и предназначены для дополнительного объяснения заявленного изобретения.

Определения

Следующие определения представлены в виде понятий, хорошо известных специалисту в данной области, и предназначены для полного понимания следующего изобретения, но не служат для ограничения данного изобретения.

Адъювант: Используемый здесь термин «адъювант» относится к неспецифическим стимуляторам иммунного ответа или веществам, которые создают депо у хозяина, которые при объединении с вакциной и фармацевтической композицией, соответственно, по настоящему изобретению могут давать более сильный иммунный ответ. Может использоваться большое разнообразие адъювантов. Примеры включают в себя полный и неполный адъювант Фрейнда, гидроксид алюминия и модифицированный мурамилдипептид. Другими адъювантами являются неорганические гели, такие как гидроксид алюминия, поверхностно-активные вещества, такие как лизолецитин, плюрониловые полиоли, полианионы, пептиды, масляные эмульсии, гемоцианины лимфы молюсков, динитрофенол и потенциально эффективные адъюванты человека, такие как BCG (бацилла Кальмета-Герена) и Corynebacterium parvum. Такие адъюванты также хорошо известны в данной области. Кроме того, адъюванты, которые могут вводиться вместе с композициями по данному изобретению, включают в себя, но ими не ограничиваются, иммуномодулятор монофосфорил липид, AdjuVax 100a, QS-21, QS-18, CRL1005, соли алюминия (Alum), MF-59, OM-174, OM-197, OM-294 и виросомальные адъювантные технологии. Адъюванты также могут содержать смеси этих веществ.

Иммунологически активные сапониновые фракции, обладающие адъювантной активностью, получали из коры дерева Quillaja Saponaria Molina родом из Южной Америки, хорошо известного в данной области. Например, QS21, также известный как QA21, является очищенной с помощью ВЭЖХ фракцией, полученной из дерева Quillaja Saponaria Molina, и способ ее получения описан (как QA21) в патенте США № 5057540. Сапонины Quillaja также были описаны в качестве адъюванта Scott et al., Int. Archs. Allergy Appl. Immun., 1985, 77, 409. Моносфорил липид A и его производные хорошо известны в данной области. Предпочтительным производным является 3 де-o-ацилированный монофосфорил липид A. Более предпочтительные адъюванты описаны в WO 00/00462, описание которого приводится здесь в качестве ссылки.

Тем не менее, преимуществом настоящего изобретения является высокая иммуногенность композиций по данному изобретению. Как уже отмечалось здесь или станет очевидно из данного подробного описания, в дополнительных альтернативных или предпочтительных воплощениях представлены вакцины и фармацевтические композиции, лишенные адъювантов, что ведет к вакцинам и фармацевтическим композициям для лечения наркомании, предпочтительно зависимости от никотина, свободным от адъювантов и, таким образом, обладающим большими свойствами безопасности, так как адъюванты могут вызывать побочное действие. Использующийся здесь термин «свободные» в контексте вакцин и фармацевтических композиций для лечения наркомании предпочтительно зависимости от никотина, относятся к вакцинам и фармацевтическим композициям, которое применяются без адъювантов.

Животные: Как используется здесь, к термину «животное» относятся, например, люди, овцы, лоси, олени, чернохвостый олень, норки, млекопитающие, обезьяны, лошади, крупный рогатый скот, свиньи, козы, собаки, кошки, крысы, мыши, птицы, куры, рептилии, рыбы, насекомые и пауки.

Антитела: Как используется здесь, термин «антитела» относится к молекулам, которые способы связывать эпитоп или детерминант антигена. К этому термину относятся целые антитела и их антиген-связывающие фрагменты, включая антитела с одной цепью. Наиболее предпочтительно антителами являются антиген-связывающие фрагменты антител человека и включают в себя, но ими не ограничиваются, Fab, Fab' и F(ab')2, Fd, Fvs (scFv) с одной цепью, антитела с одной цепью, Fvs (sdFv), связанные дисульфидным мостиком, и фрагменты, содержащие либо VL, либо VН домен. Антитела могут быть от любого животного, включая птиц и млекопитающих. Предпочтительно антитела являются антителами млекопитающих, например человека, мыши или крысы, кролика, козла, морской свинки, верблюда, лошади и тому подобное, или других подходящих животных, например цыпленка. Как используется здесь, антитела «человека» включают в себя антитела, содержащие аминокислотную последовательность человеческого иммуноглобулина, и к ним относятся антитела, выделенные из библиотек иммуноглобулинов человека или из животных, трансгенных по одному или нескольким иммуноглобулинам человека, и которые не экспрессируют эндогенные иммуноглобулины, как описано, например, в патенте США № 5939598, описание которого приведено здесь в качестве ссылки в полном объеме.

Активная иммунизация: Как используется здесь, термин «активная иммунизация» относится к индукции иммунного ответа у субъекта, обычно у животного, вызываемой путем введения иммуногена, вакцины, антигена или конъюгата гаптен-носитель. Наоборот, пассивная иммунизация относится к предоставлению иммунитета субъекту путем введения иммунных молекул или клеток указанному субъекту.

Альфавирус: Как используется здесь, термин «альфавирус» относится к любым РНК-содержащим вирусам, относящимся к роду Alphavirus. Описание членов этого рода содержится в Strauss and Strauss, Microbiol Rev., 55:491-562 (1994). Примеры альфавирусов включают в себя вирус Aura, вирус Bebaru, вирус Cabassou, вирус Чукунгунской лихорадки, вирус восточного лошадиного энцефаломиелита, вирус Fort morgan, вирус Гета, вирус Kyzylagach, вирус Mayoaro, вирус Middleburg, Mucambo вирус, вирус Ndumu, вирус Pixuna, вирус Tonate, вирус Triniti, вирус Una, вирус западного лошадиного энцефаломиелита, вирус Whataroa virus, вирус Синдбис (SIN), вирус лихорадки Семлики (SFV), вирус венесуэльского лошадиного энцефаломиелита (VEE) и вирус Ross River.

Антиген: Как используется здесь, термин «антиген» относится к молекуле, способной связываться антителом или рецептором T-клетки (TCR), если он презентирован молекулами MHC. Антиген, кроме того, способен распознаваться иммунной системой и/или способен индуцировать гуморальный иммунный ответ и/или клеточный иммунный ответ, что приводит к активации B- и/или T-лимфоцитов. Однако, по крайней мере, в некоторых случаях, может потребоваться, чтобы антиген содержал или был связан с эпитопом Тх-клетки и предоставлялся в адъюванте. Антиген может иметь один или несколько эпитопов (эпитопы B- и/или T-клеток). Под вышеуказанными специфическими реакциями понимают, что антиген будет предпочтительно взаимодействовать, обычно высокоселективно, с соответствующим ему антителом или TCR, а не с множеством других антител или TCR, которые могут быть вызваны другими антителами. Антигены, как используется здесь, также могут быть смесями нескольких отдельных антигенов.

Детерминант антигена: Как используется здесь, под термином «детерминант антигена» понимают часть антигена, которая специфически распознается либо B-, либо T-лимфоцитами. B-лмфоциты, отвечающие на антигенные детерминанты, продуцируют антитела, тогда как T-лимфоциты отвечают на антигенные детерминанты путем пролиферации и обеспечивают эффекторную функцию, опосредуя клеточный и/или гуморальный иммунитет.

Ассоциация: Как используется здесь, термин «ассоциация», применяемый к первому и второму сайтам присоединения, относится к соединению первого и второго сайтов присоединения, которое, предпочтительно, происходит с помощью, по крайней мере, одной непептидной связи. Природа ассоциации может быть ковалентной, ионной, гидрофобной, полярной или любым их сочетанием, предпочтительно природа ассоциации является ковалентной.

Сайт присоединения, первый: Как используется здесь, фраза «первый сайт присоединения» относится к элементу коровой частицы, с которым может ассоциироваться второй сайт присоединения, расположенный на антигене или детерминанте антигена. Первый сайт присоединения может быть белком, полипептидом, аминокислотой, пептидом, сахаром, полинуклеотидом, природным или синтетическим полимером, вторичным метаболитом или соединением (биотин, флуоресцеин, ретинол, дигоксигенин, ионы металла, фенилметилсульфонилфторид) или их сочетанием, или их химически активной группой. Разнообразные первые сайты присоединения присутствуют на поверхности неприродного молекулярного каркаса в повторяющейся конфигурации.

(a) Сайт присоединения, второй: Как используется здесь, фраза «второй сайт присоединения» относится к элементу, ассоциированному с гаптеном, с которым может ассоциировать первый сайт присоединения на поверхности неприродного молекулярного каркаса. Второй сайт присоединения гаптена включает в себя любую химическую группу, предпочтительно амин, амид, карбоксил, сульфгидрил, гидроксил, альдегид, ацилгалогенид, гидразин, диазоний или гидразид, или, кроме того, химические группы способны специфически взаимодействовать с первым сайтом присоединения. Более того, второй сайт присоединения может включать в себя полипептид, пептид, сахар, полинуклеотид, природный или синтетический полимер, вторичный метаболит или соединение (биотин, флуоресцеин, ретинол, дигоксигенин, ионы металла, фенилметилсульфонилфторид), их сочетание или их химически активную группу. На гаптене присутствует, по крайней мере, один второй сайт присоединения. Следовательно, термин «гаптен с, по крайней мере, одним вторым сайтом присоединения» относится к гаптеновой конструкции, содержащей, по крайней мере, гаптен и второй сайт присоединения. Однако, в частности, в случае, когда второй сайт присоединения гаптена не является природным, тогда такие гаптены содержат линкер, который связывает гаптен со вторым сайтом присоединения, или более предпочтительно уже содержит или имеет в своем составе второй сайт присоединения.

Связь: Как используется здесь, термин «связь» относится к связыванию или присоединению, которое может быть ковалентным, например, путем химического присоединения, или нековалентным, например ионные взаимодействия, гидрофобные взаимодействия, водородные связи и тому подобное. Ковалентные связи могут быть, например, сложноэфирной связью, эфирной, фосфоэфирной, амидной, пептидной, имидной связями, связями углерод-сера, углерод-фосфор и тому подобное. Термин «связь» шире и включает в себя термины, такие как «соединение», «конденсирование» и «присоединение».

Коровая частица: Как используется здесь, термин «коровая частица» относится к жесткой структуре с присущей повторяющейся структурой, которая обеспечивает основу для присоединения первого сайта присоединения. Коровая частица, как используется здесь, может быть продуктом синтетического процесса или продуктом биологического процесса.

Белки(ок) оболочки: Как используется здесь, термин «белки(ок) оболочки» относится к белку(ам) бактериофага или РНК-содержащего фага, способного(ым) вводиться в конструкцию оболочки бактериофага или РНК-содержащего фага. Однако если термин относится к специальному генному продукту белка оболочки РНК-содержащего фага, то используется термин «CP». Например, специфический генный продукт белка оболочки РНК-содержащего фага Qβ называется «Qβ CP», тогда как «белки оболочки» бактериофага Qβ составляют «QB CP», а также вспомогательный белок A1. Оболочка бактериофага QR состоит главным образом из QR CP и минорного содержания белка A1. Более того, белок оболочки VLP Qβ содержит главным образом QR CP и минимальное содержание белка A1.

Конъюгат: Как используется здесь, существительное «конъюгат» относится к продукту конъюгации одной или нескольких (a) коровой частицы, такой как VLP, и одной или нескольких (b) органической молекулы, гаптена, антигена или детерминанта антигена, как описано здесь, где элементы (a) и (b) связаны между собой.

Композиция: Как используется здесь, термин «композиция» относится к продукту смешения или объединения различных элементов или ингредиентов.

Заболевание, расстройство, состояние: Как используется здесь, термин «заболевание» или «расстройство» относится к любому патологическому состоянию субъекта, включая опухоли, рак, аллергии, наркоманию, аутоиммунные процессы, интоксикацию или ухудшение оптимальной умственной функции или функции организма. Как используется здесь, «состояния» включают в себя не только заболевания и расстройства, но также относятся к физиологическим состояниям. Например, фертильность является физиологическим состоянием, а не заболеванием или расстройством. Композиции по данному изобретению, подходящие для предотвращения беременности путем снижения фертильности, могли бы таким образом быть описаны как композиции для терапии состояния (фертильности), а не терапии расстройства или заболевания. Другие состояния известны специалисту в данной области.

Эффективное количество: Как используется здесь, термин «эффективное количество» относится к количеству, необходимому или достаточному для осуществления желаемого биологического действия. Эффективное количество композиции может быть количеством, при котором достигается этот выбранный результат, и такое количество может быть определено обычными способами специалистом в данной области. Например, эффективное количество для лечения дефицита иммунной системы будет таким количеством, которое необходимо для активации иммунной системы, приводящей к развитию антиген специфического иммунного ответа при воздействии антигена. Синонимом этого термина является «достаточное количество».

Эффективное количество при любом конкретном применении может изменяться в зависимости от таких факторов, как заболевание или состояние, на которое направлено лечение, конкретная вводимая композиция, размер субъекта и/или тяжесть заболевания или состояния. Специалист в данной области может эмпирически определить эффективное количество конкретной композиции по настоящему изобретению без необходимости проведения эксперимента.

Эпитоп: Как используется здесь, термин «эпитоп» относится к основному элементу или наименьшей единице, которая распознается отдельным антителом или рецептором T-клетки, и, таким образом, связывается с определенным доменом, областью или молекулярной структурой указанного антитела или рецептора T-клетки. Антиген может содержать большое количество эпитопов в гаптене, обычно может содержать несколько эпитопов.

Слияние: Как используется здесь, термин «слияние» относится к сочетанию аминокислотных последовательностей различного происхождения в одной полипептидной цепи путем объединения в рамке считывания их кодирующих нуклеотидных последовательностей. Ясно, что термин «слияние» включает в себя внутреннее слияние, то есть включение последовательностей различной природы в полипептидную цепь, кроме слияния с одним из ее концов.

Гаптен: Как используется здесь, термин «гаптен» относится к низкомолекулярному органическому соединению, которое не способно самостоятельно вызывать иммунный ответ, но вызывает иммунный ответ, когда присоединено к молекуле носителя. Характерные гаптены, применяемые в конъюгатах, композициях и способах по данному изобретению, включают в себя, но не ограничиваются этими специфическими гаптенами, лекарственные препараты, гормоны и токсины, но ими не ограничиваются.

Гетерологическая последовательность: Как используется здесь, термин «гетерологическая последовательность» относится ко второй последовательности нуклеиновой кислоты или белка, которую обычно обнаруживают вместе с указанной нуклеиновой кислотой или белком и которую обычно искусственно добавляют к последовательности для придания конкретных свойств. В одном из примеров, гетерологические аминокислоты могут быть добавлены к рекомбинантным белкам оболочки для очистки белка или для того, чтобы служить первым сайтом присоединения.

Выделение: Как используется здесь, если термин «выделение» относится к молекуле, то термин означает, что молекулу выделяют из ее природного окружения. Например, полинуклеотид или полипептид, который обычно находится в живом организме животного, является не «выделенным», а тот же полинуклеотид или полипептид отделенный от веществ, окружающих его в его природном состоянии, является «выделенным». Кроме того, рекомбинантные молекулы ДНК, находящиеся в векторе, для целей настоящего изобретения рассматриваются как выделенные. Выделенные молекулы РНК включают в себя продукты in vivo или in vitro репликации РНК их ДНК и РНК молекул. Выделенные молекулы нуклеиновой кислоты, кроме того, включают в себя молекулы, получаемые искусственно. Кроме того, векторные молекулы, содержащиеся в рекомбинантных клетках-хозяевах, также являются выделенными. Таким образом, не все «выделенные» молекулы необходимы быть «очищенными».

Иммунный ответ: Как используется здесь, термин «иммунный ответ» относится к гуморальному иммунному ответу и/или клеточному иммунному ответу, что приводит к активации или пролиферации B- и/или T-лимфоцитов и/или предоставляющих антиген клеток. В некоторых случаях, тем не менее, иммунные ответы могут быть менее интенсивными и могут быть определены только при использовании, по крайней мере, одного вещества в соответствии с данным изобретением. «Иммунногенный» относится к агенту, используемому для стимуляции иммунной системы живого организма, с тем, чтобы одна или несколько функций иммунной системы увеличивались и были направлены на иммуногенный агент. «Иммуногенный полипептид» представляет собой полипептид, который либо сам по себе, либо присоединенный к носителю вызывает клеточный и/или гуморальный иммунный ответ в присутствии или отсутствие адъюванта. Предпочтительно предоставляющая антиген клетка может быть активированной.

Вещество, которое «усиливает» иммунный ответ, относится к веществу, при котором наблюдаемый иммунный ответ становится больше или интенсивнее, или отклоняется в любую сторону при добавлении вещества по сравнению с тем же иммунным ответом без добавления этого вещества. Например, литическая активность цитотоксических T-клеток может быть измерена, например, с помощью анализа высвобождения 51Cr, в образцах, полученных при использовании и без использования этого вещества во время иммунизации. Количество вещества, при котором литическая активность CTL увеличивается по сравнению с литической активностью CTL без этого вещества, называется количеством, достаточным для усиления иммунного ответа животных на антиген. В предпочтительном варианте осуществления, иммунный ответ увеличивается, по крайней мере, в приблизительно 2 раза, более предпочтительно в приблизительно 3 раза или больше. Количество или тип секретируемых цитокинов также может изменяться. Альтернативно, количество индуцируемых антител или их подклассов может изменяться.

Иммунизация: Как используется здесь, термины «иммунизация» или сходные термины относятся к передаче способности вызывать стабильный иммунный ответ (включая антитела и/или клеточный иммунитет, такой как эффекторные CTL) против заданного антигена или эпитопа. Эти термины подразумевают создание абсолютного иммунитета и относятся к вызываемым иммунным ответам, которые значительно больше базисной линии. Например, млекопитающее может рассматриваться как иммунизированное в отношении заданного антигена, если клеточный и/или гуморальный иммунный ответ на заданный антиген возникает при использовании способов по данному изобретению.

Иммунотерапевтический: Как используется здесь, термин «иммунотерапевтический» относится к композиции для лечения заболеваний, расстройств или состояний. Более конкретно, используемый термин относится к способу лечения, когда при вакцинации или введении иммунных молекул возникает полезный иммунный ответ.

Иммунологически эффективное количество: Как используется здесь, термин «иммунологически эффективное количество» относится к количеству композиции, достаточному для индукции иммунного ответа у субъекта при введении его этому субъекту. Применительно к активной иммунизации, термин является синонимом «иммуногенно эффективного количества». Количество композиции, необходимое для того, чтобы быть иммунологически эффективным, изменяется в зависимости от большого числа факторов, входящих в композицию, присутствия в композиции других компонентов (например, адъювантов), антигена, пути иммунизации, субъекта, предшествующего иммунного или физиологического состояния и так далее.

Субъект: Как используется здесь, термин «субъект» относится к многоклеточным организмам и включает в себя как растения, так и животных. Предпочтительными многоклеточными организмами являются животные, более предпочтительно позвоночные, еще более предпочтительно млекопитающие и наиболее предпочтительно человек.

Низкий или необнаруживаемый: Как используется здесь, фраза «низкий или необнаруживаемый», при использовании в отношении уровня генной экспрессии, относится к уровню экспрессии, которая либо значительно ниже, чем уровень, наблюдаемый при максимальной генной индукции (например, по крайней мере, в пять раз) или с трудом определяемый с помощью способов, используемых в нижеследующем разделе примеров.

Лектин: Как используется здесь, белки, получаемые предпочтительно из семян бобовых растений, а также из других растений и животных, которые имеют сайты связывания для специфических моно- или олигосахаридов. Примеры включают в себя конканавалин A и агглютинин зародышей пшеницы, которые широко применяются в качестве аналитических и препаративных агентов при изучении гликопротеина.

Естественное происхождение: Как используется здесь, термин «естественное происхождение» обозначает, что все или часть соединения не являются искусственными и существуют или продуцируются в природе.

Неприродный: Как используется здесь, термин, как правило, обозначает неприродное происхождение, более конкретно, термин обозначает сделанный руками человека.

Неприродного происхождения: Как используется здесь, термин «неприродного происхождения», как правило, обозначает синтетический или неприродный; более конкретно, термин обозначает сделанный руками человека.

Неприродный молекулярный каркас: Как используется здесь, фраза «неприродный молекулярный каркас» относится к любому продукту, сделанному руками человека, который служит для обеспечения жесткости и предоставляет повторяющуюся матрицу первому сайту присоединения. Идеально, но необязательно, чтобы эти первые сайты присоединения находились в геометрическом порядке. Неприродный молекулярный каркас, частично или полностью, может быть органическим или неорганическим и может быть синтезирован химически или с помощью биологических процессов. Неприродный молекулярный каркас включает в себя: (a) коровую частицу либо природного, либо неприродного происхождения; и (b) по крайней мере, один первый сайт присоединения, который соединен с коровой частицей с помощью, по крайней мере, одной ковалентной связи. В конкретном варианте осуществления, неприродный молекулярный каркас может быть вирусом, вирусоподобной частицей, бактериальной фимбрией, частицами вирусной оболочки, фагом, их рекомбинантной формой или синтетической частицей.

Никотиновый гаптен: Термин «никотиновый гаптен», как используется в настоящем изобретении, относится к никотину либо к его энантиомерно чистой (S)- или (R)-форме или к их смеси, которые могут быть преобразованы таким образом, чтобы он содержал, по крайней мере, один второй сайт присоединения, который затем способен соединяться с первым сайтом присоединения носителя либо непосредственно, либо через перекрестную связь. Предпочтительно никотиновый гаптен преобразуют таким способом, чтобы он содержал только один второй сайт присоединения. Это преобразование, кроме того, усиливает упорядоченность и повторяемость конъюгата никотиновый гаптен-носитель и обеспечивает направленное и контролируемое присоединение никотинового гаптена к носителю.

Упорядоченная и повторяющаяся антигенная матрица или матрица детерминанта антигена: Как используется здесь, термин «упорядоченная и повторяющаяся антигенная матрица или матрица детерминанта антигена», как правило, относится к повторяющейся структуре антигена или детерминанты антигена, характеризующейся однообразным пространственным расположением антигенов или детерминант антигена относительно неприродного молекулярного каркаса. В одном из вариантов осуществления данного изобретения, повторяющаяся структура может быть геометрической структурой. Типичными и предпочтительными примерами подходящим образом упорядоченных и повторяющихся матриц антигена или детерминанта антигена являются такие матрицы, которые обладают точно повторяющимся паракристаллическим порядком антигенов или детерминант антигенов, предпочтительно с расстоянием 0,5-30 нанометров, более предпочтительно с расстоянием 5-15 нанометров.

Пассивная иммунизация: как используется здесь, термин «пассивная иммунизация» относится к передаче иммунитета путем введения, любым путем, экзогенно продуцируемых иммунных молекул (например, антител) или клеток (например, T-клеток) в организм животного. Пассивная иммунизация отличается от «активной» иммунизации, при которой иммунитет вырабатывается путем введения иммуногена, вакцины, антигена или конъюгата гаптен-носитель в субъект для того, чтобы вызвать иммунный ответ.

Фимбрии: Как используется здесь, термин «фимбрии» (единственное число «фимбрия») относится к экстрацеллюлярным структурам бактериальных клеток, состоящих из белковых мономеров (например, мономеры фимбрии), которые организованы в упорядоченные и повторяющиеся структуры. Кроме того, фимбрии представляют собой структуры, которые вовлечены в процессы, такие как присоединение бактериальных клеток к рецепторам на поверхности клеток-хозяинов, внутриклеточный генетический обмен и распознование «клетка-клетка». Примеры фимбрий включают в себя фимбрии типа-1, P-фимбрии, пили F1C, S-фимбрии и 9S7P-фимбрии. Дополнительные примеры фимбрий перечислены здесь ниже.

Фимбрия-подобные структуры: Как используется здесь, фраза «фимбрияподобные структуры» относятся к структурам, имеющим свойства, сходные со свойствами фимбрий, и состоят из мономеров белков. Одним из примеров «фимбрияподобной структуры» является структура, образуемая бактериальной клеткой, которая экспрессирует модифицированные белки пилина, которые не образуют упорядоченных и повторяющихся матриц, что по существу сходно с природными фимбриями.

Полипептид: Как используется здесь, термин «полипептид» относится к молекуле, состоящей из мономеров (аминокислот), линейно связанных амидными связями (также называемыми пептидными связями). Это обозначает молекулярную цепь аминокислот и не относится к конкретной длине продукта. Таким образом, пептиды, дипептиды, трипептиды, олигопептиды и белки подходят под определение полипептид. Этот термин также относится к постэкспрессионным модификациям полипептида, например гликозилированию, ацетилированию, фосфорилированию и тому подобное. Рекомбинант или полипептидное производное не обязательно транслируется из созданной последовательности нуклеиновой кислоты. Оно также может быть получено любым способом, включая химический синтез.

Белок: Как используется здесь, термин белок относится к полипептиду обычно размера около 5 или более, 10 или более, 20 или более, 25 или более, 50 или более, 75 или более, 100 или более, 200 или более, 500 или более, 1000 или более, 2000 или более аминокислот. Белки обычно имеют определенную трехмерную структуру, хотя это не обязательно, и зачастую относятся к складчатой структуре, в противоположность пептидам и полипептидам, которые часто не обладают определенной трехмерной структурой, но могут принимать большое количество различных форм, и относятся к нескладчатым структурам. Пептиды могут, однако, принимать трехмерные структуры. Определенные трехмерные структуры белков особенно важны для ассоциации коровой частицы и антигена, опосредованной вторым сайтом присоединения, и, в частности, с помощью химических перекрестных связей между первым и вторым сайтом присоединения, используя химические перекрестные связи. Аминокислотный линкер также тесно связан со структурными свойствами белков в некоторых аспектах данного изобретения.

Очищенная: Как используется здесь, если термин «очищенная» используется в отношении молекулы, то он обозначает, что концентрация очищенной молекулы увеличилась по сравнению с молекулами, связанными со своим природным окружением или окружением, в котором она была получена, обнаружена или синтезирована. Природные молекулы включают в себя белки, нуклеиновые кислоты, липиды и сахара, но обычно не включают в себя воду, буферы и реагенты, добавляемые для поддержания чистоты или облегчающие очистку очищаемых молекул. Например, даже если мРНК разводят водным раствором растворителя во время олиго dT колоночной хроматографии, молекулы мРНК очищаются при этой хроматографии, если природные нуклеиновые кислоты и другие биологические молекулы не связываются с этой колонкой, и отделяются от данных молекул мРНК. В соответствии с этим определением степень чистоты вещества может быть 5% или более, 10% или более, 20% или более, 30% или более, 40% или более, 50% или более, 60% или более, 70% или более, 80% или более, 90% или более, 95% или более, 98% или более, 99% или более, или 100%, рассматривая относительно его загрязняющих примесей.

Рецептор: Как используется здесь, термин «рецептор» относится к белкам или гликопротеинам или их фрагментам, способным взаимодействовать с другой молекулой, называемой лигандом. Лиганд может принадлежать любому классу биохимических или химических соединений. Рецептор необязательно должен быть мембрано-связанным белком. Растворимый белок, такой как, например, мальтоза связывающий белок или ретинол связывающий белок, также является рецептором.

Остаток: Как используется здесь, термин «остаток» обозначает специфическую аминокислоту в полипептидной цепи или боковой цепи.

Рекомбинантная клетка-хозяин: Как используется здесь, термин «рекомбинантная клетка-хозяин» относится к клетке-хозяину, в которую вводят одну или несколько молекул нуклеиновых кислот по данному изобретению.

Рекомбинантный вирус: Как используется здесь, фраза «рекомбинантный вирус» относится к вирусу, который генетически модифицирован человеком. Фраза относится к любому известному в данной области вирусу. Более конкретно, фраза относится к альфавирусу, генетически модифицированному человеком, и, наиболее конкретно, фраза относится к вирусу Синбис, генетически модифицированному человеком.

РНК-содержащий фаг, РНК-содержащий бактериофаг: Как используется здесь, термин «РНК-содержащий бактериофаг» или его аббревиатура «РНК-содержащий фаг» относится к РНК-содержащим вирусам, инфицирующим бактерии, предпочтительно к вирусам, содержащим однонитевую положительную копию РНК, инфицирующим бактерии.

Аутоантиген: Как используется здесь, термин «аутоантиген» относится к белкам, кодируемым ДНК хозяина, и продуктам, производимыми белками, или к РНК, кодируемой ДНК хозяина, определяемым как ауто. Кроме того, белки, которые образуются при сочетании двух или нескольких аутомолекул или которые представляют собой фракции аутомолекул, и белки, которые являются высокогомологичными по отношению к двум аутомолекулам, как определено выше (>95%, предпочтительно >97%, более предпочтительно >99%), также могут рассматриваться как ауто.

Вакцины: Как используется здесь, термин «вакцина» относится к лекарственной композиции, которая состоит из композиции по настоящему изобретению и которая находится в форме, которую можно вводить животному. Обычно вакцина содержит традиционный физиологический раствор или забуференный водный раствор, в котором суспендирована или растворена композиция по настоящему изобретению. В этой форме композиция по настоящему изобретению может легко применяться для профилактики, улучшения или другого лечения состояния. При введении хозяину вакцина способна вызывать иммунный ответ, включая, но этим не ограничиваясь, продукцию антител и/или цитокинов и/или активацию цитотоксических Т-клеток, антигенпрезентирующих клеток, Т-хелперных клеток, дендритных клеток и/или других клеточных ответов. Необязательно, вакцина по настоящему изобретению, кроме того, содержит адъювант, который может присутствовать либо в незначительных, либо в значительных пропорциях относительно соединения по настоящему изобретению.

Вектор: Как используется здесь, термин «вектор» относится к агенту (например, плазмиде или вирусу), применяемому для переноса генетического материала клетке-хозяину. Вектор может содержать либо ДНК, либо РНК.

Вирусоподобная частица: Как используется здесь, термин «вирусоподобная частица» относится к структуре, сходной с вирусной частицей. Более того, вирусоподобная частица в соответствии с данным изобретением является нерепликативной и неинфекционной из-за отсутствия всего или части вирусного генома, в частности репликативных и инфекционных компонентов вирусного генома. Вирусоподобная частица в соответствии с данным изобретением может содержать нуклеиновую кислоту, отличающуюся от генома вируса.

Вирусоподобная частица бактериофага: Как используется здесь, термин «вирусоподобная частица бактериофага» относится к вирусоподобной частице, сходной по структуре с бактериофагом, являющейся нерепликативной и неинфекционной, и у которой отсутствует, по крайней мере, ген или гены, кодирующие репликативный механизм бактериофага, и, обычно, у которой также отсутствует ген или гены, кодирующие белок или белки, ответственные за прикрепление к вирусу или проникновение в клетку-хозяин. У вирусоподобной частицы в соответствии с данным изобретение отсутствует весь или часть вирусного генома, в частности репликативные и инфекционные компоненты вирусного генома. Вирусоподобная частица в соответствии с данным изобретением может содержать нуклеиновую кислоту, отличающуюся от генома вируса. В типичном и предпочтительном варианте осуществления вирусоподобная частица в соответствии с настоящим изобретением представляет собой вирусную оболочку, такую как вирусный капсид соответствующего вируса, бактериофага или РНК-содержащего фага. Термины «вирусный капсид» или «оболочка», в данном случае взаимозаменяющие друг друга, относятся к макромолекулярному комплексу, состоящему из белковых субъединиц вируса. Типично и предпочтительно, белковые субъединицы вируса, которые составляют вирусную оболочку и оболочку, соответственно, имеют структуру с присущей повторяющейся структурой, где указанная структура обычно является сферической или трубчатой. Например, оболочки РНК-содержащих фагов или HBcAg имеют сферическую форму икосаэдрической симметрии. Термин «структура, подобная оболочке», как используется здесь, относится к макромолекулярному комплексу, состоящему из белковых субъединиц вируса, сходному с морфологией оболочки, значение которой дано выше, но отклоняющему от обычного симметрического комплекса, но при этом поддерживая достаточную степень упорядоченности и повторяемости.

Вирусоподобная частица бактериофага: Как используется здесь, термин «вирусоподобная частица бактериофага» относится к вирусоподобной частице, сходной по структуре с бактериофагом, являющейся нерепликативной и неинфекционной, и у которой отсутствует, по крайней мере, ген или гены, кодирующие репликативный механизм бактериофага, и у которой обычно также отсутствует ген или гены, кодирующие белок или белки, ответственные за прикрепление к вирусу или проникновение в клетку-хозяин. Это определение, тем не менее, может также относиться к вирусоподобным частицам бактериофагов, у которых присутствует вышеуказанный ген или гены, но они являются интактными, и что, следовательно, также приводит к образованию нерепликативных и неинфекционных вирусоподобных частиц бактериофага.

Белковая оболочка VLP РНК-содержащего фага: Структура оболочки, полученная из аутокомплекса из 180 белковых субъединиц оболочки РНК-содержащего фага и необязательно содержащая РНК хозяина, относится к «белковой оболочке VLP РНК-содержащего фага». Конкретным примером является белковая оболочка VLP Qβ. В этом конкретном случае белковая оболочка VLP Qβ может быть либо собрана только из белковых субъединиц оболочки Qβ (полученных экспрессией гена белка оболочки Qβ, содержащего, например, TAA стоп кодон, препятствующий любой экспрессии длинного белка A1 посредством супрессии, смотри Kozlovska, T.M., et al., Intervirology 39: 9-15 (1996)), либо дополнительно содержать белковые субъединицы A1 в комплексе оболочки.

Вирусная частица: Термин «вирусная частица», как используется здесь, относится к морфологической форме вируса. Некоторые вирусные типы содержат геном, окруженный белковой оболочкой; другие формы имеют дополнительные структуры (например, оболочки, хвосты и тому подобное).

Если не указано иного, то подразумевается использование, по крайней мере, «одного» или «одного или нескольких».

Как используется здесь, если он относится к любому числовому значению, термин «около» обозначает значение ±10% указанного значения (например, «около 50°C» включает в себя диапазон температур от 45°C до 55°C, включительно; аналогично, «около 100 мМ» включает в себя диапазон концентраций от 90 мМ до 110 мМ включительно).

Подробное описание

В одном из вариантов воплощения данное изобретение относится к конъюгатам одного или нескольких гаптенов с носителем в упорядоченном и повторяющемся конъюгате гаптен-носитель и к способам получения таких конъюгатов. Данное изобретение также относится к композициям, содержащим, по крайней мере, один такой конъюгат по данному изобретению и, по крайней мере, другой подходящий компонент, по крайней мере, один наполнитель или носитель и, особенно, по крайней мере, один фармацевтически приемлемый наполнитель или носитель. Гаптены, подходящие для применения в конъюгатах и композициях по данному изобретению, включают в себя, но ими не ограничиваются, гормоны, токсины и лекарственные средства, особенно, средства, вызывающие зависимость, такие как никотин. Конъюгаты и композиции по данному изобретению могут использоваться для индукции иммунных ответов против гаптенов. Такой иммунный ответ может использоваться для продукции антител, которые могут применяться для терапевтических, профилактических и диагностических целей. Иммунный ответ может применяться для профилактики или лечения наркоманий и заболеваний, связанных с наркоманией.

Конъюгаты по настоящему изобретению включат в себя высокоупорядоченные и повторяющиеся гаптеновые матрицы. Конъюгированные матрицы в соответствии с этим аспектом данного изобретения включают в себя (a) коровую частицу, содержащую первый сайт присоединения, и (b) гаптен, содержащий второй сайт присоединения, где элементы (a) и (b) связаны посредством первого и второго сайтов присоединения с получением указанных высокоупорядоченных и повторяющихся гаптеновые матрицы.

Коровые частицы, подходящие для применения в конъюгатах и композициях по данному изобретению, могут быть природными или неприродными. Природные коровые частицы по настоящему изобретению включают в себя вирусные частицы, вирусоподобные частицы и фимбрии. Белки этих природных коровых частиц могут быть природными или рекомбинантными. Первые сайты присоединения коровой частицы могут быть природными или могут быть введены химическими или рекомбинантными способами. Гаптенами по настоящему изобретению являются такие гаптены, которые могут индуцировать иммунные ответы против различных молекул, включая, но ими не ограничиваясь, токсины, гормоны и лекарственные средства, особенно средства, вызывающие зависимость или пристрастие. Второй сайт присоединения гаптена может быть природным или может вводиться. Взаимодействие между первым и вторым сайтами может быть непосредственное или может включать в себя, по крайней мере, одну другую молекулу, например линкер. К линкерам относятся молекулы, образующие перекрестные сшивки.

Конъюгаты и композиции по данному изобретению неожиданно эффективно индуцируют иммунные ответы, особенно антитела, против гаптенов. Таким образом, они могут использоваться в композициях, применимых для иммунизации животных для лечения и профилактики заболеваний, расстройств или состояний, связанных с различными лекарственными средствами, гормонами или токсинами. Антитела, продуцируемые при иммунизации конъюгатами и композициями по данному изобретению, также могут использоваться для терапевтических и профилактических целей.

В других вариантах осуществления, данное изобретение относится к способам лечения и профилактики заболевания с применением конъюгатов и композиций по данному изобретению. В еще одном воплощении, данное изобретение относится к наборам, применимым для диагностики и скрининга.

Композиции упорядоченных и повторяющихся матриц антигена или детерминанта антигена и способы их получения

Настоящее изобретение относится к конъюгатам и композициям конъюгатов, содержащих упорядоченные и повторяющиеся гаптеновые матрицы. Более того, данное изобретение дает возможность специалисту конструировать упорядоченные и повторяющиеся гаптеновые матрицы для различных целей и предпочтительно для индукции иммунного ответа против органических молекул.

Конъюгаты по данному изобретению, по существу, включают в себя или, альтернативно, состоят из двух элементов: (1) неприродного молекулярного каркаса; и (2) гаптена, по крайней мере, с одним вторым сайтом присоединения, способным ассоциировать посредством, по крайней мере, одной связи с указанным первым сайтом присоединения.

Неприродный молекулярный каркас содержит или, альтернативно, состоит из: (a) коровой частицы, выбранной из группы, включающей (1) коровую частицу неприродного происхождения и (2) коровую частицу природного происхождения; и (b) по крайней мере, один первый сайт присоединения, связанный с указанной коровой частицей, по крайней мере, одной ковалентной связью. Коровые частицы, которые могут использоваться в конъюгатах, композициях и способах по данному изобретению включают в себя неорганические молекулы, вирусные частицы, вирусоподобные частицы и бактериальные фимбрии. Гаптены, которые могут использоваться в конъюгатах, композициях и способах по данному изобретению, имеют, по крайней мере, один второй сайт присоединения, который выбран из группы, состоящей из (a) сайта присоединения неприродного относительно указанного гаптена; и (b) сайта присоединения природного относительно указанного антигена или детерминанта антигена.

Данное изобретение относится к упорядоченной и повторяющейся гаптеновой матрице посредством ассоциации второго сайта присоединения с первым сайтом присоединения с помощью, по крайней мере, одной связи. Таким образом, гаптен и неприродный молекулярный каркас соединены вместе посредством такой ассоциации первого и второго сайта присоединения с образованием упорядоченной и повторяющейся матрицы антигена.

Специалист может, в частности, сконструировать гаптен и второй сайт присоединения таким образом, чтобы расположение всех гаптенов, присоединенных к неприродному молекулярному каркасу или, в определенных вариантах осуществления, к коровым частицам, могло бы быть одинаковым. Например, специалист может поместить, тем самым, следуя замыслу конструкции, единственный второй сайт присоединения на гаптен так, чтобы все гаптены, которые присоединены к неприродныму молекулярному каркасу, располагались одинаково. Следовательно, данное изобретение относится к подходящим способам размещения любого гаптена на неприродном молекулярном каркасе в определенном порядке и способом, при котором образуется повторяющаяся структура.

Специалисту в данной области понятно, что определенные варианты осуществления данного изобретения включают в себя применение технологий рекомбинантных нуклеиновых кислот, таких как клонирование, полимеразная цепная реакция, очистка ДНК и РНК, экспрессия рекомбинантных белков в прокариотических и эукариотических клетках и тому подобное. Такие способы хорошо известны специалистам в данной области и могут быть без труда найдены в опубликованных руководствах по лабораторным методам (например, Sambrook, J. et al., eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2-е издание, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel, F. et al., eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc. (1997)). Основные лабораторные способы для работы с культурами тканей и клеточными линиями (Cells, J., ed., CELL BIOLOGY, Academic Press, 2-е издание, (1998)) и технологии на основе антител (Harlow, E. и Lane, D., «Antibodies: A Laboratory Manual», Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1988); Deutscher, M.P., «Guide to Protein Purification», Meth. Enzymol. 128, Academic Press San Diego (1990); Scopes, R.K., «Protein Purification Principles и Practice», 3-е издание, Springer-Verlag, New York (1994)) также достаточно описаны в литературе, где каждая статья приведена здесь в качестве ссылки.

Более того, технологии присоединения органических молекул к аминокислотам и способы получения производных гаптенов, содержащих соответствующие вторые сайты присоединения, такие как необходимые для осуществления данного изобретения, хорошо известны специалисту в данной области. Такие способы могут быть обнаружены в книгах и публикациях по химии, примеры которых указанны ниже и приведены в качестве ссылки; патент США № 5876727; WO 99/61054; Isomura, S. et al. J. Org. Chem. 66:4115-4121 (2001); Matsushita, H. et al. Biochem. Biophys. Res. Comm. 57:1006-1010. (1974); Langone, J.L. и Van Vunakis, H., Methods Enzymol. 84:628-640 (1982); Wong, Chemistry of Protein Conjugation and Cross-Linking. CRC Press, Inc., Boca Raton, Fla (1991).

Коровые частицы и неприродные молекулярные каркасы

В одном из вариантов воплощения, настоящее изобретение относится к способам получения упорядоченных и повторяющихся матриц гаптенов. С помощью данного изобретения такое получение происходит путем ассоциации коровой частицы, к которой присоединяется один или несколько гаптенов, посредством первого и второго сайтов присоединения.

Таким образом, один элемент в определенных конъюгатах и композициях по данному изобретению является неприродным молекулярным каркасом, содержащим или, альтернативно, состоящим из коровой частицы и первого сайта присоединения. Более конкретно, неприродный молекулярный каркас содержит или, альтернативно, состоит из (a) коровой частицы природного или неприродного происхождения и (b), по крайней мере, одного первого сайта присоединения, связанного с коровой частицей с помощью, по крайней мере, одной ковалентной связи.

Коровые частицы. В одном из вариантов осуществления настоящего изобретения коровая частица представляет собой синтетический полимер, липидную мицеллу или метал. Такие коровые частицы, хорошо известные в данной области, обеспечивают основу для построения неприродного молекулярного каркаса по данному изобретению. В качестве примера, коровые частицы в виде синтетического полимера или металла описаны в патенте США № 5770380 и патенте США № 5334394, которые приведены здесь в качестве ссылки в полном объеме. Подходящие металлы включают в себя, но ими не ограничиваются, хром, рубидий, железо, цинк, селен, никель, золото, серебро, платину. Подходящие керамические материалы включают в себя, но ими не ограничиваются, диоксид кремния, диоксид титана, оксид алюминия, оксид рутения и оксид олова. Коровые частицы в этом варианте осуществления могут быть сделаны из органических материалов, включая, но ими не ограничиваясь, углерод и подходящие полимеры, включая полистирол, нейлон и нитроцеллюлозу. Для нанокристаллических частиц могут использоваться частицы, сделанные из оксида олова, диоксида титана или углерода (алмаза). Липидные мицеллы, которые могут использоваться в настоящем изобретении, получают любыми способами, хорошо известными в данной области, Baiselle and Millar (Biophys. Chem. 4:355-361 (1975)) or Corti et al. (Chem. Phys. Lipids 55:197-214 (1981)) or Lopez et al. (FEBS Lett. 426:314-318 (1998)) or Topchieva and Karezin (J. Colloid Interface Sci. 213:29-35 (1999)) or Morein et al., (Nature 308:457- 460 (1984)), которые приведены здесь в качестве ссылки в полном объеме.

В одном из вариантов осуществления данного изобретения коровую частицу получают с помощью биологического процесса, и она может быть природной или неприродной. Например, вирусы и бактериальные фимбрии или структуры, подобные фимбриям, получают из белков, которые организованы в упорядоченные и повторяющиеся структуры. Следовательно, настоящее изобретение включает в себя конъюгаты, композиции и способы, содержащие эффективные коровые частицы, которые включают в себя, но ими не ограничиваются, вирусную, вирусоподобную частицу, бактериальную фимбрию, фаг, частицу вирусной оболочки или их фрагменты. В определенных вариантах осуществления белки могут быть рекомбинантными.

В определенных вариантах осуществления коровая частица неприродного молекулярного каркаса включает в себя вирус, бактериальную фимбрию, структуру, полученную из бактериального пилина, бактериофаг, вирусоподобную частицу, частицу вирусной оболочки или их рекомбинантные формы. Любые вирусы, известные в данной области, обладающие упорядоченной и повторяющейся структурой белковой оболочки и/или корового белка, могут быть выбраны для применения как в способах, так в и конъюгатах и композициях по данному изобретению в качестве неприродного молекулярного каркаса. Примеры подходящих вирусов включают в себя, но ими не ограничиваются, вирус Синдбиса и другие альфавирусы, рабдовирусы (например, вирус везикулярного стоматита), пикорнавирусы (например, риновирус человека, вирус Aichi), тогавирусы (например, вирус краснухи), ортомиксовирусы (например, вирус Тогото, вирус Batken, вирус чумы птиц), полиомавирусы (например, полиомавирус BK, полиомавирус JC, полиомавирус птиц BFDV), парвовирусы, ротавирусы, бактериофаг Qβ, бактериофаг R17, бактериофаг M11, бактериофаг MX1, бактериофаг NL95, бактериофаг fr, бактериофаг GA, бактериофаг SP, бактериофаг MS2, бактериофаг f2, бактериофаг PP7, бактериофаг AP205, вирус Norwalk, вирус болезни ступней и рта, ретровирус, вирус гепетита B, вирус табачной мозаики, вирус Flock House и папиломавирус человека (например, смотри таблицу1 в Bachman, M.F. and Zinkernagel, R.M., Immunol. Today 77:553-558 (1996)). В более конкретных типичных вариантах осуществления настоящего изобретения коровая частица может содержать или, альтернативно, состоять из рекомбинантных белков ротавируса, рекомбинантных белков Norwalk, рекомбинантных белков альфавируса, рекомбинантных белков, которые образуют бактериальные фимбрии или структуры, подобные фимбриям, рекомбинантных белков вируса ящура, рекомбинантных белков ретровируса, рекомбинантных белков вируса гепатита B (например,HBcAg), рекомбинантных белков вируса табачной мозаики, рекомбинантных белков вируса Flock House и рекомбинантных белков папилломавируса человека.

Коровая частица, которая может использоваться в конъюгатах, композициях и способах по данному изобретению, может, кроме того, содержать или, альтернативно, состоять из одного или нескольких фрагментов таких белков, а также из вариантов этих белков, которые сохраняют способность связываться друг с другом с образованием упорядоченных и повторяющихся матриц антигена или детерминанта антигена. Например, как описано в WO 02/056905, коровые частицы могут быть получены из разнообразных форм HBcAg человека, которые отличаются по идентичности и подобию аминокислотной последовательности от частицы дикого типа и по длине последовательности. Например, аминокислотная последовательность HBcAg вирусов гепатита B, которые инфицируют белых гусей и уток, значительно отличаются от вирусов HBcAg, инфицирующих млекопитающих, что делает затруднительным сравнительный анализ первичной структуры белка. Однако оба вируса остаются способными образовывать коровые структуры, подходящие для образования упорядоченных повторяющихся гаптеновых матриц. Аналогично, HBcAg может оставаться способным образовать мультимерные частицы, что типично для вируса, после удаления N-концевых лидерных последовательностей, а также после делеций, замен или добавлений в последовательность. Способы, которые могут быть использованы для того, чтобы определить, образуют ли белки такие структуры, включают в себя гель-фильтрацию, электрофорез на агарозном геле, центрифугирование в градиенте сахарозы и электронную микроскопию (например, Koschel, M. et al., J. Virol 73: 2153-2160 (1999)).

Первые сайты присоединения. Природная или неприродная коровая частица, используемая в конъюгатах, композициях и способах по настоящему изобретению, обычно обладает компонентом, содержащим первый сайт присоединения, который присоединен к природной или неприродной коровой частице с помощью, по крайней мере, одной ковалентной связи. Элемент, содержащий первый сайт присоединения, связывается с коровой частицей неслучайным образом, что обуславливает сайт нуклеации для создания упорядоченной и повторяющейся антигенной матрицы. Идеально, но не необязательно, когда этот элемент ассоциирует с коровой частицей в геометрическом порядке. Первый сайт присоединения может быть природной частью коровой частицы, например экспонированный на поверхности аминокислотный остаток, подходящий для взаимодействия со вторым сайтом присоединения. Например, лизин и цистеин могут образовывать непептидные связи с посредством реакционно-способных групп на аминокислоте. Альтернативно, элемент, содержащий первый сайт присоединения, может вводиться в коровую частицу посредством химического присоединения или посредством конструирования рекомбинантных молекул. Первый сайт присоединения может быть или может обнаруживаться на любом элементе, включая элемент, присоединенный к коровой частице с помощью, по крайней мере, одной ковалентной связи.

Элементы, содержащие или, альтернативно, состоящие из первого сайта присоединения, могут быть белками, полипептидом, пептидом, аминокислотой (то есть остатком белка, полипептида или пептида), сахаром, полинуклеотидом, природным или синтетическим полимером, вторичным метаболитом или соединением (биотин, флуоресцеин, ретинол, дигоксигенин, ионы металлов, фенилметилсульфонилфторид) или их сочетанием, или их химически реакционно-способной группой. В более конкретном варианте осуществления первый сайт присоединения содержит антиген, антитело или фрагмент антитела, биотин, авидин, стрепавидин, рецептор, лиганд рецептора, лиганд, лиганд-связывающий белок, взаимодействующий полипептид с лейциновыми застежками, аминогруппу, химическую группу, активную в отношении амингруппы; карбоксильную группу, химическую группу, активную в отношении карбоксильной группы, сульфгидрильную группу, химическую группу, активную в отношении сульфгидрильной группы, или их сочетание.

В одном из вариантов осуществления данного изобретения применяется генная инженерия вирусов для создания слияния между упорядоченным и повторяющимся белком вирусной оболочки и элементом, содержащим первый сайт присоединения, который содержит гетерологичный белок, пептид, детерминант антигена или предпочтительно реакционно-способный аминокислотный остаток. Другие генетические манипуляции, известные специалистам в данной области, могут быть включены в конструкцию неприродного молекулярного каркаса; например, может быть желательным ограничить способность к репликации рекомбинантного вируса посредством генетической мутации. Вирусный белок, выбранный для слияния с белком, содержащим первый сайт присоединения, должен иметь упорядоченную и повторяющуюся структуру. Такая упорядоченная и повторяющаяся структура включает в себя паракристаллические структуры с шагом 0,5-30, предпочтительно 5-15 нм, на поверхности вируса. Создание белка слияния такого типа может давать в результате множественные, упорядоченные и повторяющиеся первые сайты присоединения на поверхности вируса. Таким образом, возникающая в результате упорядоченная и повторяющаяся структура первых сайтов присоединения будет отражать нормальную структуру природного белка вируса.

Специалистам в данной области понятно, что первый сайт присоединения может быть любым подходящим белком, полипептидом, сахаром, полинуклеотидом, пептидом (аминокислотой), природным или синтетическим полимером, вторичным метаболитом или их сочетанием, который может служить для специфического присоединения антигена или предпочтительно детерминанта антигена к неприродному молекулярному каркасу. В одном из вариантов воплощения сайт присоединения представляет собой белок или пептид, который может быть выбран из белка или пептида, известного в данной области. Например, первый сайт присоединения может быть лигандом, рецептором, лектином, авидином, стрептавидином, биотином, эпитопом, таким как HA или таг T7, Myc, Max, доменами иммуноглобулинов и любой другой аминокислотной последовательностью, известной в данной области, которая может использоваться в качестве первого сайта присоединения.

Специалистам в данной области понятно, что в другом варианте осуществления данного изобретения первый сайт присоединения может быть образован вторично для создания элемента, несущего первый сайт присоединения (то есть белок или полипептид), применяемого при создании составной конструкции с белком капсулы с сохранением рамки считывания. Например, белок может использоваться для соединения с белком оболочки с аминокислотной последовательностью, которая, как известно, специфическим образом гликозилируется, и сахарная группа, добавляемая таким образом, может затем служить на первом сайте присоединения вирусного каркаса для связывания с лектином, служащим вторым сайтом присоединения антигена. Альтернативно, последовательность может быть биотинилирована in vivo,имолекула биотина может служить первым сайтом присоединения по данному изобретению, или последовательность может подвергаться химической модификации отдельных аминокислотных осадков in vitro, модификация служит первым сайтом присоединения.

В одном из конкретных вариантов осуществления данного изобретения первый сайт присоединения представляет собой JUN-FOS доменбелка с лейциновыми застежками, который соединен с сохранением рамки считывания с белком оболочки (коровым белком) вируса гепатита B (HBcAg). Однако специалистам в данной области будет понятно, что в составной белковой конструкции могут использоваться другие белки вирусной капсулы для помещения первого сайта присоединения в неприродный молекулярный каркас по данному изобретению. Например, в другом варианте осуществления данного изобретения первый сайт присоединения выбран из лизинового или цистеинового остатка, который соединен с HBcAg с сохранением рамки считывания. Однако специалисту в данной области понятно, что в составной белковой конструкции могут использоваться другие белки вирусной капсулы или белки вирусоподобных частиц для помещения первого сайта присоединения в неприродный молекулярный каркас по данному изобретению.

Вирусные частицы. В одном из вариантов осуществления данного изобретения коровая частица представляет собой рекомбинантные альфавирусны и более конкретно рекомбинантные вирусы Синдбис. Некоторым членам семейства альфавирусов, Синдбис (Xiong, C. et al., Science 243:1188-1191 (1989); Schlesinger, S., Trends Biotechnol. 11:18-22 (1993)), вирусу лихорадки Семлики (SFV) (Liljeström, P. & Garoff, H., Bio/Technology 9:1356-1361 (1991)) и другим (Davis, N.L. et al., Virology 171:189-204 (1989)) уделяется значительное внимание для применения их в качестве векторов экспрессии на основе вируса множества различных белков (Lundstrom, K., Curr. Opin. Biotechnol. 8:578-582 (1997); Liljeström, P., Curr. Opin. Biotechnol. 5:495-500 (1994)) и в качестве возможных кандидатов для разработки вакцин. Использование альфавирусов для экспрессии гетерологичных белков и для разработки вакцин было описано (смотри патент США №№ 5766602; 5792462; 5739026; 5789245 и 5814482), описание которых приводится здесь в качестве ссылки в их полном объеме. Конструкция альфавирусного каркаса по данному изобретению может быть получена способами, хорошо известными в области технологий рекомбинантных ДНК, как описано в вышеуказанных статьях, которые приведены здесь в качестве ссылки. Большое количество разнообразных рекомбинантных клеток-хозяев может использоваться для получения коровой частицы на основе вируса для присоединения антигена или детераминанта антигена.

Упакованные последовательности РНК также могут использоваться для инфицирования клеток-хозяев. Эти упакованные последовательности РНК могут вводиться в клетки-хозяева путем их добавления в культурную среду. Например, препарат неинфекционных альфавирусных частиц описан во многих источниках, включая «Sindbis Expression System», Version C (Invitrogen Corporation, Carlsbad CA; Catalog No. K750-1).

Если для получения коровых частиц на основе вируса в качестве рекомбинантных клеток-хозяев используются клетки млекопитающих, то эти клетки обычно растут в тканевой культуре. Способы выращивания клеток в культуре хорошо известны в данной области (смотри, например,Celis, J., ed., CELL BIOLOGY, Academic Press, 2-е издание, (1998); Sambrook, J. et al., eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2-е издание, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel, F. etal., eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc. (1997); Freshney, R., CULTURE OF ANIMAL CELLS, Alan R. Liss, Inc. (1983)).

Данное изобретение также включает в себя коровые частицы на основе вирусов, которые включают или, альтернативно, состоят из вируса, вирусоподобной частицы, фага, капсулы вирусной частицы или их рекомбинантных форм. Специалисту в данной области известно, как получить такие коровые частицы и присоединить к ним первые сайты присоединения. Получение вирусоподобной частицы гепатита B, в частности частиц, собранных или самособранных из HBcAg, и капсида вирусных частиц краснухи, в качестве коровых частиц, описанных в примерах 17-22 WO 00/32227, подробное описание которых приведено здесь в качестве ссылки. В этих вариантах воплощения белок, содержащий домен с лейциновыми застежками JUN, или белок, содержащий домен с лейциновыми застежками FOS, могут использоваться в качестве первого сайта присоединения неприродного молекулярного каркаса по данному изобретению. Специалисту в данной области известны способы конструирования коровых частиц вируса гепатита B, несущих составной пептид с реакционно-способным лизиновым остатком с сохранением рамки считывания, и антигенов, несущих генетически лигированный цистеиновый остаток, в качестве первого и второго сайтов присоединения соответственно.

В другом варианте осуществления коровые частицы, которые используются в композиции по данному изобретению, состоят из белка оболочки (коровый белок) вируса гепатита B (HBcAg), фрагмента HBcAg или другого белка или пептида, который может образовывать вирусоподобную частицу, которая имеет упорядоченные матрицы, модифицированные для либо удаления, либо сокращения числа свободных цистеиновых остатков. Zhou et al. (J. Virol. 66:5393-5398 (1992)) показали, что HBcAg, которые были модифицированы для удаления природных цистеиновых остаток, сохраняют способность ассоциировать и образовывать мультимерные структуры. Таким образом, коровые частицы, подходящие для использования в композиции по данному изобретению, включают в себя частицы, содержащие модифицированные HBcAg или их фрагменты, в которых один или несколько природных цистеиновых остатков были либо удалены, либо замещены другим аминокислотным остатком (например,сериновый остаток). В предпочтительном варианте осуществления, HBcAg имеют аминокислотные последовательности, как показано в SEQ ID NO: 1, или последовательность, которая, по крайней мере, приблизительно на 80%, по крайней мере, приблизительно на 85%, по крайней мере, приблизительно на 90%, по крайней мере, приблизительно на 95%, более предпочтительно, по крайней мере, приблизительно на 99% или 100%, идентична последовательности SEQ ID NO: 1. В одном из вариантов осуществления данного изобретения, модифицированный HbcAg, содержащий аминокислотную последовательность, показанную на SEQ ID NO:1, или ее субфрагмент, может использоваться для получения неприродных молекулярных каркасов. В частности, модифицированные HBcAg, которые подходят для использования в осуществлении данного изобретения, включают в себя белки, в которых один или несколько цистеиновых остатков в положениях, соответствующих положениям 48, 61, 107 и 185 белка, имеющего аминокислотую последовательностью, показанную в SEQ ID NO:1, либо удалены, либо замещены другими аминокислотными остатками (например, сериновым остатком). Как понятно специалисту в данной области, цистеиновые остатки в сходных положениях вариантов HBcAg, имеющих аминокислотные последовательности, отличающиеся от той, которая показана в SEQ ID NO:1, также могут быть удалены или замещены другими аминокислотными остатками. Модифицированные варианты HBcAg могут затем использоваться для получения композиций вакцин по данному изобретению.

В определенных обстоятельствах (например, когда для присоединения антигенов или детерминант антигенотов к неприродному молекулярному каркасу используется гетеробифункциональный реагент, образующий перекрестные связи) присутствие свободных цистеиновых остатков в HBcAg, по-видимому, приводит к ковалентному связыванию токсичных компонентов с коровыми частицами, а также перекрестному связыванию мономеров с получением производных видов.

Более того, во многих случаях эти токсические компоненты могут не определяться анализами, проводимыми для композиций по данному изобретению. Это так, потому что ковалентное связывание токсических компонентов с неприродным молекулярным каркасом приводит к образованию множества разнообразных видов, в которых токсические компоненты связаны с различными цистеиновыми остатками или в некоторых случаях с нецистеиновыми остатками, HBcAg. Другими словами, каждый свободный цистеиновый остаток на каждом HBcAg не будет ковалентно связан с токсическими компонентами. Более того, во многих случаях ни один цистеиновый остаток конкретных HBcAg не будет связан с токсическими компонентами. Таким образом, присутствие этих токсических компонентов может быть затруднительным для определения, так как они могут присутствовать в смешанном множестве молекул. Введение отдельных видов HBcAg, содержащих токсические компоненты, однако, может приводить к потенциально серьезному побочному действию.

В данной области хорошо известно, что свободные цистеиновые остатки могут вовлекаться в большое число побочных химических реакций. Эти побочные реакции включают в себя дисульфидные обмены, взаимодействие с химическими соединениями или метаболитами, которые, например, вводят или образуются с другими веществами при комбинационной терапии, или прямое окисление и взаимодействие с нуклеотидами при облучении ультрафиолетовым светом. Таким образом, могут образовываться токсические аддукты, особенно учитывая тот факт, что HBcAg имеют большую склонность связываться с нуклеиновыми кислотами. Определение таких токсических продуктов в конъюгатах антиген-капсид может быть затруднительным, используя капсиды, полученные с помощью HBcAg, содержащих свободные цистеины и гетеробифунциональные линкеры, образующие перекрестные связи, так как может быть получен большой диапазон распределения продуктов по молекулярной массе. Токсические аддукты могут также иметь большое разнообразие видов, каждый из которых может присутствовать в низких концентрациях, но все вместе они могут достигать токсических уровней.

Принимая во внимание вышеуказанное, одним из преимуществ использования в композициях вакцин HBcAg, модифицированных с удалением природных цистеиновых остатков, является то, что число этих сайтов, с которыми могут связываться токсические вещества, когда антигены или детерминанты антигенов присоединены к неприродному молекулярному каркасу, может быть снижено или полностью удалено. Более того, высокая концентрация перекрестно-сливающего агента может использоваться для получения высоко декорированных частиц, лишенных такого недостатка, как образование множества неопределенных перекрестно-слитых образцов мономеров HBcAg (то есть разнотипной смеси перекрестно-связанных мономерных HbcAg).

Было идентифицировано большое число природных вариантов HBcAg, подходящих для применения при осуществлении настоящего изобретения. Yuan et al. (J. Virol. 73:10122-10128 (1999)), например, описали варианты, в которых изолейциновый остаток в положении, соответствующем положению 97 в SEQ ID NO: 1, замещен либо остатком лейцина, либо остатком фенилаланина. Аминокислотные последовательности некоторого количества вариантов HBcAg, а также несколько вариантов предшественников корового антигена гепатита B описаны в отчетах GenBank AAF121240, AF121239, X85297, X02496, X85305, X85303, AF151735, X85259, X85286, X85260, X85317, X85298, AF043593, M20706, X85295, X80925, X85284, X85275, X72702, X85291, X65258, X85302, M32138, X85293, X85315, U95551, X85256, X85316, X85296, AB033559, X59795, X8529, X85307, X65257, X85311, X85301, X85314, X85287, X85272, X85319, AB010289, X85285, AB010289, AF121242, M90520, P03153, AF110999 и M95589, описание каждого из которых приведено здесь в качестве ссылки. Эти варианты HBcAg отличаются аминокислотной последовательностью в некоторых положениях, включая аминокислотные остатки, которые соответствуют аминокислотным остаткам, расположенным в положениях 12, 13, 21, 22, 24, 29, 32, 33, 35, 38, 40, 42, 44, 45, 49, 51, 57, 58, 59, 64, 66, 67, 69, 74, 77, 80, 81, 87, 92, 93, 97, 98, 100, 103, 105, 106, 109, 113, 116, 121, 126, 130, 133, 135, 141, 147, 149, 157, 176, 178, 182 и 183 в SEQ ID NO:1.

Другие варианты HBcAg, подходящие для использования в композициях по данному изобретению, которые могут быть дополнительно модифицированы, как представлены в данном описании, описаны в WO 00/198333, WO 00/177158 и WO 00/214478, приведенных здесь в качестве ссылки в полном объеме.

Подходящие для применения в настоящем изобретении HBcAg могут быть получены из любого организма при условии, что они способны ассоциироваться с получением упорядоченной и повторяющейся антигенной матрицы. Преобразованные как обычно HBcAg (то есть те, в которых отсутствует лидирующая последовательность) могут использоваться в композициях вакцин по данному изобретению. Настоящее изобретение включает в себя композиции вакцин, а также способы применения этих композиций, которые используют вышеописанный вариант HBcAg для получения неприродных молекулярных каркасов. В рамки данного изобретения, кроме того, включены дополнительные варианты HBcAg, которые способны ассоциировать с образованием димерных или мультимерных структур. Таким образом, данное изобретение, кроме того, включает в себя композиции вакцин, содержащие полипептиды HBcAg, содержащие или, альтернативно, состоящие из аминокислотных последовательностей, которые, по крайней мере, приблизительно на 80%, приблизительно на 85%, приблизительно на 90%, приблизительно на 95%, приблизительно на 97% или приблизительно на 99%, идентичны любой аминокислотной последовательности, показанной в вышеуказанных последовательностях, включая SEQ ID No: 1, и форм этих белков, которые были преобразованы, где это целесообразно, с удалением N-концевой лидирующей последовательности.

Содержит ли аминокислотная последовательность полипептида аминокислотную последовательность, которая, по крайней мере, приблизительно на 80%, приблизительно на 85%, приблизительно на 90%, приблизительно на 95%, приблизительно на 97% или приблизительно на 99%, идентична одной из аминокислотных последовательностей, показанных выше, или их субфрагмент, может быть определено обычным способом, используя известные компьютерные программы, такие как программа Bestfit. При использовании Bestfit или любой другой программы сравнительного анализа первичной структуры последовательности для определения того, идентична ли конкретная последовательность, например, приблизительно на 95%, ссылочной аминокислотной последовательности в соответствии с настоящим изобретением, параметры задаются таким образом, чтобы процент идентичности рассчитывался по всей длине ссылочной аминокислотной последовательности и чтобы допускались расхождения в гомологии до 5% от общего числа аминокислотных остатков в соответствующей последовательности. Таким образом, может быть сделано сравнение аминокислотной последовательности HBcAg SEQ ID NO:1 и другой HBcAg. Если при сравнении белков, которые являются относительно сходными, указывают на аминокислотный остаток варианта HBcAg, расположенный в положении, которое соответствует конкретному положению в SEQ ID NO:1, то это касается аминокислотного остатка, который присутствует в этом положении в аминокислотной последовательности, показанной в SEQ ID NO: 1. Гомология между этими вариантами HBcAg большей частью достаточно высокая среди вирусов гепатита B, которые инфицируют млекопитающих, так что специалисту в данной области не составит труда проанализировать и аминокислотную последовательность, показанную в SEQ ID NO:1, и последовательность конкретного варианта HBcAg и идентифицировать «соответствующие» аминокислотные остатки. Например, при сравнении SEQ ID NO:1 и аминокислотной последовательности HBcAg, полученной из вируса, инфицирующего североамериканских лесных сурков, ясно видно, что в этой последовательности имеется три введенных аминокислотных остатка между аминокислотными остатками 155 и 156 SEQ ID NO: 1.

Однако, когда сравнительный анализ первичной структуры проблематичен, специалист в данной области определит важность конкретной аминокислоты или мотивов в последовательности. Например, аминокислотная последовательность HBcAg вирусов человека отличается от последовательности вирусов утки, так что сравнительный анализ первичной структуры проблематичен, тем не менее, специалист в данной области определит консервативные остатки цистеина, которые должны быть либо замещены другим аминокислотным остатком, либо удалены до их введения в композиции вакцин по данному изобретению.

В одном из вариантов осуществления остатки цистеина в положениях 48 и 107 белка с аминокислотной последовательностью, показанной в SEQ ID NO:1, удаляли или замещали другим аминокислотным остатком, а цистеин в положении 61 оставляли на месте. Более того, модифицированные полипептиды затем использовали для получения композиций вакцин по данному изобретению.

Получение предпочтительных вирусоподобных частиц гепатита B, которые могут использоваться в настоящем изобретении, описаны, например, в WO 00/32227, и, в частности, в примерах 17-19 и 21-24, а также в WO 01/85208, и, в частности, в примерах 17-19, 21-24, 31-41 и в WO 02/056905. В случае последней заявки, наиболее предпочтительные описания относятся к примеру 23, 24, 31 и 51. Подробное описание всех этих документов приведено здесь в качестве ссылки.

Как описано ниже в примере 31 WO 02/056905, остатки цистеина в положениях 48 и 107, которые доступны для растворителя, могут быть удалены, например, с помощью сайт-направленного мутагенеза. Кроме того, авторами данного изобретения было обнаружено, что Cys-48-Ser, Cys-107-Ser HBcAg двойной мутант, сконструированный, как описано в WO 02/056905 (которая приведена здесь в качестве ссылки в полном объеме), может экспрессироваться в E. coli.

Как обсуждено выше, удаление свободных остатков цистеина снижает количество сайтов, на которых к HBcAg могут присоединяться токсические компоненты, и также устранение сайтов, в которых может происходить перекрестное связывание остатков лизина и цистеина одной и той же или соседних молекул HBcAg. Цистеин в положении 61, который вовлечен в образование димера и получение дисульфидного мостика с цистеинов в положении 61 другого HBcAg, обычно будет оставаться нетронутым для стабилизации димеров и мультимеров HBcAg по данному изобретению. Эксперименты по перекрестному связыванию осуществляли с (1) HBcAg, содержащими свободные остатки цистеина, и (2) HBcAg, у которого свободные остатки цистеина делали нереакционно-способными с помощью йодацетамида, показали, что свободные остатки цистеина HBcAg отвечают за перекрестное связывание HBcAg путем взаимодействий между гетеробифункциональными боковыми цепями с перекрестными связями преобразованного лизина и свободными остатками цистеина. Также было обнаружено, что эти субъединицы HBcAg с перекрестыми связями приводят к образованию высокомолекулярных видов неопределенного размера, которые не могут быть растворены с помощью электрофореза на полиакриламидном геле с SDS.

Если антиген или детерминант антигена присоединены к неприродному молекулярному каркасу через остаток лизина, то это может быть выгодно для либо замещения, либо удаления одного или обоих природных остатков лизина, расположенных в соответствующих положениях 7 и 96 в SEQ ID NO:1, а также других остатков лизина, присутствующих в вариантах HBcAg. Удаление этих остатков лизина приводит к удалению сайтов связывания антигенов или детерминантов антигенов, которые могут разрушать упорядоченную матрицу, и может улучшить качество и единообразие окончательной композиции вакцины.

Во многих случаях, когда удаляют оба природных остатка лизина в положениях, соответствующих положениям 7 и 96 в SEQ ID NO:1, то в качестве сайта присоединения антигена или детерминанты антигена в HBcAg вводят другой лизин. Способы введения такого остатка лизина описаны, например, в примере 23 WO 02/056905, который приведен здесь в качестве ссылки в полном объеме. Часто выгодным является введение остатков лизина в HBcAg, например, когда изменены оба природных остатка лизина в положениях, соответствующих положениям 7 и 96 в SEQ ID NO: 1, и антиген, или требуется присоединить антиген или детерминант антигена к неприродному молекулярному каркасу, используя гетеробифункциональный агент, образующий перекрестные связи.

Было показано, что C-концы HBcAg непосредственно расположены в ядре этого белка (Eckhardt et al., J. Virol. 65:575-582 (1991)). Более того, эта область белка также, вероятно, придает способность HBcAg присоединять нуклеиновые кислоты.

В некоторых вариантах осуществления, композиции вакцин по данному изобретению могут содержать HBcAg, которые обладают активностью в отношение связывания нуклеиновых кислот (например, которые содержат природный домен HBcAg, связывающий нуклеиновые кислоты). HBcAg, содержащие один или несколько доменов, связывающих нуклеиновые кислоты, могут использоваться для получения композиций вакцин, которые демонстрируют повышенную стимулирующую активность T-клеток. Таким образом, композиции вакцин по данному изобретению включают в себя композиции, которые содержат HBcAg, имеющие активность связывания нуклеиновых кислот. Включены также композиции вакцин, а также применение таких композиций в протоколах вакцинации, где HBcAg присоединены к нуклеиновым кислотам. Эти HBcAg могут быть присоединены к нуклеиновым кислотам до введения субъекту или могут связывать нуклеиновые кислоты после введения.

Другие HBcAg, подходящие для использования при осуществлении настоящего изобретения, включают в себя мутанты с урезанными N- и C-концами и мутеины, в которых аминокислотные последовательности включают в себя или, альтернативно, состоят из аминокислотных последовательностей, которые, по крайней мере, приблизительно на 80%, приблизительно на 85%, приблизительно на 90%, приблизительно на 95%, приблизительно на 97%, или приблизительно на 99%, идентичны вышеописанным мутантам укорочения.

Как описано выше, в некоторых вариантах осуществления данного изобретения, остаток лизина введен в качестве первого сайта присоединения в полипептид, которые образует неприродный молекулярный каркас. В предпочтительных вариантах осуществления, композиции вакцин по данному изобретению получают, используя HBcAg, содержащий или, альтернативно, состоящий из аминокислот 1-144, или аминокислот 1-149, или аминокислот 1-185 SEQ ID NO:1, которые модифицируют так, что аминокислоты, соответствующие положениям 79 и 80, заменяли пептидами, имеющими аминокислотную последовательность Gly-Gly-Lys-Gly-Gly (SEQ ID NO: 11), и остатки цистеина в положениях 48 и 107 были либо удалены, либо замещены другими аминокислотными остатками, тогда как цистеин в положении 61 оставался на месте.

Изобретение, кроме того, включает в себя композиции вакцин, содержащие фрагменты HBcAg, содержащие или, альтернативно, состоящие из аминокислотной последовательности, отличной от той, которая показана в SEQ ID NO:1, из которой был удален остаток цистеина, не присутствующий в соответствующем положении в SEQ ID NO:1.

Композиции вакцин по данному изобретению могут содержать смесь различных HBcAg. Таким образом, эти композиции вакцин могут состоять из HBcAg, которые отличаются по аминокислотной последовательности. Например, могут быть получены композиции вакцин, содержащие HBcAg «дикого типа» и модифицированные HBcAg, в которых был изменен один или несколько аминокислотных остатков (например, удалены, вставлены или замещены). Данное изобретение также включает в себя композиции вакцин, где неприродный молекулярный каркас получали, используя HBcAg, слит с другим белком. Как описано выше, одним примером такого составного белка является составной белок HBcAg/FOS. Другие примеры составных белков HBcAg, подходящие для применения в композициях вакцин по данному изобретению, включают в себя составные белки, в которые вводили аминокислотную последовательность, способствующую образованию и/или стабилизации димеров HBcAg и мультимеров. Эта дополнительная аминокислотная последовательность может быть лигирована с C-концом HBcAg. Одним из примеров такого составного белка является составной белок HBcAg со спиральной областью GCN4 Saccharomyces cerevisiae, которая образует гомодимеры посредством нековалентных взаимодействий, которые могут использоваться для получения и стабилизации димеров и мультимеров HBcAg.

В одном из вариантов осуществления данное изобретение относится к композициям вакцин, полученных с помощью составных белков HBcAg, содержащих HBcAg или его фрагмент, и полипептида GCN4 (PAALKRARNEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKK (SEQ ID NO: 12)), лигированного с C-концом. Эти полипептиды GCN4 также могут лигировать с N-концом HbcAg.

Домены составных белков белка HBcAg/src гомология 3 (SH3) также могут использоваться для получения композиции вакцин по данному изобретению. Домены SH3 представляют собой относительно небольшие домены, обнаруживаемые в большом количестве белков, которые придают способность взаимодействовать со специфическими богатыми пролином последовательностями, белок-связывающих партнеров (смотри McPherson, Cell Signal 77:229-238 (1999). Составные белки HBcAg/SH3 могут использоваться несколькими способами. Первое, домен SH3 может образовывать первый сайт присоединения, который взаимодействует со вторым сайтом присоединения антигена или детерминанта антигена. Подобным образом, аминокислотная последовательность, богатая пролином, может добавляться к HBcAg и использоваться в качестве первого сайта присоединения для взаимодействия со вторым сайтом присоединения антигена или детерминанта антигена, доменом SH3. Второе, домен SH3 может ассоциировать с областями, богатыми пролином, введенными в HBcAg. Таким образом, домены SID и сайты взаимодействия SH3, богатые пролином, могут вводиться либо в один и тот же, либо в разные HBcAg и использоваться для получения и стабилизации димеров и мультимеров по данному изобретению.

Как продемонстрировано с помощью вышеуказанного примера, специалисту в данной области должно быть известно, как получить молекулярный каркас, содержащий коровые частицы и первый сайт присоединения из HBcAg и мутеинов, полученных из HBcAg. Применяя способы, хорошо известные в данной области, и проводя обычные эксперименты, специалисту в данной области понятно, как для построения молекулярного каркаса могут быть сходным образом применены другие вирусы.

Как здесь представлено, вирусные капсиды могут использоваться для (1) презентации гаптенов и (2) получения композиций вакцин по данному изобретению. Особенно эффективными в осуществлениях данного изобретения являются белки вирусного капсида, также называемые здесь «белки оболочки», которые при экспрессии образуют оболочки или структуры, подобные оболочкам. Таким образом, эти белки оболочки могут образовывать коровые частицы и неприродные молекулярные каркасы. Обычно эти оболочки или структуры, подобные оболочкам, образуют упорядоченные и повторяющиеся матрицы, которые могут быть эффективны для презентации детерминант гаптенов и получения композиций вакцин по данному изобретению.

Один или несколько (например, один, два, три, четыре, пять и так далее) гаптенов могут быть присоединены любым способом к одному или нескольким (например, одному, двум, трем, четырем, пяти и так далее) белкам, которые образуют вирусные капсиды или структуры, подобные оболочкам (например, белки оболочки бактериофага), а также другие белки. Например, гаптены могут быть присоединены к коровым частицам, используя первый и второй сайты присоединения. Более того, для присоединения детерминантов гаптена к одному или нескольким белкам, которые образуют вирусные капсиды или структуры, подобные оболочкам, может использоваться один или несколько (например, один, два, три, четыре, пять и тому подобное) гетеробифункциональных линкеров, образующих перекрестные связи.

Белки вирусного капсида или их фрагменты могут использоваться, например, для получения коровых частиц и композиций вакцин по данному изобретению. Белки оболочки бактериофага Qβ, например, могут рекомбинантно экспрессироваться в E. coli. Кроме того, при такой экспрессии эти белки спонтанно образуют оболочки, которые представляются собой вирусоподобные частицы. Дополнительно, эти оболочки образуют упорядоченные и повторяющиеся антигенные матрицы, которые могут использоваться для презентации гаптена и получения композиций вакцин. Как описано ниже в примере 1, белки оболочки бактериофага Qβ могут использоваться для получения композиций вакцин, которые вызывают иммунологические ответы на Гаптены.

В предпочтительном варианте осуществления вирусоподобная частица включает в себя, по существу состоит или, альтернативно, состоит из рекомбинантных белков или их фрагментов РНК-содержащего фага. Предпочтительно РНК-содержащий фаг выбран из группы, состоящей из a) бактериофага QP; b) бактериофага R17; c) бактериофага fr; d) бактериофага GA; e) бактериофага SP; f) бактериофага MS2; g) бактериофага M11; h) бактериофага MX1; i) бактериофага NL95; k) бактериофага f2; 1) бактериофага PP7 и m) бактериофага AP205.

В другом предпочтительном варианте осуществления по настоящему изобретению, вирусоподобная частица включает в себя или, альтернативно, по существу состоит из или, альтернативно, состоит из рекомбинантного белка, или его фрагментов РНК-содержащего бактериофага Qβ, или РНК-содержащего бактериофага fr, или РНК-содержащего бактериофага AP205.

В дополнительном предпочтительном варианте осуществления по настоящему изобретению, рекомбинантные белки содержат или, альтернативно, по существу состоят из или, альтернативно, состоят из белков оболочки РНК-содержащих фагов.

Конкретные примеры белков оболочки бактериофагов, которые могут использоваться для получения композиций по данному изобретению, включают в себя белки оболочки РНК-содержащих бактериофагов, таких как бактериофаг Qβ (SEQ ID NO:3, PIR Database, Accession No. VCBPQβ упоминается как Qβ CP; и SEQ ID NO: 4, Accession No. AAA16663 упоминается как Qβ A1 белок), бактериофаг R17 (SEQ ID NO: 24; PIR Accession No. VCBPR7), бактериофаг fr (SEQ ID NO: 25; PIR Accession No. VCBPFR), бактериофаг GA (SEQ ID NO: 26; GenBank Accession No. NP-040754), бактериофаг SP (SEQ ID NO: 27; GenBank Accession No. CAA30374 упоминается как SP CP и SEQ ID NO: 28, Accession No. NP 695026 упоминается как SP A1 белок), бактериофаг MS2 (SEQ ID NO: 29; PIR Accession No. VCBPM2), бактериофаг M11 (SEQ ID NO: 30; GenBank Accession No. AAC06250), бактериофаг MX1 (SEQ ID NO: 31; GenBank Accession No. AAC14699), бактериофаг NL95 (SEQ ID NO: 32; GenBank Accession No. AAC14704), бактериофаг f2 (SEQ ID NO: 33; GenBank Accession No. P03611), бактериофаг PP7 (SEQ ID NO: 13), бактериофаг AP205 (SEQ ID NO: 14). Специалисту в данной области должно быть понятно, что любой белок, которые образует оболочки или структуры, подобные оболочкам, может использоваться для получения композиций вакцин по данному изобретению. Более того, белок A1 бактериофага Qβ (Genbank accession No. AAA16663 (SEQ ID NO: 4)) или формы с укороченным C-концами, в которых отсутствует до приблизительно 100, приблизительно 150 или приблизительно 180 аминокислот в их C-концах, могут вводиться в капсидную конструкцию белков оболочки Qβ. Белок A1 также может быть сконденсирован с элементом, содержащим первый сайт присоединения для присоединения гаптенов, содержащих второй сайт присоединения. Обычно, процент белка A1, относящегося к Qβ CP, в капсидной конструкции ограничен, для того, чтобы гарантировать образование капсида.

Также было обнаружено, что белок оболочки Qβ самособирается в капсиды при экспрессии в E. coli (Kozlovska TM. et al., GENE 137: 133-137 (1993)). Полученные оболочки или вирусоподобные частицы представляют икосаэдрическую фагоподобную структуру оболочки с диаметром 25 нм и T=3 квазисимметрию. Более того, была выяснена кристаллическая структура фага Qβ. Оболочка содержит 180 копий белка оболочки, которые соединены в ковалентные пентамеры и гексамеры с помощью дисульфидных мостиков (Golmohammadi, R. et al., Structure 4: 543-5554 (1996)). Также было показано, что другие белки оболочек РНК-содержащих фагов также способны к самосборке при экспрессии в бактериальной клетке-хозяине (Kastelein, RA. et al., Gene 23: 245-254 (1983), Kozlovskaya, TM. et al., Dokl Akad. Nauk SSSR 287: 452-455 (1986), Adhin, MR. et al., Virology 170: 238-242 (1989), Ni, CZ., et al., Protein ci Set 5: 2485-2493 (1996), Priano, C. et al., J. Mol. Biol. 249: 283-297 (1995)). Капсид Qβ фага содержит, кроме белка оболочки, так называемый прочитываемый белок A1 и белок развития A2. A1 образуется путем супрессии стоп-кодона UGA и имеет длину 329 а.к. Рекомбинантный белок оболочки капсида фага Qβ, использующийся в данном изобретении, не имеет A2 лизисный белок и содержит РНК хозяина. Белок оболочки РНК-содержащих фагов представляет собой РНК-связывающий белок и взаимодействует со структурой «стебель-петля» сайта связывания рибосомы гена репликазы, действующего в качестве трансляционного репрессора во время клеточного цикла вируса. Последовательность и структурные элементы взаимодействия хорошо известны (Witherell, GW. & Uhlenbeck, OC. Biochemistry 28:71-76 (1989); Lim F. et al., J. Biol Chem. 271: 31839-31845 (1996)). Хорошо известно, что структура «стебель-петля» и РНК вовлечены в вирусные конструкции (Golmohammadi, R. et al., Structure 4: 543-5554 (1996)).

При экспрессии в E. coli N-концевой метионин белка оболочки Qβ обычно удаляется, что наблюдалось с помощью N-концевой последовательности Эдмана, как описано в Stoll, E. et al. J. Biol. Chem. 252:990-993 (1977). Также в рамки настоящего изобретения входит VLP, состоящий из белков оболочки Qβ, где N-концевой метионин не удаляется, или VLP, содержащие смесь белков оболочки Qβ, где N-концевой метионин либо удален, либо присутствует.

Более предпочтительные вирусоподобные частицы РНК-содержащих фагов, в частности Qβ, в соответствии с данным изобретением, описаны в WO 02/056905, описание которой приведено здесь в качестве ссылки в полном объеме.

Кроме того, было показано, что белки оболочки РНК-содержащего фага способны к самосборке при экспрессии в бактериальной клетке-хозяине (Kastelein, RA. et al., Gene 23: 245-254 (1983), Kozlovskaya, TM. et al., Dokl. Akad. Nauk SSSR 287: 452-455 (1986), Adhin, MR. et al., Virology 170: 238-242 (1989), Ni, CZ., et al., Proteine Sci. 5: 2485-2493 (1996), Priano, C. et al., J. Mol. Biol. 249: 283-297 (1995))

В другом предпочтительном варианте осуществления по настоящему изобретению, вирусоподобная частица включает в себя, или, альтернативно, по существу состоит из или, альтернативно, состоит из рекомбинантных белков или их фрагментов, РНК-содержащего фага, где рекомбинантные белки включают в себя, по существу состоят из или, альтернативно, состоят из мутантных белков оболочки РНК-содержащих фагов. В другом предпочтительном варианте осуществления, мутантные белки оболочки модифицированы путем удаления, по крайней мере, одного остатка лизина, более предпочтительно, по крайней мере, двух остатков лизина, путем замещения или путем добавления, по крайней мере, одного остатка лизина, путем замещения. Альтернативно, мутантные белки оболочки модифицированы путем удаления, по крайней мере, одного остатка лизина, более предпочтительно, по крайней мере, двух остатков лизина или путем добавления, по крайней мере, одного остатка лизина, более предпочтительно, по крайней мере, двух остатков лизина путем включения.

В другом предпочтительном варианте осуществления, вирусоподобная частица включает в себя, по существу состоит из или, альтернативно, состоит из рекомбинантных белков или их фрагментов РНК-содержащего бактериофага Qβ, где рекомбинантные белки включают в себя, по существу состоят из или, альтернативно, состоят из белков оболочки с аминокислотной последовательностью SEQ ID NO:3, или смесь белков оболочки с аминокислотной последовательностью SEQ ID NO:3 и SEQ ID NO: 4 или мутантов SEQ ID NO: 4, и где N-концевой метионин предпочтительно удален.

В еще одном предпочтительном варианте осуществления по настоящему изобретению вирусоподобная частица включает в себя, по существу состоит из или, альтернативно, состоит из рекомбинантных белков QP или их фрагментов, где рекомбинантные белки включают в себя, по существу состоят из или, альтернативно, состоят из мутантных белков оболочки Qβ. В другом предпочтительном варианте осуществления, эти мутантные белки оболочки модифицированы удалением, по крайней мере, одного остатка лизина путем замещения или добавлением, по крайней мере, одного остатка лизина путем замещения. Альтернативно, эти мутантные белки оболочки модифицированы удалением, по крайней мере, одного остатка лизина или добавлением, по крайней мере, одного остатка лизина путем инсерции.

Четыре остатка лизина экспонированы на поверхности капсида Qβ белка оболочки. Qβ мутанты, для которых экспонированные лизиновые остатки заменены аргининами, также могут использоваться в настоящем изобретении. Следующие мутанты белков оболочки Qβ и мутанты VLP Qβ могут, таким образом, быть использованы для осуществления данного изобретения: «Qβ-240» (Lys13-Arg; SEQ ID NO:6), «Qβ-243» (Asn 10-Lys; SEQ ID NO:7), «Qβ-250» (Lys 2-Arg, Lysl3-Arg; SEQ ID NO:8), «Qβ-251» (SEQ ID NO:9) и «Qβ-259» (Lys 2-Arg, Lys16-Arg; SEQ ID NO:10). Таким образом, в другом предпочтительном варианте осуществления настоящего изобретения вирусоподобная частица включает в себя, по существу состоит из или, альтернативно, состоит из рекомбинантных белков мутантных белков оболочки Qβ, которые включают в себя белки с аминокислотной последовательностью, выбранной из группы a) аминокислотная последовательность SEQ ID NO:6; b) аминокислотная последовательность SEQ ID NO:7; c) аминокислотная последовательность SEQ ID NO:8; d) аминокислотная последовательность SEQ ID NO:9; и e) аминокислотная последовательность SEQ ID NO: 10. Конструирование, экспрессия и очистка вышеуказанных белков оболочки Qβ, мутантов белков оболочки VLP Qβ и капсидов, соответственно, описаны в WO 02/056905. В частности, белки описаны в примере 18 вышеуказанной заявки.

В другом предпочтительном варианте осуществления настоящего изобретения вирусоподобная частица включает в себя, по существу состоит из или, альтернативно, состоит из рекомбинантных белков Qβ или их фрагментов, где рекомбинантные белки включают в себя, по существу состоят из или, альтернативно, состоят из смеси либо одно из указанных мутантов Qβ и соответствующего A1 белка.

В другом предпочтительном варианте осуществления настоящего изобретения, вирусоподобная частица включает в себя или, альтернативно, по существу состоит из или, альтернативно, состоит из рекомбинантных белков или их фрагментов, РНК-содержащего фага AP205.

Геном AP205 состоит из белка созревания, белка оболочки, репликаз и двух открытых рамок считывания, отсутствующих в сходных фагах; лизисный ген и открытая рамка считывания играют роль в трансляции ген созревания (Klovins,J., et al., J. Gen. Virol. 83: 1523-33 (2002)). Белок оболочки AP205 может быть экспрессирован из плазмиды pAP283-58 (SEQ ID NO: 15), которая является производным pQb10 (Kozlovska, T. M. et al., Gene 137:133-37 (1993)) и которая содержит сайт связывания рибосомы AP205. Альтернативно, белок оболочки AP205 может быть клонирован в pQb185 после присутствующего в векторе сайт связывания рибосомы. Оба подхода приводят к экспрессии белка и образованию оболочек, как описано в примере 10. Векторы pQb10 и pQb185 представляют собой векторы, полученные из вектора pGEM, и экспрессия клонированных генов в этих векторах находится под контролем trp промотора(Kozlovska, T. M. et al., Gene 137:133-37 (1993)). Плазмида pAP283-58 (SEQ ID NO: 15) включает в себя предполагаемый AP205 сайт связывания рибосомы в следующей последовательности, которая находится после сайта XbaI, и сразу перед старт-кодоном ATG белка оболочки AP205: tctaga ATTTTCTGCGCACCCATCCCGGGTGGCGCCCAAAGTGAGGAAAATCACatg (SEQ ID NO: 16). Вектор pQb185 включает в себя последовательность Shine Delagarno, следующую после сайта XbaI и перед старт-кодоном (tctagaTTAACCCAACGCGTAGGAG TCAGGCCatg (SEQ ID NO: 17), последовательность Shine Delagarno подчеркнута).

В другом предпочтительном варианте осуществления настоящего изобретения, вирусоподобная частица включает в себя, или альтернативно, по существу состоит из или, альтернативно, состоит из рекомбинантных белков оболочки или их фрагментов, РНК-содержащего фага AP205.

Этот предпочтительный вариант осуществления настоящего изобретения, таким образом, включает в себя белки оболочки AP205, которые образуют оболочку. Такие белки рекомбинантно экспрессированы или получены из природных источников. Белки оболочек AP205, продуцируемые в бактериях, спонтанно образуют оболочки, что подтверждено электронной микроскопией (EM) и иммунодиффузией. Структурные свойства капсида, полученного с помощью белка оболочки AP205 (SEQ ED NO: 14), и капсида, полученного с помощью белка оболочки AP205 РНК-содержащего фага, почти не отличаются по данным EM. VLP AP205 являются высокоиммуногенными и могут связываться с антигенами и/или детерминантами антигенов с получением структур вакцин, экспонирующих антигены и/или детерминанты антигенов, располагающихся повторяющимся образом. Были выявлены высокие титры против таким образом экспонированных антигенов, показывая, что связывание антигенов и/или детерминант антигенов доступно для связывания с молекулами антител и являются иммуногенными.

В другом предпочтительном варианте осуществления настоящего изобретения, вирусоподобная частица включает в себя или, альтернативно, по существу состоит из или, альтернативно, состоит из рекомбинантных мутантных белков оболочки или их фрагментов, РНК-содержащего фага AP205.

Мутантные формы VLP с подходящим комплексом AP205, включая белок оболочки AP205 с замещенным на треонин пролином 5-й аминокислоты (SEQ ID NO: 18), также может использоваться для осуществления данного изобретения и образует дополнительные предпочтительные варианты осуществления данного изобретения. Эти VLP, VLP с AP205, полученные из природных источников или AP205 вирусной частицы, могут присоединяться к антигенам для получения упорядоченных повторяющихся матриц антигенов в соответствии с настоящим изобретением.

Мутантный белок оболочки AP205 P5-T может быть экспрессирован из плазмиды pAP281-32 (SEQ ID No. 19), которую получают непосредственно из pQb185 и которая содержит ген мутантного белка оболочки AP205 вместо гена белка оболочки Qβ. Векторы экспрессии белка оболочки AP205 трансфицируют в E. coli для экспрессии белка оболочки AP205.

Способы экспрессии белка оболочки и мутантного белка оболочки соответственно, приводящие к самосборке в VLP, описаны в примерах 9 и 10. Подходящие штаммы E. coli включают в себя, но ими не ограничиваются, E. coli K802, JM 109, RR1. Подходящие векторы и штаммы и их сочетания могут быть идентифицированы путем исследования экспрессии белка оболочки и мутантного белка оболочки, соответственно, с помощью SDS-PAGE и образования и конструкции капсида с помощью необязательно первичной очистки оболочек гель-фильтрацией и последующим их тестированием в иммунодиффузном анализе (тест Ouchterlony) или электронной микроскопией (Kozlovska, T. M.. et al., Gene 137:133-37(1993)).

Белки оболочки AP205, экспрессируемые векторами pAP283-58 и pAP281-32, могут быть лишены исходной аминокислоты метионина путем процессинга в цитоплазме of E. coli. Расщепленные, нерасщепленные формы AP205 VLP или их смеси представляют собой дополнительные предпочтительные варианты осуществления данного изобретения.

В дополнительном предпочтительном варианте осуществления настоящего изобретения, вирусоподобная частица включает в себя или, альтернативно, по существу состоит из или, альтернативно, состоит из смеси рекомбинантных белков оболочки или их фрагментов, РНК-содержащего фага AP205 и рекомбинантных мутантных белков оболочки, или их фрагментов, РНК-содержащего фага AP205.

В дополнительном предпочтительном варианте осуществления настоящего изобретения, вирусоподобная частица включает в себя или, альтернативно, по существу состоит из или, альтернативно, состоит из фрагментов рекомбинантного белка оболочки или рекомбинантного мутантного белка оболочки РНК-содержащего фага AP205.

Фрагменты рекомбинантного белка оболочки AP205 могут собираться в VLP, и оболочка, соответственно, может быть использована для осуществления данного изобретения. Эти фрагменты могут образоваться путем делеции либо внутренней, либо на концах белка оболочки и мутантного белка оболочки, соответственно. Вставки в последовательность белка оболочки и мутантного белка оболочки или слияние последовательностей антигена с последовательностью белка оболочки и мутантного белка оболочки и сборка в конструкцию VLP являются дополнительными вариантами осуществления данного изобретения и приводят к образованию химерных белков оболочки AP205 и частиц, соответственно. Результат инсерций, делеций и слияний с последовательностью белка оболочки и совместимо ли это со сборкой в VLP, может быть определено электронной микроскопией.

Частицы, образуемые с помощью белка оболочки AP205, фрагментов белка оболочки и химерных белков оболочки, описанных выше, могут быть выделены в чистой форме путем сочетания стадий фракционирования стадий осаждения и очищения путем гель-фильтрации, используя, например, колонки Sepharose CL-4B, Sepharose CL-2B, Sepharose CL-6B и их сочетания. Другие способы выделения вирусоподобных частиц хорошо известны в данной области и могут использоваться для выделения вирусоподобных частиц (VLP) бактериофага AP205. Например, применение ультрацентрифугирования для выделения VLP ретротранспозона Ty дрожжей описано в патенте США № 4918166, который приведен здесь в качестве ссылки в полном объеме.

В соответствии с настоящим изобретением один или несколько гаптенов могут быть присоединены к одной субъединице капсида из белков оболочки РНК-содержащих фагов. Способность присоединять несколько гаптенов на субъединицу капсида из белка оболочки РНК-содержащих фагов и, в частности, Qβ капсид, делает возможным образование плотной гаптеновой матрицы. Другие вирусные капсиды могут использоваться для ковалентного присоединения гаптенов путем химического перекрестного связывания, так, например, HBcAg модифицирован по остатку лизина в своей главной иммунодоминантной области (MIR; WO 00/32227). Расстояние между пиками (соответствующие MIR) HBcAg составляет 50 ангстрем (Wynne, SA. et al., Mol. Cell 3: 771-780 (1999)), и, следовательно, гаптеновая матрица с расстояниями меньше 50 Е не может быть создана.

Капсиды из белка оболочки Qβ имеют на своей поверхности определенное число остатков лизина с определенной топологией, где три остатка лизина располагаются по направлению к внутренней части оболочки и взаимодействуют с РНК, а четыре других остатка лизина экспонированы на внешнюю часть оболочки. Эти определенные свойства благоприятствуют присоединению гаптенов на внешнюю часть частицы, а не на внутреннюю, где лизиновые остатки взаимодействуют с РНК. Капсиды из белков оболочки других РНК-содержащих фагов также имеют определенное число остатков лизина на своей поверхности и определенную топологию этих остатков лизина. Другим преимуществом капсидов, полученных из РНК-содержащих фагов, является их высокий экспрессионный выход в бактерии, который делает возможным получение большого количества вещества с допустимыми расходами.

Другой особенностью капсида из белка оболочки Qβ является его стабильность. Субъединицы Qβ связываются друг с другом посредством дисульфидных мостиков, ковалентно связывая субъединицы. Белок оболочки Qβ также демонстрирует необычайную устойчивость в отношении органических растворителей и денатурирующих агентов. Неожиданно, авторами данной заявки было обнаружено, что ДМСО и ацетонитрил в концентрациях до приблизительно 30% и гуанидин в концентрациях до приблизительно 1 M могут использоваться, не оказывая влияния на стабильность или способностью образовывать гаптеновые матрицы из капсида. Таким образом, органические растворители могут использоваться для взаимодействия с гидрофобными молекулами, такими как гормоны, препараты и токсины. Высокая стабильность капсида из белка оболочки Qβ является важной особенностью, относящейся к его использованию, в частности, для иммунизации и вакцинации млекопитающих и людей. Устойчивость капсида в отношении органического растворителя делает возможным присоединение гаптенов, нерастворимых в водных буферах.

Инсерция остатка цистеина в N-конец β-шпильки белка оболочки РНК-содержащего фага MS-2 была описана в патенте США № 5698424, описание которого приведено здесь в качестве ссылки в полном объеме. Авторы, однако, отмечают, что присутствие экспонированного свободного остатка цистеина в капсиде может приводит к олигомеризации оболочек в виде дисульфидных мостиковых образований. Другие присоединения, рассмотренные в вышеуказанном патенте США, включают в себя образование дисульфидных мостиков между антигеном и частицей Qβ. Такие присоединения изменяют лабильность сульфгидрильной группы, содержащейся в молекуле.

Взаимодействие между исходным дисульфидным мостиком, образованным цистеиновым остатком на Qβ, и антигенсодержащим свободным сульфгидрильным остатком приводит к сульфгидрил-содержащим видам, отличным от гаптена. Эти заново полученные сульфгидрил-содержащие виды могут снова взаимодействовать с другими дисульфидными мостиками, присутствующими на частице, таким образом создавая равновесие. При реакции с дисульфидным мостиком, образованным на частице, гаптен может образовывать либо дисульфидный мостик с остатком цистеина частицы, либо с остатком цистеина молекулы удаляемой группы, которая образовывала исходный дисульфидный мостик частицы. Более того, в другом описанном способе присоединения, использование гетеро-бифункционального линкера, образующего перекрестные связи с цистеином на частице Qβ, с одной стороны, и с остатком лизина на антигене, с другой стороны, приводит к случайной ориентации антигенов на частице.

Авторы данной заявки также отмечают, что в отличие от оболочки Qβ и белков оболочки Fr рекомбинантный MS-2, описанный в патенте США № 5698424, по существу свободен от нуклеиновых кислот, в то время как внутри двух оболочек, указанных выше, находится упакованная РНК.

Авторы данной заявки описывают новые и соответствующие изобретательскому уровню композиции, которые делают возможным образование твердых гаптеновых матриц с различной плотностью гаптена. Авторы демонстрируют, что очень высокая плотность эпитопа может быть достигнута путем присоединения гаптенов к VLP. Более того, плотность и интервалы гаптенов могут быть модифицированы путем изменения числа и типа остатков с подходящим первыми сайтами присоединения. Например, в WO 02/056905 описан мутантный белок оболочки Qβ с дополнительными остатками лизина, подходящий для получения матриц с более высокой плотностью, чем плотность, наблюдаемая в матрицах из белка оболочки дикого типа Qβ. Более того, в вышеуказанной заявке также описаны композиции, подходящие для одновременной экспозиции нескольких гаптенов с подходящим интервалом, и композиции с добавлением вспомогательной молекулы, повышающей растворимость или модифицирующей оболочку подходящим и желательным путем. Другие мутантные белки оболочки Qβ, образующие капсиды, которые представляют собой вирусоподобные частицы, описаны в WO 02/056905 и подходят для образования композиций по данному изобретению. В частности, в случаях, если растворимость гаптена и Qβ-гаптен антигенной матрицы накладывает ограничение на число остатков гаптена, которые могут быть присоединены на вирусоподобную частицу Qβ, могут применяться мутанты, в которых лизиновые остатки заменены на аргинины, которые не имеют такой же реакционной способности как лизиновые остатки. При получении этих композиций для того, чтобы достигнуть полного взаимодействия на остатках лизина на мутантах Qβ вирусоподобной частицы без образования потенциально нерастворимых частиц с большим числом присоединенных гаптенов, как в том случае, когда используется вирусоподобная частица дикого типа Qβ, может использоваться высокая концентрация гаптена или гаптена, модифицированного так, что он содержит второй сайт присоединения.

Была определена кристаллическая структура нескольких РНК-содержащих бактериофагов (Golmohammadi, R. et al., Structure 4:543-554 (1996)). Используя эту информацию, специалист в данной области может легко идентифицировать поверхность, экспонирующую остатки, и модифицировать белки оболочки бактериофага так, чтобы могли быть введены один или несколько реакционно-способных аминокислотных остатков. Таким образом, специалист в данной области может легко получить и идентифицировать модифицированные формы белков оболочки бактериофага, который может быть использован для осуществления данного изобретения. Таким образом, различные белки, которые образуют капсиды или структуры, подобные капсидам (например, белки оболочки бактериофага Qβ, бактериофага R17, бактериофага fr, бактериофага GA, бактериофага SP и бактериофага MS2), также могут быть использованы для получения композиций вакцин по данному изобретению.

Хотя последовательность различных белков, рассмотренных выше, будет зависеть от их эквивалентов дикого типа, эти различные белки обычно сохраняют способность образовывать капсиды или структуры, подобные капсидам. Таким образом, данное изобретение, кроме того, включает в себя композиции вакцин, которые содержат различные белки, образующие капсиды или структуры, подобные капсидам, а также к способам получения таких композиций вакцин, отдельных субъединиц белка, используемых для получения таких композиций вакцин. Таким образом, в рамки данного изобретения включены различные формы белков дикого типа, которые образуют упорядоченные и повторяющиеся гаптеновые матрицы (например, варианты белков, которые образуют капсиды или или структуры, подобные капсидам) и сохраняют способность связываться и образовывать капсиды или структуры, подобные капсидам. Обычно, варианты с C- и N-концевыми укорачиваниями сохраняют способность образовывать вирусоподобные частицы. В результате различные формы, включая делецию, добавление или замещение, химерные формы и природные варианты являются подходящими компонентами по данному изобретению.

Бактериальные фимбрии и пилины. В другом варианте осуществления, коровая частица по данному изобретению включает в себя, предпочтительно состоит из бактериальной фимбрии или частиц, подобных фимбриям. Частицы фимбрий включают в себя белки, мутантые белки или фрагменты пилинов, продуцируемых организмами, включая Escherichia coli; Haemophilus influenzae; Neisseria meningitidis; Neisseria gonorrhoeae; Caulobacter crescentus; Pseudomonas stutzeri; Pseudomonas aeruginosa; Salmonella spp; и Vibrio cholera. В предпочтительном варианте осуществления, пилины или их фрагменты выбраны из группы, состоящей из: a) пилины типа 1; и b) P-пилины. В другом варианте осуществления, пилины представляют собой рекомбинантные белки, или фимбрия или частица, подобная фимбрии, включает в себя смесь рекомбинантных и нерекомбинантных белков. В еще одном варианте осуществления, фимбрия или частица, подобная фибрии, включает в себя пилин типа I или его фрагменты. В дополнительном варианте осуществления, пилины являются мутантными белками, предпочтительно белками, которые модифицированы путем удаления, по крайней мере, одного остатка лизина в виде замены, путем добавления, по крайней мере, одного остатка лизина в виде замены, путем делеции, по крайней мере, одного остатка лизина или путем добавления, по крайней мере, одного остатка лизина в виде включения. В предпочтительном варианте осуществления, пилины типа I имеют аминокислотную последовательность, показанную в SEQ ID NO: 2. В еще одном дополнительном аспекте, данное изобретение относится к композиции, содержащей конъюгат по данному изобретению, где коровая частица включает в себя, предпочтительно состоит из бактериальной фимбрии или частицы, подобной фимбрии, и фармацевтически приемлемого носителя.

В других вариантах осуществления, бактериальный пилин, субфрагмент бактериального пилина или слитый белок, который содержит либо бактериальный пилин, либо его субфрагмент, используется для получения композиций вакцин по данному изобретению. Примеры пилинов включают в себя пилины, продуцируемые Escherichia coli, Haemophilus influenzas, Neisseria meningitidis, Neisseria gonorrhoeae, Caulobacter crescentus, Pseudomonas stutzeri и Pseudomonas aeruginosa. Аминокислотные последовательности пилинов, подходящих для использования в настоящем изобретении, включают в себя последовательности, представленные в GenBank под номерами AJ000636, AJ132364, AF229646, AF051814, AF051815 и X00981, описание которых приведено здесь в качестве ссылки.

Бактериальные пилины обычно преобразовывают, удаляя N-концы лидирующих последовательностей перед экспортом белков в бактериальную периплазму. Более того, как известно специалисту в данной области, бактериальные пилины, используемые для получения композиций вакцин по данному изобретению, обычно не имеют природной лидирующей последовательности.

Одним из конкретных примеров пилинов, подходящих для применения в настоящем изобретении, является P-пилин E. coli (в GenBank под номером AF237482). Примером пилина типа 1 E. coli, подходящего для использования в данном изобретении, является пилин с аминокислотной последовательностью, представленной в GenBank под номером P04128 (SEQ ID NO:2), который кодируется нуклеиновой кислотой с нуклеотидной последовательностью, представленной в GenBank под номером M27603. Полное описание этих последовательностей GenBank приведено здесь в качестве ссылки. И опять, зрелая форма вышеуказанного белка обычно может использоваться для получения композиций вакцин по данному изобретению.

Бактериальные пилины или субфрагменты пилина, подходящие для использования при практическом осуществлении настоящего изобретения, обычно способны ассоциировать с образованием неприродных молекулярных каркасов. Способы получения фимбрий и структур, подобных фимбриям, in vitro хорошо известны в данной области. Bullitt et al., Proc. Natl. Acad Sci. USA 93:12890-12895 (1996), например, описали реконструирование in vitro субфрагментов Р-фимбрий E. coli. Более того, Eshdat et al. (J. Bacteriol 148:308-314 (1981)) описали способы, подходящие для диссоциации фимбрий типа 1 Е. coli иреконструкции фимбрий. Коротко, эти способы таковы: фимбрии диссоциируют путем инкубирования при 37°C в насыщенном гуанидине гидрохлориде. Затем пилины очищают с помощью хроматографии, после чего путем диализа против 5 мМ трис(гидроксиметил)аминометана гидрохлорида (pH 8,0) образуются димеры пилинов. Eshdat et al. также обнаружили, что димеры пилинов заново собираются с образованием фимбрий при диализе против 5 мМ трис(гидроксиметил)аминометана (pH 8,0), содержащего 5 мМ MgCl2.

Кроме того, применяя, например, обычные способы генной инженерии и способы модифицирования белков, пилины могут быть модифицированы и содержать первый сайт присоединения, к которому через второй сайт присоединения присоединяется гаптен. Альтернативно, гаптены могут непосредственно присоединяться через второй сайт присоединения к аминокислотным остаткам, которые присутствуют в этих природных белках. Эти модифицированные пилины могут затем использоваться в композициях для иммунизации по данному изобретению.

Бактериальные пилины, которые используются для получения композиций по данному изобретению, могут быть модифицированы аналогичным образом, который описан здесь в случае с HBcAg. Например, остатки цистеина и лизина могут быть либо удалены, либо замещены другими аминокислотными остатками, и в эти белки могут быть добавлены первые сайты присоединения. Кроме того, пилины могут быть либо экспрессированы в модифицированной форме, либо могут быть химически модифицированы после экспрессии. Подобным образом, интактные фимбрии могут быть получены из бактерий и затем химически модифицированы.

В другом варианте осуществления, фимбрии или структуры, подобные фимбриям, получали из бактерий (например, E. coli) и использовали для получения композиций вакцин по данному изобретению. Одним из примеров фибрий, подходящих для получения композиций вакцин, является фимбрия типа 1 E. coli, которую получали из мономеров пилина с аминокислотной последовательностью, представленной в SEQ ID NO:2.

В данной области известно большое количество способов получения бактерильных фимбрий. Bullitt и Makowski (Biophys. J. 74:623-632 (1998)), например, описали способ очистки фимбрий для получения P-фимбрий E. coli. В соответствии с этим способом фимбрии отделяли от E. coli, содержащих большое количеством фимбрий из-за присутствия плазмиды P-фимбрий, и очищали с помощью цикла солюбилизации и осаждения MgCl2 (1,0 M). В WO 02/056905 описано получение и очистка фимбрий типа I из бактерий, которые по своей природе продуцируют фимбрии или в которые введен вектор, кодирующий fim оперон, ответственный за продукцию фимбрий.

После получения фимбрии или структуры, подобные фимбриям, могут быть различными путями модифицированы. Например, в фимбрии может быть добавлен первый сайт присоединения, к которому через второй сайт присоединения могут присоединяться гаптены. Другими словами бактериальные фимбрии или структуры, подобные фимбриям, могут быть получены и модифицированы с образованием неприродных молекулярных каркасов.

Фимбрии или структуры, подобные фимбрии, могут также быть модифицированы путем присоединения гаптенов в отсутствие неприродного первого сайта присоединения. Например, антигены или детерминанты антигенов могут быть присоединены к природным остаткам цистеина или остатками лизина. В этих случаях, высокоупорядоченный и повторяемый природный аминокислотный остаток может ориентировать присоединение антигенов или детерминант антигенов к фимбриям или структурам, подобным фимбриям. Например, фимбрии или структуры, подобные фимбриям, могут быть присоединены ко вторым сайтам присоединения гаптенов, используя гетеробифункциональный агент, образующий перекрестные связи.

Если для получения композиций вакцин по данному изобретению используются структуры, которые синтезируются в организме в природе (например, фимбрии), то часто полезно изменить способами генной инженерии эти организмы так, чтобы они продуцировали структуры, имеющие желаемые характеристики. Например, если используются фимбрии типа 1 E. coli, то E. coli, из которых получают эти фимбрии, могут быть модифицированы с тем, чтобы продуцировать структуры со специфическими характеристиками. Примеры возможных модификаций пилинов включают в себя вставки одного или нескольких остатков лизина, делецию или замену одного или нескольких природных остатков лизина и делецию или замену одного или нескольких природных остатков цистеина (например, остатки цистеина в положениях 44 и 84 в SEQ ID NO:2).

Более того, могут быть осуществлены дополнительные модификации генов фимбрий, результатом которых является экспрессия продуктов, содержащих первый сайт присоединения, отличный от остатка лизина (например, домены FOS или JUN). Конечно, подходящие первые сайты присоединения обычно ограничены сайтами, которые позволяют пилинам образовывать фимбрии или структуры, подобные фимбриям, подходящие для применения в композициях вакцин по данному изобретению. Способность рекомбинантных пилинов образовывать фимбрии может быть определена большим количеством способов, включая электронную микроскопию.

Гены пилинов, которые присутствуют в бактериальных клетках в природе, могут быть модифицированы in vivo (например, гомологичной рекомбинацией), или гены пилинов с конкретными характеристиками могут быть введены в эти клетки. Например, гены пилинов могут быть введены в бактериальные клетки в качестве компонента либо репликативного клонирующего вектора или вектора, который введен в бактериальную хромосому. Введенные гены пилинов также могут быть связаны с экспрессией регуляторных контрольных последовательностей (например, lac оператор).

В большинстве случаев, фимбрии или структуры, подобные фимбриям, которые могут применяться в композициях вакцин по данному изобретению, состоят из фимбрий с одним типом субъединиц. Однако композиции по данному изобретению также включают в себя вакцины, содержащие фимбрии или структуры, подобные фимбрии, образованные гетерогенными субъединицами фимбрий. Обычно используются фимбрии или структуры, подобные фимбриям, состоящие из идентичных субъединиц, так как ожидается, что они образуют структуры, которые имеют высокоупорядоченные и повторяющиеся антигенные матрицы.

Второй сайт присоединения. Настоящее изобретение относится к получению молекулярных каркасов с упорядоченными и повторяющимися матрицами, включая композиции капсидов из белков оболочки РНК-содержащего фага с высокой плотностью эпитопа. Природа гаптена и природа и расположение второго сайта присоединения на гаптене являются важными факторами, которые могут влиять на способы, доступные для конструирования конъюгатов по данному изобретению, и эффективность этих конъюгатов в индукции иммунного ответа, что понятно специалисту в данной области.

Предварительным условием конструирования второго сайта присоединения является выбор положения, с которым он должен быть сконденсирован, вставлен или, обычно, сконструирован и присоединен. Специалисту в данной области должно быть известно, чем следует руководствоваться при выборе положения второго сайта присоединения, и для принятия этого решения может учитываться много факторов. Химическая и/или кристаллическая структура гаптена может дать информацию о доступности доменов или групп на молекуле, подходящих для присоединения. Реакционно-способные группы или домены, доступные для растворителя, могут быть ограничительным фактором в кинетике химического присоединения к первому сайту присоединения. Группы, подходящие для присоединения, должны быть доступными, например сульфгидрильные группы. Обычно, в случае, когда иммунизация гаптеном предназначена для ингибирования взаимодействия указанного гаптена, который также может быть аутоантигеном, с его природными лигандами, такими как рецептор, второй сайт присоединения может быть добавлен таким образом, чтобы сделать возможным образование антител против сайта взаимодействия природных лигандов. Таким образом, расположение второго сайта присоединения будет выбрано так, чтобы избежать стерических препятствий второго сайта присоединения или любого линкера или аминокислотного линкера, его содержащего. В дополнительных вариантах осуществления, желательным является антителогенез, направленный на сайт, отличающийся от сайта взаимодействия гаптена, который также может быть аутоантигеном, с его природным лигандом. В таких вариантах осуществления второй сайт присоединения может быть выбран так, чтобы предотвратить образование антител против сайта взимодействия гаптена с его природными лигандами. Другие принимаемые во внимание факторы включают в себя природу гаптена, его биохимические свойства, такие как pI, распределение заряда, другие модификации. Обычно, предпочтительным является гибкий линкер.

Другие критерии при выборе положения второго сайта присоединения включают в себя состояние олигомеризации гаптена, место олигомеризации, присутствие кофактора, химическую активность гаптена и наличие экспериментальных данных, описыващих сайты в структуре гаптена и последовательность, где модификации гаптена совместимы с функцией гаптена, или с образованием антител, распознающих указанный гаптен и предпочтительно блокирущих функцию гаптена.

Одним из способов присоединения гаптенов, содержащих полипептидный линкер с VLP, и в частности, с капсидами из белков оболочки РНК-содержащего фага, является присоединение остатка лизина на поверхности капсида из белков оболочки РНК-содержащего фага с остатками сульфгидрильных групп на полипептидном линкере, такими как те, которые обнаруживаются в остатках цистеина. Аналогичным образом, свободные сульфгидрильные группы на гаптенах также могут быть активными сайтами присоединения. Если окисленные сульфгидрильные группы должны быть в восстановленном состоянии для функционирования в качестве второго сайта присоединения, восстановление может быть достигнуто, например, с помощью DTT, TCEP или β-меркатоэтанола.

В одном из предпочтительных вариантов осуществления данного изобретения, гаптен, синтезированный таким образом, является гаптеном, который включает в себя второй сайт присоединения, который может взаимодействовать с остатком лизина на поверхности капсида из белков оболочки РНК-содержащего фага.

В соответствии с настоящим изобретением плотность эпитопа на капсиде из белков оболочки РНК-содержащего фага может быть модулирована путем выбора условий для реакции образования перекрестных связей и других реакционных условий. Например, Sulfo-GMBS и SMPH, образующие перекрестные связи, позволяют получить высокую плотность эпитопа. На получение производных положительное влияние оказывают высокие концентрации реагентов, и коррекция условий реакций может использоваться для контроля за числом антигенов, присоединенных к белкам оболочки РНК-содержащих фагов и, в частности, к белкам оболочки Qβ. Кроме того, число первых сайтов присоединения на коровой частице является еще одним фактором, влияющим на плотность гаптеновой матрицы. В одном из вариантов осуществления настоящего изобретения, авторы представляют мутантный белок оболочки Qβ с дополнительными остатками лизина, подходящий для получения матриц с высокой плотностью.

Перекрестное связывание. Способы связывания гаптен с коровой частицей хорошо известны специалисту-практику в данной области, и в помощь такому специалисту-практику имеется большое количество ссылок (например, Sambrook, J. et al., eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2-е издание, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel, F. et al., eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc. (1997); Celis, J., ed., CELL BIOLOGY, Academic Press, 2-е издание, (1998); Harlow, E. and Lane, D., «Antibodies: A Laboratory Manual», Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1988), каждый из которых приведен здесь в качестве ссылки в полном объеме.

Различные способы достижения связывания между коровой частицей и гаптеном описаны здесь и дополнительно описаны в WO 02/056905. Способы включают в себя JUN и FOS белковые домены с лейциновыми застежками, используемыми в первом и втором сайтах присоединения по данному изобретению, соответственно.

Предпочтительные варианты осуществления по данному изобретению включают в себя присоединение неприродного молекулярного каркаса к гаптену путем химического перекрестного связывания. Существует большое разнообразие соединений, которые были разработаны для облегчения перекрестного связывания белков/пептидов или конъюгатов белков для получения производных молекул, например гаптенов. Они включают в себя, но ими не ограничиваются, реакционно-способные сложные эфиры карбоновой кислоты (активированные соединения), смешанные ангидриды, ацилгалогениды, ацилазиды, алкилгалогениды, N-малеимиды, сложные иминоэфиры, изоцианаты и изотиоцианаты, которые хорошо известны специалисту в данной области. Они способны образовывать ковалентную связь с реакционно-способной группой белковой молекулы. В зависимости от активирующей группы реакционно-способная группа представляет собой аминогруппу остатка лизина на молекуле белка или тиоловую группу на белковом носителе или модифицированную молекулу белкового носителя, которая при взаимодействии образует амидную, аминную, тиоэфирную, амидинуреидную или тиоуреидную связь. Специалист в данной области может определить другие подходящие активирующие группы, например, исходя из обычных литературных ссылок, таких как Chemistry of Protein Conjugation и Cross-Linking (Wong (1991) CRC Press, Inc., Boca Raton, Fla.). Большинство реагентов взаимодействуют предпочтительно с группами боковой цепи лизина.

В некоторых вариантах осуществления, антиген присоединен к коровой частице с помощью химического перекрестного связывания, используя гетеробифункциональный линкер, образующий перекрестные связи. В данной области известно несколько гетеробифункциональных линкеров, образующих перекрестные связи. В одном из вариантов осуществления, гетеробифункциональный линкер, образующий перекрестные связи, содержит функциональную группу, которая может взаимодействовать с аминогруппой боковой цепи остатков лизина коровой частицы, и функциональную группу, которая может взаимодействовать с остатком цистеина или сульфгидрильной группой, присутствующей на гаптене, которая сделана доступной для взаимодействия путем восстановления, или сконструирована, или присоединена на гаптен и, необязательно, также сделана доступной для взаимодействия путем восстановления. Первая стадия этого способа, называемого получением производных, представляет собой взаимодействие коровой частица с линкером, образующим перекрестные связи. Продуктом этой реакции является активированная коровая частица, также называемая активированным носителем. На второй стадии непрореагировавший линкер, образующий перекрестные связи, удаляли, используя обычные способы, такие как гель-фильтрация или диализ. На третьей стадии антиген взаимодействовал с активированной коровой частицей, и эту стадию называют стадией присоединения. Непрореагировавший антиген может быть необязательно удален на четвертой стадии.

В альтернативном варианте осуществления, производные гаптена получали с помощью активной группы, подходящей для перекрестного связывания к первому сайту присоединения, образуя активированный гаптен. Такая модификация может происходить с выделенным гаптеном или посредством химического синтеза. Активированный гаптен затем взаимодействует с коровой частицей, таким образом, осуществляется такое связывание.

В данной области известно несколько гетеробифункциональных линкеров. Они включают в себя линкеры, образующие перекрестные связи, SMPH (Pierce), Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA и другие линкеры, образующие перекрестные связи, доступные, например, от Pierce Chemical Company (Rockford, IL, USA), и обладающие одной функциональной группой, активной в отношении аминогрупп, и одной функциональной группой, активной в отношении остатков SH. Все вышеуказанные линкеры, образующие перекрестные связи, приводят к образованию тиоэфирных связей. Другой класс линкеров, образующих перекрестные связи, при практическом осуществлении данного изобретения характеризуется введением дисульфидной связи между гаптеном и коровой частицей при их связывании. Линкеры, образующие перекрестные связи, принадлежащие этому классу, включают в себя, например, SPDP и Sulfo-LC-SPDP (Pierce). Пределы модификации коровой частицы линкером, образующим перекрестные связи, могут зависеть от различных условий эксперимента, таких как концентрация каждого реакционного партнера, избыток одного реагента по сравнению с другим, pH, температура и ионная сила, а также хорошо известных в теории взаимодействия в области органической химии. Степень присоединения, то есть количество гаптена на носитель, может быть установлена при изменении условий эксперимента, описанных выше так, как требуется для вакцины. Растворимость гаптена может накладывать ограничения на количество антигена, которое может взаимодействовать с каждой субъединицей, и в тех случаях, когда получаемая вакцина является нерастворимой, полезно снижать количество антигенов на субъединицу.

В одном из конкретных вариантов осуществления, химический агент является гетеробифункциональным агентом, образующим перекрестные связи, N-гидроксисукцинимидным эфиром ε-млеимидокапроновой кислоты (Tanimori et al., J. Pharm. Dyn. 4:812 (1981); Fujiwara et al., J. Immunol. Meth. 45:195 (1981)), который содержит (1) сукцинимидную группу, взаимодействующую с аминогруппами, и (2) малеимидную группу, взаимодействующую с группами SH. Гетерологичный белок или полипептид первого сайта присоединения может быть сконструирован таким образом, чтобы он содержал один или несколько остатков лизина, которые служат в качестве реакционно-способной группы сукцинимидной части гетеробифункционального агента, образующего перекрестные связи. При химическом присоединении к остаткам лизина гетерологического белка малеимидная группа гетеробифункционального агента, образующего перекрестные связи, способна взаимодействовать с SH группой остатка цистеина на антигене или детерминантах антигена. Для препаратов антигена или детерминанта антигена в этом случае могут требоваться конструирование сульфгидрильного остатка в качестве второго сайта присоединения с тем, чтобы он мог взаимодействовать со свободной малеимидной функциональной группой на агенте, образующем перекрестные связи, присоединенном к неприродному молекулярному каркасу первых сайтов присоединения. Таким образом, в этом случае гетеробифунциоальный агент, образующий перекрестные связи, присоединяется к первому сайту присоединения неприродного молекулярного каркаса и связывает каркас со вторым сайтом присоединения антигена или детерминанта антигена.

Другие способы присоединения гаптена к коровой частице включают в себя способы, где гаптен перекрестно связан с коровой частицей, используя карбодимидные соединения. Они включают в себя карбодиимид EDC (1-(3-диметиламинопропил)-3-этилкарбодиимид гидроксихлорид), который может быть необязательно использован вместе с N-гидроксисукцинимидом NHS в реакции. В одном из способов, EDC смешивали с гаптеном, содержащим свободную карбоновую кислоту, затем добавляли к белковому носителю. В других способах, гаптен присоединен к коровой частице, используя гомобифункциональный линкер, образующий перекрестные связи, такой как глютаральдегид, DSG, BM[PEO]4, BS3, (Pierce Chemical Company, Rockford, IL, USA) или другой известный гомо-бифункциональный линкер, образующий перекрестные связи, с функциональными группами, активными в отношении аминогрупп или карбоксильных групп коровой частицы.

Другие способы получения перекрестных связей и другие линкеры, образующие перекрестные связи, подходящие для присоединения гаптена к коровой частице и вирусоподобной частице, соответственно, а также руководство для осуществления реакций присоединения и применения химических линкеров, образующих перекрестные связи, и химических способов получения перекрестных связей могут быть найдены в Hermanson, G.T. в Bioconjugate Techniques, Academic Press Inc., San Diego, CA, USA.

Другие способы связывания коровой частицы с гаптеном включают в себя способы, где коровая частица является биотинилированной и гаптен присоединен к стрептавидину, или способы, где как гаптен, так и коровая частица являются биотинилированными. В этом случае гаптен сначала может быть присоединен к стрептавидину или авидину путем добавления части антигена к стрептавидину так, чтобы оставались свободные сайты связывания для связывания коровой частицы, которую добавляли на следующей стадии. Альтернативно, все компоненты могут быть смешаны в одном реакционном сосуде. Другие пары лиганд-рецептор, в которых пригодны растворимая форма рецептора и лиганд и которые могут образовывать перекрестные связи с коровой частицей или гаптеном, могут использоваться в качестве связывающих агентов для связывания гаптена с коровой частицей.

Гаптены. В одном из аспектов данное изобретение относится к упорядоченным, повторяющимся гаптеновым матрицам, которые могут использоваться для иммунизации против гаптенов. Предпочтительными гаптенами являются горомоны, препараты и токсические соединения. Более предпочтительными являются препараты, особенно наркотики. Иммунные ответы против указанных препаратов, гормонов и токсических соединений могут использоваться для защиты субъекта от риска действия указанных соединений в качестве терапии субъекта, подвергающегося такому действию, или в качестве профилактики или лечения пристрастия.

Характерные гормоны включают в себя, но ими не ограничиваются, прогестерон, тестостерон, эстроген, меланин-стимулирующий гормон, кортизон, фолликуло-стимулирующий гормон, адреналин и норадреналин. Иммунные ответы против указанных гормонов могут использоваться при лечении меланомы, злокачественных новообразований репродуктивных органов, таких как рак молочной железы, рак яичника, рак матки, рак яичек и рак шейки матки; и при состояниях, при которых желательно изменение гормональных уровней, например, при контрацепции.

Характерные токсичные соединения включают в себя, но ими не ограничиваются, природные продукты токсичных растений, животных и микроорганизмов; они включают в себя, но ими не ограничиваются, афлатоксин, ciguatera токсин и тетродотоксин. Характерные токсичные соединения, продуцируемые искусственно или в результате метаболизма, включают в себя антибиотики (например, ванкомицин и тому подобное), противоопухолевые соединения (например, винбластин и тому подобное) и химические боевые отравляющие вещества (например, токсин бутулина, зарин, табун, зоман, VX (О-изобутил-S-2-диэтиламиноэтилметилтиофосфонат) и тому подобное). Один из аспектов данного изобретения включает в себя продукцию антител против токсических метаболитов широко используемых фармацевтических агентов таким образом, чтобы субъект мог продолжительное время получать положительные эффекты фармацевтических агентов без побочных эффектов, связанных с токсичными метаболитами.

Выбор антигенов или детерминантов антигенов для композиций и способов лечения наркомании, в частности «рекреационной» наркомании, должен быть известен специалисту в области медицины, занимающемуся лечением таких заболеваний. Характерные примеры таких антигенов или детерминантов антигенов включают в себя, например, опиоиды и производные морфина, такие как кодеин, фентанил, героин, морфий и опиум; релаксанты, такие как диазепам; стимулятны, такие как амфетамин, кокаин, MDMA (метилендиоксиметамфетамин), метамфетамин, метилфенидат и никотин; галлюциногены, такие как PCP (фенилциклидин), ЛСД, мескалин и псилоцибин; каннабиноиды, такие как гашиш и марихуана; а также препараты класса диазепам/имипрамин и препараты класса нортриптилин/амитриптилин. Лечение никотиновой зависимости также может быть направлено на никотиновые метаболиты, включая норникотин и котинин, каждый из которых имеет бульший период полураспада, чем никотин, имеют фармакологические и нейрофармакологические эффекты, сходные с эффектами никотина, и могут вызывать зависимость.

В представленных выше вариантах осуществления необязательно, чтобы иммунизирующий гаптен содержал полную молекулу гормона, препарата или токсина. Подходящие иммунные ответы против интересующего препарата, гормона или токсина могут образоваться при использовании фрагментов этого препарата, гормона или токсина, или сходных химических структур.

Данное изобретение включает в себя различные сайты присоединения и способы присоединения гаптена на носитель, которые были проиллюстрированы в данном изобретении выше, а также с помощью ссылок на эти примеры. Предпочтительные сайты и способы присоединения могут быть определены на основании предшествующего уровня знаний, теории и путем обычных экспериментов.

Никотин и никотиновые метаболиты. Иммунные ответы, подходящие для никотина, могут быть вызваны гаптенами, присоединенными к коровой частице либо через пиридиновое, либо пирролидиновое кольцо. В одном из вариантов осуществления, конъюгат 6-(карбоксиметилуреидо)-(±)-никотин (CMUNic) синтезировали из 6-амино-(±)-никотина, который взаимодействовал с этилизоцианоацетатом с получением 6-(карбоксиэтилуреидо)-(±)-никотина, и гидролизировали с помощью гидроксида лития с получением CMUNic, как описано (Hieda et al. Int J Pharmacol 22:809-819 (2000)), приведено здесь в качестве ссылки в полном объеме. Гаптен соединяли с коровой частицей посредством концевой карбоксильной группы, которая могла быть активирована, используя, например, 1-этил-3-(3-диметиламинопропил)карбодиимид HCl. В другом варианте осуществления, 6-амино-(±)-никотин присоединяли к белковому носителю, как описано в WO 99/61054, приведен здесь в качестве ссылки в полном объеме.

В другом варианте осуществления настоящего изобретения, конъюгат транс-3'-аминометилникотина получали с помощью транс-3'-гидроксиметилникотинового спирта посредством тозилирования, как описано Cushman and Castignoli (J Org Chem 37:1268-1271 (1972)), описание которой приведено здесь в качестве ссылки в полном объеме. Гаптен соединяли с коровой частицей с помощью линкера янтарной кислоты, используя 1-этил-3-(3-диметиламинопропил)карбодиимид HCl (EDAC) для активирования группы карбоксильной кислоты линкера.

В близком варианте осуществления, 3'-присоединение к никотиновым гаптенам осуществляли путем первоначального образования транс-3'-гидроксиметилникотина, который взаимодействовал с ангидридом янтарной кислоты с получением сукцинилированного гидроксиметилникотина (O-сукцинил-3'-гидроксиметилникотин). Этот продукт затем смешивали с EDAC и коровой частицей для присоединения путем активирования карбодиимида, как описано Langone and Van Vunakis (Methods Enzymol 84:629-641 (1982)), приведено здесь в качестве ссылки в полном объеме. В другом варианте осуществления, транс-4'-карбоксикотинин аналогичным образом активировали EDAC для присоединения к белковому носителю.

В одном из вариантов осуществления, никотиновый гаптен присоединен через азот в 1-положении путем преобразования в производное аминоэтилпиридиния, S-1-(b-аминоэтил)никотиний хлорид дигидрохлорид, которое затем присоединяли к коровой частице в присутствии 1-циклогексил-3-(2-морфолиноэтил)-карбодиимида мето-п-толуолсульфоната, как описано Noguchi et al. (Biochem Biophys Res Comm. 83:83-86 (1978)), приведено здесь в качестве ссылки в полном объеме. В близком варианте осуществления, котинин соединяли с коровыми частицами, используя тот же общий подход, посредством образования S-1-(b-аминоэтил)котинин хлорид гидрохлорида.

В одном из вариантов осуществления, никотиновый гаптен присоединен через 1'-положение, как описано Isomura et al. (J. Org Chem 66:4115-4121 (2001), приведено здесь в качестве ссылки в полном объеме посредством образования N-[1-оксо-6-[(2S)-2-(3-пиридил)-1-пирролидинил]гексил]-β-аланина. Этот активированный гаптен затем присоединяли к белковому носителю. В другом варианте осуществления, конъюгаты образовывались между первым сайтом присоединения сайтом на белке коровой частицы и котининовым гаптеном 4-оксо-4-[[6-[(5S)-2-оксо-5-(3-пиридинил)-1-пирролидинил]]гексил]амино]масляной кислоты, или норникотиновыми гаптенами фенилметиловым эфиром (2S)-2-(3-пиридинил)-1-пирролидинмасляной кислоты, или фенилметиловым эфиром (2R)-2-(3-пиридинил)-1-пирролидинмасляной кислоты.

В одном из вариантов осуществления, котинин 4'-карбоновой кислоты ковалентно связан с лизинами носителей, как описано Bjerke et al. (J. Immunol. Methods, 96, 239-246 (1987)), приведено здесь в качестве ссылки в полном объеме.

Никотиновые гаптены могут быть соединены с белковым носителем посредством линкера в 6-положении никотина. Наряду с этими вариантами в вариантах осуществления настоящего изобретения могут использоваться следующие Гаптены: N-сукцинил-6-амино-(.±.)-никотин; 6-(.сигма.-аминокапрамидо)-(.±.)-никотин и 6-(.сигма.-аминокапрамидо)-(.±.)-никотин, как описано (Castro et al. Eur. J. Biochem., 104, 331-340 (1980); Castro et al. in Biochem. Biophys. Res. Commun. 67, 583-589 (1975); Castro et al. Res. Commun Chem. Path. Pharm. 51, 393-404 (1986)), приведено здесь в качестве ссылок в полном объеме.

В других вариантах осуществления по данному изобретению никотиновые гаптены связаны через 3', 4' или 5' положение посредством сукцинилирования аминометилникотина, активирования EDC и последующим смешиванием с носителем, как описано в патенте США № 6232082, приведен здесь в качестве ссылки в полном объеме. В других вариантах осуществления аминометил никотин связан посредством полиглутаминовой кислоты-ADH с коровой частицей. В других вариантах осуществления конъюгаты получены из ацетил никотина и альдегида никотиновой кислоты, модифицированного в 3', 4' или 5' положениях.

В других вариантах осуществления, конъюгаты гаптен-носитель включают в себя никотин, присоединенный в 5- и 6-положениях, включая 5-(1-метил-2-пирролидинил)-2- или 3-пиридинил-конъюгаты и 5-(N-метил-2-пирролидинил)-2- или 3-пиридинил-конъюгаты. Конструирование гаптенов этих конъюгатов описано в WO 99/61054, приведено здесь в качестве ссылок в полном объеме. В других вариантах осуществления 5- и 6-аминоникотин использовали в качестве исходных продуктов, которые в последующем модифицировали по аминогруппе с добавлением, обычно, углеродных цепей, которые закачивались подходящими реакционно-способными группами, включая амины и карбоновые кислоты. Эти гаптены затем могут быть использованы для связывания с коровыми частицами по настоящему изобретению. В других вариантах осуществления, 5- или 6-бромникотин использовали в качестве подходящего исходного продукта для взаимодействия с алкинами, что приводило к добавлению ненесыщенных углеродных групп с цепями, которые заканчивались группами, подходящими для присоединения, включая амины и карбоновые кислоты, которые давали возможность присоединения к коровой частице.

Другие варианты осуществления по настоящему изобретению включают в себя конъюгаты, содержащие никотиновые гаптены, связанные в 1, 2, 4, 5, 6 или 1' положении никотина, как описано Swain et al. (WO 98/14216), приведено здесь в качестве ссылок в полном объеме.

Другие варианты осуществления по настоящему изобретению включают в себя конъюгаты, содержащие никотиновые гаптены, как описано Janda et al. (WO 02/058635).

Дополнительные варианты осуществлений включают в себя конформационно затрудненные никотиновые Гаптены, как описано Meijler et al. (J. Am. Chem. Soc, 2003,125, 7164-7165).

Кокаин и родственные препараты. Настоящее изобретение относится к конъюгатам, композициям и способам, включающим кокаин, конъюгированный с коровой частицей. В одной группе вариантов осуществления диазониевые соли бензоил кокаина и бензоил экогнина присоединяют к белковым носителям. В других вариантах осуществления пара-имино эфирные производные кокаина и норкокаина конъюгированы с коровыми частицами. Гаптены, подходящие для этих вариантов осуществления, описаны в патентах США №№: 388866, 4123431 и 4197237, приведено здесь в качестве ссылок в полном объеме. Конъюгаты кокаина, использующие пара-положение фенильного кольца различных производных кокаина, обладают повышенной стабильностью при гидролизе благодаря введению амидной связи.

Другие варианты осуществления настоящего изобретения включают в себя кокаиновые гаптены, описанные в патенте США № 5876727, приведено здесь в качестве ссылок в полном объеме.

В одном из вариантов осуществления предшественники конъюгатов по настоящему изобретению были синтезированы путем ацилирования метилового эфира экгонина с помощью бромацетил бромида в ДМФ в присутствии двух эквивалентов диизопропилэтиламина. Продукт затем присоединяли к тиольной группе тиолированного белкового носителя с получением конъюгата.

В другом варианте осуществления предшественники конъюгатов по настоящему изобретению были синтезированы путем сукцинилирования метилового эфира экгонина с помощью ангидрида янтарной кислоты в ДМФ в присутствии одного эквивалента триэтиламина. Продукт затем присоединяли к аминогруппе лизинового остатка белкового носителя с получением конъюгата. В одном из вариантов осуществления предшественники конъюгатов по настоящему изобретению были синтезированы путем взаимодействия норкокаина с ангидридом янтарной кислоты в метиленхлориде в присутствии двух эквивалентов триэтиламина. В других вариантах осуществления предшественники конъюгатов по настоящему изобретению были синтезированы путем взаимодействия раствора норкокаина моноактивированной янтарной кислоты и триэтиламина с получением сукцинилированного норкокаина. В другом случае полученный сукцинил норкокаин состоит из смеси, по крайней мере, двух изомеров, называемых экзо и эндо формы, сукцинильной группы. В этих вариантах осуществления сукцинил норкокаин затем присоединяли к .эпсилон.-аминогруппе лизинового остатка белкового носителя, используя EDC, с получением конъюгата. В альтернативном варианте осуществления реакцию присоединения осуществляли, используя заранее активированное сукцинилированное производное норкокаина. То есть, производное может быть выделено и охарактеризовано. Заранее активированное сукцинилированное производного норкокаина синтезировали путем взаимодействия натриевой соли 4-гидрокси-3-нитробензолсульфоновой кислоты с сукцинилированным норкокаином в присутствии дициклогексилкарбодиимида (DCC) и ДМФ. Продукт конъюгировали с аминогруппой лизинового остатка белкового носителя с получением конъюгата.

В одном из альтернативных вариантах осуществления соединения по настоящему изобретению были синтезированы путем взаимодействия сукцинилированного норкокаина с N-гидроксисукцимидом в присутствии этил хлорформиата, N-метилморфолина (NMM) и ДМФ. Продукт затем присоединяли к аминогруппе лизинового остатка белкового носителя с получением конъюгата.

В одном из вариантов осуществления соединения по настоящему изобретению синтезировали путем взаимодействия тионил хлорида и сукцинилированного норкокаина. Продукт затем конъюгировал с белковым носителем с получением конъюгата. В другом варианте осуществления соединения по настоящему изобретению синтезировали путем взаимодействия сукцинилированного норкокаина с HATU в ДМФ и диизопропилэтиламине, как описано в общих чертах Carpino ((1993) J. Am. Chem. Soc. 115:4397-4398), приведено здесь в качестве ссылок в полном объеме. Продукт добавляли к водному раствору, содержащему белковый носитель с получением конъюгата.

В другом варианте осуществления соединения по данному изобретению синтезировали путем взаимодействия сукцинилированного норкокаина с PyBroP в ДМФ и диизопропилэтиламине. Продукт добавляли к водному раствору, содержащему белковый носитель с получением конъюгата. В связанном варианте осуществления белковый носитель сукцинилирован ангидридом янтарной кислоты в боратном буфере. Продукт затем присоединяли к норкокаину в присутствии EDC с получением конъюгата.

В другом варианте осуществления, восстановление свободной кислоты кокаина в бензоил экгонине до его соответствующего первичного спирта выполняли, используя боран-диметилсульфидный комплекс. Спирт взаимодействовал с ангидридом янтарной кислоты в ДМФ, продукт которого затем конъюгировал со свободной аминогруппой белкового носителя в присутствии EDC с получением конъюгата.

В другом варианте осуществления соединения по настоящему изобретению синтезировали путем конъюгирования бензоил экгонина с аминогруппой лизинового остатка белкового носителя в присутствии EDC с получением конъюгата.

В одном из вариантов осуществления, предшественники конъюгатов были синтезированы путем ацилирования рацемического норникотина с ангидридом янтарной кислоты в метиленхлориде в присутствии двух эквивалентов диизопропилэтиламина. Продукт этой реакции затем присоединяли к лизиновому остатку белкового носителя, используя HATU с получением конъюгата. В другом варианте осуществления селективно алкилированный азот пиридина (S)-(-)-никотина в безводном метаноле с этил 3-бромбутиратом, 5-бромвалериановой кислотой, 6-бромгексановой кислотой или 8-бомоктановой кислотой с получением продуктов, подходящих для конъюгирования с белковым носителем, используя HATU.

Композиции, вакцины и их введение и способы лечения

Как описано здесь, данное изобретение относится к композициям, которые могут использоваться для профилактики и/или лечения заболеваний или состояний. Данное изобретение также относится к способам вакцинации для профилактики и/или лечения заболеваний или состояний у субъектов. В предпочтительном варианте осуществления композиции стимулируют иммунный ответ, что приводит к синтезу иммунных молекул, включая антитела, которые связываются с органическими молекулами. Данное изобретение дополнительно относится к способам вакцинации для профилактики и/или лечения заболеваний или состояний у субъектов.

Природы или тип иммунного ответа не является ограничивающим фактором в этом описании. Желательный результат терапевтического или профилактического иммунного ответа может изменяться в соответствии с заболеванием, в соответствии с принципами, хорошо известными в данной области. Например, вакцина против вдыхаемых наркотиков (например, никотин, кокаин) может быть желательна для индукции высоких титров IgG в сыворотки, а также секретированных антител sIgA в эпителии дыхательных путей, таким образом связывая никотин как в дыхательных путях, так и в кровеносной системе. Для сравнения, титры антител sIgA, вероятно, ниже значимых, когда выбирается инъекционное введение наркотика (например, героина). Однако методология вакцинации против наркотика, вводимого инъекцией, что приводит к высоким титрам в сыворотке, а также к sIgA, тем не менее будет эффективна при условии значимых титров в сыворотке.

Данное изобретение включает в себя вакцины, эффективные для лечения или профилактики заболевания или состояния или пристрастия. Данное изобретение, кроме того, включает в себя вакцины, которые снижают число, серьезность или продолжительность симптомов; и композиции вакцин, эффективные для снижения числа субъектов в популяции с симптомами. Данное изобретение включает в себя композиции, которые влияют на иммунную систему, которая может способствовать лечению заболевания, в качестве одного из аспектов в полном терапевтическом лечении в отношении заболевания. Учитывая исключительно сложную природу пристрастия, данное изобретение включает в себя композиции, которые способствуют лечению наркомании, но сопровождаются психическим, поведенческим, социальным и правовым вмешательством.

Более того, может быть желательным стимулировать различные типы иммунного ответа в зависимости от заболевания и в соответствии с принципами, известными в данной области. Хорошо известно, что, например, некоторые иммунные ответы больше подходят для конкретного антигена, чем другие иммунные ответы. Некоторые иммунные ответы, безусловно, не подходят и могут вызывать патологию, такую как патологическое воспаление.

На природу иммунного ответа может влиять природа антигена, путь введения в организм, доза, режим дозирования, повторяющаяся сущность антигена, состояние хозяина и сигнальные факторы иммунной системы. Эти сведения хорошо известны в данной области. По существу иммунный ответ может быть получен, используя как теоретические знания, так повседневное экспериментирование.

Более того, данное изобретение относится к использованию различных коровых частиц во время курса вакцинации против наркотика или наркотиков. Субъекты, которые развивают стойкий иммунный ответ против коровых частиц, таких как, например, фимбрии, могут быть иммунизированы композициями, содержащими тот же гаптен, но другую коровую частицу.

Не желая привязывать настоящее изобретение к теории или к какому-либо конкретному объяснению механизма действия, конъюгаты по настоящему изобретению позволяют получить, в частности, новые и неожиданные преимущества в качестве компонентов фармацевтических композиций для генерирования иммунного ответа, и, в частности, в виде вакцин. Другие носители, известные в данной области, включающие в себя BSA, гемоцианин лимфы моллюсков, анатоксин тетана, белки внешней мембраны бактерий, холерный токсин и экзотоксин А Pseudomonas aeruginosa,могут быть неподходящими для применения у субъектов, в частности у человека. Вышеуказанные носители могут индуцировать аллергические реакции или стимулировать патологические иммунные ответы (например, холерный токсин, KLH, BSA). Вышеуказанные носители могут требовать присутствия адъювантов, таких как полный адъювант Фрейнда, в данный момент рассматриваемый как неприемлемый для применения у человека. Большое число носителей могут быть компонентами существующих вакцин (например, анатоксин титана, холерный токсин, экзотоксин A). По существу, субъекты могут иметь высокие уровни существующего иммунитета к этим носителям, так что иммунизация конъюгатом антиген-носитель будет индуцировать относительно более сильный иммунный ответ на носитель, чем на новый антиген. По этой причине каждый по отдельности или все вместе конъюгаты и композиции по настоящему изобретению имеют улучшенную эффективность по сравнению с вышеописанными белковыми носителями. В настоящем изобретении показано применение композиции конъюгата никотин-VLP Qβ для стимулирования иммунного ответа против никотина без применения полного адъюванта Фрейнда и без признаков патологических иммунных ответов. При применении вариантов осуществления по данному изобретению, гаптены конъюгировали с коровыми частицами для поглощения антиген-презентирующими клетками и, следовательно, стимуляции T-хелперных клеток для индукции иммунного ответа. Ответы T-хелперных клеток могут разделяться на два типа 1 (ТХ1) и типа 2 (TХ2) Т-хелперные ответы (Romagnani, Immunol. Today 18:263-266 (1997)). Клетки Тх1 секретируют интерферон-гамма и другие цитокины, которые инициируют B клетки продуцировать антитела IgG1-3. Наоборот, важнейшим цитокином, продуцируемым Тх2 клетки, является IL-4, который стимулирует B клетки продуцировать IgG4 и IgE. Во многих экспериментальных системах развитие Тх1 и Тх2 ответов взаимно исключают друг друга, так как Тх1 клетки подавляют индукцию Тх2 клеток и наоборот. Таким образом, антигены, которые запускают сильный Тх1 ответ, одновременно подавляют развитие Тх2 ответов и поэтому продукцию антител IgE. Интересен тот факт, что фактически все вирусы индуцируют Тх1 ответ у хозяина и не способны запускать продукцию антител IgE (Coutelier et al., J. Exp. Med. 165:64-69 (1987)). Антитела изотипа IgE являются важными компонентами всех аллергических реакций. Тучные клетки связывают антитела IgE на их поверхности и высвобождают гистамины и другие медиаторы аллергического ответа при присоединении специфического антигена с молекулами IgE, расположенными на тучных клетках. Характерный изотип, типичный для Тх1 ответов, не только ограничивает живые вирусы, но также наблюдался для неактивированных или рекомбинантных вирусных частиц (Lo-Man et al., Eur. J. Immunol 25:1401-1407 (1998)). Таким образом, используя способы по данному изобретению (например, технологии альфавакцин), вирусные частицы могут иметь различные гаптены и использоваться для иммунизации. Вследствие полученной «вирусной структуры» гаптена будет вызываться Tх1 ответ, будут продуцироваться «защитные» антитела IgG1-3 и будет предотвращена продукция антител IgE, которые вызывают аллергические реакции. Таким образом, данное изобретение включает в себя композиции, способные индуцировать предпочтительные иммунные ответы, особенно ответы Тх1 типа. Более того, изобретение включает в себя композиции по данному изобретению для противодействия аллергических реакциям, индуцируемым другими вакцинами против интересующих гаптенов.

Дополнительной преимущественной особенностью настоящего изобретения является тот факт, что гаптены могут находиться в упорядоченных, повторяющихся матрицах, которые способны индуцировать эффективные иммунные ответы как без, так и с Т-хелперными клетками. Эта особенность по данному изобретению является особенно выгодной.

В отличие от отдельных белков вирусы индуцируют быстрые и эффективные иммунные ответы в отсутствие любого адъюванта с или без Т-хелперных клеток (Bachmann & Zinkernagel, Ann. Rev. Immunol: 15:235-270 (1997)). Хотя вирусы часто состоят из нескольких белков, они способны инициировать гораздо более сильные иммунные ответы, чем их отдельные компоненты. В случае B-клеточных ответов известно, что одним из ключевых факторов для иммуногенности вирусов является повторяемость и упорядоченность эпитопов на поверхности. Большое количество вирусов имеют квазикристаллическую поверхность, которая демонстрирует регулярную матрицу эпитопов, которые эффективно образуют перекрестные связи между эпитопом и специфическими иммуноглобулинами на B клетках (Bachmann & Zinkernagel, Immunol. Today 17:553-558 (1996)). Это перекрестное связывание поверхностных иммуноглобулинов на B клетках является сильнейшим сигналом активации, который непосредственно индуцирует клеточный цикл и продукцию антител IgM. Более того, такое инициирование B клеток способно активировать T-хелперные клетки, которые, в свою очередь, индуцируют смену продукции антител от IgM к IgG в B клетках и образование долгоживущих B-клеток памяти, что является задачей любой вакцинации (Bachmann & Zinkernagel, Ann. Rev. Immunol. 15:235-270 (1997)). Настоящее изобретение представляет один из путей улучшения эффективности вакцинации путем увеличения степени повторяемости гаптена, используемого для иммунизации, посредством присоединения гаптена к коровым частицам. Как отмечалось ранее, данное изобретение относится к композициям, содержащим коровую частицу, модифицированную изменением числа и/или расположением первых сайтов присоединения.

Специалисту в данной области понятно, что когда конъюгаты по настоящему изобретению вводят субъекту, то они могут быть в композиции, содержащей соли, буферы, адъюванты и другие вещества, наполнители или носители, которые желательны для улучшения эффективности композиции. Примеры веществ, подходящих или приемлемых для применения при получении фармацевтических композиций, представлены в различных источниках, включая REMINGTON'S PHARMACEUTICAL SCIENCES (Osol, A, ed., Mack Publishing Co., (1990)).

Композиции по данному изобретению могут называться «фармакологически приемлемыми», если при введении они могут быть толерантными в отношении отдельного реципиента. Более того, композиции по данному изобретению могут вводиться в «терапевтически эффективном количестве» (то есть количество, которое дает желаемый физиологический эффект).

Композиции по настоящему изобретению могут вводиться различными способами, известными в данной области, но обычно вводятся путем инъекции, инфузии, ингаляции, перорального введения или другими подходящими физическими способами. Композиции могут альтернативно вводиться внутримышечно, внутривенно, через слизистую, трансдермально или подкожно. Компоненты композиции для введения включают в себя стерильную воду (например, физиологический раствор) или безводные растворы и суспензии. Примерами безводных растворов являются пропиленгликоль, полиэтиленгликоль, растительные масла, такие как оливковое масло, и органические эфиры, которые можно вводить инъекцией, такие как этил олеат. Носители или перевязочный материал могут использоваться для повышения кожной проницаемости и увеличения абсорбции антигена.

В одном из специфических вариантов осуществления человека с никотинозависимостью иммунизировали от 5 до 500 мкг, предпочтительно от 25 до 200 мкг, более предпочтительно от 50 до 100 мгк, наиболее предпочтительно 100 мкг конъюгата Nic-Qβ, повторную иммунизацию осуществляли на 3 недели и опять на 6 недели, более предпочтительно повторную иммунизацию осуществляли на 4 недели и снова на 8 недели. Пути иммунизации могут включают в себя внутримышечную, подкожную, интрадермальную, чрескожную или внутривенную инъекцию. Две недели после иммунизации иммунный ответ контролировали с помощью наборов, как описано здесь. Полученный иммунный ответ является специфическим в отношении никотина и включает в себя высокие титры IgG в сыворотке, которые являются достаточными для ингибирования поступления никотина в мозг. Полученный иммунный ответ является долгосрочным, и, таким образом, субъект не получает удовольствие от никотина и прекращает применение никотина. Специалисту в данной области ясно при измерении иммунного ответа, необходимы ли дополнительные иммунизации для поддержания никотин-специфических уровней IgG. В альтернативном варианте осуществления настоящего изобретения конъюгаты никотиновый гаптен-носитель по данному изобретению вводят интраназальной вакцинацией. Этот тип введения дает высокие титры антител, включающие IgA, как показано в примерах.

В дополнительном варианте осуществления данного изобретения фармацевтическая композиция, предназначенная для лечения никотинозависимости, уменьшения симптомов отмены никотина, облегчения отвыкание от курения или препятствует рецидиву, включает в себя терапевтически эффективное сочетание композиции вакцины по данному изобретению и дополнительного агента. В одном из вариантов осуществления дополнительный агент выбран из группы, состоящей из: антидепрессанта; модулятора рецептора никотина; антагониста каннабиноидного рецептора; антагониста опиоидного рецептора; ингибитора моноаминоксидазы; анксиолитика или любого сочетания этих агентов. Предпочтительно дополнительным агентом является антидепрессант, выбранный из группы, состоящей из бупропиона, доксепина, дезипрамина, хломипрамина, имипрамина, нортриптилина, амитриптилина, протриптилина, тримипрамина, флуоксетина, флувоксамина, пароксетина, сертралина, фенелзина, транилципромина, амоксапина, мапротилина, тразодона, венлафаксина, миртразапина и их фармацевтически активные соли и их оптические изомеры. В особо предпочтительном варианте осуществления, антидепрессантом является либо бупропион или его фармацевтически приемлемая соль, или нортриптилин или его фармацевтически приемлемая соль.

В другом варианте осуществления дополнительный агент представляет собой модулятор никотинового рецептора, выбранный из группы, состоящей из мекамиламина, SSR591813, амантадина, пемпидина, дигидро-бета-эритроидина, гексаметония, эризодина, хлоризондамина, триметафан камсилата, тубокурарина хлорида, d-тубокурарина, варениклина, их фармацевтически приемлемых солей и их оптических изомеров. В наиболее предпочтительном варианте осуществления, модулятор никотинового рецептора представляет собой мекамиламин или его фармацевтически приемлемую соль. В другом предпочтительном варианте осуществления модулятором никотинового рецептора является варениклин или его фармацевтически приемлемая соль.

Один из вариантов осуществления настоящее изобретение включает в себя способ лечения табакозависимости или никотинозависимости, уменьшения симптомов отмены никотина, препятствует рецидиву или облегчает отвыкание от курения, который включает в себя стадию введения пациенту композиции вакцины по данному изобретению и дополнительного агента. В предпочтительном варианте осуществления композицию вакцины вводят интраназально, перорально, подкожно, чрескожно, через слизистую оболочку или внутривенно, где указанный дополнительный агент вводят перорально или с помощью чрездермального пластыря. В более предпочтительном варианте осуществления композиция вакцины по данному изобретению включает в себя О-сукцинил-3'-гидроксиметилникотин, конъюгированный с вирусноподобными частицами Qβ.

Антидепрессанты, агонисты и антагонисты никотинового рецептора, антагонисты каннабиноидного и опиоидного рецептора, ингибиторы моноаминоксидазы и анксиолитики способны ослаблять некоторые симптомы во время прекращения курения, такие как синдром отмены, тяга, депрессия, раздражительность, вялость, отсутствие мотивации, изменение аппетита, тошнота и повышенная сонливость. Они главным образом действуют на рецепторы мозга. Более того, повышение массы при прекращении курения является главной причиной для беспокойства большинства людей. Вакцинация ингибирует поступление никотина в мозг и таким образом ингибирует его стимулирующие эффекты. Она не ингибирует симптомы отмены, но ингибирует усиление зависимости от никотина после его отмены. Следовательно, сочетание вакцинации и применение антидепрессантов, антагонистов рецептора никотина, антагонистов каннабиноидного рецептора, ингибиторов моноаминоксидазы и анксиолитиков и, кроме того, препаратов, ингибирующих увеличение веса являются полезным при содействии прекращения курения и предотвращения рецидива.

Для лечения симптомов отмены никотина и содействия прекращению курения могут использоваться антидепрессанты. Одним из таких антидепрессантов является бупропион и в качестве вспомогательного средства для прекращения курения, на рынке доступна композиция бупропиона HCl с замедленным высвобождением с торговым названием Zyban. Механизм действия бупропиона предполагает вовлечение ингибирования нейронального поглощения допамина и/или норэпинефрина. Так как допамин связан со стимулирующими эффектами веществ, вызывающих привыкание, таких как никотин, ингибирование поглощения норэпинефрина предполагает индукцию снижения симптомов отмены. Способы получения бупропиона и его фармацевтически приемлемых солей описаны в патенте США № 3819706 и 3885046. Способы получения оптически чистых (+)-бупропиона и чистого (-)-бупропиона были описаны (Castaldi G, et al., J. Org. Chem., 1987, 52:3018, Musso et al., 1993, Chirality 5: 495-500).

В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ, и вводя бупропион, предпочтительно бупропион гидрохлорид. Количество бупропиона для введения подбирают для препарата таким образом, чтобы получить начальную дозу, равную приблизительно 150 мг в день в течение 6 дней, после чего следует доза 300 мг в день.

Нортриптилин, используемый для лечения депрессий и, как было показано, эффективный для содействия прекращению курения (da Costa et al., 2002, Chest, 122, 403-408). Способы получения нортриптилина хорошо известны в данной области. В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ и вводя нортриптилин. Нортриптилин вводят в дозе 10-150 мг, наиболее предпочтительно 75 мг в день.

Дополнительные антидепрессанты, рассматриваемые для комбинирования с вакцинацией, включают в себя: доксепин, флуоксетин, дезипрамин, хломипрамин, имипрамин, амитриптилин, тримипрамин, флувоксамин, проксетин, сертралин, фенелзин, транилципромин, амоксапин, мапротилин, тразодон, венлафаксин, миртразапин и их фармацевтически активные соли и их оптические изомеры.

Агонисты и антагонисты рецептора никотина ослабляют стимулирующие эффекты табака, блокируя рецепторы.

Варениклин тартрат является другим селективным модулятором никотинового рецептора. Варениклин тартрат (7,8,9,10-тетрагидро-6,10-метано-6H-пиразино[2,3-h][3]бензазепин (2R,3R)-2,3-дигидроксибутандионат) снижает тяжесть симптомов отмены никотина. Его синтез описан в WO 01/62736. В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ, и вводя варениклин, предпочтительно верениклин тартрат. Вводимая доза варениклина тартрата составляет 1 мг дважды в день.

(5aS,8S,10aR)-5a,6,9,10-тетрагидро,7H,11H-8,10a-метанопиридино[2',3':5,6]пирано-[2,3-d]азепин (SSR591813) является соединение, которое с высокой аффинностью связывают ацетилхолиновые рецепторы альфа4бета2никотинового подтипа (nAChR). Синтез производных описан в патенте США 6538003. В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ, и вводя SSR591813. Доза SSR591813 в композиции составляет между 1 мг и 500 мг ежедневно.

В предпочтительном варианте осуществления данного изобретения антагонист рецептора никотина мекамиламин гидрохлорид или его фармацевтически приемлемую соль вводят субъекту для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ. Было показано, что мекамиламин гидрохлорид блокирует большое количество физиологических, поведенческих и усиливающих эффектов никотина. Количество мекамиламина гидрохлорида подбирают таким образом, чтобы доза составляла приблизительно 1 мг, приблизительно 25 мг в день.

Дополнительные специфические никотиновые антагонисты включают в себя амантадин, пемпидин, дигидро-бета-эртироидин, гексамэтоний, еризодин, хлоризондамин, триметафан камзилат, тубокурарин хлорид, d-тубокурарин, их фармацевтически приемлемые соли или их оптические изомеры.

Антагонисты центральных каннабиноидных рецепторов также могут использоваться для содействия прекращению курения. Такими антагонистами каннабиноидов являются N-пиперидино-5-(4-хлорфенил)-1-(2,4-дихлорфенил)-4-метилпиразол-3-карбоксамид, называемый ниже римонабант. Их синтез и фармацевтические композиции, их содержащие, описаны в патентных заявках EP-576357, EP-656354, WO 96/02248 и WO 03/040105. Эффективность римонабанта описана Cohen et al. (Behav Pharmacol. 2002, 13, 451-63).

В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ, и вводя римонабант. Количество вводимого римонабанта подбирают таким образом, чтобы его доза составляла 5-40 мг в день, предпочтительно 20 мг/день.

В дополнительном варианте осуществления в сочетании с вакцинированием против никотина могут использоваться антагонисты опиоидов, такие как налтрексон. Применение налтрексона и родственных ему соединений для содействия прекращению курения описано в патентной заявке США № 6004970. Обычные дозы находятся в диапазоне от 12,5 мг и 150 мг.

Для лечения синдрома отмены никотина также вводят анксиолитики. Анксиолитики противодействуют умеренным симптомам беспокойства, которые возникают во время прекращения курения, или для лечения алкоголизма и других наркоманий. Анксиолитик изовалерамид рекомендован для применения для прекращения курения (Baladrin et al., WO 94/28888). Другие анксиолитики включают в себя буспирон, гидроксизин и мепробамат. Буспирон вводят в диапазоне доз приблизительно от 5 мг до 60 мг в день.

Ингибиторы моноаминоксидазы были описаны для лечения симптомов отмены наркотиков (WO 92/21333 и WO 01/12176). Селективные ингибиторы моноаминоксидазы A обратимого действия, селективные ингибиторы моноаминоксидазы B обратимого действия или смесь ингибиторов моноаминоксидазы A и B обратимого действия могут быть эффективны для снижения симптомов отмены. Из числа ингибиторов моноаминоксидазы А обратимого действия могут быть приведены бефлоксатон, моклобемид, брофаромин, феноксатин, эзупрон, бефол, RS 8359 (Sankyo), T794 (Tanabe), KP 9 (Krenitsky USA), E 2011 (Eisei), толоксатон, пирлиндол, амифлавин, серклоремин и базинаприн. Эти соединения хорошо известны, и их получение описано в данной области. Из числа ингибиторов моноаминоксидазы В обратимого действия могут быть приведены лазабемид, милацемид, кароксазон, IFO, депренил, AGN-1135, MDL72145 и J-508. Применение бефиоксатона или 3-[4-(4,4,4-трифтор-3R-гидроксибутокси)фенил]5(R)-метоксиметил-2-оксазолидинона для лечения ожирения описано в WO 01/12176. Применение депренил изомера селегелина описано в WO 92/21333.

Дополнительным соединением, которое может использоваться для прекращения курения, является клонидин (Gourlay et al., Cochrane Library 2003, 2). В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ, и вводя клонидин, предпочтительно клонидин гидрохлорид.

Дополнительным соединением, которое может использоваться для прекращения курения, является сибутрамин. Сибутрамин был одобрен FDA для содействия снижению массы тела человека, и он ингибирует обратный захват серотонина и норэпинефрина. Предпочтительно субитрамин назначают в форме гидрохлорида моногидрата. Ежедневная доза составляет от 1 до 20 мг, предпочтительно 10 или 15 мг в день. В предпочтительном варианте осуществления данного изобретения рассматривается комбинированная терапия субъектов для содействия прекращению курения или для предупреждения рецедива путем вакцинации, используя конъюгаты никотин-VLP, предпочтительно конъюгаты никотин-Qβ и сибутрамин, предпочтительно сибутрамин гидрохлорид.

Все препараты, указанные выше, могут вводиться перорально в виде таблетки или желатиновой капсулы или в виде трансдермальных пластырей. Композиции таблеток, желатиновых капсул и трансдермальных пластырей описаны в данной области.

Прекращение курения также лечат сочетанием антидепрессантов и анксиолитиков (Glazer, патент США 4788189 или сочетание антагонистов рецептора никотина и антидепрессанта или противотревожного препарата (Cary, WO 99/17803).

Дополнительные варианты осуществления данного изобретения включают в себя иммунные молекулы, продуцируемые при иммунизации композициями по данному изобретению. Иммунные молекулы включают в себя антитела и рецепторы T-клеток. Такие иммунные молекулы могут использоваться при вакцинации субъекта для связывания заданных гаптенов. Иммунные молекулы также могут использоваться для переноса другому субъекту, не иммунизированному композициями по данному изобретению, таким образом «пассивной» иммунизации путем переноса. В одном из вариантов осуществления, иммунными молекулами являются антитела. Моноклональные антитела, которые могут использоваться для связывания токсина, гормона или препарата, могут переноситься субъекту для осуществления лечения или профилактики. Антитела против никотина и других веществ, вызывающих привыкание, обеспечивают временное облегчение в стремлении к употреблению наркотика. В других вариантах осуществления, антитела могут вводиться субъекту при риске отравления или тем, кто остро подвергается действию токсического агента.

В другом варианте осуществления, антитела переносят субъекту с иммунными дефицитами, такими как дефицит, наблюдаемый при приеме циклоспорина или других иммуносупрессивных препаратов, или приобретенный иммунодефицит, например ВИЧ-инфекция. ВИЧ-инфекция зачастую возникает при наркомании, особенно при применении наркотиков, вводимых инъекцией, и склонность может быть первопричиной, приводящей к поведению, которое увеличивает риск субъекта приобрести ВИЧ-инфекцию (например, применение общих игл, проституция). Таким образом лечение употребления наркотиков положительно влияет на перенос ВИЧ к неинфицированным индивидуумам в популяции.

В вариантах осуществления, когда применяется пассивная иммунизация, группу добровольцев-доноров иммунизировали конъюгатами по данному изобретению, используя оптимальный режим иммунизации, как определено эмпирически. В разное время у доноров брали кровь из вены и титры анти-кокаиновых антител анализировали с помощью ELISA. Гипериммунизированную плазму разных доноров объединяли и фракции IgG выделяли путем фракционирования холодным спиртом. Препарат антител буферировали, стабилизировали, консервировали и стандартизировали, как требуется для гипериммунных препаратов антител, применяемых для людей. Уровень анти-гаптеновых антител стандартизировали с помощью ELISA или другими анализами на основе антител.

Соответствующую дозу очищенного антитела вводили пациенту внутримышечно, подкожно или внутривенно. В одном из вариантов осуществления, антитела вводили с вакциной конъюгата, в разные анатомические области для активной иммунизации. Соответствующую дозу определяли, анализируя уровни сыворотки у реципиентов в исследуемой группе больных с помощью ELISA или других анализов, связанных с антителами, в момент времени 24 часа или другой подходящий момент времени после инъекции гипериммунного препарата антител и/или анализировали эффективность различных доз для ингибирования эффектов гаптена.

Пассивный перенос иммунных глобулинов ингибировал действие гормонов, токсинов или препаратов у пациента. Использование доноров-добровольцев, поликлональных антител и большое количество доноров в группе доноров ограничивали возможность возникновения иммунного ответа у пациентов при переносе антител.

Другие варианты осуществления по данному изобретению включают в себя способы получения композиций по данному изобретению и способы лечения, используя указанные композиции. Различные подходы для лечении пристрастия могут использоваться для совместной терапии для профилактики рецедива, включая психиатрическую помощь, социальную и правовую поддержку. Фармакологические агенты, которые могут совместно использоваться для лечения пристрастия, включают в себя дезипрамин, бупренорфин, налоксон, галоперидол, хлорпроазин, бромкриптин, ибогаин, мазиндол, антидепрессанты и другие, которые известны специалисту в данной области.

Наборы

В данном изобретении также рассматривается применение антител, продуцируемых при иммунизации композициями по данному изобретению, в наборах для определения гаптенов в иммунологических анализах (например, ELISA). В связанном варианте осуществления, повторяющиеся упорядоченные гаптеновые матрицы могут использоваться для определения антител против гаптенов в анализе связывания.

В некоторых конкретных вариантах осуществления композиции по настоящему изобретению могут быть частью наборов для определения в анализах или промышленных нужд, диагностики или определения заболеваний, состояний или расстройств. Такие наборы в соответствии с настоящем изобретением могут включать в себя, по крайней мере, один контейнер, содержащий один или несколько вышеописанных конъюгатов или композиций, включая конъюгаты гаптен-коровая частица и иммунные молекулы, направленные против таких конъюгатов. Другие наборы по данному изобретению могут включать в себя одно или несколько антител по данному изобретению, которые получают способами по данному изобретению или способами иммунизации, сходными со способами, применяемыми специалистами в данной области, используя конъюгаты и композиции по настоящему изобретению. Наборы по данному изобретению могут необязательно дополнительно включать в себя, по крайней мере, один дополнительный контейнер, который может содержать, например, один или несколько антигенов, один или несколько гаптенов, один или несколько коровых частиц, один или несколько конъюгатов/композиций по данному изобретению, один или несколько фармацевтически приемлемых носителей или наполнителей, один или несколько буферов, один или несколько белков, один или несколько молекул нуклеиновых кислот и тому подобное.

Настоящее изобретение относится к наборам, которые могут использоваться в вышеуказанных способах. В одном варианте осуществления, набор включает в себя антитела, продуцируемые способами по данному изобретению, предпочтительно очищенные антитела, в одном или нескольких контейнерах. В специфических вариантах осуществления, наборы по настоящему изобретению содержат по существу изолированный гаптен, который специфически иммунноактивен в отношении антитела, включенного в набор. Предпочтительно наборы по настоящему изобретению, дополнительно содержат контрольное антитело, которое не взаимодействует с интересующим гаптеном. В другом конкретном варианте осуществления наборы по настоящему изобретению содержат средства для определения связывания интересующего гаптена антителом (например, антитело может быть конъюгировано с детектируемым субстратом, таким как флуоресцентное соединение, ферментативный субстрату, радиоактивное соединение или люминесцирующее соединение или вторым антителом, которое при распознавании первого антитела может быть конъюгировано с детектируемым субстратом).

В другом специфическом варианте осуществления настоящего изобретения набор является диагностическим набором для применения для скрининга антител в сыворотке, специфичных против никотина. Такой набор включает в себя антитела подклассов IgA, IgE, IgG и IgG, направленных против никотина и получаемых при иммунизации человека конъюгатами никотин-VLP Qβ по настоящему изобретению. Такой набор включает в себя контрольное антитело, которое не взаимодействует с никотином, и по существу изолированный никотин, гаптены котинина и норникотина и очищенную коровую частицу без гаптена. Кроме того, такой набор включает в себя способы для определения связывания указанного антитела никотинового гаптена (например, антитело может быть конъюгировано с флуоресцентным соединение, таким как флуоресцин или родамин, которое может быть определено проточной цитометрией, или HRP для применения в ELISA). В одном из специфических вариантов осуществления набор может включать в себя никотин, присоединенный к твердой подложке. В данном изобретении рассматривается применение такого набора, где титр различных иммунноглобулиновых классов и подклассов определяют в ELISA. Антиникотиновые антитела IgA, IgE и IgG, представленные в наборе, служат в качестве контролей для оценки относительных титров антител в сыворотке пациента. После связывания антител сыворотки и набора с никотиновым гаптеном и удаления несвязавшихся компонентов сыворотки путем промывки антитела взаимодействовали с антителами, специфическими в отношении подклассов иммуноглобулинов, которые конъюгированы с репортерными молекулами. После дополнительной стадии промывки для удаления несвязавшихся меченых антител определяли количество репортерных молекул, связанных с твердой фазой, в присутствии подходящего флуорометрического, люминесцирующего или калориметрического субстрата (Sigma, St. Louis, MO).

Таким образом, используя вышеописанные наборы, данное изобретение представляет способ контроля за процессом иммунизации против никотина. За иммунизированным субъектом может осуществляться контроль в течение курса иммунизации антителами IgG и IgA против никотина и за отсутствием антител IgE против никотина, которые могут указывать на развитие аллергической реакции. Если иммунный ответ является первичным против коровой частицы, а не гаптена, может использоваться другой никотиновый конъюгат с отличающейся коровой частицей и, в одном из вариантов осуществления, отличающийся гаптен.

В одном из вариантов осуществления набор включает в себя твердую подложку, к которой присоединен конъюгат никотин-коровая частица. В этом варианте осуществления, связывание антитела в сыворотке субъекта для антиген презентации, коровая частица может быть определена связыванием репортерного меченого антитела.

Агент твердой подложки в вышеуказанном анализе получали известными способами для присоединения белкового вещества к материалу твердой подложки, такому как полимерные бусы, щуп, 96-луночная плашка или материал фильтра. Эти способы присоединения включают в себя неспецифическую адсорбцию белка на подложку или ковалентное присоединение белка, обычно посредством свободной аминогруппы, к химической реакционно-способной группе на твердом носителе, таком как активированная карбоксильная, гидроксильная или альдегидная группа. Альтернативно, могут использоваться плашки, покрытые стрептовидином, в сочетании с биотинилированным антигеном(ами).

Таким образом, данное изобретение относится к системам для анализа или наборам для осуществления диагностических способов. Набор обычно включает в себя связанный рекомбинантный антиген и репортерное меченое антитело для определения связанного анти-антиген антитело. Другие подходящие наборы по настоящему изобретению понятны специалисту в данной области.

Специалисту в данной области понятно, какие другие подходящие модификации и изменения способов, описанных здесь, можно осуществить и не выходя за рамки объема данного изобретения или любых вариантов его осуществления. На основании подробного описания настоящего изобретения специалисту в данной оласти будет более понятны возможности осуществления данного изобретения, ссылаясь на примеры, которые представлены только для иллюстрации и не предназначены для ограничения данного изобретения.

Примеры

Пример 1

Процедура присоединения конъюгата никотин-Qβ

Производное никотина, подходящее для присоединения к VLP, синтезировали в соответствии с Langone et al. (1982, supra). Транс-4'-карбоксикотинин доступен из коммерческих источников. Метиловый эфир транс-4'-карбоксикотинина получали путем взаимодействия транс-4'-карбоксикотинина с метаноловой серной кислотой. Раствор нейтрализовали бикарбонатом натрия, экстрагировали хлороформом, концентрировали на роторном испарителе и перекристаллизовывали из простого эфира-ацетона. Восстановление метилового эфира алюмогидридом лития в эфире затем давало транс-3'-гидроксиметилникотин. Затем получали O'-сукцинил-гидроксиметилникотин путем добавления янтарного ангидрида в бензол. Раствор концентрировали на роторном испарителе. Затем проводили активацию карбоксильной группы путем добавления EDC (1-этил-3-(3-диметиламинопропил)карбодиимида) и N-гидроксисукцинимида (NHS), что приводило к образованию N-гдроксисукцинимидного эфира O'-сукцинилгидроксиметилникотина (указан ниже в виде аббревиатуры «Suc-Nic»).

Проводили диализ Qβ CP VLP (последовательность ID NO: 3) против Hepes-забуференного солевого раствора HBS (50 мМ Hepes, 150 мМ NaCl, pH 8,0). Производное никотина Suc-Nic растворяли в HBS при концентрации 121 мМ. Раствор добавляли к Qβ CP VLP раствору (0,14 мМ) при 1x, 5x, 50x, 100x и 500x молярный избыток и инкубировали при комнатной температуре в течение 2 часов на шейкере. Реакционный раствор затем подвергали диализу против HBS, pH 8,0 (отсекали 10000 Да), быстро замораживали в жидком азоте и хранили при -80°C. Производное никотина Suc-Nic взаимодействовало с лизинами на поверхности Qβ с образованием амидной связи. Полученный ковалентный конъюгат обозначали здесь «Nic-Qβ».

Анализ SDS-PAGE показал, что с увеличением молярного избытка Suc-Nic происходит перемещение полосок мономеров Qβ к более высоким молекулярным массам (фиг.1A). Присутствие никотина в конъюгированном продукте подтверждалось Вестерн блотом, используя антиникотиновую сыворотку. Тогда как неконъюгированный Qβ контроль и Qβ, конъюгированный с никотином с избытком 1x и 5x, не показывали полосок с активностью против никотина, полоски 50x, 100x и 500x явно демонстрировали ковалентное связывание никотина с Qβ (фиг.1B). Это подтверждалось в анализе ELISA с никотином-BSA, нанесенным на лунки, и визуализацией анти-никотиновой сывороткой. Наибольшее поглощение достигалось, когда Qβ взаимодействовал с 500-кратным избытком никотина при сравнении с вакциной, полученной с 50-кратным избытком.

Пример 2

Иммунизация мышей Nic-Qβ и измерение титров анти-никотиновых антител

A. Иммунизация мышей

Самки мышей Balb/c в возрасте 10 недель вакцинировали дважды 30 мкг конъюгатом никотин-Qβ (Nic-Qβ), полученного при присоединении Suc-Nic, используя его 500x избыток. Вакцину разбавляли в стерильном PBS и вводили интраназально или подкожной инъекцией без или с добавлением Alum (Imject, Pierce). Через 14 дней после иммунизации мышей иммунизировали бустерной инъекцией (табл.1). На 29 день титры никотин-специфичных антител в сыворотки определяли с помощью ELISA.

Таблица 1
Схема иммунизации мышей
День 0День 14День 29
Колич.

животных
ВакцинаКоличество(мкг)Количество(мкг)Сбор крови
3Nic-Qβ п.к.3030Сбор крови
3Nic-Qβ п.к. & Alum3030Сбор крови
3Nic-Qβ интраназально3030Сбор крови

B. ELISA.

Сыворотку анализировали в никотин-специфическом ELISA: микротитровальные плашки (Maxisorp, Nunc) в течение ночи покрывали 5 мкг/мл никотина, присоединенного к BSA (NAB03) в буфере для покрытия (pH 9,6). После промывки и блокирования 2% BSA в PBS добавляли сыворотку с различными разведениями в 2% BSA/1% FCS/PBS. Через 2 часа инкубирования при комнатной температуре плашки промывали (0,05% Tween 20/PBS) и добавляли HRPO-меченые антитела, специфические для мышиных субклассов антител. Через 1 час инкубирования плашки промывали и добавляли цветной субстрат OPD в буфере с лимонной кислотой. Через 5 минут цветную реакцию останавливали с помощью 5% H2SO4.

Оптическую плотность при 450 нм считывали в считывающем устройстве ELISA (Benchmark, Becton Dickinson). Для определения IgE сыворотку заранее инкубировали в пробирках Eppendorf с бусами с белком G (Pierce) в течение 30 минут на шейкере перед добавлением в плашку для ELISA.

Вакцина Nic-Qβ индуцировала никотин-специфические антитела IgG (фиг.3A). Титры ELISA рассчитывали для оценки общего ответа IgG (фиг.3B, табл.2). Титр ELISA определяли как разведение сыворотки, которая давала половину от максимального сигнала оптической плотности (OD 50%) в ELISA. Для подкожного пути с добавлением Alum средние титры IgG, полученные Nic-Qβ, составляли 13228. Для интраназального пути титры никотин-Qβ, составляли 38052.

Субтитры IgG и IgE также измеряли с помощью ELISA и определяли титры (фиг.3, фиг.4, табл.2). Ни при каких тестрированных условиях не было обнаружено значительного ответа IgE выше фонового (неиммунная сыворотка). Отношение титров антител IgG2a и IgG1 свидетельствует об иммунном ответе, обусловленном Th1. У мышей, иммунизированных подкожно Nic-Qβ в отсутствие Alum, измеренное отношение составило 2,1, а при интраназальном введении было даже больше, 2,6. Как и ожидалось, Alum направлял иммунный ответ больше к ответу типа Th2, и полученное отношение составляло 0,4. Примечательно, что вакцины Nic-Qβ также индуцировали высокие титры IgG2b и IgG3. В сыворотке может быть обнаружено значительное количество анти-никотиновых антител IgA (фиг.5), что свидетельствует о присутствии IgA на поверхности слизистой оболочки.

Особенно примечательны высокие никотиновые титры при интраназальной иммунизации.

Таблица 2

Титры никотин-специфических антител у вакцинированных мышей

Титры подсчитывали как разведение сыворотки, которое давало половину максимального сигнала оптической плотности в ELISA. Даны средние титры для групп из 3 мышей.

ВакцинаТитры IgGТитры IgG1Титры IgG2aТитры IgG2bТитры IgG3
Nic-Qβ п.к.1322867213865152030
Nic-Qβ alum п.к.937629642100161497719701
Nic-Qβ интраназально380522845749336176107

Пример 3

Оценка распределения никотина в плазме и мозге крыс

Группы крыс иммунизировали вакциной никотин-VLP, бустерную инъекцию осуществляли на 21 день. Одна группа получала вторую бустерную инъекцию на 35 день. Семь крыс на 10 день после последней бустерной инъекции анастезировали и вводили катетеры в бедренную артерию и вену для взятия образца и в яремную вену другой ноги для введения никотина. Никотин 0,03 мг/кг, содержащий 3 микроКи 3H-(-)-никотина, вводили в 1 мл/кг 0,9% физиологического раствора через яремную вену в течение 10 секунд. Радиоактивную метку добавляли для того, чтобы оценить концентрации никотина в очень маленьком количестве крови. Это допустимо, так как метаболизм никотина в котинин происходит в течение первых 90 секунд после введения ничтожного количества никотина. Кровь (0,3 мл) отбирали как из бедренной артерии, так и вены, через катеторы каждые 15 сек - 90 сек, сразу центрифугировали и сыворотку отделяли для анализа. Крыс убивали на 3 минуту путем обезглавливания, мозг быстро удаляли, промывали водой и хранили при -20°C перед анализом. Для изменения концентраций 3H-никотина в сыворотке 100 мкл сыворотки смешивали с сцинтилляционной жидкостью. Образцы мозга разрушали в 5 объемах NaOH перед экстракцией и проведением анализа после добавления сцинтилляционной жидкости.

Никотин-специфические антитела, индуцированные вакцинацией, способны связывать 3H-никотин в сыворотке и ингибировать или снижать его распространение в мозге. Таким образом измеряли пониженные концентрации никотина в мозге и повышенные концентрации никотина в плазме.

Пример 4

Химическое присоединение никотинового гаптена к HbcAg-Lys

O-сукцинил-гидроксиметилникотин получали, как описано в примере 1, и инкубировали с EDC и NHS с получением активированного N-гидроксисукцинамидного эфира (Suc-Nic). Очищенные HbcAg-Lys VLP получали, как описано в патентной заявке США № 10/050902, находящейся в процессе одновременного рассмотрения. Раствор Suc-Nic в HBS добавляли с 1x, 5x, 50x, 100x и 500x молярным избытком к раствору HBcAg-Lys частиц (2 мг/мл) со степенью очистки 95% и инкубировали в течение 2 часов при комнатной температуре. После окончания взаимодействия смесь диализировали в течение ночи против HBS, pH 8,0, быстро замораживали в жидком азоте и хранили при -80°C. Взаимодействие контролировали с помощью анализа SDS-PAGE и Вестерн блота с анти-никотинов антисывороткой. Частицы с никотином вводили грызунам для индукции иммунных ответов против никотина.

Пример 5

Химическое присоединение никотинового гаптена к фимбриям типа-1 Escherichia coli

Фимбрии типа I получали из штамма W3110 E. coli,трансформированного вектором pFIMAICDFGK, и очищали ультрацентрифугированием, как описано в принадлежащей данным заявителям патентной заявке США № 10/050902, поданной 18 января 2002, находящейся в процессе одновременного рассмотрения, описание которой приведено здесь в качестве ссылки в полном объеме. Активированный гаптен Suc-Nic в HBS добавляли с 1x, 5x, 50x, 100x и 500x молярным избытком в раствор частиц фимбрий типа 1 со степенью чистоты 95% (2 мг/мл) и инкубировали в течение 2 часов при комнатной температуре. После окончания взаимодействия смесь диализировали против HBS, pH 8,0, быстро замораживали в жидком азоте и хранили при -80°C. Взаимодействие контролировали с помощью анализа SDS-PAGE и Вестерн блота с антиникотиновой антисывороткой. Частицы с никотином вводили грызунам для индукции иммунных ответов против никотина.

Пример 6

Синтез мультигаптеновой вакцины, которая может применяться для лечения никотинозависимости

Вакцину против никотинозависимости разрабатывали для мультиэпитопов никотина и также получали фармацевтически активные метаболиты котинин и норникотин. Отдельные 120 мМ растворы в HBS 6-(карбоксиметилуреидо)-(±)-никотина (CMUNic), транс-3'-аминометилникотин сукцината, O-сукцинил-3'-гидроксиметилникотина, транс-4'-карбоксикотинина, N-[1-оксо-6-[(2S)-2-(3-пиридинил)-1-пирролидинил]гексил]-β-аланина, 4-оксо-4-[[6-[(5S)-2-оксо-5-(3-пиридинил)-1-пирролидинил]]гексил]амино]масляной кислоты, фенилметилового эфира (2S)-2-(3-пиридинил)-1-пирролидинмасляной кислоты, фенилметилового эфира (2R)-2-(3-пиридинил)-1-пирролидинмасляной кислоты, котинин 4'-карбоновой кислоты, N-сукцинил-6-амино-(±)никотина, 6-(.сигма.-аминокапрамидо)-(±)-никотин- и 6-(.сигма.-аминокапрамидо)-(.±.)-никотин-конъюгатов; сукцинилированных 3', 4' и 5' аминометилникотинов, 5 и 6 аминоникотина и 3', 4', и 5' ацетил производных ацетил никотина. Растворы смешивали с EDC и NHS с получением активированных форм, которые добавляли, в разделенных реакциях, с 10-100 молярным избытком к Qβ VLP, как описано здесь.

Отдельные растворы S-1-(b-аминоэтил)никотиний хлорид дигидрохлорида и S-1-(b-аминоэтил)котиний хлорид гидрохлорид присоединяли к Qβ VLP с 1-циклогексил-3-(2-морфолиноэтил)карбодиимид мето-п-толуолсульфонатом.

Из этих выбранных конъюгатов восемь конъюгатов никотинового гаптен-VLP Qβ, конъюгат котинин-VLP Qβ и конъюгат номикотин-VLP Qβ затем смешивали с получением композиции вакцины, которую использовали для вакцинации субъектов. После введения 2 доз субъектам 3 раза делали бустерную инъекцию конъюгатов, параллельных гаптену, присоединенных к VLP HBc-Lys.

Пример 7

Синтез конъюгата кокаиновый гаптен-VLP

Раствор норкокаина гидрохлорида (1 г, 3,07 ммоль), триэтиламина (0,86 мл, 6,14 ммоль) в метиленхлориде (20 мл) подвергали действию ангидрида янтарной кислоты (614 мг, 6,14 ммоль) и смесь нагревали при 45° в течение ночи, как описано в патенте США 5876727. Растворители удаляли при пониженном давлении и остаток очищали, используя флэш-хроматографию на силикагеле (в качестве элюента 2:1 хлороформ:метанол). Хроматография давала сукцинилированный норкокаин (1,0 г, 84%) в виде жирного сиропа (метиловый эфир 3.бета.-(бензоилокси)-8-сукциноил-8-азабицикло[3.2.1]октан-2.бета.-карбоновой кислоты). К раствору кислоты (14 мг, 0,036 ммоль) в дистиллированной воде (1 мл) при 0°С добавляли EDC (10,4 мг, 0,055 ммоль). Через 5 минут по каплям добавляли раствор VLP Qβ в PBS (1 мл) и смесь оставляли нагреваться до температуры окружающей среды в течение ночи. Конъюгат очищали диализом против PBS и степень конъюгирования анализировали с помощью масс-спектрального анализа. Полученные конъюгаты использовали для иммунизации субъектов.

На основании полного, детального описания настоящего изобретения посредством иллюстраций и примеров для большего понимания специалисту в данной области очевидно, что возможны модификации и изменения изобретения в рамках его объема и эквивалентных условиях, композициях и других параметров, не влияя на объем данного изобретения или любой конкретный вариант его осуществления, и такие модификации или изменения включены в объем присоединенной формулы изобретения.

Все публикации, патенты и патентные заявки, указанные в описании, вполне понятны среднему специалисту в данной области, для которого данные публикации и предназначаются, и включены в настоящее описание в виде ссылки в том же объеме, что и оригинальная публикация, что касается патента или патентной заявки, в частности, то они указаны отдельно, как включенные в виде ссылки.

Пример 8

Оценка распределения никотина в плазме и мозге мышей

Группы из 4-5 мышей иммунизировали 60 мкг вакцины никотин-VLP, полученной, как описано в примере 1, и делали бустерную инъекцию на 35 день и 63 день с тем же количеством вакцины. Через четырнадцать дней после последней бустерной инъекции мышам внутривенно вводили в начало хвоста раствор, содержащий 750 нг (-)-никотина гидротартрата с 5 микроКи 3H-(-)-никотина. Количество никотина соответствовало 0,03 мг/кг, которое было эквивалентно никотину, поглощаемому курильщиком из 2 сигарет. Радиоактивную метку добавляли для того, чтобы оценить концентрации никотина в очень маленьком количестве крови. Через пять минут мышей убивали для проведения эксперимента путем CO2. Кровь извлекали путем пункции сердца и получали сыворотку. Мозги сразу иссекали, очищали от прилипшей крови и измеряли вес. Для измерения концентрации 3H-никотина в сыворотке 50 мкл сыворотки смешивали с сцинтилляционной жидкостью. Образцы мозга полностью растворяли в 2 мл тканевого солюбилизатора (Serva) и анализировали после добавления сцинтилляционной жидкости. На основании радиоактивности рассчитывали концентрации никотина в сыворотке и мозге.

Индуцированные вакцинацией никотин-специфические антитела могли связывать 3H-никотин в сыворотке и ингибировать или снижать его распространение в мозге. Таким образом, были измерены пониженные концентрации никотина в мозге и повышенные концентрации никотина в плазме. Вакцина никотин-VLP была способна ингибировать поглощаемый мозгом никотин на 56% в отсутствие Alum и > 68% в присутствии Alum.

Дополнительные схемы иммунизации, такие как иммунизация на 0 день и повторная иммунизация на 14, также давали уровни антител, способные снижать поглощение никотина мозгом. Обычно высокие титры анти-никотиновых антител связаны с высокой эффективностью вакцинации.

Пример 9

Клонирование гена белка оболочки AP205

кДНК белка оболочки (БО) AP205 (SEQ ID NO: 90) собирали из двух фрагментов кДНК, полученных из РНК фага AP205, используя способы обратной транскрипции - ПЦР и клонировали в коммерчески доступной плазмиде pCR 4-TOPO для секвинирования. Способы обратной транскрипции хорошо известны специалисту в этой области. Первый фрагмент, содержащийся в плазмиде p205-246, содержал 269 нуклеотидов выше последовательности БО и 74 нуклеотида, кодирующих первые 24 N-концевых аминокислоты БО. Второй фрагмент, содержащийся в плазмиде p205-262, содержал 364 нуклеотидов, кодирующих аминокислоты 12-131 БО и дополнительные 162 нуклеотида ниже последовательности БО. Обе плазмиды, и p205-246, и p205-262, были щедро подарены J. Klovins.

Плазмида 283.-58 была сконструирована с помощью двухстадийной ПЦР, для того чтобы соединить фрагменты БО плазмид p205-246 и p205-262 в одну последовательность БО всей длины.

Использовали праймер p1.44, расположенный в направлении 3'-5' и содержащий сайт NcoI для клонирования в плазмиду pQb185, или p1.45, содержащий сайт XbaI для клонирования в плазмиду pQb10, и праймер p1.46, расположенный в направлении 5'-3' и содержащий сайт рестрикции HindIII (подчеркнуты последовательности, распознаваемые ферментами рестрикции):

p1.44 5'-NNCC ATG GCA AAT AAG CCA ATG CAA CCG-3' (SEQ ID NO: 5)

p1.45 5'-NNTCTAGAATTTTCTGCGCACCCATCCCGG-3' (SEQ ID NO: 20)

p1.46 5'-NNAAGC TTA AGC AGT AGT ATC AGA CGA TAC G-3'

(SEQ ID NO:21)

Для амплификации фрагментов в первом цикле ПЦР использовали два дополнительных праймера, p1.47, отжиг на 5' конце фрагмента, содержащегося в p205-262, и p1.48, отжиг на 3' конце фрагмента, содержащегося с плазмиде p205-246. Праймеры p1.47 и p1.48 были комплементарны друг другу.

p1.47: 5'-GAGTGATCCAACTCGTTTATCAACTACATTTTCAGCAAGTCTG-3' (SEQ ID NO: 22)

p1.48: 5'-CAGACTTGCTGAAAATGTAGTTGATAAACGAGTTGGATCACTC-3' (SEQ ID NO: 23)

В первых двух реакциях ПЦР получали два фрагмента. Первый фрагмент получали с помощью праймеров p1.45 и p1.48 и образца p205-246. Второй фрагмент получали с помощью праймеров p1.47 и p1.46 и образца p205-262. Оба фрагмента использовали в качестве образцов для второй реакции ПЦР, сплайс-оверлап экстенцию, с комбинацией праймеров p1.45 и p1.46 или p1.44 и p1.46. Продукт двух реакций второй стадии ПЦР конструировали с помощью XbaI или NcoI соответственно и HindIII и клонировали с помощью тех же сайтов рестрикции в pQb10 или pQb185 соответственно два pGEM-модифицированного вектора экспрессии под контролем промотора триптофанового оперона E.coli.

Были получены две плазмиды, pAP283-58 (SEQ ID NO: 15), содержащие ген, кодирующий БО AP205 дикого типа (SEQ ID NO: 14) в pQb10, и pAP281-32 (SEQ ID NO: 19) с мутацией Pro5->Thr (SEQ ID NO: 18) в pQb185. Последовательности белка оболочки верифицировали с помощью сиквенирования ДНК. PAP283-58 содержат 49 нуклеотидов, располагающихся выше кодона ATG БО, ниже сайта XbaI, и содержат предполагаемый природный рибосомально-связывающий сайт мРНК белка оболочки.

Пример 10

Экспрессия и очистка рекомбинантных AP205 VLP

A. Экспрессия рекомбинантных AP205 VLP

E.coli JM109 трансформировали плазмидой pAP283-58. 5 мл жидкой среды LB с 20 мкг/мл ампициллина инкубировали с единичной колонией при 37°C в течение 16-24 часов без перемешивания.

Полученный инокулят разводили 1:100 в 100-300 мл среды LB, содержащей 20 мкг/мл ампициллина, и инкубировали при 37°C в течение ночи без перемешивания. Полученный второй инокулят разводили 1:50 в среде 2TY, содержащей 0,2% глюкозы и фосфата для буферизации, и инкубировали при 37°C в течение ночи на шейкере. Клетки собирали центрифугированием и замораживали при -80°C.

B. Очистка рекомбинантных AP205 VLP

Растворы и буферы:

1. Буфер для лизиса

50 мМ Tris-HCl pH 8,0 с 5 мМ EDTA, 0,1% TritonХ100 и PMSF с 5 микрограммами на мл.

2. SAS

Насыщенный сульфат аммония в воде

3. Буфер NET.

20 мМ Tris-HCl, pH 7,8 с 5 мМ EDTA и

150 мМ NaCl.

4. PEG

40% (мас./об.) полиэтиленгликоля 6000 в NET

Лизис:

Замороженные клетки ресуспенировали в буфере для лизиса в количестве 2 мл/г клеток. Смесь подвергали действию ультразвука 22 kH пять раз в течение 15 секунд с интервалами 1 мин для охлаждения на льду. Лизат затем центрифугировали в течение 20 минут при 12000 об/мин, используя F34-6-38 ротор (Ependorf). Все стадии центрифугирования, описанные ниже, осуществляли, используя один и тот же ротор, если не указано иного. Супернатант хранили при 4°C, во время чего остатки клеток промывали два раза буфером для лизиса. После центрифугирования объединяли супернатанты лизата и фракции промывки.

Для очистки VLP AP205 может затем использоваться осаждение сульфатом аммония. В первой стадии выбирали концентрацию сульфата аммония, при которой не осаждались VLP AP205. Полученный осадок удаляли. В следующей стадии выбирали концентрацию сульфата аммония, при которой количественно осаждались VLP AP205, и VLP AP205 отделяли от осадка этой стадии осаждения путем центрифугирования (14000 об/мин в течение 20 минут). Полученный осадок солюбилизировали в буфере NET.

Хроматография:

Белок оболочки из объединенных супернатантов помещали на колонку Sepharose 4B (2,8 X 70 см) и элюировали буфером NET при 4 мл/час/фракция. Фракции 28-40 собирали и осаждали сульфатом аммония при 60% насыщении. Фракции анализировали SDS-PAGE и Вестерн блотом с антисывороткой, специфичной для AP205 по осаждению. Осадок отделяли путем центрифугирования, еще раз солюбилизировали в буфере NET и помещали на колонку Sepharose 2B (2,3 X 65 см), элюировали при 3 мл/ч/фракция. Фракции анализировали с помощью SDS-PAGE и фракции 44-50 собирали, объединяли и осаждали сульфатом аммония с 60% насыщенностью. Осадок, выделенный центрифугированием, ресолюбилизировали в буфере NET и очищали на колонке Sepharose 6B (2,5 X 47 см), элюировали при 3 мл/час/фракция. Фракции анализировали с помощью SDS-PAGE. Фракции 23-27 собирали, концентрацию соли доводили до 0,5 M и осаждали PEG 6000, добавляли из 40% основного раствора в воду до конечной концентрации 13,3%. Осадок, выделенный центрифугированием, ресолюбилизировали в буфере NET и помещали на колонку Sepharose 2B, как указано выше, элюируя тем же образом. Фракции 43-53 собирали и осаждали сульфатом аммония с 60% насыщенностью. Осадок, выделенный центрифугированием, ресолюбилизировали в воде и полученный белок экстенсивно диализировали против воды. Может быть выделено приблизительно 10 мг очищенного белка на грамм клеток. Оценка вирусоподобных частиц электронной микроскопией показала, что они идентичны фаговым частицам.

1. Конъюгат гаптен-носитель для индукции иммунного ответа на лекарственный препарат, вызывающий привыкание или допускающий злоупотребление, содержащий а. коровую частицу, содержащую, по крайней мере, один первый сайт присоединения, где указанная коровая частица представляет собой вирусоподобную частицу РНК-содержащего фага и b. по крайней мере, один гаптен никотина, по крайней мере, с одним вторым сайтом присоединения и где указанный второй сайт присоединения способен к ассоциации посредством, по крайней мере, одной ковалентной непептидной связи с указанным первым сайтом присоединения, образуя, таким образом, упорядоченный и повторяющийся конъюгат гаптена-носителя.

2. Конъюгат по п.1, где указанная вирусоподобная частица РНК-содержащего фага содержит рекомбинатные белки РНК-содержащего фага или их фрагменты.

3. Конъюгат по п.1 или 2, где указанный РНК-содержащий фаг выбран из группы, включающей

(а) бактериофаг Qβ;

(b) бактериофаг R17;

(c) бактериофаг fr;

(d) бактериофаг GA;

(e) бактериофаг SP;

(f) бактериофаг MS2;

(g) бактериофаг M11;

(h) бактериофаг МХ1;

(i) бактериофаг NL95;

(j) бактериофаг f2;

(k) бактериофаг АР205 и

(l) бактериофаг РР7.

4. Конъюгат по п.1 или 2, где указанный РНК-содержащий фаг представляет собой Qβ.

5. Конъюгат по п.2, где рекомбинантные белки включают в себя или альтернативно состоят из белков оболочки РНК-содержащих фагов, и где предпочтительно указанные белки оболочки РНК-содержащих фагов имеют аминокислотную последовательность, выбранную из группы, включающей

(a) SEQ ID NO:3;

(b) смесь SEQ ID NO: 3 и SEQ ID NO: 4;

(c) SEQ ID NO: 24;

(d) SEQ ID NO: 25;

(e) SEQ ID NO: 26;

(f) SEQ ID NO: 27;

(g) смесь SEQ ID NO: 27 и SEQ ID NO: 28;

(h) SEQ ID NO: 29;

(i) SEQ ID NO: 30;

(j) SEQ ID NO: 31;

(k) SEQ ID NO: 32;

(l) SEQ ID NO: 33;

(m) SEQ ID NO: 13 и

(n) SEQ ID NO: 14.

6. Конъюгат по п.2, где рекомбинантные белки включают в себя или альтернативно, состоят из белков оболочки РНК-содержащих фагов, где указанные белки оболочки РНК-содержащих фагов имеют аминокислотную последовательность SEQ ID NO: 3.

7. Конъюгат по п.2, где указанные рекомбинантные белки указанного РНК-содержащего фага включают в себя или альтернативно состоят из одного или нескольких мутантных белков оболочек РНК-содержащих фагов, и где предпочтительно указанный РНК-содержащий фаг выбран из группы, включающей

(a) бактериофаг Qβ;

(b) бактериофаг R17;

(c) бактериофаг fr;

(d) бактериофаг GA;

(e) бактериофаг SP;

(f) бактериофаг MS2;

(g) бактериофаг М11;

(h) бактериофаг МХ1;

(i) бактериофаг NL95;

(k) бактериофаг f2;

(l) бактериофаг РР7 и

(m) бактериофаг АР205.

8. Конъюгат по п.7, где указанные мутантные белки оболочки указанного РНК-содержащего фага модифицированы (а) путем удаления, по крайней мере, одного остатка лизина в виде замены, (b) путем добавления, по крайней мере, одного остатка лизина путем замены, (с) путем делеции, по крайней мере, одного остатка лизина, или (d) добавлением, по крайней мере, одного остатка лизина в виде вставки.

9. Конъюгат по п.2, где указанные рекомбинантные белки включают в себя мутантные белки оболочки Qβ, и где предпочтительно указанные мутантные белки оболочки Qβ модифицированы (а) путем удаления, по крайней мере, одного остатка лизина в виде замены, (b) путем добавления, по крайней мере, одного остатка лизина в виде замены, (с) путем делеции, по крайней мере, одного остатка лизина, или (d) путем добавления, по крайней мере, одного остатка лизина в виде вставки, или где предпочтительно указанные мутантные белки оболочки Qβ включают в себя белки, имеющие аминокислотную последовательность, выбранную из группы, включающей

(a) аминокислотную последовательность SEQ ID NO: 6;

(b) аминокислотную последовательность SEQ ID NO: 7;

(c) аминокислотную последовательность SEQ ID NO: 8;

(d) аминокислотную последовательность SEQ ID NO: 9 и

(e) аминокислотную последовательность SEQ ED NO: 10.

10. Конъюгат по п.1, где указанные первые сайты присоединения включают в себя

(a) аминогруппу;

(b) карбоксильную группу;

(c) сульфгидрильную группу;

(d) гидроксигруппу;

(e) группу гуанидинила или

(f) группу гистидинила.

11. Конъюгат по п.1, где указанный, по крайней мере, один первый сайт присоединения выбран из остатка лизина, остатка аргинина, остатка цистеина, аспартата, глутаминового остатка, остатка серина, остатка треонина, остатка гистидина и остатка тирозина.

12. Конъюгат по п.1, где указанный, по крайней мере, один первый сайт присоединения представляет собой остаток лизина.

13. Конъюгат по п.1, где конъюгат получают из исходных продуктов, выбранных из группы, включающей

(a) 6-(карбоксиметилуреидо)-(±)-никотин (CMUNic);

(b) транс-3'-аминометилникотин сукцинат;

(c) О-сукцинил-3'-гидроксиметилникотин;

(d) транс-4'-карбоксикотинин;

(e) N-[1-оксо-6-[(2S)-2-(3-пиридил)-1-пирролидинил]гексил]-β-аланин;

(f) N-сукцинил-6-амино-(±)-никотин;

(g) 6-(.сигма.-аминокапрамидо)-(±)-никотин;

(h) 3'-аминометилникотин;

(i) 4'-аминометилникотин;

(j) 5'-аминометилникотин;

(k) 5-аминоникотин;

(l) 6-аминоникотин; и

(m) S-1-(b-аминоэтил)никотиний хлорид.

14. Конъюгат по п.1, где указанный гаптен включает в себя исходный продукт О-сукцинил-3'-гидроксиметилникотин.

15. Конъюгат по п.1, где указанный конъюгат содержит O-сукцинил-3'-гидроксиметилникотин, конъюгированный с вирусоподобной частицей Qβ.

16. Конъюгат по п.1, где указанный гаптен получен из исходного продукта О-сукцинил-3'-гидроксиметилникотина.

17. Конъюгат по п.1, где второй сайт присоединения содержит предпочтительно представляет собой, активную группу, выбранную из группы, включающей

(a) амин;

(b) амид;

(c) карбоксил;

(d) сульфгидрил;

(e) гидроксил;

(f) альдегид;

(g) диазоний;

(h) ацилгалогенид;

(i) гидразин;

(j) винил;

(k) малеимид;

(l) сукцинимид и

(m) гидразид.

18. Конъюгат по п.1, где второй сайт присоединения содержит предпочтительно представляет собой амид.

19. Конъюгат по п.1, где указанный второй сайт присоединения образован путем взаимодействия О-сукцинильной группы указанного О-сукцинил-3'-гидроксиметилникотина с первым сайтом присоединения, и предпочтительно указанным первым сайтом присоединения является остаток лизина.

20. Конъюгат по п.1, где указанный конъюгат включает в себя О-сукцинил-3'-гидроксиметилникотин, конъюгированный с вирусоподобной частицей Qβ, и, таким образом, предпочтительно с вирусоподобной частицей Qβ, содержащей или предпочтительно состоящей из белков оболочки РНК-содержащего фага Qβ.

21. Фармацевтическая композиция для индукции иммунного ответа на никотин, содержащая эффективное количество конъюгата по любому из предшествующих пунктов и фармацевтически приемлемый носитель, и где предпочтительно указанная фармацевтическая композиция дополнительно содержит адъювант, или где предпочтительно указанная композиция не содержит адъювант.

22. Композиция вакцины для индукции иммунного ответа на никотин, содержащая эффективное количество конъюгата по любому из пп.1-20, и где предпочтительно указанная вакцина содержит адъювант, или где предпочтительно указанная композиция вакцины не содержит адъювант.

23. Способ индукции иммунного ответа на никотин у животного, где указанный способ включает введение иммунологически эффективного количество конъюгата по любому из предшествующих пунктов животному и позволяющего у указанного животного вызывать иммунный ответ на никотин, и где предпочтительно указанный конъюгат вводят указанному животному путем, выбранным из группы, включающей интраназальный, пероральный, подкожный, чрезкожный, внутримышечный или внутривенный пути, и где предпочтительно указанный путь является интраназальным.

24. Способ лечения или профилактики никотиновой зависимости у животного, где указанный способ включает введение животному иммунологически эффективного количества конъюгата никотиновый гаптен-носитель, содержащего

(а) вирусоподобную частицу носителя, по крайней мере, с одним первым сайтом присоединения, и

(b) по крайней мере, один никотиновый гаптен, по крайней мере, с одним вторым сайтом присоединения;

где указанная вирусоподобная частица содержит или альтернативно состоит из рекомбинантных белков или их фрагментов, РНК-содержащего фага;

где указанный второй сайт присоединения способен связываться посредством, по крайней мере, одной ковалентной связи с указанным первым сайтом присоединения с образованием таким образом упорядоченного и повторяющегося конъюгата никотиновый гаптен-носитель, и где указанный второй сайт присоединения способен связываться с первым сайтом присоединения посредством по меньшей мере непептидной связи;

и где предпочтительно указанную композицию вводят указанному животному интраназально, перорально, подкожно, чрезкожно, внутримышечно или внутривенно; и, в частности, где животным является человек.

25. Фармацевтическая композиция для лечения никотиновой зависимости, временного ослабления симптомов отмены никотина, облегчения отвыкания от курения или профилактики рецидива, которая включает в себя терапевтически эффективное сочетание композиции вакцины по п.22 и дополнительного агента.

26. Композиция по п.25, где указанный дополнительный агент выбран из группы, включающей

(a) антидепрессант;

(b) модулятор никотинового рецептора;

(c) антагонист каннабиноидного рецептора;

(d) антагонист опиоидного рецептора;

(e) ингибитор моноаминоксидазы и

(f) анксиолитик.

27. Композиция по п.25, где указанный дополнительный агент представляет собой антидепрессант, выбранный из группы, включающей бупропион, доксепин, дезипрамин, кломипрамин, имипрамин, нортриптилин, амитриптилин, протриптилин, тримипрамин, флуоксетин, флувоксамин, пароксетин, сертралин, фенелзин, транилципромин, амоксапин, мапротилин, тразодон, венлафаксин, миртразапин и их фармацевтически активные соли и оптические изомеры, и где предпочтительно указанный антидепрессант представляет собой либо бупропион или его фармацевтически приемлемую соль, либо нортриптилин или его фармацевтически приемлемую соль.

28. Композиция по п.25, где указанный дополнительный агент представляет собой модулятор никотинового рецептора, выбранный из группы, включающей мекамиламин, SSR591813, амантадин, пемпидин, дигидро-бета-эритроидин, гексаметоний, эризодин, клоризондамин, триметафан камсилат, тубокурарин хлорид, d-тубокурарин, варениклин, их фармацевтически приемлемые соли и оптические изомеры, и где предпочтительно указанный модулятор никотинового рецептора представляет собой мекамиламин или его фармацевтически приемлемую соль или веренклин тартрат.

29. Композиция по п.25, где указанный дополнительный агент представляет собой (а) антагонист каннабиноидного рецептора, указанный каннабиноидный рецептор представляет собой римонабант, (b) анксиолитик, выбранный из группы, включающей гидроксизин, мепробамат, буспирон, их фармацевтически приемлемые соли и оптические изомеры, (с) клонидин или (d) сибутрамин.

30. Способ лечения табакозависимости или никотиновой зависимости, временного ослабления симптомов отмены никотина, облегчения отвыкания от курения или профилактики рецидива, который включает стадию введения пациенту композиции вакцины по п.22 и дополнительного агента, и, где предпочтительно указанную композицию вакцины вводят интраназально, перорально, подкожно, чрескожно, внутримышечно или внутривенно, и где указанный дополнительный агент вводят перорально или с помощью трансдермального пластыря.

31. Способ по п.30, где указанный дополнительный агент выбран из группы, состоящей из

(a) антидепрессант;

(b) модулятор никотинового рецептора;

(c) антагонист каннабиноидного рецептора;

(d) антагонист опиоидного рецептора;

(e) ингибитор моноаминоксидазы и

(f) анксиолитик.



 

Похожие патенты:

Изобретение относится к мицеллярному препарату, образованному из нового блок-сополимера и таксанового противоракового агента, и к противораковому средству, содержащему его в качестве активного ингредиента.
Изобретение относится к биотехнологии. .

Изобретение относится к области фармацевтической химии, конкретно к способу получения аналогов аденокортикотропного гормона (АКТГ) (4-10), обладающих нейротропной активностью.

Изобретение относится к области биотехнологии и генной инженерии и может быть использовано в фармацевтической промышленности. .
Изобретение относится к биотехнологии и может быть использовано в медицине для профилактики, лечения и диагностики заболеваний, обусловленных Neisseria meningitidis. .

Изобретение относится к биотехнологии и может быть использовано для сохранения пищевых продуктов. .

Изобретение относится к биотехнологии и может быть использовано для лечения и профилактики заболевания, ассоциированного с инфекцией стрептококком или Гр+ бактерией.

Изобретение относится к биотехнологии, в частности к глобальным регуляторам бактериальных патогенных генов, применяемых для придания устойчивости растений к болезням.

Изобретение относится к биотехнологии и представляет собой ген белка массой 120 кДа Ehrlichia canis, амплифицированный посредством ПЦР с использованием праймеров, происходящих от последовательностей ДНК, фланкирующих ген белка массой 120 кДа Ehrlichia chaffeensis.

Изобретение относится к области иммунобиотехнологии и может быть использовано для производства вакцины для лечения и профилактики инфекций респираторного тракта или воспаления среднего уха, а также диагностики инфекций, вызываемых Haemophilus influenzae.
Наверх