Способ получения полипептида из актинии heteractis crispa, обладающего анальгетическим действием

Изобретение относится к области биотехнологии, конкретно к способам получения полипептидов, обладающих выраженным анальгетическим действием. Способ включает гомогенизацию актинии Heteractis crispa, этанольную экстракцию полипептидов, гидрофобную хроматографию на полихроме-1, последующую очистку целевого продукта ионообменной хроматографией и обращенно-фазовой ВЭЖХ. Гидрофобную хроматографию на полихроме-1 осуществляют в статическом варианте, а ионообменную хроматографию осуществляют на Cellulose СМ-32. Изобретение позволяет увеличить выход целевого продукта в 12 раз. 2 ил., 1 табл.

 

Изобретение относится к области медицины, конкретно к способам получения полипептидов, обладающих выраженным анальгетическим действием.

Известно, что ядовитые морские кишечнополостные актинии, являются богатейшим источником биологически активных соединений полипептидной природы, выполняющих алломональную и экологическую роль в морских биоценозах. К настоящему времени из них выделено более четырех десятков соединений, которые принадлежат к различным функциональным группам белков и полипептидов и взаимодействуют с высокой селективностью с различными мишенями, в том числе с болевыми рецеторами [Diochot S., Baron A., Rash L.D., Deval E., Escoubas P., Scarzello S., Salinas M., Lazdunski M. A new sea anemone peptide, APETx2, inhibits ASIC3, a major acid-sensitive channel in sensory neurons // The EMBO Journal 2004, V.23, P.1516-1525; Shiomi К. Novel peptide toxins recently isolated from sea anemones, Toxicon (2009), doi: 10.1016 / j. toxicon. 2009.02.031].

Заявителем совместно с Институтом биоорганической химии РАН им. академиков М.М.Шемякина и Ю.А.Овчинникова впервые был выделен из актинии Heteractis crispa полипептид АРНС1, имеющий структуру ингибитора протеиназ семейства BPTI/Кунитц-типа и обладающий значительной анальгетической активностью in vivo [Andreev Y.A., Kozlov S.A., Koshelev S.G., Ivanova E.A., Monastyrnaya М.М., Kozlovskaya E.P., Grishin E.V. Analgesic compound from sea anemone Heteractis crispa is the first polypeptide inhibitor of vanilloid receptor 1 (TRPV1) // J. Biol. Chem. 2008, V.283, P.23914-23921]. Авторами было показано, что анальгетический эффект полипептида АРНС1, а также полученной на его основе рекомбинантной формы полипептида связан с модулированием (частичным блокированием) болевого ваниллоидного рецептора TRPV1, одного из важнейших интеграторов болевых и воспалительных стимулов и одну из перспективных терапевтических мишеней в лечении болевых состояний.

Аминокислотная последовательность полипептида из актинии Heteractis crispa и получение его рекомбинантной формы были запатентованы, поскольку он является первым полипептидом направленного действия на болевой рецептор TRPV1, перспективным для использования в медицине [RU 2368621 С1, 27.09.2009].

Способ выделения ингибитора болевого рецептора TRPV1 включает следующие стадии: экстракцию полипептидов 70%-ным водным этанолом; гидрофобную хроматографию полипептидов на полихроме-1 в ступенчатом градиенте этанола от 10 до 70%; катионообменную хроматографию на Bio-Rex 70 в линейном градиенте концентрации NaCl от 0 до 0,5 М (в 5 мМ аммоний-ацетатном буферном растворе, рН 4,5); катионообменную хроматографию на SP-Sephadex C-25 в линейном градиенте рН от 4,5 до 7,3 (в 5 мМ аммоний-ацетатном буферном растворе) и градиенте концентрации NaCl от 0 до 0,2 М; а также обращенно-фазовую ВЭЖХ активной фракции полипептидов на колонке Jupiter C5 в линейном градиенте концентрации ацетонитрила от 5 до 60% в присутствии 0,1% ТФУ.

Длительность этого способа составляет 158 ч, выход целевого продукта - 0,025% от суммарного белка в экстракте.

К недостаткам способа-прототипа относятся его длительность, трудоемкость и низкий выход целевого продукта.

Задачей изобретения является усовершенствование известного способа получения полипептида актинии Heteractis crispa, обладающего анальгетическим действием.

Поставленная задача решена тем, что в известном способе получения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием, включающем гомогенизацию актинии, экстракцию активной фракции полипептидов 70% водным этанолом и последующую хроматографическую очистку целевого продукта, согласно изобретению очистку активной фракции осуществляют на полихроме-1 в статическом варианте элюцией балластных белков 15%-ным водным этанолом; фракции полипептидов, проявляющих анальгетический эффект на тепловой модели, элюируют 20%-ным этанолом. Затем полученную фракцию полипептидов очищают хроматографией на Cellulose СМ-32 в линейном градиенте концентрации NaCl от 0 до 0,5 М в 0,01 М аммоний-ацетатном буферном растворе (pH 6.0). Далее фракцию, проявляющую выраженный анальгетический эффект на тепловой модели, подвергают ВЭЖХ на обращенной фазе Nucleosil C18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе трифторуксусной кислоты (pH 2.2), элюируя конечный активный полипептид-анальгетик в линейном градиенте концентрации ацетонитрила (5-60%) в 0,1%-ном водном растворе трифторуксусной кислоты.

Технический результат, обеспечиваемый изобретением, заключается в увеличении выхода целевого продукта, в упрощении способа его выделения, что снижает трудозатраты на его очистку и тем самым снижает себестоимость целевого продукта.

Низкая эффективность выделения анальгетического полипептида по способу-прототипу обусловлена использованием гидрофобной хроматографии в колоночном варианте и ионообменной хроматографии на смолах Bio-Rex 70 и SP-Sephadex C25. Высокая обменная емкость этих смол (3,3 мэкв/мл у Bio-Rex 70 и 2,3±0,3 мэкв/мл у SP-Sephadex C25) обусловливает многоточечное связывание с ними элюируемых белков и, как следствие, их неудовлетворительное разрешение. Низкий выход целевого продукта связан, по-видимому, также со значительными гидрофобными взаимодействиями и образованием водородных связей аминокислотных остатков элюируемых белков с материалом матриц, что приводило к заметной сорбции белков актинии носителями Bio-Rex 70 и SP-Sephadex C25.

Использование в заявляемом способе Cellulose CM-32 в предлагаемых условиях выделения позволило устранить вышеперечисленные недостатки, как следует из сравнительных данных, приведенных в таблице. Преимущество предлагаемого приема выделения не является очевидным, т.к. невозможно заранее предсказать поведение белков при хроматографировании на этом носителе ввиду многокомпонентности экстракта актинии, содержащего помимо полипептида-анальгетика массу балластных белков.

Так, например, ранее сочетание смол Bio-Rex 70 и SP-Sephadex C25 было успешно использовано заявителем для выделения нескольких нейротоксинов из актинии Radianthus macrodactylus (в настоящее время этот вид актинии называется Heteractis crispa), причем после хроматографии на SP-Sephadex C25 белковые фракции, содержавшие нейротоксины, элюировались с очень хорошим разрешением и, практически, в индивидуальном состоянии [Зыкова Т.А., Винокуров Л.М., Козловская Э.П., Еляков Г.Б. Аминокислотная последовательность нейротоксина III из актинии Radianthus macrodactylus // Биоорган, химия 1985. Т.11, С.302-310]. В то же время применение Bio-Rex 70 и SP-Sephadex C25 для ионообменной хроматографии белковых фракций в способе-прототипе оказалось менее эффективным (фиг.1, стадии 2 и 3).

Применение гидрофобной хроматографии в статическом варианте (на воронке Шотта), предложенное в заявляемом способе, значительно уменьшило как время элюции белков (фиг.2, 1 стадия), так и их возможную денатурацию, связанную с гидрофобными взаимодействиями белковых глобул с материалом матрицы.

Предлагаемый способ осуществляют следующим образом.

Актинии Heteractis crispa гомогенизируют и экстрагируют активную фракцию полипептидов 70%-ным этанолом в течение 12 часов при 4°С, затем супернатант отделяют центрифугированием, после чего этанол упаривают. Полученный прозрачный раствор (20 мг/мл белка по Лоури) наносят на фильтровальную воронку Шотта с полихромом-1 (14×8 см), уравновешенным дистиллированной водой. Элюцию балластных белков и полипептидов осуществляют 15%-ным этанолом, фракцию полипептидов, проявляющих анальгетический эффект на тепловой модели, элюируют 20%-ным этанолом. Полученную фракцию полипептидов хроматографируют на колонке с ионообменной смолой Cellulose CM-32. Элюцию полипептидов, проявляющих анальгетический эффект на тепловой модели, осуществляют в линейной градиенте концентрации NaCl от 0 до 0,5 М в рабочем буферном растворе. Фракции, проявляющие анальгетический эффект на тепловой модели, объединяют и используют для дальнейшей очистки с помощью обращенно-фазовой ВЭЖХ.

Данные по выходу и времени хроматографии на каждой стадии выделения полипептидных фракций представлены в таблице.

Таблица
Схема выделения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием
Способ-прототип Предлагаемый способ
Стадия выделения // время выделения Кол-во белка, мг Выход, % Стадия выделения // время выделения Кол-во белка, мг Выход, %
Суммарный экстракт 20000 100 Суммарный экстракт 20000 100
Гидрофобная хроматография на полихроме-1 (колоночный вариант) 20%-ная фр. // 23 ч 10000 50 Гидрофобная хроматография на полихроме-1 (статический вариант): 20%-ная фр. / 2 ч 10000 50
Ионообменная хроматография на Bio-Rex 70: 1 фр. // 102 ч 2000 10 Ионообменная хроматография на Cellulise СМ-32 полипептидов 20%-ной фр.: 5 фр. // 28 ч
Ионообменная хроматография фракции 1 на SP-Sephadex G-25: 3 фр. // 32 ч 50 0,25 1400 7
Обращенно-фазовая ВЭЖХ 3 фр. на Jupiter C5: 1 фр. //1 ч 5 0,025 Обращенно-фазовая ВЭЖХ 5 фр. на Nucleosil C18: 1 фр. / 1 ч 60 0,3

Из представленной таблицы видно, что длительность заявляемого способа составляет 31 ч - это в 5 раз меньше длительности способа-прототипа (158 ч). Выход целевого продукта - 0,3% от суммарного белка в экстракте, что в 12 раз превышает его выход по способу прототипу (0,025%).

На фиг.1 представлены стадии выделения анальгетического полипептида из Heteractis crispa по способу-прототипу.

На фиг.2 представлены стадии выделения анальгетического полипептида из Heteractis crispa по заявляемому способу.

Стрелками показаны объединенные фракции полипептидов, проявляющих анальгетический эффект на модели тепловой стимуляции боли. Скорость элюции полипептидов на колонке с полихромом-1 - 1,2 л/ч, на воронке Шотта с полихромом-1 - 5 л/ч; на Bio-Rex 70 - 22 мл/ч мин; на SP-Sephadex С-25 - 70 мл/ч; на Cellulose СМ-32 - 24 мл/ч.

Изобретение иллюстрируется примером конкретного выполнения.

Пример. 5 кг актинии Heteractis crispa, свежевыловленной или хранящейся в замороженном состоянии, измельчают и экстрагируют активную фракцию полипептидов 70%-ным этанолом в течение 12 часов при 4°С при соотношении ткань: этанол 1:3, затем супернатант отделяют центрифугированием при 3000×g в течение 0,5 ч, после чего этанол упаривают. Полученный прозрачный раствор (1 л, 20 мг/мл белка по Лоури) наносят на воронку Шотта с полихромом-1 (14×8 см), уравновешенным дистиллированной водой. Элюцию балластных белков и полипептидов осуществляют 15%-ным этанолом (6 л). Затем фракцию активных полипептидов элюируют 20%-ным этанолом (1,5 л) со скоростью элюции 500 мл/5 мин. После упаривания и концентрирования на полихроме-1 полипептиды хроматографируют на колонке (2,5×50 см) с Cellulose CM-32 (Whatman, Англия), уравновешенной 0,01 М аммоний-ацетатным буферным раствором, рН 5,14. Элюцию полипептидов осуществляют в линейном градиенте концентрации NaCl от 0 до 0,5 М в рабочем буферном растворе по 1 л каждого. Фракции, проявляющие выраженный анальгетический эффект на тепловой модели, объединяют и используют для обращенно-фазовой ВЭЖХ на колонке Nucleosil С18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе ТФУ. Элюцию проводят линейным градиентом концентрации ацетонитрила (5-60%) в 0,1%-ном водном растворе ТФУ. Целевой продукт элюируется с колонки 40% ацетонитрилом с выходом 0,3% от суммарного белка в экстракте актинии.

Препарат полипептида, полученный предлагаемым способом, является индивидуальным соединением. Его гомогенность доказана методами SDS-электрофореза в 15%-ном ПААГ (полиакриламидном геле) и МАЛДИ-ТОФ-МС (матричной лазерной десорбционно-ионизационной времяпролетной масс-спектрометрией).

Для подтверждения идентичности полученного полипептида-анальгетика анальгетику-прототипу определена его аминокислотная последовательность методом деградации по Эдману на автоматическом секвенаторе Procise 492 (Applied Biosystems, США). Предварительно дисульфидные связи были восстановлены дитиотреитолом, после чего полипептид был актилирован 4-винилпиридином для защиты образовавшихся сульфгидрильных групп. Модифицированный полипептид (фракция, соответствующая восстановлению всех дисульфидных связей) был выделен из реакционной смеси с помощью обращенно-фазовой ВЭЖХ на колонке Nucleosil C18 и затем подвергнут трипсинолизу (гидролиз пептидных связей по остаткам лизина и аргинина).

В результате разделения продуктов гидролиза с помощью обращенно-фазовой ВЭЖХ было выделено 7 триптических пептидов, секвенирование которых позволило установить их последовательность (GSICLEPK, VVGPCTAYFR, VVGPCTAYFRR, FYFDSETGK, CTVFIYGGCEGNGNNFETLR, ACR, AICRA). Сравнение последовательностей полученных триптических пептидов с аминокислотной последовательностью анальгетика-прототипа показало полную идентичность полипептидов:

GSICLEPKVVGPCTAYFRRFYFDSETGKCTVFIYGGCEGNGNNFETLRACRAICRA

Молекула ингибитора состоит из 56 аминокислотных остатков, его точная молекулярная масса равна 6187 Да, что хорошо согласуется с данными масс-спектрометрического анализа.

Анальгетический эффект, проявляемый белковыми фракциями на стадиях гидрофобной и ионообменной хроматографии, а также конечного продукта, определяют на экспериментальных животных (мышах) в биологическом тесте теплового стимулирования боли по отдергиванию лапки (измеряют увеличение времени, прошедшего с момента погружения лапки в горячую воду (50°С) до момента ее отдергивания).

Способ получения полипептида из актинии Heteractis crispa, обладающего анальгетическим действием, включающий гомогенизацию актинии, экстракцию активной фракции полипептидов 70%-ным водным этанолом и последующую хроматографическую очистку целевого продукта, отличающийся тем, что очистку активной фракции осуществляют на полихроме-1 в статическом варианте элюцией балластных белков 15%-ным водным этанолом, фракции полипептидов, проявляющих анальгетический эффект на модели тепловой стимуляции боли, элюируют 20%-ным этанолом, затем полученную фракцию полипептидов очищают хроматографией на Cellulose CM-32 в линейном градиенте концентрации NaCl от 0 до 0,5 М в 0,01 М аммоний-ацетатном буферном растворе рН 6,0, далее фракцию, проявляющую выраженный анальгетический эффект на модели тепловой стимуляции боли, подвергают ВЭЖХ на обращенной фазе Nucleosil С18, уравновешенной 5%-ным ацетонитрилом в 0,1%-ном водном растворе трифторуксусной кислоты рН 2,2, элюируя конечный активный полипептид-анальгетик в линейном градиенте концентрации ацетонитрила 5-60% в 0,1%-ном водном растворе трифторуксусной кислоты.



 

Похожие патенты:

Изобретение относится к биотехнологии и генетической инженерии. .
Изобретение относится к косметическому средству, предназначенному для повышения эластичности кожи и содержащему активный ингредиент и носитель, где активный ингредиент содержит комплекс, который включает теломерную последовательность ДНК и связанный с ней пептид, имеющий сигнал ядерной локализации, и который способен проникать через плазматическую мембрану клетки.

Изобретение относится к биотехнологии и может быть использовано в различных областях промышленности. .

Изобретение относится к области биотехнологии и может быть использовано в медико-биологической промышленности при получении препаратов, используемых в качестве смазывающих веществ, антиадгезивных средств и/или внутрисуставных добавок.

Изобретение относится к области биотехнологии, конкретно к получению соединений, обладающих активностью ингибиторов ангиогенеза, и может быть использовано в медицине для терапии заболеваний, сопровождающихся несбалансированной васкуляризацией.

Изобретение относится к области биотехнологии, конкретно к биологически активным полипептидам, обладающим анальгетическим действием, и может быть использовано в медицине.

Изобретение относится к генной инженерии, конкретно к получению извлеченных из нематоды противосвертывающих белков (NAP), и может быть использовано в медицине. .

Изобретение относится к области биотехнологии, конкретно к получению рекомбинантных белков шелка паука, и может быть использовано в медицине

Изобретение относится к области биотехнологии и может быть использовано для получения рекомбинантных белков шелка пауков

Изобретение относится к области биотехнологии, в частности к способу очистки группы высокомолекулярных белковых антигенов фасциол

Изобретение относится к области биотехнологии, конкретно к биологически активному пептиду

Изобретение относится к биотехнологии, в частности к генной и белковой инженерии, и может быть использовано для получения делеционного варианта рекомбинантного тканевого фактора человека

Изобретение относится к созданию пептидов, происходящих из области 32-51 белка LALF, лишенных способности к связыванию LPS и гепарина, и усиливающих противоопухолевый и иммуномодулирующий эффект

Изобретение относится к области молекулярной биологии и генетики и может быть использовано в медицине

Изобретение относится к области биотехнологии, конкретно к получению ингибиторов адгезии и/или агрегации тромбоцитов, и может быть использовано в медицине

Изобретение относится к области биотехнологии, а именно к выделенной нуклеиновой кислоте, кодирующей белок с активностью флуоресцентного биосенсора для детекции пероксида водорода, экспрессионному вектору, который содержит данную нуклеиновую кислоту, клетке E.coli, продуцирующей белок, кодируемый данной нуклеиновой кислотой, и выделенному белку, с активностью флуоресцентного биосенсора для детекции пероксида водорода

Изобретение относится к области биотехнологии, конкретно к способам получения полипептидов, обладающих выраженным анальгетическим действием

Наверх