Тетрапептид, композиция (варианты) и способ стимуляции продукции коллагена фибробластом

Изобретение относится к области биотехнологии, конкретно к получению коротких пептидов - стимуляторов продукции белков внеклеточного матрикса в коже, и может быть использовано в медицине. Получены пептиды, состоящие из четырех аминокислотных остатков, которые используются по отдельности или в комбинации в способе стимуляции продукции коллагена фибробластом. Изобретение позволяет эффективно стимулировать коллагенез в фибробластных клетках. 4 н. и 21 з.п. ф-лы, 3 ил., 7 табл.

 

По настоящей заявке испрашивается приоритет предварительной заявки США с порядковым номером 60/813284, поданной 13 июня 2006 года, которая включена в настоящее описание в качестве ссылки в полном объеме.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к тетрапептидам с аминокислотным мотивом GxxG или PxxP, где G (глицин) и Р (пролин) сохраняются, а х обозначает вариабельную аминокислоту. Настоящее изобретение относится также к активным тетрапептидам со сдвигом рамки, которые являются тетрапептидными последовательностями, сдвинутыми на одну рамку считывания от тетрапептида GxxG или PxxP в белке ЕСМ. В частности, настоящее изобретение относится к GxxG, PxxP или активным пептидам сдвига рамки, которые стимулируют продукцию белков внеклеточного матрикса и усиливают закрытие раны монослоя эпителиальных клеток имеющей экскориации (ссадины, царапины) кожи человека. Эти пептидные композиции могут быть использованы в составах для заживления поврежденной кожи или поддержания здоровой кожи.

УРОВЕНЬ ТЕХНИКИ

Старение кожи рассматривается как образование морщин и ослабленное заживление ран. Рана определяется как разрыв в целостности эпителия кожи. Нормальное заживление ран включает сложную и динамичную, но прекрасно организованную серию событий, приводящих к заживлению поврежденных тканей. Преобладающим компонентом нормальной кожи является внеклеточный матрикс (ЕСМ), гелеподобный матрикс, продуцируемый клетками, которые он окружает. Этот ЕСМ состоит из двух основных классов, включающих фиброзные структурные белки и протеогликаны. Известно, что изменения в составе и состоянии сшивания ЕСМ ассоциированы со старением и диапазоном приобретенных и наследуемых нарушений кожи. Хорошо описано, что ЕСМ не только обеспечивает структурную поддержку, но также влияет на клеточное поведение, такое как дифференцировка и пролиферация. Кроме того, все большее и большее количество исследований предполагают, что компоненты матрикса могут быть источником клеточных сигналов для облегчения пролиферации и миграции эпителиальных клеток и усиления таким образом заживления ран.

Самым большим классом фиброзных молекул ЕСМ является семейство коллагенов, которое включает по меньшей мере 16 различных типов коллагена. Коллаген в дермальном матриксе состоит прежде всего из коллагенов типа I (80-85%) и типа III (8-11%), оба из которых являются фибриллярными или палочкообразными коллагенами. Предел прочности кожи при растяжении обусловлен преимущественно этими фибриллярными молекулами коллагена, которые самособираются в микрофибриллы с размещением голова к хвосту и латерально ступенчатым образом. Молекулы коллагена становятся сшитыми с соседними молекулами коллагена, создавая дополнительную прочность и стабильность в волокнах коллагена. Повреждение в коллагеновой сети (например, ферментами или физическим разрушением) или ее общий коллапс вызывает заживление посредством репарации.

Различные биологически активные пептиды, которые стимулируют продукцию белков ЕСМ, описаны как в научной литературе, так и в выданных патентах. Пептиды исторически были выделены из природных источников и недавно были предметом исследований взаимосвязи структуры и функции. Природные пептиды служили также в качестве исходных точек для коструирования синтетических пептидных аналогов.

Специфические последовательности в белках ЕСМ могут стимулировать полезные элементы в коже, такие как коллаген типа I, коллаген типа III и фибронектин (Katayama et. al., J. Biol. Chem. 288:9941-9944 (1983)). Katayama et al. идентифицировали пентапептид, KTTKS (SEQ ID NO:17), в карбоксиконцевом пропептиде (остатки 197-241) коллагена типа I. Этот пропептид отщепляется во время продукции зрелого белка коллагена. Этот отщепленный пропептид может участвовать в регуляции продукции коллагена посредством биосинтетического механизма обратной связи, причем сегмент KTTKS играет активную роль. Maquart et al. (J Soc Biol. 193:423-28 (1999)) сообщали, что пептиды GHK и CNYYSNS также стимулируют синтез ECM. Эти последовательности могут высвобождаться во время метаболизма ЕСМ, передавая посредством этого сигнал о необходимости репарации ЕСМ. Короткие пептидные последовательности, высвобождаемые любым механизмом, часто называют “матрикинами” (Maquart et al., J. Soc. Biol. 193:423-28 (1999)).

Хотя существует ряд природных и синтетических пептидов, существует потребность в улучшенных биологически активных пептидах и способах их применения.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Описаны тетрапептиды, которые характеризуются мотивом аминокислотной последовательности GxxG или PxxP, где остатки G (глицин) и P (пролин) сохраняются, а x является вариабельной аминокислотой. Эти тетрапептиды происходят из последовательностей, которые встречаются многократно по всей первичной последовательности белка ЕСМ, коллагена типа IV. Описанные последовательности индуцируют продукцию всех форм коллагена в большей степени, чем ранее известные пептидные последовательности, в том числе KTTKS, продаваемый под товарным названием MATRIXYL™ SEDERMA SAS (Франция). Кроме того, композиция, содержащая комбинацию различных многократно повторяющихся последовательностей, вызывает даже более высокую продуцирующую коллаген реакцию. Дополнительные преимущества могут ожидаться от комбинаций пептидов, присутствующих в различных белках ЕСМ.

Получение специфической комбинации тетрапептидов для восстановления ЕСМ может быть коммерчески чрезмерно затратным. Описаны относительно простые и экономичные средства получения отличающейся комбинации биологически активных тетрапептидов. Посредством получения комбинаторной библиотеки тетрапептидов с мотивом GxxG или PxxP может быть генерировано множество биологически активных тетрапептидов в одном и том же цикле получения (например, GEPG, GPEG, GPPG и GEEG). Комбинация тетрапептидов может индуцировать большее образование белков ЕСМ, чем отдельные пептиды. Композиции, содержащие описанные тетрапептиды, отдельно или в комбинации, применимы на рынках средств для ухода за кожей, в том числе, но не только, средств, которые предназначены для воздействия на появление морщин, тонус кожи, плотность кожи или обвисание кожи. Стимуляция коллагена описанными тетрапептидами может значительно улучшать здоровье и вид поврежденной и постаревшей кожи.

КРАТКОЕ ОПИСАНИЕ ФИГУР

Фиг.1 представляет собой SEQ ID NO:45, которая является аминокислотной последовательностью коллагена IV, иллюстрирующей местонахождения тетрапептидов GxxG. Все последовательности, напечатанные жирным шрифтом, подчеркнуты, а перекрывающиеся последовательности подчеркнуты дважды.

Фиг.2 представляет собой SEQ ID NO:46, которая является аминокислотной последовательностью коллагена III, иллюстрирующей местонахождения активных сегментов со сдвигом рамки PGPR и GAGP. Все активные последовательности со сдвигом рамки напечатаны жирным шрифтом и подчеркнуты, а последовательности GxxG, имеющие один сдвиг рамки, подчеркнуты дважды.

Фиг.3 также представляет собой SEQ ID NO:45, аминокислотную последовательность коллагена IV, иллюстрирующую местонахождения тетрапептида PGPP.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Это изобретение относится в общем к тетрапептидам, которые стимулируют продукцию белков ЕСМ и модулируют заживление ран, и применениям таких тетрапептидов.

Пептиды

Один вариант осуществления изобретения относится к выделенному тетрапептиду, содержащему мотив GxxG или PxxP. В этом варианте осуществления G (глицин) или P (пролин) сохраняются, а х обозначает вариабельную аминокислоту. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15 или SEQ ID NO:16.

Другой вариант осуществления изобретения относится к выделенному тетрапептиду, содержащему мотив GxPG, где x обозначает P в любом вариабельном положении или в обоих. В этом варианте осуществления G (глицин) и P (пpолин) сохраняются, а х обозначает вариабельную аминокислоту. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:5 или SEQ ID NO:7.

Другой вариант осуществления изобретения относится к выделенному тетрапептиду, содержащему мотив GЕxG. В этом варианте осуществления G (глицин) и Е (глутаминовая кислота) сохраняются, а х обозначает вариабельную аминокислоту. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:5 или SEQ ID NO:8.

Другой вариант осуществления изобретения относится к выделенному тетрапептиду, содержащему мотив PGxP. В этом варианте осуществления P (пролин) и G (глицин) сохраняются, а х обозначает вариабельную аминокислоту. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:14 или SEQ ID NO:16.

Другой вариант осуществления изобретения относится к выделенному тетрапептиду, содержащему мотив PExP. В этом варианте осуществления Р (пролин) и Е (глутаминовая кислота) сохраняются, а х обозначает вариабельную аминокислоту. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:1 или SEQ ID NO:9.

Другой вариант осуществления изобретения относится к активному тетрапептиду со сдвигом рамки. В этом варианте осуществления этот тетрапептид находится в одном сдвиге рамки либо от тетрапептида GxxG, либо от тетрапептида PххР в белке ECM. Этим пептидом может быть обычно любой пептид, попадающий в объем вышеуказанного описания, и, более предпочтительно, он представляет собой SEQ ID NO:4 или SEQ ID NO:6.

Каждый из вышеописанных пептидов может содержать D- или L-аминокислоты. Эти пептиды могут содержать все D-аминокислоты или L-аминокислоты. Эти пептиды могут иметь кислотный C-конец (-CO2H) или, предпочтительно, амидный C-конец (-CОNH2, -CONHR или -CОNR2). Эти пептиды могут быть дополнительно увеличены или модифицированы либо химически, либо ферментативно. Например, эти пептиды могут быть амидированы (-NH2) на С-конце, что может делать этот тетрапептид менее чувствительным к протеазной деградации и увеличивать их растворимость в сравнении с формами свободных кислот. Эти пептиды могут быть также липидированы, что может обеспечивать улучшенное проникновение в кожу.

Вышеописанные пептиды могут содержать следующие аминокислоты: R (аргинин), L (лейцин), P (пролин), F (фенилаланин), Q (глутамин), E (глутаминовую кислоту), I (изолейцин), K (лизин), S (серин), V (валин), A (аланин), N (аспарагин), D (аспарагиновую кислоту), T (треонин), Y (тирозин) и G (глицин). Вышеописанные пептиды не включают в себя следующие аминокислоты: M (метионин), C (цистеин), H (гистидин) или W (триптофан). Таким образом, в одном варианте осуществления x не выбран из М (метионина), C (цистеина), H (гистидина) или W (триптофана).

Способы применения

Дополнительный вариант осуществления настоящего изобретения относится к способам применения вышеописанных пептидов. Эти способы применения могут включать применение одного пептида или могут включать применение двух или более пептидов в комбинации.

Одним вариантом осуществления настоящего изобретения является способ активации заживления поврежденной кожи и поддержания здоровой кожи с использованием тетрапептидов, которые стимулируют продукцию белков ЕСМ. Этот способ обычно относится к контактированию дермальных (кожных) клеток с композицией, содержащей этот пептид. Эти композиции могут быть аэрозолем, эмульсией, жидкостью, лосьоном, кремом, пастой, мазью, пенкой или другим фармацевтически приемлемым составом. Обычно фармацевтически приемлемый состав может включать любой приемлемый носитель, подходящий для применения на коже человека, например косметически приемлемый носитель и дерматологически приемлемый носитель. Композиции могут содержать другие активные средства, такие как ретиноиды или другие пептиды. Эти композиции могут содержать фармацевтически приемлемые носители или адъюванты. Стадия контактирования может выполняться in vivo, in situ, in vitro или любым способом, известным квалифицированным в данной области специалистам. Наиболее предпочтительно, стадия контактирования должна выполняться местно в концентрации, достаточной для индукции стимулирующей реакции. Концентрация этого пептида в данной композиции может быть равна приблизительно 0,01 мкг/мл - приблизительно 100 мкг/мл, приблизительно 0,1 мкг/мл - приблизительно 50 мкг/мл и приблизительно 0,1 мкг/мл - приблизительно 1 мкг/мл. Стадия контактирования может выполняться на млекопитающем, кошке, собаке, корове, лошади, свинье или человеке. Предпочтительная композиция для стимуляции продукции белка ECM содержит SEQ ID NO:8; более предпочтительно, эта композиция содержит SEQ ID NO:8 в гетерогенной смеси по меньшей мере с одним другим тетрапептидом. В наиболее предпочтительном варианте осуществления отдельные тетрапептиды в этой композиции могли бы вызывать устойчивую продукцию коллагена на протяжении периода по меньшей мере 48 часов.

Дополнительный вариант осуществления настоящего изобретения относится к способу активации заживления кожи, поврежденной естественным старением, заболеванием, повреждением, травмой или хирургическим вмешательством или другими медицинскими процедурами. Этот способ может предусматривать введение в рану животного композиции, где эта композиция содержит любой из вышеуказанных пептидов, отдельно или в комбинации. Эти композиции могут быть жидкостью, лосьоном, кремом, пастой, мазью, пенкой или любым другим фармацевтически приемлемым составом. Эти композиции могут содержать фармацевтически приемлемые носители или адъюванты. Эти композиции могут содержать другие биологически активные агенты, такие как антимикробные агенты или факторы роста. Эти композиции могут быть также использованы в комбинации с другими терапевтическими агентами, такими как трансплантаты ткани, продукты культуры ткани, кислород или перевязочные материалы. Концентрация пептида в этой композиции может быть равна приблизительно 0,01 мкг/мл - приблизительно 100 мкг/мл, приблизительно 0,1 мкг/мл - приблизительно 50 мкг/мл и приблизительно 0,1 мкг/мл - приблизительно 1 мкг/мл. Композиция может вводиться в рану местно. Животное обычно может быть животным любого типа и предпочтительно является млекопитающим и более предпочтительно человеком, коровой, лошадью, кошкой, собакой, свиньей, козой или овцой. Предпочтительная композиция для применений в заживлении ран, в которых стимулируется продукция белка ЕСМ, содержит SEQ ID NO:8; более предпочтительно эта композиция содержит SEQ ID NO:8 в гетерогенной смеси по меньшей мере с одним другим тетрапептидом. В наиболее предпочтительном варианте осуществления отдельные тетрапептиды в этой композиции могли бы вызывать длительную продукцию коллагена на протяжении периода по меньшей мере 48 часов.

Дополнительный вариант осуществления настоящего изобретения относится к способу уменьшения рубцевания кожи, поврежденной нормальным старением, заболеванием, повреждением, травмой или хирургическим вмешательством или другими медицинскими процедурами. Этот способ может предусматривать введение в рану животного композиции, причем эта композиция содержит любой из вышеописанных пептидов, по отдельности или в комбинации. Эти композиции могут быть жидкостью, лосьоном, кремом, пастой, мазью, пенкой или любым другим фармацевтически приемлемым составом. Эти композиции могут содержать фармацевтически приемлемые носители или адъюванты. Эти композиции могут содержать другие биологически активные агенты, такие как антимикробные агенты или факторы роста. Эти композиции могут быть также использованы в комбинации с другими терапевтическими агентами, такими как трансплантаты ткани, продукты культуры ткани, кислород или перевязочные материалы. Концентрация пептида в этой композиции может быть равна приблизительно 0,01 мкг/мл - приблизительно 100 мкг/мл, приблизительно 0,1 мкг/мл - приблизительно 50 мкг/мл и приблизительно 0,1 мкг/мл - приблизительно 1 мкг/мл. Композиция может вводиться в рану местно. Животное обычно может быть животным любого типа и предпочтительно является млекопитающим и более предпочтительно человеком, коровой, лошадью, кошкой, собакой, свиньей, козой или овцой. Предпочтительная композиция для применений в заживлении ран, в которых стимулируется продукция белка ЕСМ, содержит SEQ ID NO:8; более предпочтительно эта композиция содержит SEQ ID NO:8 в гетерогенной смеси по меньшей мере с одним другим тетрапептидом. В наиболее предпочтительном варианте осуществления отдельные тетрапептиды в этой композиции могли бы вызывать длительную продукцию коллагена на протяжении периода по меньшей мере 48 часов.

Следующий вариант осуществления настоящего изобретения относится к способу получения описанных тетрапептидов в комбинации. Эти пептиды могут быть получены с использованием любого способа, известного квалифицированным в данной области специалистам, такого как способы, описанные в Merrifield, R.B., Solid Phase Peptide Synthesis I., J. AM. CHEM. SOC. 85:2149-2154 (1963); Carpino, L.A. et al., [(9-Fluorenylmethyl)Qxy] Carbonyl (Fmoc) Amino Acid Chlorides: Synthesis, Characterization and Application to the Rapid Synthesis of Short Peptides, J. Org. Chem. 37:51:3732-3734; Merrifield, R.B. et al. Instrument for Automated Synthesis of Peptides, Anal. Chem. 38:1905-1914 (1966) или Kent, S.B.H. et al. High Yield Chemical Synthesis of Biologically Active Peptides on an Automated Peptide Synthesizer of Novel Design, In: PEPTIDES 1984 (Ragnarsson U., ed.) Almqvist and Wiksell Int., Stockholm (Sweden), pp. 185-188, все из которых включены в настоящее описание в качестве ссылки в полном объеме. Предпочтительно, эти пептиды будут получаться в устройстве, способном к последовательному присоединению аминокислот к растущей пептидной цепи. Однако эти пептиды могут быть получены с использованием стандартной твердофазной методологии.

Наблюдали, что добавление смеси свободных аминокислот вместо гомогенных пептидных смесей во время синтеза пептидных цепей приводит к отличающемуся включению свободных аминокислот, такому как комбинация пептидов, получающаяся в реакциях синтеза. Относительная частота включения конкретной аминокислоты, включенной в смесь из двух или более аминокислот, добавляемую во время синтеза, может корректироваться. Эта коррекция становится возможной посредством модификации отношения свободной аминокислоты, сделанной доступной во время процесса синтеза, относительно других аминокислот в этой смеси (называемой изокинетической смесью).

Следующие примеры включены для иллюстрации предпочтительных вариантов осуществления настоящего изобретения. Специалистам с квалификацией в данной области должно быть понятно, что способы, описанные в этих примерах, представляют способы, обнаруженные авторами изобретения как способы, которые хорошо функционируют в применении на практике настоящего изобретения, и следовательно, могут рассматриваться в качестве предпочтительных способов для применения на практике. Однако квалифицированным в данной области специалистам должно быть, в свете данного описания, понятно, что могут быть произведены многочисленные изменения в конкретных вариантах осуществления, которые описаны, и все еще может быть получен подобный или сходный результат без отклонения от идеи и объема настоящего изобретения.

ПРИМЕРЫ

Пример 1

Идентификация повторяющихся тетрапептидных последовательностей в коллагене

Относительно высокая доля повторяющихся последовательностей тетрапептида коллагена IV имеет мотив GxxG (где x обозначает любую аминокислоту). Некоторое количество из них показаны in situ как часть полной последовательности коллагена IV, показанной на фиг.1 в виде SEQ ID NO:45. Коллаген IV исследовали сначала в отношении его роли во взаимодействии с другими специализированными компонентами ECM (см. Gregory Schultz et al., 2005). Имеются одиннадцать последовательностей с мотивом GxxG в коллагене IV, которые появляются более десяти раз (GxxG, где xx представлен: vp, ek, fp, lp, pp, sp, ep, ip, pk, qp и tp). Среди этих тетрапептидных последовательностей восемь из одиннадцати последовательностей содержат пролин в положении 3, две из одиннадцати последовательностей содержат Р в положении 2, одна из одиннадцати последовательностей содержит пролин в положениях 2 и 3 и одна из одиннадцати последовательностей не содержит пролина. Описанные последовательности называют репликинами (REPLIKIN™). "РЕПЛИКИН" определяется как короткая последовательность в белках ЕСМ, которая встречается много раз (т.е. является реплицированной). Эта последовательность может присутствовать в одном белке ЕСМ (например, коллагене IV). Предпочтительно, эта последовательность присутствует во многих белках ЕСМ (например, во всех коллагенах, эластине, ламинине и т.д.). Присутствие этой последовательности во множественных белках ЕСМ увеличивает вероятность того, что этот фрагмент способен стимулировать синтез или репарацию ЕСМ.

Эти одиннадцать последовательностей GxxG, обнаруживаемых в коллагене IV, перечисленных выше, выделены в последовательности коллагена IV человека, показанной на фиг.1. На этой фигуре все напечатанные жирным шрифтом последовательности являются подчеркнутыми, а перекрывающиеся последовательности подчеркнуты дважды. Все, кроме одной из этих последовательностей, обнаруживаются также в коллагенах I, II, III и V. Этот факт способствует способности описанных пептидов стимулировать продукцию всех типов коллагенов, в частности, когда эти пептиды используются в комбинации. Таблица 1 показывает встречаемость нескольких тетрапептидных повторов в белках ЕСМ. Выделенные жирным шрифтом последовательности в таблице 1 являются последовательностями, которые встречаются в коллагене IV десять или более раз.

Таблица 1
Встречаемость тетрапептидов в белках ЕСМ
SEQ. ID NO Последовательность Коллаген I Коллаген II Коллаген III Коллаген IV Коллаген V Эластин Предшественник эластина
19 GAAG 10 5 7 2 4 5
20 GAKG 3 4 3 5 5
21 GAPG 13 21 25 6 9
22 GDKG 2 2 4 9 3
23 GDRG 2 5 2 4 1
8 GEKG 3 5 4 22 15
5 GEPG 11 15 10 11 4
24 GERG 10 11 14 6 7
2 GFPG 4 8 6 22 5 1 1
25 GIPG 2 2 6 14 6 5 5
26 GKDG 1 4 5 2 2
27 GКPG 2 3 3 4 1
28 GLKG 2 1 1 5 4
29 GLPG 15 10 9 42 15 1 1
30 GNPG 3 5 3 2 1
31 GPAG 16 20 20 3 6
32 GPKG 3 11 4 12 9
7 GPPG 33 40 40 46 43
33 GPQG 7 11 9 7 5
34 GPRG 11 13 10 4 7
35 GPSG 10 11 5 1 5
36 GPTG 4 3 2 2 6
37 GPVG 9 3 3 2 5
38 GQPG 3 4 6 12 7
39 GRDG 4 2 3 3
40 GRPG 3 3 4 2 5
3 GSPG 4 6 21 16 3
41 GTPG 3 4 2 11 2
42 GVKG 1 3 2 3 1
43 GVPG 1 3 10 1 14 15
44 GYPG 1 1 1 4 2

Как также очевидно из рассмотрения последовательности коллагена IV, SEQ ID NO:45, имеются также много случаев встречаемости последовательностей, имеющих мотив PxxP. Например, последовательность PGPP встречается не менее пятнадцати раз, как показано на фиг.3. Таким образом, эту описанную последовательность также называют репликином (REPLIKINE™). Предпочтительно, эта последовательность присутствует во множественных белках ЕСМ (например, во всех коллагенах, эластине, ламинине и т.д.), так как присутствие этой последовательности во множественных белках ЕСМ увеличивает вероятность того, что этот фрагмент может быть способен стимулировать синтез или репарацию ЕСМ. Эти пятнадцать последовательностей PGPP, встречающихся в коллагене IV, перечисленных выше, выделены жирным шрифтом и подчеркнуты в последовательности коллагена, иллюстрированной на фиг.3.

Пример 2

Идентификация активных сегментов со сдвигом рамки

Кроме относительно высокой доли тетрапептидных повторяющихся последовательностей коллагена IV с мотивом GxxG, были идентифицированы другие тетрапептидные последовательности, имеющие сдвиг рамки на одну аминокислоту от тетрапептидной последовательности либо GxxG, либо PxxP. Эти последовательности могут повторяться или встречаются только один раз в белке ЕСМ и могут быть расположены со сдвигом на одно положение аминокислоты от тетрапептидной последовательности либо GxxG, либо PxxP, как описано здесь. Эти тетрапептидные последовательности называют активными последовательностями сдвига рамки. Такие активные последовательности сдвига рамки могут, соответственно, содержать либо G, либо Р либо во втором, либо в третьем положении в зависимости от направления сдвига рамки. Кроме того, было обнаружено, что эти активные последовательности сдвига рамки могут быть объединены с другими тетрапептидными последовательностями, описанными в этой заявке, с образованием комбикина. Примером такого комбикина является Н06 и Н15.

Одним примером активной последовательности сдвига рамки является GAGP или H12 (SEQ ID NO:6). H12 (GAGP) предстает как сдвиг на один остаток (или одну рамку) от GxxG-тетрапептида GGAG в коллагене III (SEQ ID NO:46), как показано на фиг.2. На этой фигуре все активные последовательности сдвига рамки изображены жирным шрифтом и подчеркнуты, а GxxG-последовательности, имеющие один сдвиг рамки, подчеркнуты дважды. Кроме того, как показано в таблице 5, этот тетрапептид (GAGP) достигает хороших результатов в отношении продукции коллагена через 48 часов. Другим примером является последовательность PGPR, которая является Н10 (SEQ ID NO:4), которая встречается одиннадцать раз в коллагенах I-IV. Поскольку она предстает множественное число раз в отдельном белке ЕСМ, этот тетрапептид может быть дополнительно рассматриваться как репликин (REPLIKINE). На фиг.2 (SEQ ID NO:46) показано несколько случаев этого тетрапептида, в каждом из которых встречается один сдвиг рамки от GxxG-тетрапептида GPRG. Эта конкретная активная последовательность сдвига рамки имеется во множественных белках ЕСМ и, следовательно, увеличивает вероятность того, что этот фрагмент может быть способен стимулировать синтез или репарацию ЕСМ.

Пример 3

Идентификация повторяющихся последовательностей, которые стимулируют продукцию коллагена

Несколько последовательностей, идентифицированных в примерах 1 и 2, синтезировали с использованием стандартного способа синтеза пептидов и анализировали на стимуляцию коллагена из дермальных фибробластов. Эти синтезированные пептиды амидировали на С-конце, что делало эти тетрапептиды менее чувствительными к протеазной деградации и увеличивало их растворимость в сравнении с формами свободной кислоты. Дермальные фибробласты человека инкубировали в 96-луночных планшетах при 37°С и 5% CO2 в течение 24 и 48 часов в 150 мкл полной среды для культуры клеток (Cascade Biologies, Portland, OR; Cat. No. M-106-500), дополненной добавкой для роста с низким содержанием сыворотки (Cascade Biologies, Portland, OR; Cat. No. S-003-10), содержащих пептиды проб в конечной концентрации 50 мкг/мл. В каждую лунку засевали 10000 клеток. После инкубации из каждой лунки извлекали пробы 100 мкл среды и их анализировали на продукцию коллагена.

Эти анализы выполнялись Tebu-bio Laboratories (Франция) с использованием набора для анализа коллагена SIRCOL™ (Biocolor Assays, UK) в соответствии с протоколом изготовителя. Анализ коллагена SIRCOL™ является количественным способом со связыванием красителя, предназначенным для анализа растворимых коллагенов, выделяемых в культуральную среду клетками млекопитающих во время культивирования in vitro. Коллаген тестируемых проб связывается с анионным красителем SIRCOL™. Комплексы коллаген-краситель осаждаются из раствора и осадки собирают центрифугированием. Извлеченный осадок коллаген-краситель растворяли в щелочном растворе перед измерениями оптической плотности. Измерения в двух повторностях выполняли через 24 и 48 часов для двух отдельных проб. Среднее рассчитывали из этих четырех измерений для каждой пробы. Оптическую плотность слепых проб (реагентов), стандартов коллагена и проб измеряли при 560 нм. Оптическую плотность слепой пробы (реагентов) вычитали из оптической плотности для каждой пробы через 24 и 48 часа.

Два отдельных набора данных использовали для получения двух калибровочных кривых стандартов. Первую калибровочную кривую получали для целей расчета количества коллагена в пробах Н6 (комбинации SEQ ID NO:1-4), H7-H14 (SEQ ID NO:1-8 соответственно) и H15 (комбинации SEQ ID NO:5-8). Вторую калибровочную кривую получали расчетом количества коллагена в пробах H16 (SEQ ID NO:9), H21-23 (SEQ ID NO:10-12 соответственно), H25-26 (SEQ ID NO:13-14 соответственно) или H29-30 (SEQ ID NO:15-16 соответственно), H32 (SEQ ID NO:17), H33 (комбинации SEQ ID NO:9-12), H34 (комбинации SEQ ID NO:11-14), H35 (комбинации SEQ ID NO:13-16), H36 (комбинации SEQ ID NO:l, 6, 5, 8), H37 (SEQ ID NO:17) и H38 (SEQ ID NO:8) из измерений оптической плотности и построением кривой зависимости Abs560 нм от соответствующих концентраций стандартов коллагена (в микрограммах) каждый раз, когда выполняли серию анализов. В отношении каждой серии данных одну и ту же калибровочную кривую использовали для проб, взятых через 24 и 48 часа (таблицы 2А и 2В). Таким образом, разные кривые стандартов получали непосредственно перед выполнением каждой серии анализов.

Таблица 2A
Калибровочная кривая для анализа продукции коллагена пептидами H6-H15
Стандарты коллагена (мкг) 24 ч А560 нм тест 48 ч А560 нм тест
0 0,00 0,00
5 0,08 0,10
10 0,11 0,15
25 0,32 0,35
50 0,66 0,65
Таблица 2B
Калибровочная кривая для анализа продукции коллагена пептидами H16, H21-23, H25-26 и H29-38
Стандарты коллагена (мкг) А560 нм тест день 1 А560 нм тест день 2
0 0,00 0,00
5 0,12 0,09
10 0,14 0,15
25 0,48 0,42
50 0,88 0,80

Линейную регрессию выполняли построением величин Abs560нм в зависимости от концентраций соответствующих стандартов коллагенов с использованием MICROSOFT EXCEL™. Регрессия приводила к линиям, описываемым формулой y=0,013x для обоих периодов инкубации, указанных в таблице 2А. Поскольку эти результаты были идентичными, для второй серии калибровочных кривых использовали только 24-часовой период времени. Формула линии, полученной в день анализа 1 и день анализа 2 второй серии проб, была y=0,0178x и y=0,0162x соответственно. Пептид LL-37 (SEQ ID NO:18) использовали в качестве положительного контроля, так как широко сообщалось, что он оказывает действие при заживлении ран у человека (Heilborn et al. The Cathelicidin Anti-Microbial Peptide LL-37 is Involved in The Re-Epithelialization of Human Skin Wounds and is Lacking in Chronic Ulcer Epithelium, J. Invest. Dermato. 120:379-89 (2003)). Предел детектирования этого анализа, определенный изготовителем, равен 2,5 мкг.

Общее количество коллагена, продуцированного в пробах, содержащих пептиды, рассчитывали из средних величин оптической плотности, полученных через 24 часа (таблица 3А) и 48 часов (таблица 3В), с использованием линейного уравнения, произведенного из этой стандартной кривой. Общее количество коллагена, продуцированного в пробах, содержащих пептиды H16 (SEQ ID NO:9), H21-23 (SEQ ID NO:10-12 соответственно), H25-26 (SEQ ID NO:13-14 соответственно) или H29-30 (SEQ ID NO:15-16 соответственно), H32 (SEQ ID NO:17), H33 (комбинации SEQ ID NO:9-12), H34 (комбинации SEQ ID NO:11-14), H35 (комбинации SEQ ID NO:13-16), H36 (комбинации SEQ ID NO:1, 6, 5, 8), H37 (SEQ ID NO:17) и H38 (SEQ ID NO:8), рассчитывали из величин оптической плотности, измеренных через 24 часа (таблица 4А) и 48 часов (таблица 4В), с использованием линейного уравнения, полученного из этой стандартной кривой. Эти величины сравнивали с величинами пептида LL37 (SEQ ID NO:18), пептида, о котором известно, что он стимулирует коллаген. В каждой таблице пробы, отмеченные звездочкой (*), могут не быть значимыми, так как предел детектирования этого анализа равен 2,5 мкг.

Таблица 3A
Измерения оптической плотности и количественное измерение коллагена в тест-пробах H6-H15 через 24 часа
SEQ ID NО Пептиды А560нм Среднее Среднее минус слепой опыт Коллаген (мкг)
18 LL37 0,102 0,136 0,12 0,04 3,0
- H6 0,084 0,140 0,11 0,03 2,5
1 H7 0,098 0,063 0,08 0,00 0,0*
2 H8 0,122 0,078 0,10 0,02 1,5*
3 H9 0,147 0,104 0,13 0,05 3,5
4 H10 0,103 0,146 0,12 0,04 3,4
5 H11 6,110 0,168 0,14 0,06 4,5
6 H12 0,063 0,101 0,08 0,00 0,2*
7 H13 0,114 0,093 0,10 0,02 1,8*
8 H14 0,115 0,122 0,12 0,04 3,0
- H15 0,132 0,093 0,11 0,03 2,5
- Слепой опыт 0,074 0,076 0,08 0,00 0,0
Таблица 3В
Измерения оптической плотности и количественное измерение коллагена в тест-пробах H6-H15 через 48 часа
SEQID NO Пептиды А560нм Среднее Среднее минус слепой опыт Коллаген (мкг)
18 LL37 0,262 0,113 0,19 0,07 5,2
- H6 0,086 0,189 0,14 0,02 1,3*
1 H7 0,192 0,189 0,19 0,07 5,4
2 H8 0,137 0,126 0,13 0,01 0,9*
3 H9 0,117 0,061 0,09 0,00 0,0*
4 H10 0,136 0,085 0,11 0,00 0,0*
5 H11 0,113 0,181 0,15 0,03 2,1*
6 H12 0,106 0,231 0,17 0,05 3,7
7 H13 0,100 0,145 0,12 0,00 0,2*
8 H14 0,132 0,176 0,15 0,03 2,6
- H15 0,177 0,174 0,18 0,06 4,3
- Слепой опыт 0,120 0,115 0,12 0,00 0,0
Таблица 4A
Измерения оптической плотности и количественное измерение коллагена в тест-пробах Н16, Н21-23, Н25-26 или Н29-38 через 24 часа
SEQ ID NO Пептиды А560нм Среднее Среднее минус слепой опыт Коллаген (мкг)
9 H16 0,133 0,137 0,14 0,06 3,1
10 H21 0,129 0,119 0,12 0,04 2,5
11 H22 0,192 0,085 0,14 0,06 3,3
12 H23 0,090 0,073 0,08 0,00 0,1*
13 H25 0,129 0,076 0,00 0,02 1,3*
14 H26 0,114 0,149 0,13 0,05 2,9
15 H29 0,111 0,063 0,09 0,01 0,4*
16 H30 0,099 0,092 0,10 0,02 0,9*
17 H32 (кристаллы и клеточная токсичность) 0,087 0,055 0,07 -0,01 -0,5*
- H33 0,086 0,125 0,11 0,03 1,4*
- H34 0,117 0,120 0,12 0,04 2,2*
- H35 0,103 0,090 0,10 0,02 0,9*
- H36 0,105 0,128 0,12 0,04 2,1*
17 H37 0,099 0,100 0,10 0,02 1,1*
8 H38 0,103 0,159 0,13 0,05 2,9
- Слепой опыт 0,072 0,086 0,08 0,00 0,0
Таблица 4В
Измерения оптической плотности и количественное измерение коллагена в тест-пробах Н16, Н21-23, Н25-26 или Н29-38 через 48 часа
SEQ ID NO Пептиды А560нм Среднее Среднее минус слепой опыт Слепой опыт
9 H16 0,065 0,064 0,06 0,00 0,3*
10 H21 0,089 0,126 0,11 0,05 2,9
11 H22 0,102 0,087 0,09 0,03 2,1*
12 H23 0,093 0,082 0,09 0,03 1,7*
13 H25 0,059 0,084 0,07 0,01 0,7*
14 H26 0,081 0,153 0,12 0,06 3,5
15 H29 0,086 0,094 0,09 0,03 1,9*
16 H30 0,083 0,101 0,09 0,03 2,0*
17 H32 (кристаллы и клеточная токсичность) 0,088 0,072 0,08 0,02 1,2*
- H33 0,096 0,092 0,09 0,03 2,1*
- H34 0,076 0,155 0,12 0,06 3,4
- H35 0,120 0,074 0,10 0,04 2,3*
- H36 0,154 0,082 0,12 0,06 3,6
17 H37 0,078 0,114 0,10 0,04 2,2*
8 H38 0,123 0,089 0,11 0,05 2,8
- Слепой опыт 0,106 0,0106 0,06 0,00 0,0

Поскольку размеры проб были равны 100 мкл, концентрацию коллагена, продуцируемого в каждой пробе, в микрограммах на миллилитр определяли умножением детектированного количества коллагена на десять. Результаты всех тестированных проб суммированы в таблице 5.

Таблица 5
Синтез коллагена, индуцированный пептидами
Продуцированный коллаген (мкг/мл)
SEQ ID NO Название Первичная последовательность [Пептид] (мкг/мл) 24 ч 48 ч
1 H07 PEGP 50 0 54
2 H08 GFPG 50 15 9
3 H09 GSPG 50 35 0
4 H10 PGPR 50 34 0
- H06 H7, H8, H9, H10 (SEQ ID NO:1, 2, 3, 4) 50 25 13
5 H11 GEPG 50 45 21
6 H12 GAGP 50 2 37
7 H13 GPPG 50 18 2
8 H14 GEKG 50 30 26
8 H38 GEKG 0,3 29 28
- H15 H11, H12, H13, H14 (SEQ ID NO:5, 6, 7, 8) 50 25 43
9 H16 PEKP 50 31 3
10 H21 PKGP 50 25 29
11 H22 PGQP 50 33 21
12 H23 PGTP 50 1 17
13 H25 PMGP 50 13 7
14 H26 PGPP 50 29 35
15 H29 PQGP 50 4 19
16 H30 PGNP 50 9 20
17 H32 KTTKS (пептид SEDERMA™) 50 na 12
17 H37 KTTKS (пептид SEDERMA™) 0,3 11 22
- H33 H16, H21, H22, H23 (SEQ ID NO:9, 10, 11, 12) 50 14 21
- H34 H22, H23, H25, H26 (SEQ ID NO: 11, 12, 13, 14) 50 22 34
- H35 H25, H26, H29, H30 (SEQ ID NO: 13, 14, 15, 16) 50 9 23
- H36 H7, H12, H11, H14 (SEQ ID NO: 1, 6, 5, 8) 50 21 36
18 LL37 LLGDFFRKSKEKIGKEFKRIVQRIDFLRNLVPRTES 50 30 52

Все тестированные тетрапептиды стимулировали продукцию растворимого коллагена. Из тестированных последовательностей тетрапептиды GxxG с глутаминовой кислотой в положении 2 наилучшим образом стимулируют коллаген как при 24-часовых, так и при 48-часовых временных точках. Этими последовательностями являются H11 (GEPG; SEQ ID NO:5), H14 (GEKG; SEQ ID NO:8) и H38 (GEKG; SEQ ID NO:8). Эти пептиды сначала подвергали скринингу с использованием концентрации пептидов 50 мкг/мл. Для нахождения концентрации, эффективной для стимуляции продукции коллагена, H14 (SEQ ID NO:8) тестировали также при 0,3 мкг/мл, как и Н38. Как показано в таблице 5, H38-индуцированная стимуляция коллагена не уменьшалась при более низкой концентрации, что указывает на то, что максимальная стимулирующая концентрация SEQ ID NO:8 равна или ниже 0,3 мкг/мл.

Для тестирования эффективности SEQ ID NO:8 (H14 и H38) сравнивали с пептидом LL37 (SEQ ID NO:18), о котором известно, что он стимулирует продукцию коллагена. На основе количества коллагена, высвобождаемого фибробластами в ответ на LL37, 25 мкг/мл считали значимым количеством коллагена, высвобождаемого вследствие контакта с тетрапептидом. SEQ ID NO:8 индуцировала приблизительно то же самое количество коллагена, что и LL37 (SEQ ID NO:18), через 24 часа. Важно, что коллаген, продуцированный в результате контакта с SEQ ID NO:8, по существу сохранялся в течение по меньшей мере 48 часов. SEQ ID NO:8 сравнивали также с основным пептидом для ухода за кожей, о котором известно, что он стимулирует продукцию коллагена, KTTKS (SEQ ID NO:17) (Katayama et al., J. Biol. Chem. 288:9941-9944 (1983)). KTTKS является ингредиентом в продукте MATRIXYL™ (SEDERMA SAS, Франция). SEQ ID NO:8 больше стимулировала продукцию коллагена, чем этот пептид KTTKS (SEQ ID NO:17) (таблица 5) через 24 и 48 часов.

Пример 4

Идентификация комбинаций пептидов, которые синергически усиливают стимуляцию коллагена - КОМБИКИНЫ

Гетерогенные популяции активных тетрапептидов могут стимулировать продукцию коллагена на более высоком уровне, чем гомогенные пробы тетрапептидов. Компоненты этой гетерогенной композиции называют комбикинами (COMBIKINE™). Комбикины являются группой репликинов, объединенных для получения более высокого или более широкого действия на одном или нескольких типах клеток-мишеней. Пептиды H11 (SEQ ID NO:5), H12 (SEQ ID NO:6), H13 (SEQ ID NO:7) и H14 (SEQ ID NO:8) объединяли до конечной концентрации 50 мкг/мл и анализировали с использованием того же самого протокола, который использовали для отдельных пептидов. Как и ожидалось, полученный результат во временной точке 24 часа был равен среднему отдельных оценок индукции. Однако эта комбинация пептидов при 48 часах индуцировала коллаген до уровня 43 мкг/мл. Неожиданно это количество было выше признанного среднего (21 мкг/мл) этих четырех отдельных пептидов (см. таблицу 5). Таким образом, конкретные комбинации пептидов могут стимулировать продукцию коллагена до большей степени, чем эти отдельные пептиды при той же самой концентрации. Кроме того, тетрапептиды из различных источников ЕСМ, такие как коллаген, ламинин и эластин, могут продуцировать увеличенную индукцию различных белков ЕСМ (см. таблицы 1 и 5).

Пример 5

Экономичное получение КОМБИКИНА для увеличенной стимуляции продукции коллагена

Высокая стоимость пептидного синтеза ограничивает возможность получения гетерогенных композиций биологически активных пептидов. Данное изобретение в значительной степени уменьшает это ограничение. Поскольку описанные теперь последовательности имеют общий признак (например, глицин или пролин на обоих концах), некоторый диапазон тетрапептидов, варьируемых в положениях 2 и 3, может быть синтезирован в едином цикле получения. Эти синтетические пептиды могут быть получены любым способом, известным в данной области (Benoiton, N., Chemistry of Peptide Synthesis, CRC (2005)). Во время получения этих пептидов вместо гомогенных проб добавляют смеси аминокислот. Химический способ определения правильных соотношений концентраций аминокислот, добавляемых в смешанных положениях, был описан ранее (Greenbaum et al. Molecular and Cellular Proteomics 1:60-68, 2002; Krstenansky et al. Letters in Drug Design and Discovery 1:6-13, 2004; обе эти ссылки включены здесь в их полном виде). С использованием этой методологии может быть получена библиотека гетерогенных пептидов с почти теми же затратами, которые нужны для синтеза одного пептида.

Применение этого процесса производства делает возможным экономичное получение биологически активных комбикинов. Это становится возможным вследствие уникального состава описанных тетрапептидов. Смеси тетрапептидов являются более подходящими для включения в препараты для местного применения, чем более длинные пептиды. Вследствие их длины тетрапептиды имеют практические и химические преимущества над более длинными пептидами, включающие следующее: более легкое включение и растворение в препаратах, более высокую проницаемость кожи и пор и более высокие выходы получения более легкими способами приготовления комбинаций пептидов. Хотя это и не требуется, идеальные препараты тетрапептидов, по отдельности или в комбинации, являются препаратами, которые поддерживают значительную продукцию коллагена в течение 24 часов и до 48 часов. Более предпочтительно, эти препараты могут индуцировать синтез ЕСМ в течение всего периода 48 часов, так что больше коллагена продуцируется через 48 часов, чем через 24 часа. Хотя в объеме данного изобретения тетрапептиды, которые стимулируют продукцию белков ЕСМ в течение 24 часов, но обнаруживают уменьшенную продукцию на протяжении 48 часов, являются менее предпочтительными. В этой связи таблица 6 показывает результаты описанных в настоящее время пептидов. Предпочтительные пептиды представлены жирным шрифтом.

Таблица 6
Описанные пептиды
SEQ ID NO Пептиды Высвобожденный коллаген (мкг/мл) 24 ч Высвобожденный коллаген (мкг/мл) 48 ч Значительное высвобождение коллагена через 24 ч и 48 ч Увеличение высвобождения коллагена через 48 ч в сравнении с 24 ч Уменьшение высвобождения коллагена через 48 ч в сравнении с 24 ч
18 LL37 30 52
- H6 25 13
1 H7 0 54
2 H8 15 9
3 H9 35 0
4 H10 34 0
5 H11 45 21
6 H12 2 37
7 H13 18 2
8 H14 30 26
8 H38 29 28
- H15 25 43
9 H16 31 3
10 H21 25 29
11 H22 33 21
12 H23 1 17
13 H25 13 7
14 H26 29 35
15 H29 4 19
16 H30 9 20
17 H32 (кристаллы и клеточная токсичность) NA 12
17 H37 11 22
- H33 14 21
- H34 22 34
- H35 9 23
- H36 21 36

Пример 6

Стимуляторы коллагена также служат в качестве мультиэффекторных молекул, усиливающих закрытие ран эпителиальных клеток

Коллагены являются ключевыми компонентами всех фаз заживления ран. Стимуляция продукции коллагена отражает то, что повреждение происходит в коллагеновой сети (например, под действием ферментов или вследствие физического разрушения). Действительно, общий коллапс коллагеновой сети фактически вызывает появление заживления. Таким образом, коллагеновый стимулятор может также служить в качестве мультиэффекторной молекулы, организующей определенное ремоделирование матрикса и усиление заживления ран.

Эксперименты по заживлению ран выполняли на монослоях эпителиальных клеток кожи человека (CRL-2592), посеянных на 12-луночные чашки. Клетки голодали в отношении сыворотки в течение 24 часов перед экспериментированием. На конфлюэнтные монослои CRL-2592 наносили поранения кончиком пипетки P200 (200-мкл). Эти раны промывали и документировали в виде рисунка перед обработкой пептидами. Пептиды добавляли до конечной концентрации 20-40 мкг/мл. Клетки выдерживали в термостате при 37°С, 5% CO2 и влажности 92% за исключением короткого времени получения изображений при комнатной температуре. Закрытие ран наблюдали при 6-часовой и 10-часовой временных точках. ЗФР-обработанные раны использовали в качестве отрицательного контроля для целей сравнения.

Таблица 7
Действие пептидов на закрытие ран эпителия кожи человека in vitro
0 ч 6 ч 10 ч
Соединение Размер W* Размер W % закрытия Размер W % закрытия
ЗФР-1 36 29 19,40% 21 41,70%
ЗФР-2 52 42 19,20% 30 42,30%
SEQ ID NO:14 25 12 52% 2,75 89%
SEQ ID NO:5 48 39 19% 30 37,50%
*Размер W: размер раны (относительный)

Закрытие раны монослоя in vitro является результатом клеточной миграции, которая является важной во многих биологических процессах, таких как эмбриогенез, ангиогенез, воспалительные реакции и репарация (заживление) ран. Считается, что эти процессы регулируются взаимодействием с другими клетками, цитокинами и белками ЕСМ. Как показано в таблице 7, SEQ ID NO:14 значимо индуцирует закрытие ран в сравнении с действиями одного ЗФР. Такая активность является пептид-специфической, а также специфической в отношении типа клеток, так как SEQ ID NO:14 не индуцирует закрытие ран в монослое фибробластов кожи человека (данные не показаны). SEQ ID NO:5 также является индуктором коллагена, но не усиливает закрытие ран или миграцию эпителиальных клеток до какой-либо большой степени в сравнении с действиями одного ЗФР. Тот факт, что SEQ ID NO:14 индуцировала миграцию клеток или закрытие ран специфическим в отношении эпителиальных клеток кожи образом (т.е. без рекрутинга фибробластов), может быть дополнительным преимуществом использования этого пептида для ухода за кожей, так как считается, что рекрутинг большого количества активных фибробластов к месту повреждения приводит к избыточному отложению и сморщиванию ткани, приводя к рубцеванию.

Все из описанных и заявленных здесь композиций или способов могут быть приготовлены или выполнены без излишнего экспериментирования в свете данного описания. Хотя композиции и способы настоящего изобретения были описаны в виде предпочтительных вариантов осуществления, специалисту с квалификацией в данной области будет очевидно, что могут быть использованы вариации в отношении этих композиций и/или способов и в стадиях или последовательности стадий описанных здесь способов без отклонения от концепции, идеи и объема настоящего изобретения. Более конкретно, будет очевидно, что некоторые агенты, которые являются как химически, так и физиологически сходными, могут заменять описанные здесь агенты с получением тех же самых или аналогичных результатов. Предполагается, что все такие подобные заместители и модификации, очевидные для квалифицированных в данной области специалистов, находятся в пределах идеи, объема и концепции настоящего изобретения.

1. Тетрапептид, характеризующийся формулой SEQ ID NO: 1, 3, 4, 5, 8, 9, 10, 11, 12, 13, 15 или 16, где указанный тетрапептид стимулирует продукцию коллагена фибробластами.

2. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 5.

3. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 3.

4. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 8.

5. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 12 или SEQ ID NO: 16.

6. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 1.

7. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 9.

8. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 4.

9. Тетрапептид по п.1, где тетрапептид характеризуется формулой SEQ ID NO: 11.

10. Тетрапептид по любому из пп.1-9, где тетрапептид амидирован на карбоксиконце.

11. Композиция, содержащая тетрапептид по любому из пп.1-10 и фармацевтически приемлемый носитель, где указанная композиция стимулирует продукцию коллагена фибробластами.

12. Композиция по п.11, где тетрапептид присутствует в эффективной концентрации в диапазоне от приблизительно 0,01 мкг/мл до приблизительно 100 мкг/мл.

13. Композиция по п.11, где тетрапептид присутствует в эффективной концентрации в диапазоне от приблизительно 0,1 мкг/мл до приблизительно 1 мкг/мл.

14. Композиция по п.11, где композиция находится в форме аэрозоля, эмульсии, жидкости, лосьона, крема, пасты, мази или пенки.

15. Композиция, содержащая смесь тетрапептидов SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 и SEQ ID NO: 8 и фармацевтически приемлемый носитель, где указанная композиция стимулирует продукцию коллагена фибробластами.

16. Композиция по п.11, в которой указанный тетрапептид характеризуется формулой SEQ ID NO: 5.

17. Композиция по п.11, в которой указанный тетрапептид характеризуется формулой SEQ ID NO: 8.

18. Композиция по любому из пп.11-17 для использования в средстве для ухода за кожей.

19. Композиция по любому из пп.11-17 для использования при лечении ран на коже.

20. Способ стимуляции продукции коллагена фибробластом, предусматривающий воздействие на фибробласт тетрапептидом, характеризующимся любой из формул SEQ ID NO: 1-16, с индуцированием посредством этого продукции коллагена фибробластом.

21. Способ по п.20, где тетрапептид характеризуется формулой SEQ ID NO: 5.

22. Способ по п.20, где тетрапептид характеризуется формулой SEQ ID NO: 7.

23. Способ по п.20, где тетрапептид характеризуется формулой SEQ ID NO: 6.

24. Способ по п.20, где тетрапептид характеризуется формулой SEQ ID NO: 8.

25. Способ по п.20, где тетрапептид характеризуется формулой SEQ ID NO: 14.



 

Похожие патенты:

Изобретение относится к производным метотрексата, которые содержат белоксвязывающую группу и могут быть ферментативно расщеплены в теле, так что высвобождается активное соединение или низкомолекулярное производное активного соединения.

Изобретение относится к медицине, в частности к новому фармакологически активному соединению. .

Изобретение относится к пептидам, ингибирующим гиперсекрецию муцина. .

Изобретение относится к ингибированию или снижению уровня высвобождения медиаторов воспаления из воспалительных клеток путем подавления механизма, ассоциированного с высвобождением медиаторов воспаления из гранул воспалительных клеток путем использования вариантов пептида MANS.

Изобретение относится к применению биологически активного пептида, который представляет собой аминокислотную последовательность SEQ ID No.1, для получения лекарственного средства для модуляции, по меньшей мере, одного из следующих состояний: усталости, уровня запаса гликогена в печени и уровня молочной кислоты в крови.

Изобретение относится к области фармакологии и медицины. .

Изобретение относится к области биотехнологии, а именно к биологически активным пептидам, которые обладают влиянием на регенерацию кроветворной системы, и фармацевтической композиции на их основе.

Изобретение относится к области медицины и касается агентов и способов, основанных на применении домена EDA фибронектина. .

Изобретение относится к кожевенной промышленности. .

Изобретение относится к биотехнологии и может быть использовано в медицине. .

Изобретение относится к соединениям формулы Y-(CR2)n-X-NHJ, где Х представляет собой С=O или CR2; n является целым числом, имеющим значение от 1 до 6; Y представляет собой L(A)m- или R1R2CR-, где L - металлокомплексообразующий агент, А представляет собой -CR2-, -NRCO-, -CONR- или полиалкиленгликоль; m является целым числом, имеющим значение от 0 до 10; где один из R1 и R2 является -NH(B)p Z1 и другой является -CO(B)qZ2, где р и q являются целыми числами, имеющими значение от 0 до 20, и каждый В независимо выбирают из Q или остатка аминокислоты, где Q является циклическим пептидом; Z1 и Z2 - защитные группы, которые являются биосовместимыми группами, которые ингибируют или подавляют метаболизм пептида in vivo; J и каждую R-группу независимо выбирают из Н, C1-4 алкила или С1-4 алкоксиалкила; при условии, что (i) общее число остатков аминокислот в R1 и R2 группах не превышает 20; (ii) если Х является CR2, то Y является -CRR1R2, и Z2 является металлокомплексообразующим агентом; (ii) если Y является -CRR1R2, то по крайней мере один из R1 и R2 несет, по крайней мере, одну детектируемую частицу.

Изобретение относится к усовершенствованному способу получения коллагена из солюбилизированного и очищенного, возможно, пепсинизированного экстракта нестерильного нативного или ателопептидного коллагена, включающему: i) стадию перемешивания и сдвига указанного экстракта в смесителе с двойными поперечными резцами при поэтапном повышении первоначальной скорости перемешивания на 500-1000 об/мин без превышения скорости 10000 об/мин и при поэтапном повышении температуры на 2-10oС, предпочтительно на 3-5oС, таким образом, чтобы увеличить исходную окружающую температуру экстракта до максимально контролируемой температуры, составляющей не выше 50oС, а затем ii) стадию стерилизации в жидкой среде указанного экстракта с получением стерильного коллагена в нативной или ателопептидной форме, к нативному или ателопептидному коллагену типа I, полученному в условиях вышеуказанного способа, имеющему следующие характеристики или свойства: соотношение 2(I)1/1(I)2 от 0,48 до 0,52; стерильность в соответствии со стандартом Европейской Фармакопеи; общее содержание азота от 17,0 до 18,7%; гидроксипролин от 12 до 13,9%; не содержит триптофан, аминогликаны и полипептиды с мол.м.
Изобретение относится к богатым гидроксипролином гликопротеинам, которые имеют среднюю молекулярную массу 20000 Дальтон и высокую растворимость в воде. .

Изобретение относится к легочным поверхностно-активным полипептидам, способу их получения и к содержащим их композициям. .

Изобретение относится к области биотехнологии, конкретно к получению коротких пептидов - стимуляторов продукции белков внеклеточного матрикса в коже, и может быть использовано в медицине

Наверх