Активная иммунизация для создания антител к растворимому а-бета

Заявленная группа изобретений относится к медицине, а именно к неврологии, и может быть использована для профилактики и лечения болезни Альцгеймера. Способы по изобретению заключаются во введении фрагмента Аβ16-23, имеющего аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1. Также изобретение касается фрагмента Аβ16-23 и содержащей его фармацевтической композиции. Использование изобретения позволяет осуществлять профилактику и лечение болезни Альцгеймера за счет ингибирования формирования амилоидных отложений в мозге. 4 н. и 68 з.п. ф-лы, 2 ил.

 

ОБЛАСТЬ ТЕХНИКИ

Изобретение относится к области иммунологии и медицины.

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Болезнь Альцгеймера (AD от англ. Alzheimer's Disease) представляет собой прогрессирующее заболевание, приводящее к сенильной деменции. См. главным образом Selkoe, TINS 16, 403-409 (1993); Hardy et al., WO 92/13069; Selkoe, J. Neuropathol. Exp. Neurol. 53, 438-447 (1994); Duffet al., Nature 373, 476-477 (1995); Games et al., Nature 373, 523 (1995). В общих чертах, существует два варианта данной болезни: с поздним дебютом, когда заболевание проявляется в старческом возрасте (65 + лет), и с ранним дебютом, при котором болезнь развивается в пресенильном периоде, то есть между 35 и 60 годами. При обоих вариантах заболевания патологическая основа одинакова, но в случае более раннего начала изменения часто являются более грубыми и распространенными. Для заболевания характерно, по крайней мере, два типа повреждений головного мозга, сенильные бляшки и нейрофибриллярные сплетения. Сенильные бляшки представляют собой участки дезорганизованного нейропиля вплоть до 150 мкм в диаметре с внеклеточными отложениями амилоида в центре, которые видны на срезах ткани головного мозга при микроскопии. Нейрофибриллярные сплетения представляют собой внутриклеточные отложения микротрубочек, ассоциированных с тау-протеином, состоящих из двух нитей, сплетенных между собой попарно.

Основным компонентом бляшек является пептид, называемый Аβ пептидом или β-амидоидом. Аβ пептид представляет собой внутренний фрагмент размером 39-43 аминокислот белка-предшественника, называемого белком предшественником амилоида (АРР от англ. Amyloid Precursor Protein). Несколько мутаций белка АРР, предположительно, связаны с развитием болезни Альцгеймера. См., например, Goate et al., Nature 349, 704) (1991) (валин717 на изолейцин); Chartier Harlan et al., Nature 353, 844 (1991) (валин717 на глицин); Murrell et al., Science 254, 97 (1991) (валин717 на фенилаланин); Mullan et al., Nature Genet. 1, 345 (1992) (двойная мутация, приводящая к замене пары лизин595 - метионин596 на пару аспарагин595 - лейцин596). Считается, что такие мутации вызывают болезнь Альцгеймера, поскольку они приводят к усиленному или неправильному процессингу АРР в Аβ, в особенности процессингу АРР с образованием повышенного количества длинной формы Аβ (то есть Аβ1-42 и Аβ1-43). Считается, что мутации в других генах, например генах презенилина, PS1 и PS2, непосредственно влияют на процессинг АРР с образованием повышенного количества длинной формы Аβ (см. Hardy, TINS 20, 154 (1997)). Эти наблюдения свидетельствуют о том, что Аβ, в особенности его длинная форма, является причиной развития болезни Альцгеймера.

Иммунизация трансгенных мышей моделей AD иммуногенами, насыщенными β-амилоидным пептидом (Аβ), приводила к антительному ответу, который ингибирует формирование амилоидных бляшек в головном мозге мышей или приводит к их рассасыванию (Schenk et al., (1999) Nature 400, 173-177; Janus et al., (2000) Nature 408, 979-982, Morgan et al. (2002) Nature 408, 982-985, Sigurdsson et al., (2001) Am. J. Pathol. 159, 439-447, 1-4)). Введенные пассивно готовые антитела к Аβ приводили к таким же эффектам. Было сделано предположение о том, что основным механизмом очищения ткани головного мозга от существующих амилоидных бляшек является опосредованный антителами, Fc-зависимый фагоцитоз клетками микроглии и/или макрофагами (Bard et al., (2000) Nat. Med., 6, 916-919)). Это предположение основано на том, что определенные антитела к Аβ, введенные на периферии, достигают ЦНС трансгенной мыши, связываются с амилоидными бляшками и индуцируют их рассасывание. Также была отмечена сильная корелляция между антителами, которые оказывались эффективными in vivo, и в исследованиях ех vivo, проводившихся на срезах головного мозга PDAPP или людей, пораженных болезнью Альцгеймера, для измерения рассасывающей активности антител. В исследованиях ех vivo показано, что в рассасывании бляшек задействованы Fc-рецепторы клеток микроглии. Однако также было замечено, что эффективность антител может быть также достигнута in vivo с помощью механизмов, независимых от Fc взаимодействий (Bacskai et al., (2002) J. Neurosci. 22, 7873-7878). Сообщалось, что антитело, направленное против срединного участка Аβ, которое не может распознавать амилоидные бляшки, связывает растворимый Аβ и уменьшает отложение бляшек (DeMattos et al., (2001) Proc. Natl. Acad. Sci. USA, 98, 8850-8855). Сообщалось, что кратковременное лечение этим антителом приводило к улучшению у пациентов способности к распознаванию, не влияя на амилоидную нагрузку (Dotart et al., (2002) Nat. Neurosci., 5, 452-457).

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг.1А-С. Антитела, полученные путем иммунизации мышей N-концевыми фрагментами Аβ, связываются с амилоидными бляшками. Фиг.А1. Для иммунизации PDAPP мышей использовали пептиды, включающие различные домены Aβ1-42 (SEQ ID NO:1) (синтетические пептиды, смежные с Т-клеточным эпитопом, происходящие из овальбумина). В качестве негативного контроля использовали реверсемер Аβ5-1 (SEQ ID NO:2). Фиг.1В. Титры в ELISA против агрегированного Aβ1-42 были значительно выше на всем протяжении исследования в группах Аβ5-11 и Аβ15-24, по сравнению с группой Аβ1-5 (1:14, 457, р<0.01 и 1:12, 257, р<0.05 против 1:3, 647 соответственно; ANOVA с последующим post hoc тестом Тукея). Фиг.1C. Нефиксированные криостатические срезы головного мозга необработанных PDAPP мышей обработали сывороткой мышей, иммунизированных Аβ5-1, Аβ3-9, Аβ5-11 или Аβ15-24 (титры нормализовали до 1:1000 для окрашивания). Антитела к Аβ15-24 не связывались с амилоидными бляшками. Единица шкалы соответствовала 500 мкм.

Фиг.2А-С. Захват растворимого Aβ1-42 антителами не ассоциировался с уменьшением амилоидной нагрузки или невритической патологии. Фиг.2А. Оценивали способность сывороток мышей, иммунизированных фрагментами Aβ, захватывать радиоактивно меченный растворимый Aβ1-42 в радиоиммунологическом анализе. Сыворотки всех животных, иммунизированных Аβ15-24, обладали способностью захватывать растворимый Aβ1-42 (один образец сыворотки имел титр выше чем 1:1,350, точный титр не был определен), в сравнении с 27% захвата в группе Аβ1-5 и 3% захвата в группе Аβ3-9. Фиг.2В-С. Амилоидную нагрузку (Фиг.2В) и невритическую патологию (Фиг.2С) оценивали с помощью анализа изображений при микроскопии в темном поле. Результаты выражали в средних процентах по группе Aβ5-1 (в качестве негативного контроля использовали реверсемерный пептид). Группу Аβ5-11 исследовали при отдельном содержании от других групп, но в тесной взаимосвязи с той же самой группой негативного контроля в качестве внутреннего стандарта сравнения (второй набор реверсемеров Аβ5-1). Амилоидная нагрузка значительно уменьшалась в группах Аβ1-5, Аβ3-9 и Аβ5-11 (р<0.001). Стрелки соответствуют средним значениям и пунктирные горизонтальные линии обозначают контрольный уровень. Невритическая нагрузка была существенно изменена при иммунизации групп Аβ3-9 и Аβ5-11 (р<0.05). Ни одна из конечных точек не была существенно изменена при иммунизации группы Аβ15-24. Статистический анализ осуществляли по среднему квадратичному отклонению (для нормализации непараметрических отклонений) и анализировали методом ANOVA. Тест Дюннетта затем использовали для сравнения групп Аβ1-5, Аβ3-9, Aβ15-24 с контролем Аβ5-1, а тест Манна-Уитнея - для группы Аβ5-11 и соответствующего реверсемерного контроля Аβ5-1.

ДЕТАЛЬНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Общие положения

Данное изобретение относится к способу предупреждения, эффективной профилактики или лечения заболевания, связанного с отложением амилоида, заключающемуся в использовании фрагментов центральных или С-концевых участков Аβ. Эти фрагменты могут индуцировать образование поликлональной смеси антител, которые специфично связывают растворимый Аβ без связывания с амилоидными бляшками. Антитела могут ингибировать формирование амилоидных отложений Аβ из растворимого Аβ в головном мозге пациента, обеспечивая тем самым профилактику и лечение заболевания. Предпочтительными иммуногенами являются 15-24 фрагменты А-бета и субфрагменты 5-10 их смежных аминокислот, поскольку они обладают способностью генерировать высокий титр антител.

Определения

С целью классификации аминокислотных замен на консервативные и неконсервативные, аминокислоты сгруппированы следующим образом: Группа I (гидрофобные боковые цепи): норлейцин, мет, ала, вал, лей, иле; Группа II (нейтральные гидрофильные боковые цепи): цис, сер, тре; Группа III (кислые боковые цепи): асп, глу; Группа IV (основные боковые цепи): асн, глн, гис, лиз, арг; Группа V (остатки, влияющие на ориентацию цепи): глу, про, и Группа VI (ароматические боковые цепи): три, тир, фен. Консервативные замены включают замены между аминокислотами одного класса. Неконсервативные замены представляют собой замены аминокислот одного класса на аминокислоты другого класса.

Термин "все-D" относится к пептидам, имеющим ≥75%, ≥80%, ≥90%, ≥95% и 100% аминокислот в D-конфигурации.

Термин "агент" используется для описания соединения, которое обладает или может обладать фармакологической активностью. К агентам относятся соединения, известные как лекарственные средства, соединения с доказанной фармакологической активностью, но чья терапевтическая активность подлежит дополнительному анализу, и соединения, которые входят в состав коллекций и библиотек, фармакологическая активность которых еще должна быть исследована.

Терапевтические агенты, заявленные в соответствии с настоящим изобретением, обычно являются полностью очищенными от нежелательных примесей. Это означает, что агент имеет обычно по крайней мере приблизительно 50% в/в (вес/вес) очистку, а также полностью свободен от примесных белков и контаминантов. Иногда агенты имеют по крайней мере 80% в/в и более предпочтительно по крайней мере 90 или 95% в/в очистку. Однако, используя рутинные технологии очищения белков, можно получить гомогенные пептиды по меньшей мере с 99% в/в очисткой. Терапевтические агенты, в соответствии с настоящим изобретением, могут эффективно предотвращать или лечить заболевания, ассоциированные с отложением амилоида.

Специфическое связывание между двумя соединениями означает, что эти два соединения обладают взаимной аффинностью, которая по крайней мере в 10, 100 раз выше, чем аффинность каждого из этих соединений по отношению к контролю, например, как неродственного антигена или антитела для другого антигена. Взаимная аффинность двух соединений по отношению друг к другу обычно составляет 107, 108, 109 М-1 или 1010 М-1. Аффинности более 108 М-1 являются предпочтительными. Специфическое связывание поликлонального антитела с эпитопом Аβ означает, что антитела в группе поликлональных антител специфично связываются с одним эпитопом Аβ и не связываются с другими эпитопами Аβ.

Термин "антитело" или "иммуноглобулин" используется для обозначения полных молекул антител и их связывающих фрагментов. Обычно фрагменты конкурируют с полной молекулой антитела, из которого они получены, за специфическое связывание с антигенным фрагментом, включая отдельные тяжелые цепи, легкие цепи. Fab, Fab'F(ab')2, Fabc и Fv. Фрагменты получают с помощью рекомбинантных ДНК технологий или с помощью химического разделения полных молекул иммуноглобулинов. Термин "антитело" также относится к одной или нескольким цепям иммуноглобулинов, которые химически конъюгированы, или экспрессируются как белки слияния с другими белками. Термин "антитело" также относится к биспецифичному антителу. Биспецифичное или бифункциональное антитело представляет собой искусственное гибридное антитело, имеющее две различные пары тяжелых/легких цепей и два различных сайта связывания. Биспецифичные антитела могут быть получены с помощью различных методов, включая слияние гибридом или связывание Fab фрагментов. См., например, Songsivilai & Lachmainn, Clin. Exp. Immunol. 79: 315-321 (1990); Kostelny et al., J. Immunol. 148, 1547-1553 (1992).

Аβ, также известный как β-амилоидный пептид, или А4 пептид (см. патент США 4666829; Glenner & Wong, Biochem. Biophys. Res. Commun., 120, 1131 (1984)), представляет собой пептид, состоящий из 39-43 аминокислот и являющийся основным компонентом бляшек, характерных для болезни Альцгеймера. Аβ имеет несколько натуральных форм. Натуральные формы Аβ человека обозначают как Аβ39, Аβ40, Aβ41, Аβ42 и Aβ43. Последовательности этих пептидов и их отношение к предшественнику АРР иллюстрирует Фиг.1 у Hardy et al., TINS 20, 155-158 (1997). Например, Аβ42 имеет следующую последовательность:

N2H-Асп-Ала-Глу-Фен-Арг-Гис-Асп-Сер-Глу-Тир-Глу-Вал-Гис-Гис-Глн-Лиз-Лей-Вал-Фен-Фен-Ала-Глу-Асп-Вал-Глу-Асп-Вал-Глу-Сер-Асн-Лиз-Глу-Ала-Иле-Иле-Глу-Лей-Мет-Вал-Глу-Глу-Вал-Вал-Иле-Ала-ОН (SEQ ID NO:1).

Аβ41, Аβ40 и Аβ39 отличаются от Аβ42 отсутствием Ала, Ала-Иле и Ала-Иле-Вал соответственно на С-конце. Аβ43 отличается от Аβ42 наличием остатка треонина на С-конце.

АРР695, АРР751 и АРР770 относятся к длинным полипептидам, включающим 695, 751 и 770 аминокислотных остатков соответственно и кодируемым геном АРР человека. См. Kang et al., Nature, 325, 773 (1987); Ponte et al., Nature, 331, 525 (1988), и Kitaguchi et al., Nature, 331, 530 (1988). Аминокислоты белка предшественника амилоида человека (АРР) пронумерованы соответственно последовательности изоформы АРР770. Такие термины как Аβ39, Aβ40, Аβ41, Aβ42 и Aβ43 относятся к Аβ пептиду, включающему аминокислотные остатки 1-39, 1-40, 1-41, 1-42 и 1-43 соответственно.

Дезагрегированные Аβ или их фрагменты - это мономерные пептидные единицы. Дезагрегированные Аβ или их фрагменты обычно являются растворимыми и обладают способностью самоагрегировать с образованием растворимых олигомеров. Олигомеры Аβ и их фрагментов обычно являются растворимыми и существуют главным образом в виде альфа-спиралей или случайных клубков. Одним из способов получения мономерного Аβ является растворение лиофилизированного пептида в чистом DMSO с последующим разрушением ультразвуком. Полученный раствор центрифугируют для удаления нерастворимых частиц. Агрегированные Аβ или их фрагменты относятся к олигомерам Аβ или их иммуногенным фрагментам, в которых мономерные единицы соединены вместе нековалентными связями и ассоциированы в нерастворимые бета-складчатые структуры. Агрегированные Аβ или их фрагменты также относятся к фибриллярным полимерам. Фибриллы обычно являются нерастворимыми. Некоторые антитела связывают как растворимые Аβ и их фрагменты, так и агрегированные Аβ и их фрагменты. Некоторые антитела связывают растворимый Аβ, но не связывают бляшки.

"Антиген" - это соединение, с которым специфично связывается антитело.

Термин "эпитоп" или "антигенная детерминанта" относится к участку антигена, с которым взаимодействуют В и/или Т-клетки. В-клеточные эпитопы могут быть сформированы из смежных аминокислот или несмежных, которые соприкасаются между собой при четвертичной укладке белка. Эпитопы, сформированные из смежных аминокислот, обычно устойчивы при воздействии денатурирующих агентов, в то время как эпитопы, сформированные при четвертичной укладке белка, обычно разрушаются при обработке денатурирующими агентами. Эпитоп обычно включает по крайней мере 3, более часто по крайней мере 5 или 8-10 аминокислот в уникальной пространственной конформации. Методы определения пространственной конформации эпитопов включают, например, рентгеновскую кристаллографию и двухмерный ядерный магнитный резонанс. См., например, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed. (1996). Антитела, которые распознают одинаковые эпитопы могут быть идентифицированы с помощью обычного иммунного анализа, показывающего способность одного антитела блокировать связывание другого антитела с антигеном-мишенью. Т-клетки распознают непрерывные эпитопы из приблизительно 9 аминокислот для CD8 клеток и из 13-15 аминокислот для CD4 клеток. Т-клетки, которые распознают эпитоп, могут быть идентифицированы с помощью анализа in vitro, который позволяет измерить антиген-зависимую пролиферацию, как определено по включению 3H-тимидина примированными Т-клетками, отвечающими на эпитоп (Burke et al., J. Inf. Dis., 170, 1110-19 (1994)), путем антиген-зависимого киллинга (метод цитотоксических Т-лимфоцитов, Tigges et al., J. Immunol., 156, 3901-3910) или секреции цитокинов.

N-концевой эпитоп Аβ относится к эпитопу, образованному остатками 1-11. Эпитоп на С-конце относится к эпитопу, образованному остатками 29-43, а эпитоп, находящийся в центральном участке, образован остатками 12-28.

Термин "иммунологический" или "иммунный" ответ - это развитие предпочтительного гуморального (опосредованного антителами) и/или клеточного (опосредованного антиген-специфичными Т-клетками или их секреторными пептидами) ответа, направленного против амилоидных бляшек в организме пациента. Этот ответ может быть активным, индуцированным введением иммуногена, или пассивным, индуцированным введением антитела или примированных Т-клеток. Клеточный иммунный ответ вызывается презентацией полипептидных эпитопов, ассоциированных с молекулами I или II Класса Главного Комплекса Гистосовместимости, для активации антиген-специфичных CD4+ Т-хелперов и/или CD8+ цитотоксичных Т-клеток. Ответ может включать также активацию моноцитов, макрофагов, NK-клеток, базофилов, дендритных клеток, астроцитов, микроглии, эозинофилов, других компонентов иммунной системы. Наличие клеточного иммунного ответа может быть подтверждено с помощью исследований пролиферации (CD4+ клеток) или CTL (цитотоксичных Т-лимфоцитов от англ. cytotoxic T lymphocyte) (см. Burke, supra; Tigges, supra). Относительный вклад гуморального и клеточного ответов в защитный терапевтический эффект иммуногена можно различить путем раздельного выделения антител и Т-клеток из иммунизированного сингенного животного и измерением их протективного или терапевтического эффекта по отношению ко второму субъекту.

"Иммунологический агент" или "иммуноген" обладает способностью индуцировать иммунный ответ, направленный против него же самого, при введении в организм млекопитающего, возможно совместно с адъювантом.

Термин "голый" полинуклеотид относится к полинуклеотиду, не связанному с коллоидными материалами. "Голые" нуклеотиды иногда клонируют в плазмидном векторе.

Термин "адъювант" относится к соединению, которое при введении совместно с антигеном, усиливает иммунный ответ на этот антиген, а при самостоятельном введении не приводит к иммунному ответу на данный антиген. Адъюванты могут усиливать иммунный ответ с помощью нескольких механизмов, включая рекрутмент (постоянное обновление пула) лимфоцитов, стимуляцию В и/или Т-клеток и стимуляцию макрофагов.

Термин "пациент" относится к человеку или другому млекопитающему, получающему профилактическое или терапевтическое лечение.

Конкуренцию между антителами определяли с помощью анализа, в котором тестируемый иммуноглобулин ингибировал специфическое связывание контрольного антитела с обычным антигеном, таким как Аβ. В настоящее время существует множество методов конкурентного связывания, например твердофазный прямой или непрямой радиоиммунный анализ (RIA от англ. Radioimmunoassay), твердофазный прямой или непрямой ферментный иммунологический анализ (EIA от англ. Enzyme Immunoassay), сэндвич-метод анализа конкурентного связывания (см. Stahli et al., Methods in Enzymology, 9: 242-253 (1983)); твердофазный прямой EIA с биотином-авидином (см. Kirklaud et al., Immunol. 137: 3614-3619 (1986)); твердофазный прямой анализ с меткой, твердофазный прямой сэндвич анализ с меткой (см. Harlow and Lane, "Antibodies, A Laboratory Manual", Cold Spring Harbor Press (1988)); твердофазный прямой RIA с меткой I-125 (см. Morel et al., Molec. Immunol. 25 (1): 7-15 (1988)); твердофазный прямой EIA с биотином-авидином (Cheung et al., Virology, 176: 546-552 (1990)) и прямой RIA с меткой (Moldenhauer et al., Scand. J. Immunol., 32: 77-82 (1990)). Обычно такие методы заключаются в использовании очищенного антигена, связанного с твердой поверхностью или клетками, несущими как непомеченный тестируемый иммуноглобулин, так и меченный контрольный иммуноглобулин. Конкурентное ингибирование измеряют путем определения количества метки, связавшейся с твердой поверхностью или клетками в присутствии тестируемого иммуноглобулина. Обычно тестируемый иммуноглобулин присутствует в избытке. Антитела, определяемые с помощью методов конкурентного связывания (конкурирующие антитела), включают антитела, связывающиеся с тем же эпитопом, что и контрольное антитело, и антитела, связывающиеся со смежным эпитопом, расположенным проксимально по отношению к эпитопу, с которым связывается контрольное антитело, для поддержания стерического барьера. Обычно в том случае,когда конкурирующее антитело присутствует в избытке, оно будет ингибировать связывание контрольного антитела с обычным антигеном по крайней мере на 50 или 75%.

Антитело, которое специфично связывается растворимым Аβ, это антитело, которое связывается с Аβ с аффиностью, составляющей по крайней мере 107 М-1. Некоторые антитела связывают растворимый Аβ с аффинностью от 108 М-1 до 1011 М-1.

Антитело, которое специфично связывается с растворимым Аβ без специфичного связывания с бляшками, представляет собой антитело, которое специфично связывает растворимый Аβ, как описано выше, и имеет по крайней мере в десять и обычно по крайней мере в 100 раз меньшую аффинность специфического связывания по отношению к бляшкам (то есть по отношению к Аβ в форме агрегированных β-складчатых структур), полученным из трупов пациентов, страдавших болезнью Альцгеймера, или из трансгенных модельных животных. Например, такое антитело может связываться с растворимым Аβ с аффинностью 109 М-1, а с бляшками - с аффиностью менее чем 107 М-1. Аффинность таких антител по отношению к бляшкам обычно составляет менее 107 или 106 М-1. Такие антитела дополнительно или альтернативно определяют по интенсивности флуоресценции по отношению к иррелевантному контрольному антителу (например, антителу или смеси поликлональных антител к реверсемерному Аβ пептиду), когда антитела находятся в контакте с бляшками и связывание контролируется с помощью флуоресцентной метки (как описано в примерах). Интенсивность флуоресценции антител, которые связываются с растворимым Аβ пептидом без связывания с бляшками, находится в пределах фактора пяти, иногда в пределах фактора двух и иногда неразличима в пределах экспериментальной ошибки от таковой контрольного антитела.

Композиции или методы "включающие" один или более повторяющихся элементов, могут включать и другие элементы, специфично не повторяющиеся. Например, композиция, содержащая Аβ пептид, включает как изолированный Аβ пептид, так и Аβ пептид как компонент большей полипептидной последовательности.

Аβ пептиды для активной иммунизации

Аβ пептиды, используемые в способах в соответствии с настоящим изобретением, представляют собой иммуногенные пептиды, которые при введении в организм человека или животного способствуют образованию антител, которые специфично связываются с одним или более эпитопом, находящимся в пределах от 12 до 43 остатка Аβ, и не приводят к образованию антител, которые специфично связываются с одним или более эпитопом, находящимся в пределах 1-11 остатков Аβ. Антитела специфично связывающиеся с эпитопами, находящимися между 12 и 43 остатками, специфично связываются с растворимым Аβ и не связываются с Аβ в бляшках. Антитела этого типа могут специфично связывать растворимый Аβ при циркуляции в организме пациента или модельного животного без специфичного связывания с бляшками, представленными отложениями Аβ в головном мозге пациента или модельного животного. Специфическое связывание антител с растворимым Аβ ингибирует включение Аβ в бляшки, таким образом приводя также к прекращению развития бляшек в головном мозге пациента или прекращению дальнейшего увеличения их размеров и количества, в том случае, если бляшки образовались до начала лечения.

Предпочтительно введенный фрагмент Аβ не имеет эпитопа, который будет генерировать Т-клеточный ответ, направленный против этого же фрагмента. В общем, эпитопы Т-клеток включают более 10 смежных аминокислот. Кроме того, предпочтительные фрагменты Аβ состоят из 5-10 или предпочтительно из 7-10 смежных аминокислот, то есть имеют достаточную длину для того, чтобы генерировать антительный ответ, но не вовлекать в иммунный ответ Т-клетки. Отсутствие эпитопов для Т-клеток является предпочтительным, поскольку эти эпитопы не являются необходимыми для иммуногенной активности фрагментов, но могут вызывать нежелательный воспалительный ответ у множества пациентов (Anderson et al., (2002) J. Immunol. 168, 3697-3701; Senior (2002) Lancet Neurol. 1, 3). В некоторых методах используется фрагмент, представляющий собой фрагмент, отличный от Аβ 13-28, 17-28, 25-35, 35-40, 33-42 или 35-42. Большинство Т-клеточных эпитопов находятся в пределах 14-30 аминокислот Аβ.

Фрагмент Aβ15-24 и субфрагменты 7-9 их смежных аминокислот являются предпочтительными, поскольку эти пептиды равным образом генерируют высокий иммунный ответ на Аβ пептид. Эти фрагменты включают Аβ15-21, Аβ16-22, Аβ17-23, Аβ18-24, Аβ19-25, Аβ15-22, Аβ16-23, Аβ17-24, Аβ18-25, Аβ15-23, Аβ16-24, Аβ17-25, Аβ18-26, Аβ15-24, Аβ16-25 и Аβ15-25. Обозначение Аβ15-21, например, относится к фрагменту, включающему остатки 15-21 Аβ и не включающему другие остатки Аβ. Также предпочтительными являются С-концевые фрагменты Аβ42 или 43 из 5-10, предпочтительно 7-10 смежных аминокислот. Эти фрагменты могут генерировать антительный ответ, который вовлекает концевые специфичные антитела. Эти антитела имеют преимущество в специфическом связывании Аβ42 и Аβ43 без специфического связывания с Аβ39-41. Эти антитела связывают растворимый Аβ без связывания с бляшками.

При использовании некоторых методов фрагмент из центрального или С-концевого участка Аβ вводится в режиме, который также включает введение фрагмента и из N-концевого участка. В целом, такие фрагменты способствуют образованию антител, которые специфично связываются с бляшками и индуцируют их разрушение фагоцитирующими клетками. Такой иммунный ответ является наиболее подходящим для разрушения существующих отложений Аβ. Однако далее после разрушения этих отложений является предпочтительным продолжить введение фрагмента из центрального или С-концевого участка Аβ для стимулирования образования антител к растворимому Аβ, чтобы предотвратить дальнейшее отложение Аβ без риска развития нежелательных воспалительных реакций у определенных пациентов. N-концевые фрагменты, начинающиеся с 1-3 остатков Аβ и заканчивающиеся на 7-11 остатках Аβ, являются наиболее предпочтительными. Примерами N-концевых фрагментов являются Аβ1-5, 1-6, 1-7, 1-10, 3-7, 1-3 и 1-4.

Если дополнительно не оговаривается иное, ссылки на фрагменты Аβ включают фрагменты натуральных аминокислотных последовательностей человека, определенные выше, а также их аналоги, выключая алелльные, видовые и индуцированные варианты. Аналоги Аβ фрагментов индуцируют образование антител, которые специфично связываются с натуральным Аβ пептидом (например, Аβ42). Аналоги Аβ фрагментов обычно отличаются от натуральных фрагментов пептида приблизительно на 30% по 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислотным позициям. Каждая делеция или замена натурального аминокислотного остатка считается за изменение позиции, как и включение аминокислотного остатка без замены. Аминокислотные замены обычно являются консервативными заменами.

Если дополнительно не оговаривается иное, ссылки на Аβ фрагменты включают фрагменты натуральных аминокислотных последовательностей человека, определенные выше, а также их аналоги, включая аллельные, видовые и индуцированные варианты. Аналоги Аβ индуцируют образование антител, которые специфично связываются с натуральным Аβ пептидом (например, Аβ42). Аналоги Аβ фрагментов обычно отличаются от натуральных фрагментов пептида на 30%. Например, аналог Аβ 15-21 может отличаться по 1, 2, 3, 4 или 10 аминокислотным позициям. Каждая делеция или замена натурального аминокислотного остатка считается за изменение позиции, как и включение аминокислотного остатка без замены. Аминокислотные замены обычно являются консервативными заменами.

Некоторые аналоги Аβ или Аβ фрагменты также включают неприродные аминокислоты или модификации N или С концевых аминокислот в одной, двух, пяти, десяти или одиннадцати, или даже во всех позициях. Например, натуральный остаток аспарагиновой кислоты в позиции 1 и/или 7 Аβ может быть замещен изоаспарагиновой кислотой. Примерами синтетических аминокислот являются D, альфа, альфа-двухзамещенные аминокислоты, N-алкиламинокислоты, молочная кислота, 4-гидроксипролин, гамма-карбоксиглутамат, ипсилон-N-ацетиллизин, O-фосфосерин, N-ацетилсерин, N-формилметионин, 3-метилгистидин, 5-гидроксилизин, омега-N-метиларгинин, β-аланин, орнитин, норлейцин, норвалин, гидроксипролин, тироксин, гамма-аминомасляная кислота, гомосерин, цитруллин и изоаспарагиновая кислота. Некоторые терапевтические агенты, заявленные в соответствии с настоящим изобретением, представляют собой all-D пептиды, например all-D-Аβ или all-D Аβ фрагменты, или all-D пептидные аналоги. Эффективность фрагментов или аналогов в отношении профилактики и лечения может быть изучена на модельных трансгенных животных при сравнении с контрольными группами, не получавшими лечения или получавшими плацебо, как описано ниже.

Аβ, его фрагменты и их аналоги могут быть синтезированы с помощью твердофазного пептидного синтеза или рекомбинантной экспрессии или могут быть получены из естественных источников. Автоматические системы для пептидного синтеза являются коммерчески доступными и предоставляются различными поставщиками, такими как Applied Biosystems, Foster City, California. Рекомбинантная экспрессия может быть осуществлена в бактериях, таких как E.coli, дрожжевых клетках, клетках насекомых или клетках млекопитающих. Методики рекомбинантной экспрессии описаны у Sambrook et al., Molecular Cloning: A Laboratory Manual (C.S.H.P. Press, NY 2d ed., 1989). Некоторые формы Аβ пептида также являются коммерчески доступными (например, American Peptides Company, Inc., Sunnyvale, CA and California Peptide Research, Inc. Napa, CA).

К терапевтическим агентам также относятся более длинные полипептиды, включая, например, иммуногенный фрагмент Аβ пептида вместе с одной или несколькими другими аминокислотами, фланкирующими Аβ пептид с одной или с обеих сторон. Например, предпочтительные терапевтические агенты включают белки слияния, содержащие сегмент Аβ, слитый с гетерологичной аминокислотной последовательностью, которая индуцирует Т-клеточный ответ, направленный против нее же, и, таким образом, способствует развитию В-клеточного иммунного ответа на Аβ сегмент. Для кэпирования Аβ пептида с целью защиты его от деградации во время получения, хранения или использования можно использовать одну или несколько фланкирующих гетерологичных аминокислот. Эффективность этих пептидов в отношении профилактики и лечения может быть изучена на модельных трансгенных животных при сравнении с контрольными группами, не получавшими лечения или получавшими плацебо, как описано ниже. Терапевтические агенты, заявленные в соответствии с настоящим изобретением, включают иммунногенный фрагмент Аβ, фланкированный полилизиновыми последовательностями. Полилизиновая последовательность может быть слита с N-концом, с С-концом или с обоими, N- и С-концевыми участками иммуногенного фрагмента Аβ. Аβ пептид, его аналог, активный фрагмент или другой полипептид могут вводиться в ассоциированной или полимерной форме или в диссоциированной форме. Терапевтические агенты также включают полимерные или мономерные иммуногенные агенты.

Другим вариантом является экспонирование имунногенного фрагмента Аβ вирусом или бактерией как части иммуногенной композиции. Нуклеиновую кислоту, кодирующую иммуногенный пептид, включают в геном или эписому вируса или бактерии. По выбору, нуклеиновую кислоту включают так, что имунногенный пептид экспрессируется как белок секреции или как белок слияния с наружным белком поверхности вируса или с трансмембранным белком бактерии, таким образом, что пептид экспонируется. Вирусы или бактерии, использующиеся в таких методиках, должны быть непатогенными или аттенуированными. Подходящими вирусами являются аденовирус, HSV, вирус венесуэльского энцефалита лошадей и другие альфа-вирусы, вирус везикулярного стоматита и другие рабдовирусы, вирус коровьей оспы и птичьей оспы. Подходящими бактериями являются бактерии рода Salmonella и Shigella. Слияние имунногенного пептида с HBsAg HBV является особенно предпочтительным.

Терапевтические агенты также включают пептиды и другие соединения, чьи аминокислотные последовательности необязательно сходны с таковыми Аβ, но которые могут имитировать действие Аβ и вызывать такой же иммунный ответ. Например, любые пептиды и полипептиды, формирующие β-складчатые структуры могут оказаться подходящими. Анти-идиотипические антитела против моноклональных антител к Аβ или другие амилоидогенные пептиды также могут быть использованы. Такие анти-Id антитела имитируют антиген и генерируют иммунный ответ, направленный на него (см. Essential Immunology (Roit ed., Blackwell Scientific Publications, Palo Alto, 6th ed.), p.181). Агенты, отличные от Аβ пептида, должны вызывать иммунный ответ, направленный против одного или нескольких предпочтительных сегментов Аβ, перечисленных выше (например, 15-24). Предпочтительно такие агенты вызывают иммунный ответ, который главным образом направлен на один из этих сегментов и не направлен на другие сегменты Аβ.

Кроме того, подходящими для этих целей могут оказаться различные библиотеки пептидов и других соединений. Комбинаторные библиотеки могут быть созданы для соединений различных типов, которые могут быть синтезированы поэтапно. К таким соединениям относятся полипептиды, миметики бета-поворота, полисахариды, фосфолипиды, гормоны, простагландины, стероиды, ароматические соединения, гетероциклические соединения, бензодиазепины, олигомерные N-замещенные глицины и олигокарбаматы. Большие комбинаторные библиотеки соединений могут быть сконструированы с помощью метода кодированных синтетических библиотек (ESL от англ. Encoded Synthetic Libraries), описанного в Affymax, WO 95/12608, Affymax, WO 93/06121, Columbia University, WO 94/08051, Pharmacopeia, WO 95/3503 and Scripps, WO 95/30642 (все источники представлены здесь в качестве ссылок). Пептидные библиотеки также могут быть получены с помощью фаговых дисплейных методов. См., например, Devlin, WO 91/18980.

В первую очередь устанавливают, являются ли комбинаторные библиотеки и другие соединения подходящими, путем определения их способности специфично связываться с антителами или лимфоцитами (В или Т), про которые известно, что они являются специфичными для Аβ или других амилоидогенных пептидов. Например, начальные исследования могут быть осуществлены с любой поликлональной сывороткой или моноклональным антителом к Аβ или его фрагментам. Затем можно исследовать, насколько соединения специфично связываются со специфичным эпитопом Аβ (например, 15-24). Соединения могут быть протестированы при использовании технологий, применяемых для определения специфичности эпитопов. Соединения, идентифицированные с помощью таких исследований, затем подвергают анализу для определения их способности индуцировать выработку антител или реактивировать лимфоциты к Аβ или его фрагментам. Например, множественные разведения сыворотки могут быть протестированы на планшетах для микротитрования, которые предварительно покрыли Аβ или его фрагментами, а для определения способности индуцировать антителообразование к Аβ или его фрагменту можно осуществить стандартную ELISA. Затем возможно исследовать профилактическую и терапевтическую эффективность этих соединений на трансгенных животных, предрасположенных к болезни Альцгеймера, как описано в примерах. К таким животным относятся, например, мыши, имеющие 717 мутацию АРР, описанную Games et al., выше, и мыши, имеющие 670/671 шведскую мутацию АРР, как описано McConglogue et al., US 5612486, Hsisao et al., Science, 274, 99 (1996); Staufenbiel et al., Proc. Natl. Acad. Sci. USA, 94: 13287-13292 (1997); Struchler-Pierrat et al., Proc. Natl. Acad. Sci. USA, 94: 13287-13292 (1997); Borchelt et al., Neuron, 19: 939-945 (1997)). Такой же скрининговый подход может быть применен и для других потенциальных агентов, аналогов Аβ и длинных полипептидов, включая фрагменты Аβ, описанные выше.

IV. Конъюгаты

Некоторые агенты, предназначенные для стимулирования иммунного ответа, имеют подходящий эпитоп для индуцирования иммунного ответа против LBs, но имеют слишком маленький размер, чтобы быть иммуногенными. В такой ситуации пептидный иммуноген может быть соединен с подходящей молекулой носителя для формирования конъюгата, который будет вызвать иммунный ответ. Один агент может быть соединен с одним носителем, множественные копии агента могут быть соединены с множественными копиями носителя, которые, в свою очередь, связаны между собой, множественные копии агента могут быть соединены с одним носителем или один агент может быть соединен с множественными копиями носителя, или с различными носителями. Подходящими носителями являются альбумин сыворотки, гемоцианин моллюска фиссуреллы, молекулы иммуноглобулина, тиреоглобулин, овальбумин, столбнячный токсин или токсины других патогенных бактерий, таких как бактерии дифтерии, Е.coli, возбудитель холеры или Н.pylori, или аттенуированные производные токсина. Эпитопы Т-клеток также являются подходящими носителями. Некоторые конъюгаты могут быть сформированы путем соединения агентов, заявленных в соответствии с настоящим изобретением, с иммуностимулирующими полимерными молекулами (например, трипалмитоил-S-глицерином (Pam3Cys), маннаном (полимер маннозы) или глюканом (бета 1→2 полимер)), цитокинами, (например, IL-1, IL-1 альфа и бета пептидами, IL-2, гамма-интерфероном, IL-10, GM-CFS) и хемокинами (например, MIP1 альфа и бета и RANTES). Иммуногенные агенты также могут быть соединены с пептидами, которые улучшают транспорт веществ через ткани, как описано у O′Manony, WO 97/17613 и WO 97/17614. Иммуногены также могут быть соединены с носителями как с помощью разделяющих аминокислот (например, гли-гли), так и без них.

Некоторые конъюгаты могут быть сформированы путем соединения агентов, заявленных в соответствии с настоящим изобретением, с по крайней мере одним Т-клеточным эпитопом. Некоторые Т-клеточные эпитопы являются универсальными, в то время как другие нет. Не являющиеся универсальными Т-клеточные эпитопы способны усиливать индукцию Т-клеточного иммунитета у большого числа людей, обладающих различными типами HLA. Наоборот, универсальные Т-клеточные эпитопы способны усиливать индукцию Т-клеточного иммунитета в большем проценте случаев, по крайней мере у 75% людей, у которых обнаруживаются различные молекулы HLA, кодируемые различными HLA-DR аллелями.

Существует большое количество натуральных Т-клеточных эпитопов, таких как, например, столбнячный токсин (например, эпитопы Р2 и Р3О), поверхностный антиген вируса гепатита В, коклюшный токсин, F белок вируса кори, основной наружный мембранный белок Chlamydia trachomatis, дифтерийный токсин, циркумспорозоит Т Plasmodium falciparum, CS антиген Plasmodium falciparum, триозофосфатизомераза Schistosoma mansoni, TraT E.coli, гемагглютинин вируса гриппа (НА). Иммуногенные пептиды, заявленные в соответствии с настоящим изобретением, могут быть также соединены с Т-клеточными эпитопами, описанными у Sinigaglia et al., Nature, 336: 778-780 (1988); Chicz R.M. et al., J. Exp. Med., 178: 27-47 (1993), Hammer J. et al., Cell 74: 197-203 (1993); Falk K. et al., Immunogenetics, 39: 230-242 (1994); WO 98/23635; и Southwood S. et al., J. Immunology, 160: 3363-3373 (1998).

Другими примерами являются следующие:

Гемагглютинин вируса гриппа: НА307-319

Малярийный CS: Т3 эпитоп EKKIAKMEKASSVFNV (SEQ ID NO:4)

Поверхностный антиген вируса гепатита В: HbsAg19-28 FFLLTRILTI (SEQ ID NO:5)

Белок токсического шока 65: hsp65153-171 DQSIGDLIAEAMDKVGNEG (SEQ ID NO:6)

Бацилла Кальметта-Герена: QVHFQPLPPAVVKL (SEQ ID NO:7)

Столбнячный токсин: TT830-844 QYIKANSKFIGITEL (SEQ ID NO:8)

Столбнячный токсин: ТТ947-967 FNNFTVSFWLRVPKVSASHLE (SEQ ID NO:9)

HIV gpl20 T1: KQIINMWQEVGKAMYA (SEQ ID NO:10)

Альтернативно, конъюгаты могут быть сформированы путем соединения агентов, заявленных в соответствии с настоящим изобретением, с по крайней мере одним искусственным Т-клеточным эпитопом, способным связываться с большим количеством молекул HLA II Класса, таким как пан DR эпитоп (PADRE). PADRE описан в патенте США US 5736141, заявке на патент WO 95/07707 и у Alexander J. et al., Immunity, 1: 751-761 (1994) (каждый источник приведен здесь в качестве ссылки). Предпочтительным PADRE пептидом является AKXVAAWTLKAAA (SEQ ID NO:11) (общие остатки выделены жирным), где Х предпочтительно представляет собой циклогексилаланин, тирозин или фенилаланин, при этом циклогексилаланин является наиболее предпочтительным.

Иммуногенные агенты могут быть соединены с носителями с помощью химического перекрестного связывания. Методика соединения иммуногена с носителем включает создание дисульфидных связей с использованием N-сукцинимидил-3-(2-пиридилтио)пропионата (SPDP) и сукцинимидил-4-(N-малеимидометил)циклогексан-1-карбоксилата (SMCC) (если пептид не имеет сульфгидрильной группы, это может быть обеспечено путем включения остатка цистеина). Эти реагенты создают дисульфидную связь между собой, пептидную связь между остатками цистеина одного белка и амидную связь через ипсилон-аминогруппу лизина, или через другие свободные аминогруппы других аминокислот. Различные варианты таких агентов, формирующих дисульфидные/амидные связи описаны в Immun. Rev. 62, 185 (1982). Другие бифункциональные соединяющие агенты формируют тиоэфиры наряду с формированием дисульфидной связи. Многие из таких соединений, формирующих тиоэфиры, являются коммерчески доступными и включают химически активные сложные эфиры 6-малеимидокапроновой кислоты, 2-бромуксусной кислоты и 2-йодуксусной кислоты, 4-(N-малеимидометил)циклогексан-1-карбоксильной кислоты. Карбоксильные группы могут быть активированы путем комбинирования их с сукпинимидом или 1-гидроксил-2-нитро-4-сульфоновой кислотой, ее натриевой солью.

Иммуногенность соединений может быть усилена путем включения разделяющих остатков (например, Гли-Гли) между Тх эпитопом и пептидным иммуногеном, заявленным в соответствии с настоящим изобретением. Для дополнительного физического разделения Тх эпитопа и В-клеточного эпитопа (то есть пептидного иммуногена), остатки глицина могут прерывать любые вторичные структуры, созданные соединением Тх эпитопа и пептидного иммуногена, и, следовательно, устранять взаимодействия между Т и/или В-клеточным ответами. Конформационное разделение между хелперным эпитопом и антителом, включающим домен, обеспечивает эффективное взаимодействие между экспонируемым иммуногеном и соответствующим Th эпитопом и В-клетками.

Для усиления индукции Т-клеточного иммунитета у большого числа людей, имеющих различные типы HLA, по отношению к агенту, заявленному в соответствии с настоящим изобретением, может быть приготовлена смесь конъюгатов с различными Тх-клеточными эпитопами. Смесь может содержать смесь по крайней мере двух конъюгатов с различными Тх-клеточными эпитопами, смесь по крайней мере трех конъюгатов с различными Тх-клеточными эпитопами или смесь по крайней мере четырех конъюгатов с различными Тх-клеточными эпитопами. Смесь может вводиться вместе с адъювантом.

Иммуногенные пептиды могут быть также экспрессированы как белки слияния с носителями (то есть как гетерологичные пептиды). Носитель может быть присоединен к аминоконцу иммуногенного пептида, к его карбоксильному концу или к обоим концам. По выбору, белок слияния может включать множество копий иммуногенного пептида. Возможно также, чтобы иммуногенный пептид был соединен с множеством копий гетерологичного пептида, например, на его С- и N-концах. Также возможно, чтобы множественные копии иммуногенного пептида были связаны с множественными копиями гетерологичного пептида, которые, в свою очередь, связаны между собой. Некоторые пептидные носители могут служить как стимуляторы иммунного Тх-клеточного ответа, направленного против этого же пептидного переносчика. Индуцированные Т-клетки в свою очередь индуцируют В-клеточный иммунный ответ, направленный против иммуногенного пептида, связанного с носителем.

Некоторые примеры белков слияния, которые являются подходящими в рамках настоящего изобретения, приведены ниже. Некоторые их этих белков слияния содержат сегменты Аβ, связанные с эпитопами столбнячного токсина, как описано в патенте США US 5196512, европейском патенте ЕР 378881 и европейском патенте ЕР 427347. Некоторые белки слияния содержат сегменты Аβ, связанные по крайней мере с одним пептидом PADRE, как описано в патенте США US 5736142. Некоторые гетерологичные пептиды не являются универсальными Т-клеточными эпитопами, в то время как другие гетерологичные пептиды представляют собой универсальные Т-клеточные эпитопы. В некоторых методиках агент для введения представляет собой простой белок слияния с Аβ сегментом, связанный с гетерологичным сегментом в линейной конфигурации. Терапевтические агенты, заявленные в соответствии с настоящим изобретением, могут быть представлены с помощью формулы. Например, в некоторых методиках агент представляет собой полимер белков слияния, соответствующий формуле 2х, в которой х является целым числом от 1 до 5. Предпочтительно х равен 1, 2 или 3, при этом 2 является более предпочтительным. В том случае, когда х равен двум, такой полимер имеет четыре белка слияния, соединенных в наиболее предпочтительной конфигурации, обозначаемой как МАР4 (см. патент США US 5229490).

MAP4 конфигурация показана ниже, разветвленные структуры которой получены путем инициального пептидного синтеза как на N-конце, так и на аминах боковой цепи лизина. В последовательность включают лизин необходимое число раз и разветвляют его, конечная структура будет иметь несколько N-концов. В данном примере четыре идентичных N-конца получены на разветвленном ядре, содержащем лизин. Такая сложная структура значительно усиливает реактивность родственных В-клеток. В примерах, приведенных ниже, Z обозначает иммуногенный фрагмент Аβ, a Z1-4 означают имуногенные фрагменты Аβ. Фрагменты могут быть идентичными или различными.

Другие примеры белков слияния включают следующие:

Z-Столбнячный токсин 830-844 в MAP4 конфигурации:

Z-QYIKANSKFIGITEL (SEQ ID NO:12)

Z-Столбнячный токсин 947-967 в MAP4 конфигурации

Z-FNNFTVSFWLRVPKVSASHLE (SEQ ID NO:13)

Z-Столбнячный токсин 830-844 в МАР4 конфигурации:

Z-QYIKANSKFIGITEL (SEQ ID NO:14)

Z-Столбнячный токсин 830-844 + 947-967 в линейной конфигурации:

Z-QYIKANSKFIGITELFNNFTVSFWLRVPKVSASHLE (SEQ ID NO:15)

PADRE пептид (все в линейной конфигурации), в котором Х предпочтительно представляет собой циклогексилаланин, тирозин или фенилаланин, циклогексилаланин является наиболее предпочтительным - Z:

AKXVAAWTLKAAA-Z (SEQ ID NO:16)

Z x 3-PADRE пептид:

Z-Z-Z-AKXVAAWTLKAAA (SEQ ID NO:17)

Z-овальбумин 323-339 в линейной конфигурации:

Z-ISQAVHAAHAEINEAGR (SEQ ID NO:20)

Другие примеры белков слияния включают:

AKXVAAWTLKAAA-Z-Z-Z-Z (SEQ ID NO:18)

Z-AKXVAAWTLKAAA (SEQ ID NO:19)

PKYVKQNTLKLAT-Z-Z-Z (SEQ ID NO:21)

Z-PKYVKQNTLKLAT-Z (SEQ ID NO:22)

Z-Z-Z-PKYVKQNTLKLAT (SEQ ID NO:23)

Z-Z-PKYVKQNTLKLAT (SEQ ID NO:24)

Z-PKYVKQNTLKLAT-EKKIAKMEKASSVFNV-QYIKANSKFIGITEL-

FNNFTVSFWLRVPKVSASHLE-Z-

Z-Z-Z-QYIKANSKFIGITEL-FNNFTVSFWLRVPKVSASHLE (SEQ ID NO:25)

Z-QYIKANSKFIGITELCFNNFTVSFWLRVPKVSASHLE-Z-QYIKANSKFIGITELCFNNFTVSFWLRVPKVSASHLE-Z (SEQ ID NO:26)

Z-QYIKANSKFIGITEL (SEQ ID NO:27) на двуразветвленной смоле: фрагменты могут быть идентичными или различными.

Для создания иммуногенов, которые стимулируют выработку антител к Аβ или иммуногенным фрагментам Аβ, могут быть использованы одинаковые или различные белки-носители и методики их соединения. Например, Аβ или иммуногенный фрагмент Аβ, соединенный с носителем, может быть введен лабораторному животному для получения моноклональных антител к Аβ или его иммуногенному фрагменту.

V. Нуклеиновая кислота, кодирующая терапевтические агенты

Иммунный ответ, направленный против амилоидных отложений, также может быть вызван введением нуклеиновой кислоты, кодирующей сегменты Аβ пептида, его фрагменты, или другие пептидные иммуногены, или антитела и их составные цепи, используемые для пассивной иммунизации. Такими нуклеиновыми кислотами могут быть ДНК и РНК. Сегмент нуклеиновой кислоты, кодирующий иммуноген, обычно соединен с регуляторными элементами, такими как промотор и энхансер, которые позволяют сегменту ДНК экспрессироваться в клетках-мишенях пациента. Для экспрессии в клетках крови, что является желательным для стимуляции иммунного ответа, подходящими являются промоторные и энхансерные элементы из генов тяжелых и длинных цепей иммуноглобулина или же основной промежуточный ранний промотор и энхансер CMV. Связанные регуляторные элементы и кодирующие последовательности обычно клонируют в векторе. Для введения двухцепочечных антител две цепи могут быть клонированы как в одном, так и в разных векторах. Нуклеиновые кислоты, кодирующие терапевтические агенты в соответствии с настоящим изобретением, также могут кодировать по крайней мере один Т-клеточный эпитоп. Заключения, приведенные здесь и относящиеся к использованию адъювантов и носителей, при внесении определенных изменений, подразумевают их использование вместе с нуклеиновыми кислотами, кодирующими терапевтические агенты в соответствии с настоящим изобретением.

В настоящее время доступно множество вирусных векторных систем, включая ретровирусные системы (см, например, Lawrie and Tumin, Cur. Opin. Genet. Develop. 3, 102-109 (1993)); аденовирусные векторы (см., например, Bett et al., J. Virol. 67, 5911 (1993)); аденоассоциированные вирусные векторы (см., например, Zhou et al., J. Exp. Med. 179, 1867 (1994)), вирусные векторы из семейства оспы, включая вирус коровьей оспы и вирусы птичьей оспы, вирусные векторы из рода альфа-вирусов, включая полученные из вирусов Sindbis и Semliki Forest (см., например, Dubensky et al., J. Virol. 70, 508-519 (1996)), вирус венесуэльского энцефалита лошадей (см. патент США US 5643576) и рабдовирусы, такие как вирус везикулярного стоматита (см. заявку на патент WO 96/34625), и палилломавирусы (Ohe et al., Human Gene Therapy 6, 325-333 (1995); Woo et al., заявка на патент WO 94/12629, и Xiao & Brandsma, Nucleic Acids. Res. 24, 2630-2622 (1996)).

ДНК, кодирующая иммуноген, или вектор, содержащий то же, могут быть заключены в липосомы. Подходящие липиды и родственные аналоги описаны в патентах США US 5208036, 5264618, 5279833 и 5283185. Векторы и ДНК, кодирующая иммуноген, также могут быть ассоциированы с определенными носителями или абсорбированы ими, примерами являются полимеры полиметилметакрилата и полиактиды и поли(лактид-со-гликолиды), см., например, McGee et al., J. Micro. Encap. (1996).

Векторы для генной терапии или "голая" ДНК могут быть доставлены in vivo путем введения их конкретному пациенту, главным образом, путем системного введения (например, путем внутривенного, внутрибрюшинного, назального, гастрального, внутрикожного, внутримышечного, подкожного и внутричерепного введения) или путем местного применения (см., например, патент США US 5399346). Такие векторы также могут включать потенцирующие агенты, такие как бупивацин (см. патент США US 5593970). ДНК также может быть введена с помощью генного "ружья", (см. Xiao & Brandsma, supra). ДНК, кодирующую иммуноген, осаждают на поверхности микроскопических металлических бусин. Микроснарядам придают ускорение с помощью ударной волны или расширяющегося потока гелиевого газа, после чего они проникают через ткани на глубину нескольких клеточных слоев. Например, подходящим является прибор для доставки генов Accel™, производимый компанией Agacetus, Inc. Middleton WI. Альтернативно, "голая" ДНК может проходить через кожу в кровоток просто после нанесения на кожу, которое сопровождается химическим или механическим раздражением (см. заявку WO 95/05853).

В другом варианте векторы, кодирующие иммуногены, могут быть введены в клетки ех vivo, например в клетки, выделенные из организма конкретного пациента (например, лимфоциты, аспират костного мозга, тканевая биопсия) или гемопоэтические стволовые клетки универсального донора, после чего эти клетки снова вводят пациенту, обычно после отбора именно тех клеток, которые содержат вектор.

VI. Адъюванты

Иммуногенные агенты в соответствии с настоящим изобретением, такие как пептиды, иногда вводят в комбинации с адъювантом. Адъювант увеличивает титр индуцированных антител и/или аффинность связывания индуцированных родственных антител, если использовался один пептид. Для стимуляции иммунного ответа могут быть использованы различные адъюванты в комбинации с иммуногенными фрагментами Аβ. Предпочтительные адъюванты усиливают иммунный ответ на иммуноген и не вызывают изменений его конформации, которые могут повлиять на качество иммунного ответа. Предпочтительные адъюванты включают гидроксид алюминия и фосфат алюминия, 3-De-O-ацилированный монофосфориловый липид A (MPL™) (см. патент Великобритании GB 2220211) (RIBI ImmunoChem Research Inc., Hamilton, Montana, now part of Corixa). Stimulon™ QS-21 - это тритерпеновый гликозид или сапонин, выделенный из коры дерева Quillaja Saponaria Molina, растущего в Южной Америке (см. Kensil et al., in Vaccine Design: The Subunit and Adjuvant Approach (eds. Powell & Newman, Plenum Press, NY, 1995); патент США US No. 5057540), (Aquila BioPharmaceuticals, Framingham, MA). Другие адъюванты представляют собой эмульсии масло в воде (такие как сквален или арахисовое масло), возможно в комбинации с иммуностимулянтами, такими как монофосфориловый липид А (см. Stoute et al., N. Engl. J. Med. 336, 86-91 (1997)), плюрониковые полимеры и убитые микобактерии. Другим адъювантом является CpG (см. заявку WO 98/40100). Адъюванты могут вводиться как компоненты лекарственной композиции совместно с активным агентом или же отдельно, перед, во время или после введения терапевтического агента.

Предпочтительным классом адъювантов являются соли алюминия, такие как алюминия гидроксид, алюминия фосфат, алюминия сульфат. Такие адъюванты могут использоваться как отдельно, так и вместе с другими иммуностимулирующими агентами, такими как MPL или 3-DMP, QS-21, полимерными или мономерными аминокислотами, такими как полиглутаминовая кислота или полилизин. Другим классом адъювантов являются эмульсионные композиции масло в воде. Такие адъюванты также могут использоваться как отдельно, так и совместно с другими иммуностимулирующими агентами, такими как мурамиловые пептиды (например, N-ацетилмурамил-L-треонил-D-изоглутамин) (thr-MDP), N-ацетилнормурамил-L-аланил-D-изоглутамин (нор-MDP), N-ацетилмурамил-L-аланил-D-изоглутаминил-L-аланин-2-(1′-2′-дипалмитоил-sn-глицеро-3-гидроксифосфорилокси)этиламин (МТР-РЕ), N-ацетилглюкозаминил-N-ацетилмурамил-L-Al-D-изоглу-L-ала-дипалмитоксипропиламид (DTP-DPP) терамидТМ) или другие компоненты клеточной стенки бактерий. Эмульсии масло-в-воде включают (a) MF59 (см. заявку на патент WO 90/14837), содержащий 5% сквален, 0.5% Твин 80 и 0.5% Спан 85 (по выбору содержащий различные количества МТР-РЕ), превращенный в субмикронные частицы с помощью микрофлюидизатора, такого как микрофлюидизатор Model 110Y (Microfluidics, Newton МА), (b) SAP, содержащий 10% сквален, 0.4% Твин 80, 5% плюрониковый блокированный полимер LI 21 и thr-MDP, также микрофлюидизированный в субмикронную эмульсию или же в эмульсию из частиц большего размера (полученную с помощью воронки), (с) Ribi™ адъювантную систему (RAS), (Ribi ImmunoChem, Hamilton, МТ), включающую 2% сквален, 0.2% Твин 80 и один или несколько компонентов клеточной стенки бактерий из группы, включающей монофософориловый пептид А (MPL), трегалозы димиколат (TDM) и скелет клеточной стенки (CWS), предпочтительно MPL+CWS (Detox™).

Другим классом адъювантов является класс сапониновых адъювантов, таких как Stimulon™ (QS-21, Aquila, Framingham, MA), или частицы, полученные на его основе, такие как ISCOMs (иммуностимулирующие комплексы) и ISCOMARTIX. Другими адъювантами являются RC-529, GM-CSF и полный адъювант Фрейнда (CFA от англ. Complete Freund's Adjuvant) и неполный адъювант Фрейнда (IFA). Также к адъювантам относятся цитокины, такие как интерлейкины (например, IL-1 α и β пептиды, IL-2, IL-4, IL-6, IL-12, IL-13 и IL-15), колониестимулирующий фактор макрофагов (M-CSF), колониестимулирующий фактор гранулоцитов-макрофагов (GM-CSF), фактор некроза опухоли (TNF), хемокины, такие как MIP1 α и β и RANTES. Другим классом адъювантов являются аналоги гликолипида, включая N-гликозиламиды, N-гликозилмочевину, N-гликозилкарбаматы, в каждом из которых сахаридный остаток замещен аминокислотой, представляющие собой иммуномодуляторы адъювантов (см. патент США US No. 4855283). Белки токсического шока, например HSP70 и HSP90, также могут быть использованы в качестве адъювантов.

Адъювант может вводиться вместе с иммуногеном в одной композиции или же может вводиться перед, во время или после введения иммуногена. Иммуноген и адъювант могут быть упакованы в один пузырек или же каждый из них может содержаться в отдельном пузырьке, тогда их смешивают перед введением. В том случае, если иммуноген и адъювант упакованы отдельно, упаковка обычно включает инструкцию по их правильному смешиванию перед использованием. Выбор того или иного адъюванта и/или носителя зависит от стабильности иммуногенной композиции, содержащей адъювант, способа ее ведения, режима дозировки, эффективности адъюванта по отношению к животному, которое подлежит вакцинации, и, в случае применения у человека, фармацевтически доступным адъювантом является тот, который уже был испытан или проходит испытание на возможность введения человеку соответствующим образом. Например, полный адъювант Фрейнда не подходит для введения человеку. Предпочтительными являются соли алюминия, MPL и QS-21. Возможно использование двух или более адъювантов одновременно. Предпочтительными комбинациями являются соли алюминия и MPL, соли алюминия и QS-21, MPL и QS-21, MPL или RC-529 вместе с GM-CSF, и соли алюминия, QS-21 и MPL вместе. Также может применяться неполный адъювант Фрейнда (Chang et al., Advanced Drug Delivery Reviews 32, 173-186 (1998)), возможно в комбинации как с солями алюминия, так и с QS-21 или MPL, а также одновременно со всеми этими адъювантами.

Пассивное введение антител

Активная иммунизация фрагментами Аβ может комбинироваться с пассивным введением антител. Антитела, которые используются для пассивного введения, могут представлять собой антитела к N-концевым эпитопам Аβ для того, чтобы стимулировать фагоцитарный ответ, направленный на разрушение амилоидных бляшек, а также могут представлять собой антитела к центральным или С-концевым участкам Аβ для связывания растворимого Аβ. В некоторых методиках пассивное введение антител к N-концевому участку используется в первую очередь для разрушения существующих отложений амилоида. После этого вводят фрагмент из центрального или С-концевого участка Аβ для предотвращения дальнейшего отложения свободного Аβ в бляшки. Согласно другим методикам активная иммунизация фрагментами к центральным или С-концевым участкам Аβ осуществляется в первую очередь для генерации антител, которые связывают растворимый Аβ. Затем, когда уровень антител в крови начинает снижаться, вводят дополнительную дозу антител, которые специфично связывают центральный или С-концевой эпитоп Аβ.

Антитела, которые являются подходящими для пассивного введения, описаны в заявках WO 00/72880 и WO 02/46237. Предпочтительные антитела, связывающиеся с N-концевым эпитопом Аβ, присоединяются, начиная с 1-3 остатков и заканчивая 7-11 остатками Аβ. Некоторые предпочтительные антитела специфически связываются с эпитопами в пределах 1-3, 1-4, 1-5, 1-6, 1-7 или 3-7 аминокислотных остатков. Некоторые предпочтительные антитела специфически связываются с эпитопом, начиная с 1-3 аминокислотных остатков и заканчивая 7-11 остатками Аβ. Такие антитела обычно специфически связываются с амилоидными отложениями, а также могут как связывать, так и не связывать растворимый Аβ. Некоторые предпочтительные антитела, специфически связывающиеся с С-концевым эпитопом Аβ, специфически связывают натуральную длинную форму Аβ (то есть Аβ42 и Аβ43) без специфического связывания с натуральной короткой формой Аβ (то есть Аβ39 или Аβ41). Антитела к С-концевому и центральному эпитопам Аβ обычно специфически связываются с растворимым Аβ, но не связываются с амилоидными бляшками. В том случае, когда антитело специфически связывается с эпитопом на его специфичных остатках, таких как, например, остатки 1-5 Аβ, это означает, что антитело специфически связывается с полипептидом, имеющим специфические аминокислотные остатки (то есть Аβ 1-5, как в этом примере). Такое антитело не обязательно должно контактировать с каждым из этих остатков (1-5). Также единичное замещение аминокислоты или ее деления в пределах 1-5 остатков Аβ не влияет существенно на связывающую аффинность. Эпитопная специфичность антител может быть определена, например, как описано в заявке WO 00/72880.

Антитела могут быть моноклональными или поликлональными. Поликлональная сыворотка обычно содержит смешанные популяции антител, специфически связывающихся с несколькими эпитопами, расположенными на протяжении молекулы Аβ. Однако поликлональная сыворотка может быть специфичной и к определенному сегменту Аβ, такому как Аβ 1-10. Предпочтительные антитела являются химерными, гуманизированными (см. Queen et al., Proc. Natl. Acad. Sci. USA 86: 10029-10033 (1989) и заявку на патент WO 90/07861, патенты США US 5693762, US 5693761, US 5585089, US 5530101 и Winter, патент США US 5225539) или человеческими (Lonberg et al., заявка на патент WO 93/12227 (1993); патенты США US 5877397, US 5874299, US 5814318, US 5789650, US 5770429, US 5661016, US 5633425, US 5625126, US 5569825, US 5545806, Nature 148, 1547-1553 (1994), Nature Biotechnology 14, 826 (1996), Kucherlapati, заявка на патент WO 91/10741 (1991)). Некоторые мышиные антитела с различной специфичностью связывания являются приемлемыми для использования в качестве стартового материала для получения гуманизированных антител. Изотип IgG1 человека является предпочтительным для получения антител к N-концевому участку, поскольку он обладает наиболее высокой аффинностью среди всех изотипов человека к FcRI рецептору, расположенному на фагоцитирующих клетках. Некоторые антитела специфично связываются с Аβ с аффинностью связывания, равной 107, 108, 109, 1010 М-1 и выше.

VIII. Пациенты, подлежащие лечению

Лечению подлежат пациенты, имеющие индивидуальный риск развития заболевания, но не имеющие симптомов, а также пациенты с развернутой клинической картиной, имеющие симптомы. В случае болезни Альцгеймера к тем, кто имеет риск заболеть, относятся мужчины или женщины, живущие достаточно долго. Кроме того, способы в соответствии с настоящим изобретением могут применяться в качестве профилактических по отношению ко всей популяции, без необходимости выделения конкретных людей, имеющих риск заболеть. Способы в соответствии с настоящим изобретением особенно показаны тем людям, которые имеют наследственную предрасположенность к болезни Альцгеймера. К таким людям относятся те, у которых имеются родственники, страдающие этим заболеванием, а также те, у которых такая предрасположенность была определена с помощью выявления генетических или биохимических маркеров. Генетические маркеры болезни Альцгеймера включают мутации гена АРР, в частности мутации в позиции 717 и позициях 670 и 671, обозначаемые как мутации Харди и Шведская мутация соответственно (см. Hardy, TINS16 выше). Другими маркерами являются мутации в генах презенилина, PS1 и PS2, и ApoE4, при наличии семейного анамнеза, гиперхолестеринемии или атеросклероза у пациента. У людей, страдающих болезнью Альйгеймера, можно выявить характерную для этого заболевания деменцию, а также маркеры, описанные выше. Кроме того, в настоящее время существует целый ряд диагностических тестов, позволяющих выявить пациентов, страдающих болезнью Альцгеймера. К таким тестам относится измерение уровней CSF-тау и Аβ42. Повышенный уровень тау-белка и сниженный уровень Аβ42 свидетельствуют о наличии болезни Альцгеймера. Пациенты, страдающие болезнью Альцгеймера, также могут быть выявлены с помощью критериев ADRDA, как описано в заявке на патент WO 00/72880.

У пациентов, не имеющих симптомов, лечение может быть начато в любом возрасте (например, в 10, 20, 30 лет). Однако обычно не имеет смысла начинать лечение, пока пациент не достигнет возраста 40, 50, 60 или 70 лет. Лечение обычно включает применение множественных доз в течение определенного периода времени. Лечение может контролироваться определением антительного, Т-клеточного (побочный эффект) или В-клеточного ответа на терапевтический агент (например, Аβ пептид) в течение какого-либо периода времени. Если ответ снижается, требуется усиливающая доза. В случае потенциальных пациентов с синдромом Дауна лечение может быть начато антенатально и заключаться во введении терапевтического агента матери или же сразу после рождения.

IX. Режимы терапии

В целом, режимы лечения включают введение пациенту терапевтического агента, эффективного в отношении стимуляции иммунного ответа на Аβ, предпочтительно иммуногенного фрагмента Аβ. В случае профилактического лечения фармацевтические композиции или лекарственные средства вводятся пациентам, подверженным или же имеющим риск развития болезни Альцгеймера, в количествах, достаточных для того, чтобы снизить риск, уменьшить тяжесть течения или отсрочить начало заболевания, включая психологические, биохимические, гистологические и/или поведенческие симптомы, а также осложнения и промежуточные патологические проявления, возникающие в процессе развития заболевания. В случае терапевтического лечения агент вводится пациенту, подверженному или уже страдающему от этого заболевания, в режиме, включающем введение определенного количества агента с определенной частотой для лечения или, по крайней мере, уменьшения симптомов заболевания (психологических, биохимических, гистологических и/или поведенческих) или его осложнений и промежуточных патологических проявлений, возникающих в процессе развития заболевания. Согласно некоторым методикам введение агента уменьшает или прекращает развитие миокогнитивных расстройств у пациентов, у которых еще не проявились все характерные симптомы болезни Альцгеймера. Количество агента, достаточное для достижения терапевтического или профилактического эффекта, обозначается как терапевтическая- или профилактическая-эффективная доза. Сочетание количества и частоты введения дозы, достаточное для достижения терапевтического или профилактического эффекта, обозначается как терапевтический- или профилактический-эффективный режим. В случае применения как профилактического, так и терапевтического режима агенты обычно вводятся в нескольких дозировках, пока не будет достигнут желаемый иммунный ответ. Дозы и частота введения, достаточные для достижения терапевтического или профилактического эффекта, обозначаются как терапевтический- или профилактический-эффективный режим. Обычно иммунный ответ пациента тщательно контролируется, поэтому в том случае, если он начинает падать, повторно вводится агент. Иммунный ответ может контролироваться путем определения антител к Аβ в крови пациента, определения уровня Аβ или количества бляшек в головном мозге или же путем выявления симптомов с помощью психометрических измерений, таких как MMSE или ADAS, которые полностью позволяют оценить статус и функциональное состояние пациентов с болезнью Альцгеймера.

Эффективные дозы агентов и композиций в соответствии с настоящим изобретением, применяющихся для лечения описанных выше состояний, различаются в зависимости от различных факторов, включая пути введения, ткани-мишени, физиологическое состояние пациента, является пациент человеком или животным, получает ли он какие-либо еще лекарственные средства, является ли введение терапевтическим или профилактическим. Обычно пациент является человеком, но возможно лечение и других млекопитающих, включая трансгенные животные. Терапевтические дозы должны быть оттитрованы для обеспечения безопасности и эффективности лечения. Количество вводимого агента зависит от того, применяется ли совместно с ним адъювант, при этом при его отсутствии требуются более высокие дозы агента. Количество иммуногена для введении иногда варьирует от 1-500 мкг для одного пациента до, более часто, 5-500 мкг на одну инъекцию человеку. Иногда используется более высокая доза - около 1-2 мг на одну инъекцию. Обычно на одну инъекцию человеку используют 10, 20, 50 или 100 мг. Количество вводимого иммуногена также зависит от массового соотношения иммуногенного эпитопа к общей массе иммуногена. Обычно используется от 10-3 до 10-5 микромолей имуногенного эпитопа на микрограмм иммуногена. Время введения агента может также различаться значительно: от одного раза в день, одного раза в год до одного раза в десять лет. На каждый день введения доза иммуногена составляет более 1 мкг для одного пациента и обычно составляет более 10 мкг в том случае, если используется адъювант, и составляет более 10 мкг и обычно более 100 мкг, если адъювант не используется. Обычный режим включает иммунизацию с последующим введением усиливающих доз с определенными временными интервалами, составляющими, например, 6 недель. Другой режим включает иммунизацию с последующим введением усиливающих доз 1, 2 и 12 месяцев спустя. Еще один режим подразумевает введение препарата каждые два месяца на протяжении всей жизни. Альтернативно, усиливающие инъекции могут не иметь регулярного режима введения и зависеть от определяемого уровня иммунного ответа пациента.

Дозы нуклеиновых кислот, кодирующих иммуногены, варьируют от 10 нг до 1 г, от 100 нг до 100 мг, от 1 мкг до 10 мг или же от 30 до 300 мкг ДНК для одного пациента. Дозировки вирусных векторов варьируют от 10-100, или более, вирионов на одну дозу.

Для пассивной иммунизации антителом (в случае комбинированной терапии) доза варьирует от 0.0001 до 100 мкг/кг, обычно, от 0.01 до 5 мкг/кг на вес пациента. Например, доза может составлять 1 мкг/кг или 10 мкг/кг, или же находиться в пределах от 1 до 10 мкг/кг, другими словами, 70 мкг или 700 мкг или же в пределах от 70 до 700 мкг соответственно для пациента весом 70 кг. Примерный режим лечения включает введение агента один раз в две недели, один раз в месяц или один раз каждые 3 или 6 месяцев. Согласно некоторым методикам одновременно вводят два или более моноклональных антитела с различной специфичностью связывания в каждом случае, дозировки каждого антитела соответствуют приведенным выше. Антитело обычно вводят различными способами. Интервал между введением единичной дозы может составлять одну неделю, один месяц или даже один год. Частота введения также может быть нерегулярной и определяться измеренным в крови пациента уровнем антител к Аβ. Согласно одним методикам доза рассчитывается таким образом, чтобы концентрация антител в плазме составляла 1-1000 мкг/мл, согласно другим 25-300 мкг/мл. Альтернативно, антитело может вводиться в виде специальной композиции с замедленным высвобождением, что требует более редкого введения. Дозировка и частота введения варьируют в зависимости от периода полужизни антитела в организме пациента. В целом, наибольший период полужизни имеют антитела человека, затем гуманизированные антитела, химерные антитела и антитела не человека. Дозировка и частота введения также зависят от того, является лечение профилактическим или терапевтическим. В случае профилактического лечения, вводят относительно небольшие дозы с относительно редкими интервалами на протяжении длительного периода времени. Некоторые пациенты получают лечение в течение всей своей жизни. В случае терапевтического лечения вводят достаточно большие дозы с короткими интервалами до тех пор, пока не появятся признаки регресса заболевания, предпочтительно до тех пор, пока у пациента частично или полностью не исчезнут симптомы заболевания. После этого пациент будет получать антитела в профилактическом режиме.

Агенты, вызывающие иммунный ответ и использующиеся для профилактики и лечения, могут вводиться парентерально, местно, внутривенно, орально, подкожно, внутриартериально, интракраниально, интраперитонеально, интраназально или внутримышечно. Наиболее часто иммуногенный агент вводят подкожно, хотя другие способы введения также являются эффективными. Другим наиболее часто применяемым способом введения является внутримышечный. Обычно инъекцию осуществляют в мышцы плеча или бедра. В некоторых методиках агенты вводят непосредственно в ту ткань, в которой находятся отложения амилоида, например, с помощью интракраниального (внутричерепного) введения. Предпочтительными способами введения антител является внутримышечный и внутривенный (в комбинированной терапии). Согласно некоторым методикам определенные терапевтические антитела вводят непосредственно в череп. В некоторых методиках антитела вводят в виде особых композиций с замедленным высвобождением, таких как, например, Madipad™.

Агенты в соответствии с настоящим изобретением обычно применяются в форме фармацевтических композиций, содержащих активный терапевтический агент и различные другие фармацевтически доступные компоненты. См. Remington's Pharmaceutical Science (15th ed., Mack Publishing Company, Easton, Pennsylvania, 1980). Предпочтительная форма зависит от назначенного пути введения и терапевтического применения. Композиции могут также содержать, в зависимости от желаемой рецептуры, фармацевтически доступные, нетоксичные носители или разбавители, которые обычно используются в качестве связующих соединений в фармацевтических композициях, применяющихся у человека и животных. Разбавитель выбирается таким образом, чтобы он не влиял на биологическую активность композиции. Примерами таких разбавителей являются дистиллированная вода, физиологический фосфатный буферный солевой раствор, раствор Рингера, раствор декстрозы, раствор Ханка. Кроме того, фармацевтическая композиция или рецептура может также включать другие носители и адъюванты или нетоксичные нелекарственные неиммуногенные стабилизаторы или им подобные соединения.

Фармацевтические композиции могут также содержать большие, медленно метаболизируемые макромолекулы, такие как белки, полисахариды, например хитозан, полимолочные кислоты, полигликолевые кислоты и сополимеры (такие как латексная функционализированная сефароза (ТМ), агароза, целлюлоза и им подобные соединения), полимерные аминокислоты, сополимеры аминокислот, липидные агрегаты (такие как масляные капельки или липосомы). Кроме того, эти носители могут выступать и как иммуностимулирующие агенты (то есть адъюванты).

Для парентерального применения агенты в соответствии с настоящим изобретением могут вводиться в виде инъекционных форм, включающих раствор или суспензию активного агента в физиологически приемлемом растворителе совместно с фармацевтическим носителем, который может представлять собой стерильную жидкость, такую как вода, масло, солевой раствор, глицерол или спирт. Кроме того, в композиции могут содержаться вспомогательные соединения, такие как увлажняющие или эмульгирующие вещества, сурфактанты, рН буферизующие соединения и им подобные вещества. Другими компонентами композиции могут быть соединения животного, растительного, синтетического или нефтяного происхождения, например арахисовое масло, масло из бобов сои, минеральное масло. В целом, предпочтительными жидкими носителями являются гликоли, такие как пропиленгликоль или полиэтиленгликоль, особенно для растворов для инъекций. Антитела могут вводиться в форме депо-инъекций или в форме композиций для имплантации, которые создаются таким образом, чтобы обеспечивать замедленное и постепенное высвобождение активного агента. Примерная композиция включает моноклональное антитело в дозе 5 мг/мл в водном буфере, содержащем 50 мМ L-гистидина, 150 мМ NaCl, доведенном до рН 6.0 с помощью HCl. Композиции для парентерального введения обычно являются полностью стерильными, изотоничными, приготовленными в соответствии с GMP-условиями PDA или сходным образом.

Обычно композиции приготавливают в форме, приемлемой для инъекций, как в виде растворов или суспензий, так и в виде твердых форм, предназначенных для растворения или суспендирования в жидкой среде перед введением. Композиция также может быть эмульгирована или инкапсулирована в липосомы или микрочастицы, такие как полилактиды, полигликолиды или сополимеры для усиления адъювантного эффекта, как обсуждалось выше (см. Langer, Science 249, 1527 (1990), и Hanes, Advanced Drug Delivery Reviews 28, 97-119 (1997). Агенты, заявленные в соответствии с настоящим изобретением, могут вводиться в форме так называемых депо-инъекций или композиций для имплантации, которые создаются таким образом, чтобы обеспечивать постепенное и замедленное высвобождение активного ингредиента.

Дополнительные композиции включают композиции для орального, интраназального, легочного применения, композиции для аппликации на кожу, а также суппозитории.

Для создания суппозиториев в качестве формирующих соединений и носителей используют, например, полиалкиленовые гликоли или триглицериды; такие суппозитории могут быть сформированы из смеси, содержащей активный ингредиент в количестве от 0.5% до 10%, предпочтительно 1%-2%. Композиции для орального применения включают так называемое воспринимающее средство (среду для лекарства), такое как фармацевтический маннитол, лактоза, крахмал, стеарат магния, сахаристый натрий, целлюлоза и карбонат магния. Эти композиции могут иметь форму растворов, супензий, таблеток, пилюль, капсул, препаратов с замедленным высвобождением активного ингредиента или порошков и содержать от 10% до 95%, предпочтительно от 25% до 70% активного соединения.

Местное применение заключается в чрезкожном или внутрикожном введении. Местное введение может быть усилено путем совместного применения агента и холерного токсина или его детоксифицированных производных или субъединиц, или же путем совместного применения активного агента и другого идентичного бактериального токсина (см. Glenn. et al., Nature 391, 851 (1998)). Совместное введение может быть достигнуто при использовании указанных компонентов в смеси, а также в виде связанных с помощью химического синтеза молекул или же при экспрессии их в качестве белков слияния.

Альтернативно, чрезкожное введение может осуществляться с помощью кожного пути или при использовании трансферсом (Paul et al., Eur. J. Immunol. 25, 3521-24 (1995); Cevc et al., Biochem. Biophys. Acta 1368, 201-15 (1998)).

X. Способы мониторинга

Изобретение относится также к способам определения антительного ответа против Аβ пептида у пациентов, страдающих от болезни, связанной с отложением амилоида, или предрасположенных к ней. Эти способы особенно пригодны для контроля за лечением пациентов. Эти способы подходят как для контроля за лечением у пациентов, имеющих симптомы заболевания, так и для мониторинга профилактического лечения у пациентов, не имеющих симптомов. Некоторые способы заключаются в определении базового уровня антител в крови пациента до начала лечения и сравнении его с уровнем антительного ответа после лечения. Значительное повышение (то есть больше, чем обычная граница экспериментальной ошибки в повторяющихся измерениях одного и того же образца, выраженная как одно стандартное отклонение от среднего для таких измерений) величины антительного ответа свидетельствует о положительном результате лечения (то есть введение агента привело к достижению или увеличению иммунного ответа). Если уровень антительного ответа значительно не увеличился или даже снизился, это свидетельствует об отрицательном результате лечения. В целом, у пациентов, получивших начальный курс лечения иммуногенными агентами в эффективных дозах, ожидается увеличение иммунного ответа, который в итоге достигнет фазы плато. Введение активного агента продолжают до тех пор, пока происходит нарастание иммунного ответа. Достижение фазы плато является сигналом к прекращению лечения или к снижению дозы и частоты ведения агента.

Другие способы заключаются в определении контрольной величины (то есть среднего и стандартного отклонений) антительного ответа в контрольной популяции. Обычно пациенты из контрольной популяции не получают предварительного лечения. Измеренные величины антительного ответа у пациентов после введения терапевтического агента сравнивают с контрольными величинами. Значительное увеличение по отношению к контрольной величине (например, более чем одно стандартное отклонение от среднего) свидетельствует о положительном результате лечения. Отсутствие значительного увеличения или снижение иммунного ответа свидетельствует о негативном результате лечения. Введение агента обычно продолжают до тех пор пока антительный ответ увеличивается по отношению к контрольной величине. Как и в предыдущей методике, достижение фазы плато является сигналом к прекращению лечения или к снижению дозы и частоты введения агента.

Другие способы заключаются в определении контрольной величины (то есть среднего и стандартного отклонений) антительного ответа в контрольной популяции пациентов, которые уже прошли курс лечения терапевтическим агентом и у которых антительный ответ достиг фазы плато. Измеренные величины антительного ответа у этих пациентов сравнивают с контрольными величинами. Если измеренный у пациента уровень не отличается значительно (то есть более чем на одно стандартное отклонение) от контрольного, это означает, что лечение может быть прекращено. Если же уровень антительного ответа значительно ниже контрольного, необходимо продолжить введение терапевтического агента. Если же величина антительного ответа остается на том же уровне, необходимо изменить режим лечения, например использовать другой адъювант, фрагмент, или же перейти на пассивное введение.

Другим способом является мониторинг антительного ответа у пациента, который в настоящее время не получает лечения, но уже прошел курс предварительного лечения, для того чтобы определить, требуется ли этому пациенту продолжение лечения. Измеренную величину антительного ответа у пациента можно сравнить с величиной, полученной у этого же пациента сразу после предварительного курса лечения. Значительное снижение относительно первого измерения (то есть более чем обычный минимум ошибки при повторных измерениях одного и того же образца) говорит о том, что лечение должно быть возобновлено. Альтернативно, величину, измеренную у пациента, можно сравнить с контрольной величиной (среднее плюс стандартное отклонение), измеренной у пациентов, уже прошедших курс лечения. Альтернативно, величину, измеренную у пациента, можно сравнить с контрольной величиной, полученной у пациентов, получавших профилактическое лечение и не имеющих симптомов заболевания, или же у пациентов, которые получали терапевтическое лечение и у которых уменьшились проявления заболевания. Во всех этих случаях значительное снижение величины по сравнению с контрольной (то есть более чем на одно стандартное отклонение) означает, что лечение этого пациента должно быть возобновлено.

Обычно для анализа берут образцы крови, плазмы, сыворотки, слизи или цереброспинальной жидкости. Образец исследуют на наличие иммунного ответа к любой форме Аβ пептида, обычно к Aβ42 или пептиду, который использовался для иммунизации. Иммунный ответ определяют по наличию антител, которые специфично связываются с Аβ пептидом. Антитела могут быть определены с помощью анализа связывания с лигандом, который специфично связывается с ними. Обычно лиганд иммобилизуют. Связывание может быть определено с помощью меченого антиидиотипического антитела.

При использовании комбинированных режимов, включающих как активное, так и пассивное введение, для мониторинга уровня антител, полученных в результате пассивного введения, могут применяться те же подходы, описанные, например, в заявке на патент WO 00/72880.

Примеры

Материалы и методики

Аβ фрагменты. Пептиды, соответствующие Аβ1-5, Аβ3-9, Аβ5-11, Аβ15-24 и обратной последовательности Aβ5-1, способные к взаимодействию с Т-клеточным эпитопом из 17 аминокислот, полученным из овальбумина, синтезировали на разветвленном пептидном каркасе (ядро из трех остатков лизина с четырьмя пептидными ответвлениями) для получения мультиантигенного пептида, как описано у Tam, J.P. (1988) Proc. Natl. Acad. Sci. USA 85, 5409-5413. Получили поликлональные антитела (Pab) Аβ1-42 и фракцию иммуноглобулина изолировали, как описано у Bard, F. et al., (2000) Nat. Med. 6, 916-919. Поликлональные антитела Pab-EL16, Pab-EL17 и Pab-EL20 получали из сыворотки PDAPP мыши, иммунизированной пептидами, соответствующими Аβ1-7, Aβ15-24 и Аβ3-9, которые были синтезированы на разветвленном каркасе, как описано выше. Pab-EL26 был получен из сыворотки мыши, иммунизированной Аβ(7-1)42. Пептиды были синтезированы AnaSpec, San Jose, CA, USA.

Процедура иммунизации. 100 мкг Аβ фрагмента в полном адъюванте Фрейнда вводили путем внутрибрюшинной инъекции, после чего через 2 недели, 4 недели и 1 месяц ввели дополнительно 100 мкг пептида в неполном адъюванте Фрейнда.

Связывание антител с агрегированным и растворимым Aβ1-42. Титры сыворотки (полученные путем нескольких разведении) и моноклональное антитело, связывающееся с агрегированным синтетическим Аβ1-42 определяли с помощью ELISA, как описано у Schenk D. et al., (1999) Nature 400, 173-177. Растворимый Aβ1-42 соответствует синтетическому Aβ1-42 пептиду, разрушенному ультразвуком в диметилсульфоксиде. Несколько разведений антитела инкубировали с 50,000 cmp 125I Aβ1-42 в течение ночи при комнатной температуре. 50 мкл жидкой глины, содержащей 75 мг/мл белка А сефарозы (Amersham Biosciences, Uppsala, Sweden)/200 мкг антимышиных IgG (H+L) кролика (Jackson ImmunoResearch, West Grove, PA, USA) инкубировали с разведенными антителами в течение 1 часа при комнатной температуре, отмыли дважды и подсчитали на гамма-счетчике Wallac (PerkinElmer Life Sciense, Grove, IL, USA). Все этапы осуществляли в буфере для радиоиммунологического исследования, содержащем 10 мМ Tris, 0.5 М NaCl, 1 мг/мл желатина и 0.5% Nonidet P-40, рН 8.0.

Результаты

Сравнивали способность нескольких серий пептидов вызывать эффективный антительный ответ in vivo. PDAPP мышей возрастом от двенадцати до тринадцати месяцев иммунизировали одним из трех N-концевых пептидных фрагментов (Aβ1-5, Aβ3-9 или Аβ5-11) или фрагментом, полученным из внутреннего участка пептида (Аβ15-24) (фиг.1А). Внутренний пептид Aβ15-24, имеющий эпитоп антитела 266, которое обладает высокой аффинностью по отношению к растворимому Aβ (Seubert et al. (1992) Nature 359, 325-327), не распознает бляшки в нефиксированных срезах головного мозга, пораженного болезнью Альцгеймера, или в PDAPP ткани. Таким образом, было интересно определить, может ли поликлональный ответ, направленный против этого пептида, приводить к образованию антител, обладающих способностью распознавать бляшки, или же введение одного растворимого Аβ является достаточно эффективным. В этих исследованиях пептид с обратной последовательностью Aβ5-1 использовали в качестве негативного контроля. Синтезировали пептиды, способные к взаимодействию с Т-клеточным эпитопом из 17 аминокислот, полученным из овальбумина, и представляли их в идентичной мультивалентной конфигурации (см. Материалы и методики). Все пептиды (за исключением реверсемера Аβ5-1) приводили к образованию сыворотки, которая распознавала агрегированный синтетический Aβ1-42 в ELISA, хотя Аβ5-11 и Aβ15-24 вызывали образование более высоких титров антител, чем AβB1-5 (р<0.05 и р<0.05 соответственно) (фиг.1B). Наоборот, только сыворотка против N-концевых пептидов была способна распознавать Аβ в бляшках; антисыворотка против Аβ15-24 не связывала бляшки, несмотря на сильную реактивность по отношению к синтетическому агрегированному пептиду (фиг.1С). Также существуют различия в способности различных групп сывороток захватывать растворимый Аβ (фиг.2А). Менее чем 30% сывороток мыши, иммунизированной Аβ1-5 или Аβ3-9, захватывали растворимый пептид (27% и 5% соответственно). В отличие от этого сыворотки приблизительно половины животных, иммунизированных Aβ5-11, и всех животных, иммунизированных Аβ15-24, захватывали растворимый Aβ1-42.

Поскольку уровень отложений Аβ значительно варьирует в зависимости от возраста PDAPP мышей, исследование in vivo осуществляли на группах, включающих по крайней мере 30 животных. Данные об эффективности иммунизации приведены для одной мыши и выражены как процентное соотношение амилоидной или невритической нагрузки к средней контрольной величине (100%). Иммунизация каждым из трех N-концевых пептидов значительно снижала амилоидную нагрузку (46-61%, р<0.002) (фиг.2B). Кроме того, Аβ3-9 и Aβ5-11 значительно снижали невритическую патологию (34% и 41% соответственно, р<0.05) (фиг.2С). Иммунизация Аβ15-24 не приводила к снижению амилоидной или невритической нагрузки. Эти результаты свидетельствуют о том, что связывание с бляшками является одним из механизмов эффективности антител. Они также показывают, что захват растворимого Аβ не требуется для снижения невритической патологии до тех пор, пока антительный ответ против Аβ3-9 обеспечивает сильную реактивность по отношению к бляшкам и высокий уровень защиты от нейронной дистрофии, даже при слабой способности связывать растворимый пептид. Антитела, которые связывают растворимый Аβ без связывания с бляшками, могут также иметь такую активность, если их вводить в высоких титрах или же в течение длительного периода времени. Антитела, которые связывают растворимый Аβ без связывания с бляшками, также могут оказаться полезными для предотвращения формирования бляшек и/или отложений Аβ. Высокий титр антител, полученный путем иммунизации Аβ15-24 показывает, что этот фрагмент или его субфрагменты являются наиболее подходящими для генерирования высоких титров растворимых антител.

1. Способ лечения или профилактики болезни Альцгеймера, заключающийся во введении фрагмента Аβ16-23, имеющего аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1, или фрагмента, имеющего аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1 и связанного с молекулой носителя для формирования конъюгата.

2. Способ по п.1, в котором Аβ фрагмент индуцирует антитела, связывающие растворимый Аβ у пациента.

3. Способ лечения или профилактики болезни Альцгеймера, заключающийся во введении полинуклеотида, кодирующего: фрагмент Аβ16-23, имеющий аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1, или фрагмента, имеющего аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1 и связанного с молекулой носителя для формирования конъюгата.

4. Способ по п.3, в котором полинуклеотид экспрессируется у пациента с продуцированием Аβ фрагмента, продуцирующего антитела, связывающие растворимый Аβ у пациента.

5. Способ по пп.1-4, в котором дополнительно вводят фрагмент Аβ, вызывающий образование антител, специфично связывающих Аβ через один или более эпитоп Аβ1-11.

6. Способ по п.5, в котором фрагмент Аβ, который индуцирует образование антител, специфично связывающих Аβ через один или более эпитопов Аβ1-11, вводят перед введением фрагмента Аβ16-23.

7. Способ по пп.1-4, в котором дополнительно вводят антитело, которое специфично связывает Аβ через эпитоп Аβ1-11.

8. Способ по п.7, в котором антитело, которое специфично связывает Аβ через эпитоп Aβ1-11, вводят перед введением фрагмента Аβ16-23.

9. Способ по любому из пп.1-8, где заболевание проявляется когнитивными нарушениями.

10. Способ по любому из пп.1-8, применяющийся по отношению к пациенту, который является человеком.

11. Способ по любому из пп.1-8, дополнительно включающий мониторинг индуцированных антител у пациента.

12. Способ по любому из пп.1-8, применяющийся по отношению к пациенту, не имеющему симптомов болезни Альцгеймера.

13. Способ по любому из пп.1-8, применяющийся по отношению к пациенту, имеющему симптомы болезни Альцгеймера, при этом способ приводит к уменьшению этих симптомов.

14. Способ по любому из пп.1-8, применяющийся по отношению к пациенту младше 50.

15. Способ по любому из пп.1-8, применяющийся по отношению к пациенту, имеющему унаследованный фактор риска, свидетельствующий о предрасположенности к болезни Альцгеймера.

16. Способ по п.15, применяющийся по отношению к пациенту, у которого в течение пяти лет после начала лечения не наблюдалось прогрессирования симптоматики.

17. Способ по любому из пп.1-14 и 16, применяющийся по отношению к пациенту, не имеющему известных факторов риска болезни Альцгеймера.

18. Способ по любому из пп.1-8, который заключается во введении фрагмента Аβ в дозе, составляющей, по крайней мере 50 мкг, в течение многих дней.

19. Способ по любому из пп.1-8, в котором фрагмент вводят в множественных дозах в течение периода времени, составляющего по крайней мере три месяца.

20. Способ по п.19, в котором доза составляет по крайней мере 50 мкг.

21. Способ по п.1 или 3, в котором дополнительно вводят адъювант, повышающий уровень антител, продуцируемых фрагментом Аβ.

22. Способ по п.21, в котором адъювант является фармацевтически приемлемым.

23. Способ по п.1 или 3, в котором фрагмент вводят внутрибрюшинно, орально, интраназально, подкожно, внутримышечно, местно или внутривенно.

24. Способ по п.1 или 3, дополнительно включающий мониторинг уровня индуцированных антител в крови пациента.

25. Способ по пп.1-4, в котором фрагмент связан с молекулой носителя для формирования конъюгата.

26. Способ по п.25, в котором множество копий фрагмента связано с молекулой носителя для формирования конъюгата.

27. Способ по п.25, в котором множество копий фрагмента связано с множеством копий молекул носителя.

28. Способ по п.26, в котором носитель представляет собой гетерологичный полипептид, включающий аминокислотную последовательность QYIKANSKFIGITEL (SEQ ID NO:8).

29. Способ по п.26, в котором носитель представляет собой гетерологичный полипептид, включающий аминокислотную последовательность AKXVAAWTLKAAA (SEQ ID NO: 11).

30. Способ по п.28 или 29, в котором полипептид индуцирует Т-клеточный ответ, направленный против гетерологичного пептида и, следовательно, В-клеточный ответ, направленный против фрагмента.

31. Способ по пп.1-4, в котором дополнительно вводят адъювант, который увеличивает титр и/или аффинность связывания индуцированных антител по сравнению с введением только одного фрагмента.

32. Способ по п.31, в котором адъювант является фармацевтически приемлемым.

33. Способ по п.31, в котором фрагмент Аβ или полинуклеотид, кодирующий фрагмент Аβ, вводят в виде композиции с адъювантом.

34. Способ по п.31, в котором адъювант вводят перед введением фрагмента или полинуклеотида, кодирующего фрагмент.

35. Способ по п.31, в котором адъювант вводят после введения фрагмента или полинуклеотида, кодирующего фрагмент.

36. Способ по п.31, в котором адъювант представляет собой соль алюминия, или MPL, или QS-21, или неполный адъювант Фрейнда.

37. Способ по п.1, в котором доза фрагмента составляет более 10 мкг на инъекцию.

38. Фрагмент Аβ, имеющий аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1.

39. Фрагмент по п.38, связанный с молекулой носителя для формирования конъюгата.

40. Фрагмент по п.39, у которого множество копий связаны с одной молекулой носителя.

41. Фрагмент по п.39, у которого одна копия связана с одной молекулой носителя.

42. Фрагмент по п.39, связанный с молекулой носителя через спейсер.

43. Фрагмент по п.39, связанный с молекулой носителя химической связью.

44. Фрагмент по п.39, у которого носитель представляет собой гетерологичный полипептид.

45. Фрагмент по п.44, у которого гетерологичный полипептид содержит последовательность QYIKANSKFIGITEL (SEQ ID NO:8).

46. Фрагмент по п.44, у которого гетерологичный полипептид содержит последовательность AKXVAAWTLKAAA (SEQ ID NO:11).

47. Фрагмент по п.39, у которого носитель представляет собой дифтерийный токсин.

48. Фрагмент по п.38, дополнительно содержащий фармацевтически приемлемый носитель.

49. Фрагмент по п.38, который вводится совместно с N-концевым участком фрагмента Аβ.

50. Фрагмент по п.49, у которого N-концевой участок представляет собой Аβ1-5.

51. Фрагмент по п.49, у которого N-концевой участок представляет собой Аβ1-6.

52. Фрагмент по п.49, у которого N-концевой участок представляет собой Аβ1-7.

53. Фармацевтическая композиция, содержащая фрагмент Аβ, включающий аминокислотную последовательность KLVFFAED из 16-23 остатков SEQ ID NO:1, и фармацевтически приемлемый носитель.

54. Композиция по п.53, в которой фрагмент связан с молекулой носителя для формирования конъюгата.

55. Композиция по п.54, в которой множество копий фрагмента связано с одной молекулой носителя.

56. Композиция по п.54, в которой одна копия фрагмента связана с одной молекулой носителя.

57. Композиция по п.54, в которой фрагмент связан с молекулой носителя через спейсер.

58. Композиция по п.54, в которой фрагмент связан с молекулой носителя химической связью.

59. Композиция по п.54, в которой носитель представляет собой гетерологичный полипептид.

60. Композиция по п.59, в которой гетерологичный полипептид содержит последовательность QYIKANSKFIGITEL (SEQ ID NO:8).

61. Композиция по п.59, в которой гетерологичный полипептид содержит последовательность AKXVAAWTLKAAA (SEQ ID NO:11).

62. Композиция по п.54, в которой носитель представляет собой дифтерийный токсин.

63. Композиция по п.53, дополнительно содержащая N-концевой Аβ фрагмент.

64. Композиция по п.63, у которой N-концевой фрагмент представляет собой Аβ1-5.

65. Композиция по п.63, у которой N-концевой фрагмент представляет собой Аβ1-6.

66. Композиция по п.63, у которой N-концевой фрагмент представляет собой Аβ1-7.

67. Композиция по п.63, дополнительно содержащая адъювант.

68. Композиция по п.67, в которой адъювант представляет собой соль алюминия.

69. Композиция по п.67, в которой адъювант представляет собой MPL.

70. Композиция по п.67, в которой адъювант представляет собой QS-21.

71. Композиция по п.67, в которой адъювант представляет собой RC-529.

72. Композиция по п.53, дополнительно содержащая сурфактант.



 

Похожие патенты:

Изобретение относится к медицине, а именно к неврологии, и может быть использовано при лечении больных рассеянным склерозом. .

Изобретение относится к лекарственным средствам и касается лекарственного средства в виде продукта-предшественника инъекции для получения жидкой инъецируемой композиции, в качестве агента для профилактики и/или лечения нейродегенеративных заболеваний, нервных нарушений или заболеваний, для которых требуется регенерация нервов, включающего эффективное количество (2R)-2-пропилоктановой кислоты или ее соли и от 1 до 5 эквивалентов основного иона металла в расчете на 1 эквивалент (2R)-2-пропилоктановой кислоты или ее соли, которое включает соль металла, выбранную из соли металла фосфорной кислоты, соли металла угольной кислоты и соли металла сернистой кислоты, и необязательно дополнительно включает гидроксид металла в качестве источника(ов) основного иона металла.

Изобретение относится к новым производным нафталина формулы I , а также к их фармацевтически приемлемым солям, которые могут найти применение для лечения и/или профилактики заболеваний, связанных с модулированием Н-3 рецепторов.

Изобретение относится к медицине, а именно к неврологии, и касается лечения неврологических нарушений, обусловленных амилоидными отложениями. .
Изобретение относится к медицине, а именно к неонатологии, и может быть использовано при лечении новорожденных, находящихся на ИВЛ в критическом состоянии, обусловленном перинатальным поражением центральной нервной системы.

Изобретение относится к соединениям общей формулы (I) где А, В представляют собой С; D выбирают из N; Х выбирают из -CRaRb-, -O-; Y выбирают из О; Z1 и Z2 независимо выбирают из водорода, замещенного или незамещенного алкила, имеющего от 1 до 8 атомов, R1-R4 независимо выбирают из водорода или галогена; R5-R16 независимо представляют собой водород; где Ra и Rb независимо представляют собой водород; n равен 1-3; m равен 0 или 1; к равен 2; или к его фармацевтически приемлемым солям или сольватам.

Изобретение относится к новым производным пирролопиримидина и пирролопиридина общей формулы (I), замещенным циклической аминогруппой (II), или их фармацевтически приемлемым солям, обладающим свойствами антагониста CRF.

Изобретение относится к новым антагонистам серотониновых 5-НТ6 рецепторов - замещенным 2-амино-3-сульфонил-6,7,8,9-тетрагидро-пиразоло[1,5-а]пиридо[3,4-е]пиримидинам общей формулы 1 и замещенным 2-амино-3-сульфонил-5,6,7,8-тетрагидро-пиразоло[1,5-а]пиридо[4,3-d]пиримидинам общей формулы 2 или их фармацевтически приемлемым солям и/или гидратам, способу их получения и фармацевтическим композициям, лекарственным средствам и способу лечения.
Изобретение относится к медицине, а именно к онкологии, и может быть использовано при лечении пациентов с Неходжкинской лимфомой. .

Изобретение относится к фармацевтической промышленности, в частности к новым лекарственным средствам и препаратам, включающим эффективные противораковые средства вместе с анти-Hsp90 антителом, которые вместе обеспечивают повышенную эффективность при лечении рака и лейкоза.

Изобретение относится к иммунологии и биотехнологии. .

Изобретение относится к области иммунологии и биотехнологии. .

Изобретение относится к медицинским технологиям, иммунологии, фармакологии и, в частности, к лекарственным средствам для лечения пациентов с ревматоидным артритом (РА) и способам их лечения, которые могут использоваться в ревматологии.

Изобретение относится к медицине и касается применения антител, специфически узнающих любой из преобладающих вариантов бета-амилоидного пептида, А 40 и A 42, в приготовлении лекарственного средства, которое применяют для профилактики и/или лечения болезни Альцгеймера.

Изобретение относится к иммунологии и биотехнологии. .
Изобретение относится к области медицины и касается сывороточного иммунобиологического препарата для экстренной профилактики и лечения сибирской язвы. .

Активная иммунизация для создания антител к растворимому а-бета

Наверх