Способ получения полипептида из актинии heteractis crispa, обладающего анальгетическим действием



Способ получения полипептида из актинии heteractis crispa, обладающего анальгетическим действием
Способ получения полипептида из актинии heteractis crispa, обладающего анальгетическим действием

 


Владельцы патента RU 2415866:

ТИХООКЕАНСКИЙ ИНСТИТУТ БИООРГАНИЧЕСКОЙ ХИМИИ ДАЛЬНЕВОСТОЧНОГО ОТДЕЛЕНИЯ РОССИЙСКОЙ АКАДЕМИИ НАУК (ТИБОХ ДВО РАН) (RU)

Изобретение относится к области биотехнологии, конкретно к способам получения полипептидов, обладающих выраженным анальгетическим действием. Способ включает гомогенизацию актинии Heteractis crispa, этанольную экстракцию полипептидов, гидрофобную хроматографию на полихроме-1, последующую очистку целевого продукта ионообменной хроматографией и обращенно-фазовой ВЭЖХ. Гидрофобную хроматографию на полихроме-1 осуществляют в статическом варианте, а ионообменную хроматографию осуществляют на Cellulose СМ-32. Изобретение позволяет увеличить выход целевого продукта в 12 раз. 2 ил., 1 табл.

 

Изобретение относится к области медицины, конкретно к способам получения полипептидов, обладающих выраженным анальгетическим действием.

Известно, что ядовитые морские кишечнополостные актинии, являются богатейшим источником биологически активных соединений полипептидной природы, выполняющих алломональную и экологическую роль в морских биоценозах. К настоящему времени из них выделено более четырех десятков соединений, которые принадлежат к различным функциональным группам белков и полипептидов и взаимодействуют с высокой селективностью с различными мишенями, в том числе с болевыми рецеторами [Diochot S., Baron A., Rash L.D., Deval E., Escoubas P., Scarzello S., Salinas M., Lazdunski M. A new sea anemone peptide, APETx2, inhibits ASIC3, a major acid-sensitive channel in sensory neurons // The EMBO Journal 2004, V.23, P.1516-1525; Shiomi К. Novel peptide toxins recently isolated from sea anemones, Toxicon (2009), doi: 10.1016 / j. toxicon. 2009.02.031].

Заявителем совместно с Институтом биоорганической химии РАН им. академиков М.М.Шемякина и Ю.А.Овчинникова впервые был выделен из актинии Heteractis crispa полипептид АРНС1, имеющий структуру ингибитора протеиназ семейства BPTI/Кунитц-типа и обладающий значительной анальгетической активностью in vivo [Andreev Y.A., Kozlov S.A., Koshelev S.G., Ivanova E.A., Monastyrnaya М.М., Kozlovskaya E.P., Grishin E.V. Analgesic compound from sea anemone Heteractis crispa is the first polypeptide inhibitor of vanilloid receptor 1 (TRPV1) // J. Biol. Chem. 2008, V.283, P.23914-23921]. Авторами было показано, что анальгетический эффект полипептида АРНС1, а также полученной на его основе рекомбинантной формы полипептида связан с модулированием (частичным блокированием) болевого ваниллоидного рецептора TRPV1, одного из важнейших интеграторов болевых и воспалительных стимулов и одну из перспективных терапевтических мишеней в лечении болевых состояний.

Аминокислотная последовательность полипептида из актинии Heteractis crispa и получение его рекомбинантной формы были запатентованы, поскольку он является первым полипептидом направленного действия на болевой рецептор TRPV1, перспективным для использования в медицине [RU 2368621 С1, 27.09.2009].

Способ выделения ингибитора болевого рецептора TRPV1 включает следующие стадии: экстракцию полипептидов 70%-ным водным этанолом; гидрофобную хроматографию полипептидов на полихроме-1 в ступенчатом градиенте этанола от 10 до 70%; катионообменную хроматографию на Bio-Rex 70 в линейном градиенте концентрации NaCl от 0 до 0,5 М (в 5 мМ аммоний-ацетатном буферном растворе, рН 4,5); катионообменную хроматографию на SP-Sephadex C-25 в линейном градиенте рН от 4,5 до 7,3 (в 5 мМ аммоний-ацетатном буферном растворе) и градиенте концентрации NaCl от 0 до 0,2 М; а также обращенно-фазовую ВЭЖХ активной фракции полипептидов на колонке Jupiter C5 в линейном градиенте концентрации ацетонитрила от 5 до 60% в присутствии 0,1% ТФУ.

Длительность этого способа составляет 158 ч, выход целевого продукта - 0,025% от суммарного белка в экстракте.

К недостаткам способа-прототипа относятся его длительность, трудоемкость и низкий выход целевого продукта.

Задачей изобретения является усовершенствование известного способа получения полипептида актинии Heteractis crispa, обладающего анальгетическим действием.

Поставленная задача решена тем, что в известном способе получения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием, включающем гомогенизацию актинии, экстракцию активной фракции полипептидов 70% водным этанолом и последующую хроматографическую очистку целевого продукта, согласно изобретению очистку активной фракции осуществляют на полихроме-1 в статическом варианте элюцией балластных белков 15%-ным водным этанолом; фракции полипептидов, проявляющих анальгетический эффект на тепловой модели, элюируют 20%-ным этанолом. Затем полученную фракцию полипептидов очищают хроматографией на Cellulose СМ-32 в линейном градиенте концентрации NaCl от 0 до 0,5 М в 0,01 М аммоний-ацетатном буферном растворе (pH 6.0). Далее фракцию, проявляющую выраженный анальгетический эффект на тепловой модели, подвергают ВЭЖХ на обращенной фазе Nucleosil C18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе трифторуксусной кислоты (pH 2.2), элюируя конечный активный полипептид-анальгетик в линейном градиенте концентрации ацетонитрила (5-60%) в 0,1%-ном водном растворе трифторуксусной кислоты.

Технический результат, обеспечиваемый изобретением, заключается в увеличении выхода целевого продукта, в упрощении способа его выделения, что снижает трудозатраты на его очистку и тем самым снижает себестоимость целевого продукта.

Низкая эффективность выделения анальгетического полипептида по способу-прототипу обусловлена использованием гидрофобной хроматографии в колоночном варианте и ионообменной хроматографии на смолах Bio-Rex 70 и SP-Sephadex C25. Высокая обменная емкость этих смол (3,3 мэкв/мл у Bio-Rex 70 и 2,3±0,3 мэкв/мл у SP-Sephadex C25) обусловливает многоточечное связывание с ними элюируемых белков и, как следствие, их неудовлетворительное разрешение. Низкий выход целевого продукта связан, по-видимому, также со значительными гидрофобными взаимодействиями и образованием водородных связей аминокислотных остатков элюируемых белков с материалом матриц, что приводило к заметной сорбции белков актинии носителями Bio-Rex 70 и SP-Sephadex C25.

Использование в заявляемом способе Cellulose CM-32 в предлагаемых условиях выделения позволило устранить вышеперечисленные недостатки, как следует из сравнительных данных, приведенных в таблице. Преимущество предлагаемого приема выделения не является очевидным, т.к. невозможно заранее предсказать поведение белков при хроматографировании на этом носителе ввиду многокомпонентности экстракта актинии, содержащего помимо полипептида-анальгетика массу балластных белков.

Так, например, ранее сочетание смол Bio-Rex 70 и SP-Sephadex C25 было успешно использовано заявителем для выделения нескольких нейротоксинов из актинии Radianthus macrodactylus (в настоящее время этот вид актинии называется Heteractis crispa), причем после хроматографии на SP-Sephadex C25 белковые фракции, содержавшие нейротоксины, элюировались с очень хорошим разрешением и, практически, в индивидуальном состоянии [Зыкова Т.А., Винокуров Л.М., Козловская Э.П., Еляков Г.Б. Аминокислотная последовательность нейротоксина III из актинии Radianthus macrodactylus // Биоорган, химия 1985. Т.11, С.302-310]. В то же время применение Bio-Rex 70 и SP-Sephadex C25 для ионообменной хроматографии белковых фракций в способе-прототипе оказалось менее эффективным (фиг.1, стадии 2 и 3).

Применение гидрофобной хроматографии в статическом варианте (на воронке Шотта), предложенное в заявляемом способе, значительно уменьшило как время элюции белков (фиг.2, 1 стадия), так и их возможную денатурацию, связанную с гидрофобными взаимодействиями белковых глобул с материалом матрицы.

Предлагаемый способ осуществляют следующим образом.

Актинии Heteractis crispa гомогенизируют и экстрагируют активную фракцию полипептидов 70%-ным этанолом в течение 12 часов при 4°С, затем супернатант отделяют центрифугированием, после чего этанол упаривают. Полученный прозрачный раствор (20 мг/мл белка по Лоури) наносят на фильтровальную воронку Шотта с полихромом-1 (14×8 см), уравновешенным дистиллированной водой. Элюцию балластных белков и полипептидов осуществляют 15%-ным этанолом, фракцию полипептидов, проявляющих анальгетический эффект на тепловой модели, элюируют 20%-ным этанолом. Полученную фракцию полипептидов хроматографируют на колонке с ионообменной смолой Cellulose CM-32. Элюцию полипептидов, проявляющих анальгетический эффект на тепловой модели, осуществляют в линейной градиенте концентрации NaCl от 0 до 0,5 М в рабочем буферном растворе. Фракции, проявляющие анальгетический эффект на тепловой модели, объединяют и используют для дальнейшей очистки с помощью обращенно-фазовой ВЭЖХ.

Данные по выходу и времени хроматографии на каждой стадии выделения полипептидных фракций представлены в таблице.

Таблица
Схема выделения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием
Способ-прототип Предлагаемый способ
Стадия выделения // время выделения Кол-во белка, мг Выход, % Стадия выделения // время выделения Кол-во белка, мг Выход, %
Суммарный экстракт 20000 100 Суммарный экстракт 20000 100
Гидрофобная хроматография на полихроме-1 (колоночный вариант) 20%-ная фр. // 23 ч 10000 50 Гидрофобная хроматография на полихроме-1 (статический вариант): 20%-ная фр. / 2 ч 10000 50
Ионообменная хроматография на Bio-Rex 70: 1 фр. // 102 ч 2000 10 Ионообменная хроматография на Cellulise СМ-32 полипептидов 20%-ной фр.: 5 фр. // 28 ч
Ионообменная хроматография фракции 1 на SP-Sephadex G-25: 3 фр. // 32 ч 50 0,25 1400 7
Обращенно-фазовая ВЭЖХ 3 фр. на Jupiter C5: 1 фр. //1 ч 5 0,025 Обращенно-фазовая ВЭЖХ 5 фр. на Nucleosil C18: 1 фр. / 1 ч 60 0,3

Из представленной таблицы видно, что длительность заявляемого способа составляет 31 ч - это в 5 раз меньше длительности способа-прототипа (158 ч). Выход целевого продукта - 0,3% от суммарного белка в экстракте, что в 12 раз превышает его выход по способу прототипу (0,025%).

На фиг.1 представлены стадии выделения анальгетического полипептида из Heteractis crispa по способу-прототипу.

На фиг.2 представлены стадии выделения анальгетического полипептида из Heteractis crispa по заявляемому способу.

Стрелками показаны объединенные фракции полипептидов, проявляющих анальгетический эффект на модели тепловой стимуляции боли. Скорость элюции полипептидов на колонке с полихромом-1 - 1,2 л/ч, на воронке Шотта с полихромом-1 - 5 л/ч; на Bio-Rex 70 - 22 мл/ч мин; на SP-Sephadex С-25 - 70 мл/ч; на Cellulose СМ-32 - 24 мл/ч.

Изобретение иллюстрируется примером конкретного выполнения.

Пример. 5 кг актинии Heteractis crispa, свежевыловленной или хранящейся в замороженном состоянии, измельчают и экстрагируют активную фракцию полипептидов 70%-ным этанолом в течение 12 часов при 4°С при соотношении ткань: этанол 1:3, затем супернатант отделяют центрифугированием при 3000×g в течение 0,5 ч, после чего этанол упаривают. Полученный прозрачный раствор (1 л, 20 мг/мл белка по Лоури) наносят на воронку Шотта с полихромом-1 (14×8 см), уравновешенным дистиллированной водой. Элюцию балластных белков и полипептидов осуществляют 15%-ным этанолом (6 л). Затем фракцию активных полипептидов элюируют 20%-ным этанолом (1,5 л) со скоростью элюции 500 мл/5 мин. После упаривания и концентрирования на полихроме-1 полипептиды хроматографируют на колонке (2,5×50 см) с Cellulose CM-32 (Whatman, Англия), уравновешенной 0,01 М аммоний-ацетатным буферным раствором, рН 5,14. Элюцию полипептидов осуществляют в линейном градиенте концентрации NaCl от 0 до 0,5 М в рабочем буферном растворе по 1 л каждого. Фракции, проявляющие выраженный анальгетический эффект на тепловой модели, объединяют и используют для обращенно-фазовой ВЭЖХ на колонке Nucleosil С18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе ТФУ. Элюцию проводят линейным градиентом концентрации ацетонитрила (5-60%) в 0,1%-ном водном растворе ТФУ. Целевой продукт элюируется с колонки 40% ацетонитрилом с выходом 0,3% от суммарного белка в экстракте актинии.

Препарат полипептида, полученный предлагаемым способом, является индивидуальным соединением. Его гомогенность доказана методами SDS-электрофореза в 15%-ном ПААГ (полиакриламидном геле) и МАЛДИ-ТОФ-МС (матричной лазерной десорбционно-ионизационной времяпролетной масс-спектрометрией).

Для подтверждения идентичности полученного полипептида-анальгетика анальгетику-прототипу определена его аминокислотная последовательность методом деградации по Эдману на автоматическом секвенаторе Procise 492 (Applied Biosystems, США). Предварительно дисульфидные связи были восстановлены дитиотреитолом, после чего полипептид был актилирован 4-винилпиридином для защиты образовавшихся сульфгидрильных групп. Модифицированный полипептид (фракция, соответствующая восстановлению всех дисульфидных связей) был выделен из реакционной смеси с помощью обращенно-фазовой ВЭЖХ на колонке Nucleosil C18 и затем подвергнут трипсинолизу (гидролиз пептидных связей по остаткам лизина и аргинина).

В результате разделения продуктов гидролиза с помощью обращенно-фазовой ВЭЖХ было выделено 7 триптических пептидов, секвенирование которых позволило установить их последовательность (GSICLEPK, VVGPCTAYFR, VVGPCTAYFRR, FYFDSETGK, CTVFIYGGCEGNGNNFETLR, ACR, AICRA). Сравнение последовательностей полученных триптических пептидов с аминокислотной последовательностью анальгетика-прототипа показало полную идентичность полипептидов:

GSICLEPKVVGPCTAYFRRFYFDSETGKCTVFIYGGCEGNGNNFETLRACRAICRA

Молекула ингибитора состоит из 56 аминокислотных остатков, его точная молекулярная масса равна 6187 Да, что хорошо согласуется с данными масс-спектрометрического анализа.

Анальгетический эффект, проявляемый белковыми фракциями на стадиях гидрофобной и ионообменной хроматографии, а также конечного продукта, определяют на экспериментальных животных (мышах) в биологическом тесте теплового стимулирования боли по отдергиванию лапки (измеряют увеличение времени, прошедшего с момента погружения лапки в горячую воду (50°С) до момента ее отдергивания).

Способ получения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием, включающий гомогенизацию актинии, экстракцию активной фракции полипептидов 70%-ным водным этанолом и последующую хроматографическую очистку целевого продукта, отличающийся тем, что очистку активной фракции осуществляют на полихроме-1 в статическом варианте элюцией балластных белков 15%-ным водным этанолом, фракции полипептидов, проявляющих анальгетический эффект на модели тепловой стимуляции боли, элюируют 20%-ным этанолом, затем полученную фракцию полипептидов очищают хроматографией на Cellulose CM-32 в линейном градиенте концентрации NaCl от 0 до 0,5 М в 0,01 М аммоний-ацетатном буферном растворе рН 6,0, далее фракцию, проявляющую выраженный анальгетический эффект на модели тепловой стимуляции боли, подвергают ВЭЖХ на обращенной фазе Nucleosil С18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе трифторуксусной кислоты рН 2,2, элюируя конечный активный полипептид-анальгетик в линейном градиенте концентрации ацетонитрила 5-60% в 0,1%-ном водном растворе трифторуксусной кислоты.



 

Похожие патенты:

Изобретение относится к биотехнологии и генетической инженерии. .
Изобретение относится к косметическому средству, предназначенному для повышения эластичности кожи и содержащему активный ингредиент и носитель, где активный ингредиент содержит комплекс, который включает теломерную последовательность ДНК и связанный с ней пептид, имеющий сигнал ядерной локализации, и который способен проникать через плазматическую мембрану клетки.

Изобретение относится к биотехнологии и может быть использовано в различных областях промышленности. .

Изобретение относится к области биотехнологии и может быть использовано в медико-биологической промышленности при получении препаратов, используемых в качестве смазывающих веществ, антиадгезивных средств и/или внутрисуставных добавок.

Изобретение относится к области биотехнологии, конкретно к получению соединений, обладающих активностью ингибиторов ангиогенеза, и может быть использовано в медицине для терапии заболеваний, сопровождающихся несбалансированной васкуляризацией.

Изобретение относится к области биотехнологии, конкретно к биологически активным полипептидам, обладающим анальгетическим действием, и может быть использовано в медицине.

Изобретение относится к генной инженерии, конкретно к получению извлеченных из нематоды противосвертывающих белков (NAP), и может быть использовано в медицине. .

Изобретение относится к области биотехнологии, конкретно к получению рекомбинантных белков шелка паука, и может быть использовано в медицине

Изобретение относится к области биотехнологии и может быть использовано для получения рекомбинантных белков шелка пауков

Изобретение относится к области биотехнологии, в частности к способу очистки группы высокомолекулярных белковых антигенов фасциол

Изобретение относится к области биотехнологии, конкретно к биологически активному пептиду

Изобретение относится к биотехнологии, в частности к генной и белковой инженерии, и может быть использовано для получения делеционного варианта рекомбинантного тканевого фактора человека

Изобретение относится к созданию пептидов, происходящих из области 32-51 белка LALF, лишенных способности к связыванию LPS и гепарина, и усиливающих противоопухолевый и иммуномодулирующий эффект

Изобретение относится к области молекулярной биологии и генетики и может быть использовано в медицине

Изобретение относится к области биотехнологии, конкретно к получению ингибиторов адгезии и/или агрегации тромбоцитов, и может быть использовано в медицине

Изобретение относится к области биотехнологии, а именно к выделенной нуклеиновой кислоте, кодирующей белок с активностью флуоресцентного биосенсора для детекции пероксида водорода, экспрессионному вектору, который содержит данную нуклеиновую кислоту, клетке E.coli, продуцирующей белок, кодируемый данной нуклеиновой кислотой, и выделенному белку, с активностью флуоресцентного биосенсора для детекции пероксида водорода
Наверх