Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством



Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством

 


Владельцы патента RU 2531754:

ЭМЕРДЖЕНТ ПРОДАКТ ДИВЕЛОПМЕНТ СИЭТЛ,ЭлЭлСи,US (US)

Изобретение относится к области биотехнологии и иммунологии. Представлена молекула, специфически связывающаяся с CD37, содержащая от N-конца до С-конца: (a) CD37-специфическую scFV, содержащую от N-конца до С-конца: (i) гуманизированную вариабельную область тяжелой цепи, содержащую CDR1 GYNMN, CDR2 NIDPYYGGTTYNRKFKG и CDR3 SVGPFDS, (ii) линкер, имеющий от 5 до 30 аминокислот, включительно, и (iii) гуманизированную вариабельную область легкой цепи, содержащую CDR1 RASENVYSYLA, CDR2 FAKTLAE и CDR3 QHHSDNPWT; (b) шарнирную область; и (c) иммуноглобулиновые области CH2 и СН3. Описаны: нуклеиновая кислота, кодирующая указанную связывающую молекулу; вектор экспрессии, содержащий указанную нуклеиновую кислоту; и клетка-хозяин для продукции связывающей молекулы, содержащая указанный вектор. Предложено применение указанной связывающей молекулы для получения лекарственного средства для снижения количества B-клеток, лечения заболевания или расстройства, связанного с аномальной активностью B-клеток. Кроме того, описаны композиции, содержащие эффективное количество указанной связывающей молекулы, для снижения количества B-клеток, лечения заболевания или расстройства, связанного с аномальной активностью B-клеток. Изобретение позволяет получить молекулу scFV, связывающую CD37, имеющую ориентацию вариабельных областей VHVL, с большим выходом и эффективностью по сравнению с молекулой scFV против CD37, которая имеет ориентацию вариабельных областей VLVH. 13 н. и 18 з.п. ф-лы, 17 ил., 13 табл., 12 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА РОДСТВЕННЫЕ ЗАЯВКИ

По данной заявке испрашивается приоритет в соответствии с 35 U.S.С. §119(e) предварительной патентной заявки США №61/190067, поданной 11 апреля 2008, причем эта предварительная заявка включена в настоящий документ в качестве ссылки в полном объеме.

ОТЧЕТ О СПИСКЕ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Список последовательностей, приложенный к данной заявке, вместо бумажной копии предоставлен в текстовом формате и, таким образом, включен в качестве ссылки в описание. Текстовый файл, содержащий список последовательностей, называется SEQUENCE_LISTING.txt. Текстовый файл размером 295 КБ создан 26 марта 2012.

ПРЕДПОСЫЛКИ

Область техники

Настоящее описание в целом относится к композициям и способам для лечения В-клеточных нарушений и, более конкретно, к гуманизированной молекуле иммунофармацевтического средства на основе модульного белка малого размера (SMIP) к CD37, а также к лекарственным средствам с синергическими комбинациями молекул, специфически связывающихся с CD37, с бифункциональными химиотерапевтическими средствами для применения при лечении или предотвращения аутоиммунных, воспалительных или гиперпролиферативных заболеваний, связанных с B-клетками.

Описание связанной области техники

В основном иммунная система человека защищает организм от проникающих инородных веществ и патогенов. Одним из компонентов иммунной системы являются B-лимфоциты, также обозначаемые как продуцирующие антитела B-клетки, которые защищают организм, связывая инородные вещества или патогены и, в некоторых случаях, опосредуя их разрушение. Однако в некоторых случаях иммунная система может функционировать неправильно и приводить к возникновению заболевания. Например, существует множество видов злокачественных опухолей, аутоиммунных заболеваний и воспалительных заболеваний, в которые вовлечена неконтролируемая пролиферация B-клеток.

B-клетки можно идентифицировать по молекулам на их клеточной поверхности, таким как CD37. CD37 представляет собой сильно гликозилированный белок массой 40-52 кДа, относящийся к тетраспаниновому семейству трансмембранных антигенов клеточной поверхности, который высоко экспрессирован на нормальных продуцирующих антитела B-клетках, но не на пре-B-клетках или плазмоцитах. Кроме нормальных B-клеток по экспрессии CD37 положительны почти все злокачественные опухоли B-клеточного происхождения, включая хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ) и волосатоклеточный лейкоз (Moore et al., J. Pathol. 152:13 (1987); Merson and Brochier, Immunol. Lett. 19:269 (1988); и Faure et al., Am. J. Dermatopathol. 12:122 (1990)).

Разработано несколько специфичных к CD37 иммунотерапевтических средств. Специфичное к CD37 моноклональное антитело IgG1 мыши, MB-1, метили 131I и тестировали в клинических испытаниях для лечения НХЛ (см. Press et al., J. Clin. Oncol. 7:1027 (1989); Bernstein et al., Cancer Res. (Suppl.) 50:1017 (1990); Press et al., Front. Radiat. Ther. Oncol. 24:204 (1990); Press et al., Adv. Exp. Med. Biol. 303:91 (1991) и Brown et al., Nucl. Med. Biol. 24:657 (1997)). У антитела MB-1 отсутствуют эффекторные функции Fc, такие как антителозависимая клеточная цитотоксичность (АЗКЦ), а “голое” антитело MB-1 не ингибирует опухолевый рост в модели ксенотрансплантации in vivo (Buchsbaum et al., Cancer Res. 52:6476 (1992)). Кроме того, мышам вводили иммуноконъюгат, содержащий адриамицин, связанный с G28-1, другим мышиным моноклональным антителом к CD37, и показали его интернализацию вместе с адриамицином, который высвобождался внутриклеточно (см. Braslawsky et al., Cancer Immunol. Immunother. 33:367 (1991)). В настоящее время у людей проходит испытание сконструированный слитый белок, названный продуктом иммунофармацевтического средства на основе модульного белка малого размера (SMIP™) к CD37 (см., например, публикации патентных заявок США 2003/0133939 и 2007/0059306).

Несмотря на то, что проводилось всестороннее исследование способов лечения на основе антител, в данной области сохраняется потребность в альтернативных или улучшенных композициях и способах для лечения связанных с B-клетками нарушений или заболеваний.

КРАТКОЕ ИЗЛОЖЕНИЕ

В одном из аспектов, настоящее описание относится к гуманизированным молекулам, специфически связывающимся с CD37, и способу уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, включающему введение нуждающемуся в этом индивидууму эффективного количества гуманизированной молекулы, специфически связывающейся с CD37, предоставленной по настоящему документу.

В определенных вариантах осуществления настоящее описание относится к гуманизированной молекуле, специфически связывающейся с CD37, которая от N-конца до C-конца содержит: (i) гуманизированную вариабельную область тяжелой цепи, (ii) линкер, как указано в SEQ ID NO:229, (iii) гуманизированную вариабельную область легкой цепи, (iv) шарнирную область IgG1, (v) область CH2 IgG1 человека и (vi) область CH3 IgG1 человека, где (a) гуманизированная вариабельная область тяжелой цепи от N-конца до C-конца содержит: гуманизированный FR1 тяжелой цепи, CDR1 тяжелой цепи, как указано в SEQ ID NO:63, гуманизированный FR2 тяжелой цепи, CDR2 тяжелой цепи, как указано в SEQ ID NO:65, гуманизированный FR3 тяжелой цепи, CDR3 тяжелой цепи, как указано в SEQ ID NO:67, 68 или 69, и гуманизированный FR4 тяжелой цепи, и (b) гуманизированная вариабельная область легкой цепи от N-конца до C-конца содержит: гуманизированный FR1 легкой цепи, CDR1 легкой цепи, как указано в SEQ ID NO:61 или 62, гуманизированный FR2 легкой цепи, CDR2 легкой цепи, как указано в SEQ ID NO:64, гуманизированный FR3 легкой цепи и CDR3 легкой цепи, как указано в SEQ ID NO:66, и гуманизированный FR4 легкой цепи.

В определенных вариантах осуществления указанных выше гуманизированных молекул, специфически связывающихся с CD37, гуманизированный FR1 тяжелой цепи содержит SEQ ID NO:144, гуманизированный FR2 тяжелой цепи содержит SEQ ID NO:151, FR3 тяжелой цепи содержит SEQ ID NO:158, и FR4 тяжелой цепи содержит SEQ ID NO:161 или 162.

В определенных вариантах осуществления любой из указанных выше гуманизированных молекул, специфически связывающихся с CD37, гуманизированный FR1 легкой цепи содержит SEQ ID NO:171, FR2 легкой цепи содержит SEQ ID NO:182, FR3 легкой цепи содержит SEQ ID NO:195 и FR4 легкой цепи содержит SEQ ID NO:206.

В соответствующем аспекте настоящее описание относится к молекуле, специфически связывающейся с CD37, которая содержит аминокислотную последовательность, как указано в SEQ ID NO:253.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, по существу состоит из аминокислотной последовательности, как указано в SEQ ID NO:253.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, состоит из аминокислотной последовательности, как указано в SEQ ID NO:253.

В соответствующем аспекте настоящее описание также относится к выделенной молекуле нуклеиновой кислоты, которая содержит нуклеотидную последовательность, которая кодирует гуманизированную молекулу, специфически связывающуюся с CD37, предоставленную по настоящему документу.

В другом соответствующем аспекте настоящее описание относится к вектору, который содержит выделенную молекулу нуклеиновой кислоты, которая кодирует гуманизированную молекулу, специфически связывающуюся с CD37, предоставленную по настоящему документу.

В другом соответствующем аспекте настоящее описание относится к клетке-хозяину, которая содержит указанный выше вектор.

Настоящее описание также относится к композиции, которая содержит гуманизированную молекулу, специфически связывающуюся с CD37, предоставленную по настоящему документу, и фармацевтически приемлемый носитель.

В другом аспекте настоящее описание относится к способу уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, который включает введение нуждающемуся в этом индивидууму, эффективного количества гуманизированной молекулы, специфически связывающейся с CD37, предоставленной по настоящему документу.

В определенных вариантах осуществления заболевание, связанное с аномальной активностью B-клеток, представляют собой B-клеточную лимфому, B-клеточный лейкоз, B-клеточную миелому, заболевание, характеризующееся продукцией аутоантител или заболевание, характеризующееся неадекватной стимуляцией T-клеток, связанной с B-клеточным путем.

В определенных вариантах осуществления заболевание, характеризующееся продукцией аутоантител, представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит или макроглобулинемию Вальденстрема.

В определенных вариантах осуществления заболевание, связанное с аномальной активностью B-клеток, представляет собой хронический лимфолейкоз (ХЛЛ).

В другом аспекте настоящее описание относится к композициям и способам для комбинированного применения молекул, специфически связывающихся с CD37, и бифункциональных химиотерапевтических средств для уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток. Неожиданным результатом применения этой комбинации было то, что эти соединения действовали синергетически, что приводило к более выраженному уменьшению количества B-клеток.

Например, настоящее описание относится к композиции, которая содержит молекулу, специфически связывающуюся с CD37, и бендамустин.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, представляет собой специфичное к CD37 антитело или SMIP, такое как гуманизированное антитело или гуманизированное SMIP.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, по специфичности связывания с CD37 конкурирует с мАТ G28-1.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, представляет собой гуманизированную молекулу, специфически связывающуюся с CD37, предоставленную по настоящему документу, такую как гуманизированная молекула, специфически связывающаяся с CD37, которая содержит аминокислотную последовательность, как указано в SEQ ID NO:253, по существу состоит или состоит из нее.

В соответствующем аспекте настоящее описание относится к способу уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, включающему введение нуждающемуся в этом индивидууму, эффективного количества молекулы, специфически связывающейся с CD37, и бендамустина.

В определенных вариантах осуществления заболевание, связанное с аномальной активностью B-клеток, представляет собой B-клеточную лимфому, B-клеточный лейкоз, B-клеточную миелому, заболевание, характеризующееся продукцией аутоантител, или заболевание, отличающееся неадекватной T-клеточной стимуляцией, связанной с B-клеточным путем.

В определенных дополнительных вариантах осуществления заболевание, характеризующееся продукцией аутоантител, представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит или макроглобулинемию Вальденстрема.

В других определенных вариантах осуществления заболевание, связанное с аномальной активностью B-клеток, представляет собой хронический лимфолейкоз (ХЛЛ).

В определенных вариантах осуществления молекулу, специфически связывающуюся с CD37, и бендамустин вводят одновременно.

В других определенных вариантах осуществления молекулу, специфически связывающуюся с CD37, и бендамустин вводят последовательно.

В определенных вариантах осуществления молекулу, специфически связывающуюся с CD37, и бендамустин формулируют в одном составе.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, представляет собой специфичное к CD37 антитело или SMIP, такое как гуманизированное антитело или гуманизированное SMIP.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, по специфичности связывания с CD37 конкурирует с мАТ G28-1.

В определенных вариантах осуществления молекула, специфически связывающаяся с CD37, представляет собой гуманизированную молекулу, специфически связывающуюся с CD37, предоставленную по настоящему документу, такую как гуманизированная молекула, специфически связывающаяся с CD37, которая содержит аминокислотную последовательность, как указано в SEQ ID NO:253, по существу состоит или состоит из нее.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

На фиг.1 приведено выравнивание аминокислотных последовательностей вариабельных областей тяжелых и легких цепей последовательностей G28.1 мыши (вариабельная область тяжелой цепи: SEQ ID NO:241, вариабельная область легкой цепи: SEQ ID NO:236) и CAS-024 мыши (вариабельная область тяжелой цепи: SEQ ID NO:245, вариабельная область легкой цепи: SEQ ID NO:238), вместе с консенсусной идентичной последовательностью вариабельной области тяжелой цепи и вариабельной области легкой цепи (SEQ ID NO:270 и 271).

На фиг.2A-2D приведены хроматограммы CAS-001, CAS-002, CAS-003 и CAS-024, полученные эксклюзионной хроматографией (ЭХ). Представляющие интерес пики (POI) содержат 98-99% очищенных молекул SMIP. CAS-024 имеет очень отчетливый и симметричный пик (указывает на гомогенность), тогда как пики CAS-001, CAS-002 и CAS-003 имеют небольшие плечи (после интегрирования плечо составляет приблизительно 35% от POI), что указывает на гетерогенную группу молекул.

Фиг. 3 представляет собой диаграмму, на которой показано, как различные специфичные к CD37 белки SMIP конкурируют с исходной молекулой CAS-006 (химерный белок SMIP к CD37, mVLmVH) за связывание с CD37 на клетках линии Ramos, что обеспечивает критерий аффинности связывания по сравнению с исходной молекулой. CAS-024 (hVHhVL) по существу обладает такой же аффинностью к CD37, что и CAS-006, тогда как другие молекулы (CAS-001, CAS-002 и CAS-003, все hVLhVH) демонстрируют 2-4-кратное снижение аффинности.

Фиг. 4A и 4B представляют собой диаграммы дополнительных анализов конкурентного связывания против CAS-006 (отмечен как SMIP-016 на этих диаграммах). Здесь гибридные молекулы SMIP мыши-человека (mVHhVL CAS-014 и hVLmVH CAS-017) обладают аффинностью, которая выше, чем у CAS-006, тогда как CAS-024 демонстрирует такую же аффинность связывания, как и CAS-006, а CAS-003 (hVLhVH) обладает меньшей аффинностью связывания.

На фиг. 5A-5E представлено конкурентное связывание между несколькими различными антителами к CD37 и CAS-006 (химерная молекула SMIP к CD37).

На фиг. 6A и 6B показано, что CAS-024 статистически превосходил Ритуксан® при лечении in vivo в модели фолликулярной лимфомы на животных, как показано (A) частотой выживаемости и (B) долей без опухолей.

На фиг. 7 показано, что CAS-024 действует синергетически с химиотерапевтическими средствами флударабином и винкристином с уничтожением клеток лимфомы из клеток мантийной зоны (ЛКМЗ), клеток Rec-1.

Фиг. 8 представляет собой столбчатую диаграмму, на которой показан уровень истощения лимфоцитов периферической крови у пациентов-людей, которых лечили молекулами SMIP к CD37 по настоящему описанию.

На фиг. 9 представлено истощение количества лимфоцитов и ход лечения пациента BJB. Пациента BJB (часть когорты 7) лечили с использованием 3,0 мг/кг на сутки 1, 3 и 5 первой недели, с последующими 3 еженедельными дозами в первом цикле, и такое же лечение проводили во втором цикле. Пациент BJB продемонстрировал резкое падение количества лимфоцитов (в пределах 48 часов), продемонстрировал уменьшение пальпируемых лимфатических узлов на сутки 4 и продолжает отвечать на лечение.

На фиг. 10 показано истощение лимфоцитов и ход лечения пациента GRP. Пациента GRP (часть когорты 4) лечили с использованием 1,0 мг/кг раз в неделю в течение четырех недель в первом цикле, а затем через два месяца таким же образом лечили во втором цикле. Пациент GRP продемонстрировал резкое уменьшение количества лимфоцитов (в пределах 2 недель), продемонстрировал уменьшение размеров лимфатических узлов при КТ-сканировании на 36%, уменьшение размеров селезенки, улучшенный уровень гемоглобина и продолжает отвечать на лечение.

На фиг. 11 показан график комбинационного индекса (КИ) для ингибирующего действия CAS-024 и бендамустина на рост клеток Rec-1.

На фиг. 12 показано ингибирующее действие хлорамбуцила, отдельно и в комбинации с CAS-024, на рост клеток SU-DHL-6.

На фиг. 13 показан график комбинационного индекса для ингибирующего действия CAS-024 и хлорамбуцила на рост клеток SU-DHL-6.

На фиг. 14A показано сравнение объемов опухолей у мышей, несущих опухоли, возникшие в результате инъекций клеток DOHH2 и затем обрабатываемые huIgG (IgG человека, R&D Systems), CAS-024, бендамустином и комбинацией CAS-024 и бендамустина. На фиг. 14B показаны объемы опухолей у отдельных мышей на сутки 13 по сравнению с сутками 0.

На фиг. 15 представлены средние объемы опухолей в течение времени у мышей, несущих опухоли, возникшие в результате инъекций клеток DOHH2 и затем обрабатываемые huIgG, CAS-024, бендамустином и комбинацией CAS-024 и бендамустина. Значения представляют собой среднее±среднеквадратическая ошибка среднего для каждых суток измерений. После того, как одну или несколько мышей в группе умерщвляют, кривые для каждой группы заканчиваются.

На фиг. 16 представлен процент выживаемости мышей, несущих опухоли, возникшие в результате инъекций клеток DOHH2 и затем обрабатываемые huIgG, CAS-024, бендамустином и комбинацией CAS-024 и бендамустина, с течением времени.

На фиг. 17 представлена частота мышей без опухолей с течением времени после обработки huIgG, CAS-024, бендамустином и комбинацией CAS-024 и бендамустина.

ПОДРОБНОЕ ОПИСАНИЕ

В одном из аспектов, настоящее описание относится к молекуле CAS-024 (SEQ ID NO:253), специфически связывающейся с CD37, которая представляет собой гуманизированную версию CAS-006 (белок иммунофармацевтического средства на основе модульного белка малого размера (SMIP), содержащий вариабельные области иммуноглобулина из моноклонального антитела мыши G28-1 к CD37 человека). Белок SMIP CAS-024 неожиданно (1) экспрессировался на уровне приблизительно до величины в 25 раз выше по сравнению с другими гуманизированными версиями CAS-006 (такими как CAS-002, CAS-003; см. примеры 2 и 5), (2) мог связываться с CD37, так же как CAS-006, хотя другие гуманизированные версии не обладали такой способностью (см. примеры 4 и 5), и (3) продуцировался в виде гомогенной группы молекул по сравнению с гетерогенным характером других гуманизированных версий (см. пример 3). Кроме того настоящее описание относится к молекуле CAS-024 (SEQ ID NO:253), специфически связывающейся с CD37, для использования в способах уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, включающих введение нуждающемуся в этом индивидууму, эффективного количества CAS-024, предоставленного по настоящему документу.

В другом аспекте настоящее описание относится к композициям и способам для комбинированного использования любой молекулы, специфически связывающейся с CD37, и бифункциональных химиотерапевтических средств (таких как бендамустин) для уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток. Неожиданным результатом применения этой комбинации является то, что эта комбинация соединений действует синергетически и по существу приводит к более эффективному лечебному режиму.

Перед более подробным изложением настоящего описания, для его понимания может оказаться полезным предоставить определения некоторых терминов, используемых в настоящем документе. Дополнительные определения приведены на всем протяжении настоящего описания.

Следует понимать, что в данном описании любой диапазон концентраций, процентный диапазон, диапазон отношений или числовой диапазон включает значение любого числа в пределах указанного диапазона и, когда это приемлемо, его дробных частей (таких как одна десятая и одна сотая целого числа), если не указано иного. Также следует понимать, что любой указанный в настоящем документе числовой диапазон, относящийся к любому физическому свойству, такому как полимерные субъединицы, размер или плотность, включает любое число в пределах указанного диапазона, если не указано иного. Как применяют в настоящем документе, "приблизительно" или "по существу состоит из" означает ±20% от указанного диапазона, значения или структуры, если не указано иного. Следует понимать, что формы единственного числа, как применяют в настоящем документе, указывают на "один или несколько" указанных компонентов. Следует понимать, что использование альтернативы (например, "или") обозначает или одну альтернативу, или обе, или любое их сочетание. Как применяют в настоящем документе, термины "включает" и "содержит" используют в качестве синонимов. Кроме того, следует понимать, что отдельные соединения или группы соединений, получаемые из различных сочетаний структур и заместителей, описываемых в настоящем документе, описаны в настоящей заявке в той же степени, как если бы каждое из этих соединений или из группы соединений указано индивидуально. Таким образом, выбор конкретных структур или конкретных заместителей находится в объеме настоящего описания.

"Связывающие домены" или "связывающие области" в соответствии с настоящим описанием могут представлять собой, например, любой белок, полипептид, олигопептид или пептид, способный специфически распознавать и связывать биологическую молекулу (например, CD37) или комплекс из двух и более одинаковых или различных молекул или структуру или агрегат, стабильные или временные. Связывающая область включает любого природного, синтетического, полусинтетического или полученного рекомбинантными способами партнера по связыванию для биологической молекулы или другой представляющей интерес мишени. Для идентификации связывающих доменов по настоящему описанию, которые специфически связываются с конкретной мишенью, известно множество анализов, включая вестерн-блоттинг, ELISA или анализ Biacore.

Связывающие домены и их слитые белки по настоящему описанию могут обладать способностью к связыванию в желаемой степени, включая "специфическое или селективное связывание" мишени, существенно не связывая другие компоненты, присутствующие в тестируемом образце, если они связывают молекулу-мишень с аффинностью или Ka (т.е., с равновесной константой ассоциации конкретного связывающего взаимодействия с размерностью 1/M), например, больше или равной приблизительно 105 M-1, 106 M-1, 107 M-1, 108 M-1, 109 M-1, 1010 M-1, 1011 M-1, 1012 M-1 или 1013 M-1. "Высокоаффинные" связывающие домены относится к связывающим доменам с Ka по меньшей мере 107 M-1, по меньшей мере 108 M-1, по меньшей мере 109 M-1, по меньшей мере 1010 M-1, по меньшей мере 1011 M-1, по меньшей мере 1012 M-1, по меньшей мере 1013 M-1 или больше. "Низкоаффинные" связывающие домены относятся к связывающим доменам с Ka до 5×107 M-1, до 107 M-1, до 106 M-1, до 105 M-1 или менее. Альтернативно, аффинность можно определить как равновесную константу диссоциации (Kd) конкретного связывающего взаимодействия с размерностью M (например, от 10-5 M до 10-13 M). Аффинности полипептидов связывающих доменов и слитых белков по настоящему описанию можно легко определить с использованием общепринятых способов (см., например, Scatchard et al. (1949) Ann. N.Y. Acad. Sci. 51:660; и патенты США №№ 5283173, 5468614 или эквивалент).

Термин "молекулы, специфически связывающиеся с CD37" относится к белку, полипептиду, олигопептиду или пептиду, который специфически связывается с CD37 с Ka по меньшей мере приблизительно 106 M-1 (например, по меньшей мере приблизительно 107 M-1, 108 M-1, 109 M-1, 1010 M-1, 1011 M-1, 1012 M-1 или 1013 M-1).

Термин "связывающий домен, специфичный к CD37" относится к части или домену молекулы, специфически связывающейся с CD37, отвечающим за специфическое связывание молекулы с CD37. Специфичный к CD37 связывающий домен самостоятельно (т.е., без всех остальных частей молекулы, специфически связывающейся с CD37) связывается с CD37 с Ka по меньшей мере приблизительно 106 M-1 (например, по меньшей мере приблизительно 107 M-1, 108 M-1, 109 M-1, 1010 M-1, 1011 M-1, 1012 M-1 или 1013 M-1). Специфичный к CD37 связывающий домен самостоятельно может оказаться достаточным в качестве молекулы, специфически связывающейся с CD37. Иллюстративные связывающие домены, специфичные к CD37, включают scFv и Fab-фрагменты, специфичные к CD37, которые можно получать из антител к CD37, таких как моноклональное антитело G28-1.

Если в данном документе не определено явно, каждый из терминов, понимаемых специалистами в данной области, как относящихся к технологии антител, приведен в значении, используемом в данной области. Например, термины "VL" и "VH" относятся к вариабельным связывающим областям, происходящим из легкой и тяжелой цепи антитела, соответственно. Вариабельные связывающие области образованы из отдельных, четко выраженных подобластей, которые известны как "определяющие комплементарность области" (CDR) и "каркасные области" (FR). Термины "CL" и "CH" относятся к "константной области иммуноглобулина", т.е. к константным областям, происходящим из легкой или тяжелой цепи антитела, соответственно, при этом понятно, что последняя область дополнительно разделяется на домены константной области CH1, CH2, CH3 и CH4, в зависимости от изотипа антитела (IgA, IgD, IgE, IgG, IgM), из которого данная область происходит. Часть доменов константной области образует Fc-область (область "кристаллизующегося фрагмента"), которая содержит домены, отвечающие за эффекторные функции иммуноглобулина, такие как АЗКЦ (антителозависимая клеточная цитотоксичность), КЗЦ (комплемент-зависимая цитотоксичность) и реакция связывания комплемента, связывание с Fc-рецепторами, увеличение времени полужизни in vivo относительно полипептида с отсутствием Fc-области, связывание с белком A и, возможно, даже трансплацентарный перенос (см. Capon et al., Nature, 337:525 (1989)). Кроме того, полипептид, содержащий Fc-область, допускает димеризацию или мультимеризацию полипептида.

"Шарнирная область" представляет собой аминокислотную последовательность, расположенную между связывающим доменом, специфичным к CD37, и другой областью (например, область CH2) в слитом белке и связывающую их так, что слитый белок все еще остается способным к специфическому связыванию с CD37 (т.е., с Ka по меньшей мере приблизительно 106 M-1, 107 M-1, 108 M-1, 109 M-1, 1010 M-1, 1011 M-1, 1012 M-1 или 1013 M-1). В определенных вариантах осуществления шарнирная область представляет собой шарнирную область иммуноглобулина.

"Шарнирная область иммуноглобулина" относится к шарнирной области иммуноглобулина дикого типа или к измененной шарнирной области иммуноглобулина дикого типа.

В соответствии с кристаллографическими исследованиями шарнирную область иммуноглобулина можно дополнительно функционально подразделить на три области: верхняя шарнирная область, центральная область и нижняя шарнирная область. Верхняя шарнирная область включает аминокислоты от карбоксильного конца CH1 до первого остатка в шарнирной области, который ограничивает подвижность, как правило, до первого остатка цистеина, который образует межцепочечную дисульфидную связь между двумя тяжелыми цепями. Длина верхней шарнирной области коррелирует с сегментной подвижностью антитела. Центральная шарнирная область включает дисульфидные связи между тяжелыми цепями, а нижняя шарнирная область соединяет N-конец домена CH2 и включает остатки в CH2. Также центральная шарнирная область IgG1 человека содержит последовательность Cys-Pro-Pro-Cys (SEQ ID NO:264), которая при димеризации путем образования дисульфидных связей приводит к образованию циклического октапептида, предположительно действующего в качестве точки вращения, таким образом, придавая подвижность.

Как применяют в настоящем документе "шарнирная область иммуноглобулина дикого типа" относится к природной аминокислотной последовательности, расположенной между областями CH1 и CH2 одной цепи антитела и соединяющей их. Она содержит верхнюю шарнирную область, центральную шарнирную область и часть нижней шарнирной области, которая не является частью области CH2. Иллюстративной шарнирной областью иммуноглобулина дикого типа является шарнирная область IgG1 человека, как указано в SEQ ID NO:90, в которой от ее N-конца до ее C-конца первые десять аминокислот (EPKSCDKTHT, SEQ ID NO:263) происходят из верхней шарнирной области, следующие четыре аминокислоты (CPPC, SEQ ID NO:264) происходят из центрально шарнирной области, а последняя аминокислота (т.е., пролин) является первой аминокислотой в нижней шарнирной области и не является частью CH2.

"Измененная шарнирная область иммуноглобулина дикого типа" или "измененная шарнирная область иммуноглобулина" относится к (a) шарнирной области иммуноглобулина дикого типа, содержащей до 30% аминокислотных замен (например, до 25%, 20%, 15%, 10% или 5% аминокислотных замен или делеций), (b) части шарнирной области иммуноглобулина дикого типа длиной, по меньшей мере, 10 аминокислот (например, по меньшей мере 12, 13, 14 или 15 аминокислот), которая содержит до 30% аминокислотных замен (например, до 25%, 20%, 15%, 10% или 5% аминокислотных замен или делеций), или (c) части шарнирной области иммуноглобулина дикого типа, которая содержит центральную шарнирную область (длина которой может составлять 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 или 15 или, по меньшей мере, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 или 15 аминокислот). Когда измененная шарнирная область иммуноглобулина дикого типа в слитом белке расположена между связывающим доменом, специфичным к CD37, и другой областью (например, областью CH2) и соединяет их, это позволяет слитому белку специфически связываться с CD37 (т.е., с Ka по меньшей мере приблизительно 106 M-1, 107 M-1, 108 M-1, 109 M-1, 1010 M-1, 1011 M-1, 1012 M-1 или 1013 M-1). В определенных вариантах осуществления один или несколько остатков цистеина в шарнирной области иммуноглобулина дикого типа можно заменить на один или несколько других аминокислотных остатков (например, один или несколько остатков серина). Измененная шарнирная область иммуноглобулина альтернативно или дополнительно может содержать остаток, где пролин из шарнирной области иммуноглобулина дикого типа, замещен на другой аминокислотный остаток (например, остаток серина).

"Линкер" относится к аминокислотной последовательности, которая соединяет вариабельную область тяжелой цепи и вариабельную область легкой цепи друг с другом и обеспечивает спейсерную функцию, соответствующую взаимодействию двух связывающих субдоменов так, чтобы полученный полипептид мог специфично связываться с CD37.

Как применяют в настоящем документе, "производное" относится к химически или биологически модифицированной версии соединения, которая структурно соответствует исходному соединению и которую (фактически или теоретически) можно получить из исходного соединения. Как правило, "производное" отличается от "аналога" тем, что исходное соединение может являться исходным веществом для получения "производного", тогда как для получения "аналога" в качестве исходного вещества не обязательно необходимо использовать исходное соединение. Химические или физические свойства производного могут отличаться от химических или физических свойств исходного соединения. Например, производное может являться более гидрофобным, или оно может представлять собой мутантную последовательность, обладающую измененной реакционноспособностью (например, CDR, содержащая аминокислотную замену, которая изменяет ее аффинность к мишени) по сравнению с исходным соединением или последовательностью.

"Связанное с B-клетками нарушение или заболевание" относится к аномальной активности B-клеток или активности, которая отклоняется от нормального, правильного или ожидаемого направления. Например, связанное с B-клетками нарушение или заболевание, может включать несоответствующую пролиферацию клеток с поврежденной или дефектной ДНК или другими клеточными компонентами. Аномальная активность B-клеток может включать клеточную пролиферацию, отличающуюся неадекватно высокими уровнями деления клеток, неадекватно низкими уровнями апоптоза или и тем, и другим. Для таких заболеваний свойственной может являться, например, наличие единичного или множественных очагов аномальной пролиферации клеток, групп клеток или ткани(ей), злокачественных или незлокачественных, доброкачественных или злокачественных. Связанное с B-клетками нарушение или заболевание также может включать в себя продукцию аномальных антител, такую как продукция аутоантител или сверхпродукция антител, более желательных при продукции на нормальных уровнях. В настоящем документе также полагают, что аномальная активность B-клеток может происходить в определенных субпопуляциях B-клеток и не происходить в других субпопуляциях, или может включать в себя несоответствующую стимуляцию T-клеток, например, путем несоответствующего представления антигена T-клеткам или посредством другого B-клеточного пути.

"Лечение" относится к терапевтическому лечению или профилактическому/предотвращающему лечению. Терапевтическое лечение может улучшать, по меньшей мере, один симптом заболевания у индивидуума, получающего лечение, или может задерживать ухудшение прогрессирования заболевания у индивидуума или предотвращать появление дополнительных связанных заболеваний.

"Терапевтически эффективное количество (или доза)" или "эффективное количество (или доза)" специфически связывающейся молекулы или соединения относится к такому количеству соединения, которого достаточно для улучшения одного или нескольких симптомов заболевания, подвергаемых лечению. При применении к отдельному активному компоненту, вводимому отдельно, терапевтически эффективная доза относится к этому ингредиенту отдельно. При применении к комбинации, терапевтически эффективная доза относится к объединенному количеству активных ингредиентов, которое приводит к терапевтическому эффекту, при периодическом или одновременном введении. В настоящем изобретении, в частности, предусмотрено, что одну или несколько специфически связывающихся молекул можно вводить способами по изобретению, каждую в эффективной дозе.

"Индивидуум, имеющий или предположительно имеющий заболевание, связанное с аномальной активностью B-клеток" представляет собой индивидуума, у которого заболевание или симптом нарушения может быть вызван аномальными активностью B-клеток или B-клеточной пролиферацией, может быть обострен неправильной активностью B-клеток или может быть ослаблен путем регулирования активности B-клеток. Примерами таких заболеваний являются B-клеточное злокачественное новообразование или B-клеточная злокачественная опухоль (например, B-клеточная лимфома, B-клеточный лейкоз или B-клеточная миелома), заболевание, характеризующееся продукцией аутоантител, или заболевание, отличающееся несоответствующей T-клеточной стимуляцией, которая вызвана несоответствующим представлением антигена B-клетками T-клеткам или опосредована другими путями, включающими B-клетки.

Дополнительные определения предоставлены в приведенном ниже подробном описании настоящего описания.

Гуманизированные молекулы, специфически связывающиеся с CD37,

В одном из аспектов настоящее описание относится к гуманизированным молекулам, специфически связывающимся с CD37. Эти молекулы могут существовать в любой форме, которая содержит гуманизированный специфичный к CD37 связывающий домен, включая гуманизированное антитело к CD37, Fab-фрагмент гуманизированного антитела к CD37, гуманизированный специфичный к CD37 одноцепочечный Fv (scFv), гуманизированный специфичный к CD37 белок SMIP, гуманизированный специфичный к CD37 белок PIMS (слитый белок, содержащий компоненты SMIP в обратной ориентации), гуманизированный специфичный к CD37 белок SCORPION, и другие би- или полиспецифические связывающие белки, которые содержат по меньшей мере один гуманизированный специфичный к CD37 связывающий домен. Подробное описание белков SMIP и способов их получения можно найти, например, в публикациях патентов США №№ 2003/0133939, 2003/0118592, 2005/0136049 и WO 2005017148. Конструкции и способы получения белков PIMS описаны в заявке США № 12/168875. Способы получения белков SCORPION можно найти, например, в публикации заявки PCT № WO 2007/146968. Другие иллюстративные полифункциональные слитые белки можно найти, например, в публикации патентной заявки США № 2006/0051844 и патенте США № 7166707. Определенные би- или полиспецифические связывающие белки могут содержать специфичный к CD37 scFv и один или несколько других связывающих доменов, которые не происходят из иммуноглобулина.

Гуманизированные связывающие домены, специфичные к CD37

Иллюстративным "гуманизированным связывающим доменом, специфичным к CD37," является вариабельная область иммуноглобулина, специфичная к CD37, которая содержит по меньшей мере одну каркасную область человека.

"Каркасная область человека" относится к каркасной области вариабельной области иммуноглобулина дикого типа (т.е., встречающейся в природе) человека, к измененной каркасной области вариабельной области иммуноглобулина человека, где в данной области удалены или заменены (например, одним или несколькими аминокислотными остатками каркасной области из иммуноглобулина, не являющегося иммуноглобулином человека, в соответствующих положениях) менее чем приблизительно 50% (например, предпочтительно менее чем приблизительно 45%, 40%, 30%, 25%, 20%, 15%, 10%, 5% или 1%) аминокислот, или к измененной каркасной области вариабельной области иммуноглобулина, не являющегося иммуноглобулином человека, где в данной области удалены или заменены (например, в положениях наружных остатков и/или одним или несколькими аминокислотными остатками каркасной области иммуноглобулина человека в соответствующих положениях) менее чем приблизительно 50% (например, менее чем 45%, 40%, 30%, 25%, 20%, 15%, 10% или 5%) аминокислот так, чтобы, в одном из аспектов, снизить иммуногенность.

В определенных вариантах осуществления каркасная область человека представляет собой каркасную область вариабельной области иммуноглобулина дикого типа человека. В других определенных вариантах осуществления каркасная область человека представляет собой измененную каркасную область вариабельной области иммуноглобулина человека с делециями или заменами аминокислот в одном, двух, трех, четырех или пяти положениях. В других определенных вариантах осуществления каркасная область человека представляет собой измененную каркасную область вариабельной области из иммуноглобулина, не являющегося иммуноглобулином человека, с делециями или заменами аминокислот в одном, двух, трех, четырех или пяти положениях.

В определенных вариантах осуществления гуманизированный специфичный к CD37 связывающий домен содержит, по меньшей мере, одну, две, три, четыре, пять, шесть, семь или восемь каркасных областей (FR) человека, выбранных из FR1 легкой цепи человека, FR1 тяжелой цепи человека, FR2 легкой цепи человека, FR2 тяжелой цепи человека, FR3 легкой цепи человека, FR3 тяжелой цепи человека, FR4 легкой цепи человека и FR4 тяжелой цепи человека.

Иллюстративные FR человека приведены в SEQ ID NO:140-146 (FR1 тяжелой цепи человека), SEQ ID NO:147, 150 и 151 (FR2 тяжелой цепи человека), SEQ ID NO:154-160 (FR3 тяжелой цепи человека), SEQ ID NO:161-163, 168 и 169 (FR4 тяжелой цепи человека), SEQ ID NO:170-172, 175 и 177-181 (FR1 легкой цепи человека), SEQ ID NO:182, 184-188 и 191 (FR2 легкой цепи человека), SEQ ID NO:194-198, 203 и 205 (FR3 легкой цепи человека) и SEQ ID NO:206-210 (FR4 легкой цепи человека). Дополнительные иллюстративные FR области человека можно найти в областях FR специфичных к CD37 белков SMIP, предоставляемых по настоящему документу, таких как CAS-001, CAS-002, CAS-003 или CAS-024.

FR человека, которые могут присутствовать в связывающих доменах, специфичных к CD37, также включают варианты иллюстративных FR, предоставленных по настоящему документу, в которых одна или две аминокислоты иллюстративных были заменены или удалены.

В определенных вариантах осуществления гуманизированный специфичный к CD37 связывающий домен содержит (a) гуманизированную вариабельную область легкой цепи, которая содержит FR1 легкой цепи человека, FR2 легкой цепи человека, FR3 легкой цепи человека и FR4 легкой цепи человека, и (b) гуманизированную вариабельную область тяжелой цепи, которая содержит FR1 тяжелой цепи человека, FR2 тяжелой цепи человека, FR3 тяжелой цепи человека и FR4 тяжелой цепи человека.

Специфичные к CD37 связывающие домены, предоставленные по настоящему документу, также содержат одну, две, три, четыре, пять или шесть CDR. Такие CDR могут представлять собой CDR, не являющиеся CDR человека, или измененные CDR, не являющиеся CDR человека, выбранные из CDR1, CDR2 и CDR3 легкой цепи и CDR1, CDR2 и CDR3 тяжелой цепи. В определенных вариантах осуществления специфичный к CD37 связывающий домен содержит (a) вариабельную область легкой цепи, которая содержит CDR1 легкой цепи, CDR2 легкой цепи и CDR3 легкой цепи, и (b) вариабельную область тяжелой цепи, которая содержит CDR1 тяжелой цепи, CDR2 тяжелой цепи и CDR3 тяжелой цепи.

Иллюстративные CDR включают CDR1 легкой цепи, как указано в SEQ ID NO:61 (RASENVYSYLA) или в SEQ ID NO:62 (RTSENVYSYLA), CDR1 тяжелой цепи, как указано в SEQ ID NO:63 (GYNMN), CDR2 легкой цепи, как указано в SEQ ID NO:64 (FAKTLAE), CDR2 тяжелой цепи, как указано в SEQ ID NO:65 (NIDPYYGGTTYNRKFKG), CDR3 легкой цепи, как указано в SEQ ID NO:66 (QHHSDNPWT), CDR3 тяжелой цепи, как указано в SEQ ID NO:67 (SVGPFDY), CDR3 тяжелой цепи, как указано в SEQ ID NO:68 (SVGPFDS), и CDR3 тяжелой цепи, как указано в SEQ ID NO:69 (SVGPMDY). Предпочтительная CDR1 легкой цепи представляет собой SEQ ID NO:61 (RASENVYSYLA), а предпочтительная CDR3 тяжелой цепи включает SEQ ID NO:68 (SVGPFDS) или SEQ ID NO:69 (SVGPMDY).

Дополнительные иллюстративные CDR включают CDR1 легкой цепи, как указано в SEQ ID NO:128 (RTSQNVYSYLA), 129 (RTSESVYSYLA), 130 (RASQSVYSYLA), 131 (RASQSVSSYLA) и 132 (RASQSVSYYLA), CDR1 тяжелой цепи, как указано в SEQ ID NO:133 (SYMNM) и 134 (SYWIG), CDR2 легкой цепи, как указано в SEQ ID NO:135 (AASSLQS), 136 (GASTRAT) и 137 (DASNRAT), CDR2 тяжелой цепи, как указано в SEQ ID NO:138 (IIYPGDSDTRYSPSFQG) и 139 (RIDPSDSYTNYSPSFQG), CDR3 легкой цепи, как указано в SEQ ID NO:220 (QHHSDNPWT), и CDR3 тяжелой цепи, как указано в SEQ ID NO:211 (SVGPMDY), 212 (SVGPFDY), 213 (SVGPMDV), 214 (SVGPFDS), 215 (SVGPFDP), 216 (SVGPFQH), 217 (SVGPFDV), 218 (SVGPFDI) и 219 (SVGPFDL). Дополнительные иллюстративные CDR включают CDR в специфичных к CD37 белках SMIP, предоставляемых по настоящему документу.

В определенных вариантах осуществления связывающие домены, специфичные к CD37, содержат гуманизированную вариабельную область легкой цепи, которая от ее N-конца до С-конца содержит: FR1 легкой цепи человека, CDR1 легкой цепи, FR2 легкой цепи человека, CDR2 легкой цепи, FR3 легкой цепи человека, CDR3 легкой цепи и FR4 легкой цепи человека.

В определенных вариантах осуществления связывающие домены, специфичные к CD37, содержат гуманизированную вариабельную область легкой цепи, которая от ее N-конца до C-конца содержит: FR1 легкой цепи человека, CDR1 легкой цепи, как указано в SEQ ID NO:61 или 62, FR2 легкой цепи человека, CDR2 легкой цепи, как указано в SEQ ID NO:64, FR3 легкой цепи человека, CDR3 легкой цепи, как указано в SEQ ID NO:66, и FR4 легкой цепи человека. В дополнительных вариантах осуществления связывающие домены, специфичные к CD37, содержат, по существу состоят из или состоят из гуманизированной вариабельной области легкой цепи, которая от ее N-конца до C-конца содержит: FR1 легкой цепи человека, как указано в SEQ ID NO:171, CDR1 легкой цепи, как указано в SEQ ID NO:61, FR2 легкой цепи человека, как указано в SEQ ID NO:182, CDR2 легкой цепи, как указано в SEQ ID NO:64, FR3 легкой цепи человека, как указано в SEQ ID NO:195, CDR3 легкой цепи, как указано в SEQ ID NO:66, и FR4 легкой цепи человека, как указано в SEQ ID NO:206. Дополнительные иллюстративные гуманизированные легкие цепи приведены в SEQ ID NO:237-240 и включают легкие цепи в гуманизированных специфичных к CD37 белках SMIP, предоставляемых по настоящему документу.

В определенных вариантах осуществления связывающие домены, специфичные к CD37, содержат гуманизированную вариабельную область тяжелой цепи, которая от ее N-конца до C-конца содержит: FR1 тяжелой цепи человека, CDR1 тяжелой цепи, FR2 тяжелой цепи человека, CDR2 тяжелой цепи, FR3 тяжелой цепи человека, CDR3 тяжелой цепи и FR4 тяжелой цепи человека.

В определенных вариантах осуществления связывающие домены, специфичные к CD37, содержат гуманизированную вариабельную область тяжелой цепи, которая от ее N-конца до C-конца содержит: FR1 тяжелой цепи человека, CDR1 тяжелой цепи, как указано в SEQ ID NO:63, FR2 тяжелой цепи человека, CDR2 тяжелой цепи, как указано в SEQ ID NO:65, FR3 тяжелой цепи человека, CDR3 тяжелой цепи, как указано в SEQ ID NO:67, 68 или 69, и FR4 тяжелой цепи человека. В дополнительных вариантах осуществления связывающие домены, специфичные к CD37, содержат, по существу состоят из или состоят из гуманизированной вариабельной области тяжелой цепи, которая от ее N-конца до C-конца содержит: FR1 тяжелой цепи человека, как указано в SEQ ID NO:144, CDR1 тяжелой цепи, как указано в SEQ ID NO:63, FR2 тяжелой цепи человека, как указано в SEQ ID NO:151, CDR2 тяжелой цепи, как указано в SEQ ID NO:65, FR3 тяжелой цепи человека, как указано в SEQ ID NO:158, CDR3 тяжелой цепи, как указано в SEQ ID NO:67, 68 или 69, и FR4 тяжелой цепи человека, как указано в SEQ ID NO:161. Дополнительные иллюстративные гуманизированные легкие цепи приведены в SEQ ID NO:242-245 и включают легкие цепи в гуманизированных специфичных к CD37 белках SMIP, предоставленных по настоящему документу.

В определенных вариантах осуществления связывающие домены, специфичные к CD37, могут находиться в форме Fab- или scFv-фрагмента. В предпочтительном варианте осуществления специфичный к CD37 связывающий домен представляет собой гуманизированный специфичный к CD37 scFv, который содержит вариабельную область легкой цепи и вариабельную область тяжелой цепи, соединенные друг другом линкером. В дополнительных вариантах осуществления вариабельные области легкой и тяжелой цепи гуманизированы и могут содержать гуманизированную вариабельную область легкой цепи, как указано в SEQ ID NO:238, и гуманизированную вариабельную область тяжелой цепи, как указано в SEQ ID NO:245.

В других дополнительных вариантах осуществления гуманизирована только вариабельная область легкой или только тяжелой цепи. Например, связывающие домены, специфичные к CD37, могут содержать гуманизированную вариабельную область легкой цепи (т.е., вариабельную область легкой цепи, которая содержит, по меньшей мере, одну FR человека) и не принадлежащую человеку вариабельную область тяжелой цепи (например, принадлежащую мыши или крысе). Альтернативно, связывающие домены, специфичные к CD37, могут содержать не принадлежащую человеку вариабельную область легкой цепи (например, принадлежащую мыши или крысе) и гуманизированную вариабельную область тяжелой цепи (т.е., вариабельную область тяжелой цепи, которая содержит, по меньшей мере, один FR человека). Оба типа связывающих доменов, специфичных к CD37, можно обозначать как "гибридный связывающий домен, специфичный к CD37, состоящий из частей от человека и не от человека" или как "химерный связывающий домен, специфичный к CD37".

В определенных вариантах осуществления C-конец вариабельной области легкой цепи в гуманизированном scFv, специфичном к CD37, соединен с N-концом вариабельной области тяжелой цепи линкером. Таким образом, полученный scFv от его N-конца до его С-конца содержит: вариабельную область легкой цепи, линкер и вариабельную область тяжелой цепи. В других определенных вариантах осуществления С-конец вариабельной области тяжелой цепи в гуманизированном scFv, специфичном к CD37, соединен с N-концом вариабельной области легкой цепи посредством линкера. Таким образом, полученный scFv от его N-конца до его С-конца содержит: вариабельную область тяжелой цепи, линкер и вариабельную область тяжелой цепи.

В определенных вариантах осуществления линкеры содержат 5-30 аминокислот, например, 15-25 аминокислот. В определенных вариантах осуществления линкеры содержат (GlynSer)m, где n и m могут представлять собой целое число, независимо выбранное из диапазона от 1 до 5 (SEQ ID NO:229, 272-293). Например, в определенных вариантах осуществления n представляет собой 4, а m представляет собой 1, 2, 3, 4 или 5 (SEQ ID NO:229, 274-275). В определенных вариантах осуществления на N-конце, С-конце или на обоих концах могут присутствовать одна или две аминокислоты, отличных - от Gly или Ser. В других определенных вариантах осуществления для замены Gly или Ser в линкере, который содержит (GlynSer)m, где m и n определены выше, можно использовать одну или две аминокислоты, отличных от Gly или Ser. Иллюстративный линкер содержит последовательность (Gly4Ser)5, как указано в SEQ ID NO:229. Дополнительные иллюстративные последовательности линкеров приведены в SEQ ID NO:225-228.

В определенных вариантах осуществления гуманизированные связывающие домены, специфичные к CD37, или молекулы, специфически связывающиеся с CD37, конкурируют за связывание с CD37 с мАТ G28-1. Т.е., в таких вариантах осуществления, связывание мАТ G28-1 с CD37 в присутствие других связывающих доменов, специфичных к CD37 (таких как моноклональные антитела к CD37), или молекул, специфически связывающихся с CD37, снижено по сравнению со связыванием мАТ G28-1 с CD37 в отсутствие связывающих доменов, специфичных к CD37, или молекул, специфически связывающихся с CD37. В данной области известны анализы конкурентного связывания, такие как описаны в примерах 4-6, и их можно использовать для определения способности данного связывающего домена, специфичного к CD37, или молекулы, специфически связывающейся с CD37, конкурировать с мАТ G28-1 за связывание с CD37.

Гуманизированные полипептиды SMIP, специфичные к CD37

В определенных вариантах осуществления молекулы, специфически связывающиеся с CD37, представляют собой полипептиды иммунофармацевтических средств на основе модульных белков малого размера (SMIP), специфичные к CD37. Белки SMIP представляют собой слитые белки связывающего домена и иммуноглобулина, которые, как правило, от их N-концов до C-концов содержат: связывающий домен, происходящий из иммуноглобулина (например, scFv), шарнирную область и эффекторный домен (например, области CH2 и CH3 IgG). В предпочтительных вариантах осуществления полипептиды SMIP, специфически связывающиеся с CD37, гуманизированы.

Шарнирная область гуманизированного полипептида SMIP, специфически связывающегося с CD37, может представлять собой шарнирную область иммуноглобулина. В определенных вариантах осуществления шарнирная область представляет собой шарнирную область иммуноглобулина дикого типа, такую как шарнирная область IgG, шарнирная область IgA, шарнирная область IgD, шарнирная область IgE, или ее фрагмент (например, длиной от 4 до 20 или от 5 до 15 аминокислот), который содержит центральную шарнирную область. В определенных предпочтительных вариантах осуществления шарнирная область может представлять собой шарнирную область антитела, выбранную из шарнирных областей IgG1 человека, IgG2 человека, IgG3 человека, IgG4 человека или их фрагментов или вариантов. В определенных вариантах осуществления шарнирная область представляет собой шарнирную область иммуноглобулина дикого типа или ее часть, такую как шарнирная область иммуноглобулина человека. Иллюстративные шарнирные области для таких вариантов осуществления представляют собой шарнирную область IgG1 дикого типа человека, как указано в SEQ ID NO:90, шарнирную область IgA1 дикого типа человека, как указано в SEQ ID NO:115, шарнирную область IgA2 дикого типа человека, как указано в SEQ ID NO:116, шарнирную область IgG3 дикого типа человека, как указано в SEQ ID NO:118, часть шарнирной области IgG3 человека, как указано в SEQ ID NO:258, и шарнирную область IgD человека, как указано в SEQ ID NO:127. В определенных вариантах осуществления на N- или C-конце шарнирной области иммуноглобулина дикого типа можно добавить один или несколько аминокислотных остатков как часть структуры конструкции слитого белка. Такие аминокислотные остатки обозначают как "соединительные аминокислоты" (см. таблицу 4).

В определенных вариантах осуществления шарнирная область представляет собой измененную (мутантную) шарнирную область иммуноглобулина дикого типа, такую как измененная шарнирная область иммуноглобулина IgG дикого типа или измененная часть шарнирной области иммуноглобулина дикого типа. Например, шарнирная область IgG1 дикого типа человека содержит три остатка цистеина - наиболее близкий к N-концу цистеин обозначают как первый остаток цистеина, тогда как самый наиболее близкий к C-концу цистеин в шарнирной области представляет собой третий остаток цистеина. В определенных вариантах осуществления мутантная шарнирная область IgG1 человека содержит только два остатка цистеина, например, шарнирная область IgG1 человека, в которой первый остаток цистеина заменен на серин. В других определенных вариантах осуществления мутантная шарнирная область IgG1 человека содержит только один остаток цистеина. В определенных вариантах осуществления пролин, расположенный ближе к C-концу относительно третьего цистеина в шарнирной области IgG1 человека, заменен, например, на серин. Иллюстративные мутантные шарнирные области IgG1 человека приведены в SEQ ID NO:92, 94, 102, 104, 255, 256, 106, 108, 257, 96, 110, 112, 98 и 100. Иллюстративные мутантные части шарнирных областей IgG3 человека приведены в SEQ ID NO:120, 126, 259-261, 122 и 124. В определенных вариантах осуществления на N- или C-конце мутантной шарнирной области иммуноглобулина можно добавить один или несколько аминокислотных остатков как часть структуры конструкции слитого белка. Примеры таких модифицированных шарнирных областей выделены курсивом в SEQ ID NO:231-235.

В определенных вариантах осуществления шарнирная область содержит или имеет последовательность, которая по меньшей мере на 80%, по меньшей мере на 81%, по меньшей мере на 82%, по меньшей мере на 83%, по меньшей мере на 84%, по меньшей мере на 85%, по меньшей мере на 86%, по меньшей мере на 87%, по меньшей мере на 88%, по меньшей мере на 89%, по меньшей мере на 90%, по меньшей мере на 91%, по меньшей мере на 92%, по меньшей мере на 93%, по меньшей мере на 94%, по меньшей мере на 95%, по меньшей мере на 96%, по меньшей мере на 97%, по меньшей мере на 98%, по меньшей мере на 99% идентична шарнирной области иммуноглобулина дикого типа, такой как шарнирные области IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD и IgE дикого типа человека.

В дополнительных вариантах осуществления измененные шарнирные области могут быть основаны на шарнирной области иммуноглобулина дикого типа (например, на шарнирной области IgG1) и по сравнению с шарнирной областью иммуноглобулина дикого типа содержать одну или несколько (например, 1, 2, 3 или 4) вставок, одну или несколько (например, 1, 2, 3 или 4) делеций, одну или несколько (например, 1, 2, 3 или 4) замен аминокислот (например, консервативные замены аминокислот или неконсервативные замены аминокислот), или сочетание указанных мутаций, но при условии, что модифицированная шарнирная область сохраняет гибкость или жесткость, подходящие для правильной ориентации связывающего домена слитого связывающего белка для взаимодействия с его мишенью. Вставка(и), делеция(и) или замена(ы) можно производить в любой части шарнирной области иммуноглобулина дикого типа, включая N- или C-конец или оба конца.

Как описано в настоящем документе, полипептиды SMIP, специфичные к CD37, могут содержать область CH2 иммуноглобулина. В определенных вариантах осуществления область CH2 иммуноглобулина представляет собой область CH2 иммуноглобулина дикого типа, такую как область CH2 иммуноглобулина дикого типа человека, включая область CH2 IgA1, IgA2, IgD, IgE, IgG1, IgG2, IgG3, IgG4 и IgM дикого типа человека. В определенных вариантах осуществления область CH2 иммуноглобулина представляет собой область CH2 IgG1 человека.

В других определенных вариантах осуществления область CH2 иммуноглобулина представляет собой измененную область CH2 иммуноглобулина дикого типа. Например, измененная область CH2 иммуноглобулина дикого типа может представлять собой область CH2 IgG1 человека, но с одной, двумя, тремя, четырьмя или пятью мутациями в положениях от 234 до 238, 253, 279, 310, 318, 320, 322 и 331 (нумерация EU, Ward et al., 1995 Therap. Immunol. 2:77-94). Мутации в таких положениях снижают или устраняют активность по антителозависимой клеточной цитотоксичности (АЗКЦ), способность связываться с Fc-рецептором и/или способность связывать комплемент.

Как описано в настоящем документе, гуманизированные полипептиды SMIP, специфичные к CD37, могут содержать область CH3 иммуноглобулина. В определенных вариантах осуществления полипептид области CH3 иммуноглобулина представляет собой полипептид области CH3 иммуноглобулина дикого типа, включая область CH3 дикого типа из иммуноглобулина любого изотипа (например, IgA, IgD, IgG1, IgG2, IgG3, IgG4, IgE или IgM) из различных видов (т.е., человек, мышь, крыса или другие млекопитающие). В других вариантах осуществления полипептид области CH3 иммуноглобулина представляет собой мутантный полипептид области CH3 иммуноглобулина. Мутации в области CH3 иммуноглобулина могут находиться в одном или нескольких положениях, которые участвуют в реакции связывания комплемента, например, в положениях H433 или N434.

В определенных вариантах осуществления гуманизированные полипептиды SMIP, специфичные к CD37 могут содержать одну или несколько дополнительных областей. Такие дополнительные области могут представлять собой лидерную последовательность на N-конце для секреции экспрессированного полипептида SMIP, дополнительную подобласть Fc (например, область CH4 дикого типа или мутантную область CH4 IgM или IgE), концевую последовательность на его C-конце для идентификации или очистки (например, эпитопные метки для обнаружения или очистки, включая метку из 6 остатков гистидина или эпитоп FLAG) или дополнительные аминокислотные остатки, которые образуются в результате использования конкретных систем экспрессии. Иллюстративные лидерные пептиды по настоящему описанию включают природные лидерные последовательности или другие последовательности, такие как последовательности, приведенные в SEQ ID NO:223 и 224.

Настоящие описание включает полипептиды SMIP, специфичные к CD37, идентичность которых с полипептидом, как указано в SEQ ID NO:2, составляет, по меньшей мере, 80 процентов (например, 82%, 84%, 85%, 86%, 88%, 90%, 92%, 94%, 95%, 96%, 97%, 98% или 99%), где специфичный к CD37 полипептид SMIP связывается с CD37. В дополнительных вариантах осуществления такие полипептиды, идентичность которых с SEQ ID NO:2 составляет, по меньшей мере, 80%, можно дополнительно гуманизировать. Иллюстративные гуманизированные полипептиды SMIP, специфичные к CD37, содержат, по существу состоят из или состоят из любой аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO:6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 52, 80, 82, 84, 86, 88 и 222, в которых удалены лидерные последовательности, а также SEQ ID NO:247-254 и 266-269.

Как применяют в настоящем документе, "идентичность последовательностей" относится к доле аминокислотных остатков в одной последовательности, которые идентичны аминокислотным остаткам в другой эталонной полипептидной последовательности после выравнивания последовательностей и, при необходимости, введения пропусков для достижения максимального процента идентичности последовательностей, и не рассматривая любые консервативные замены как долю идентичности последовательностей. Значения процента идентичности последовательностей получали посредством программного обеспечения NCBI BLAST 2.0, как определено в Altschul et al. (1997) "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402, с параметрами, установленными на значения по умолчанию.

В предпочтительном варианте осуществления настоящее описание относится к гуманизированному полипептиду SMIP, специфичному к CD37, который от N-конца до C-конца содержит: гуманизированную вариабельную область тяжелой цепи (VH), линкер (G4S)5 (SEQ ID NO:229), гуманизированную вариабельную область легкой цепи (VL), измененную шарнирную область IgG1, область CH2 IgG1 человека и область CH3 IgG1 человека. Гуманизированная вариабельная область тяжелой цепи от ее N-конца до ее C-конца содержит: FR1 тяжелой цепи человека, CDR1 тяжелой цепи, как указано в SEQ ID NO:63, FR2 тяжелой цепи человека, CDR2, как указано в SEQ ID NO:65, FR3 тяжелой цепи человека, CDR3, как указано в SEQ ID NO:67, 68 или 69, и FR4 тяжелой цепи человека. Гуманизированная вариабельная область легкой цепи от ее N-конца до ее C-конца содержит: FR1 легкой цепи человека, CDR1 легкой цепи, как указано в SEQ ID NO:61 или 62, FR2 легкой цепи человека, CDR2 легкой цепи, как указано в SEQ ID NO:64, FR3 легкой цепи человека и CDR3 легкой цепи, как указано в SEQ ID NO:66, и FR4 легкой цепи человека.

В определенных указанных выше предпочтительных вариантах осуществления FR1, FR2 и FR3 тяжелой цепи человека содержат SEQ ID NO:144, 151 и 158, соответственно, а FR4 тяжелой цепи содержит SEQ ID NO:161 или 162. В дополнительных предпочтительных вариантах осуществления FR1, FR2, FR3 и FR4 легкой цепи человека содержат SEQ ID NO:171, 182, 195 и 206, соответственно. Альтернативно эти последовательности содержат и тяжелые, и легкие цепи.

Белок SMIP CAS-024 неожиданно (1) экспрессировался на уровне приблизительно до величины в 25 раз выше по сравнению с другими гуманизированными версиями CAS-006 (такими как CAS-002, CAS-003; см. примеры 2 и 5), (2) мог связываться с CD37, также как CAS-006, хотя другие гуманизированные версии не обладали такой способностью (см. примеры 4 и 5), и (3) продуцировался в виде гомогенной группы молекул по сравнению с гетерогенным характером других гуманизированных версий (см. пример 3). В предпочтительном варианте осуществления в настоящем описании предоставлен белок, специфически связывающийся с CD37, который содержит или состоит из CAS-024 (SEQ ID NO:253). В частности, эта гуманизированная молекула, специфически связывающаяся с CD37, имеет по существу такую же аффинность связывания с CD37, как и исходная химерная молекула (CAS-006, белок SMIP, содержащий вариабельные области иммуноглобулина из моноклонального антитела мыши G28-1 к CD37 человека) в отличие от других гуманизированных молекул, экспрессирован на высоких уровнях по сравнению с другими гуманизированными молекулами и/или демонстрирует высокую степень гомогенности после очистки, например, посредством эксклюзионной хроматографии (ЭХ), в отличие от других гуманизированных молекул. Кроме того, показано, что эта молекула CAS-024, специфически связывающаяся с CD37, эффективно ингибирует опухолевый рост и вызывает длительную ремиссию опухоли.

Настоящее описание также относится к выделенной молекуле нуклеиновой кислоты, содержащей нуклеотидную последовательность, кодирующую гуманизированные молекулы, специфически связывающиеся с CD37, и их компоненты, включая принадлежащие человеку или гуманизированные FR, CDR, гуманизированные вариабельные области легкой цепи, гуманизированные вариабельные области тяжелой цепи, гуманизированные scFv и гуманизированные полипептиды SMIP. Иллюстративные выделенные молекулы нуклеиновой кислоты, кодирующие гуманизированные полипептиды SMIP, специфичные к CD37, включают молекулы нуклеиновой кислоты, содержащие SEQ ID NO:5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 51, 79, 81, 83, 85, 87 и 221. В одном из вариантов осуществления настоящее описание относится к векторам, содержим эти молекулы нуклеиновой кислоты, и клеткам-хозяевам, содержащим эти векторы.

Настоящее описание также относится к способу получения полипептидов, описываемых в настоящем документе, который включает культивирование клеток-хозяев в условиях, подходящих для экспрессии полипептидов, и, необязательно, выделение полипептидов из культуры.

Соединения, пригодные для комбинированного лечения

Настоящее описание также относится к комбинированному лечению с применением любых молекул, специфически связывающихся с CD37, известных в данной области или описываемых в настоящем документе, и бифункциональных химиотерапевтических средств (например, бендамустина).

Молекулы, специфически связывающиеся с CD37, которые можно использовать для комбинированного лечения, могут существовать в любой форме, которая содержит связывающий домен, специфичный к CD37, включая антитело к CD37, Fab-фрагмент антитела к CD37, специфичный к CD37 одноцепочечный Fv (scFv), специфичный к CD37 SMIP, специфичный к CD37 PIMS, специфичный к CD37 SCORPION и другие би- или полиспецифические связывающие белки, которые содержат по меньшей мере один белок, специфически связывающийся с CD37.

В определенных вариантах осуществления молекулы, специфически связывающиеся с CD37, пригодные для комбинированного лечения с бифункциональным химиотерапевтическим средством, являются специфичные к CD37 антитела. Такие антитела включают антитела, используемые для характеризации антигена CD37 на Thrid HLDA Workshop, т.е., HD28, G28-1, HH1, BI14, WR17 и F93G6 (см. Ling and MacLennan, стр. 302-335 в "Leucocyte Typing III. White Cell Differentiation Antigens", Oxford University Press (1987)). Другие специфичные к CD37 антитела, пригодные для комбинированного лечения, включают RFB-7, Y29/55, MB-1, M-B371, M-B372 и IPO-24 (см. Moldenhaurer, J. Biol., Regul. Homeost. Agents, 14: 281-283 (2000), где указано что все эти антитела распознают только один эпитоп CD37, и Schwartz-Albiez et al., 14: 905-914 (1988), где указано что этот эпитоп находится в углеводном остатке CD37). Другим специфичным к CD37 антителом, пригодным для комбинированного лечения, является S-B3 (Biosys).

В определенных вариантах осуществления молекулами, специфически связывающимися с CD37, пригодными для комбинированного лечения с бифункциональным химиотерапевтическим средством, являются полипептиды SMIP, специфичные к CD37. Иллюстративный полипептид SMIP содержит SEQ ID NO:2. Дополнительные иллюстративные полипептиды SMIP включают полипептиды, описанные в WO2005017148, такие как (1) scFv G28-1 (SSS-S) H WCH2 WCH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой все три остатка цистеина и пролин, расположенный ближе к C-концу, чем третий цистеин в шарнирной области IgG1 человека, заменены на остатки серина, и домены CH2 и CH3 IgG1 дикого типа человека; (2) scFv G28-1 IgAH WCH2 WCH3, содержащий scFv G28-1, часть шарнирной области IgA человека и домены CH2 и CH3 IgG1 человека; (3) scFv G28-1 VHL11S (SSS-S) H WCH2 CH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой все три остатка цистеина и пролин, расположенный ближе к C-концу, чем третий цистеин в шарнирной области, заменены на остатки серина, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (4) scFv G28-1 VHL11S (CSS-S) H WCH2 CH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой остатки цистеина во втором и третьем положении и пролин, расположенный ближе к C-концу, чем третий цистеин, заменены на остатки серина, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (5) scFv G28-1 VHL11S (CSC-S) H WCH2 CH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой остаток цистеина во втором положении и пролин, расположенный ближе к C-концу, чем цистеин в третьем положении, заменены на остатки серина, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (6) scFv G28-1 VH11S (SSC-P) H WCH2 WCH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой первый и второй остатки цистеина в шарнирной области заменены на остатки серина, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (7) scFv G28-1 VH11S (SCS-S) H WCH2 WCH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой первый и третий остатки цистеина и пролин, расположенный ближе к C-концу, чем третий цистеин в шарнирных областях, заменены на остатки серина, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (8) scFv G28-1 VHL11S (CCS-P) H WCH2 WCH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой третий остаток цистеина в шарнирной области заменен на серин, и домены CH2 и CH3 IgG1 человека, где лейцин в положении 11 вариабельной область тяжелой цепи заменен на серин (9) scFv G28-1 VHL11S (SCC-P) H WCH2 WCH3, содержащий scFv G28-1, измененную шарнирную область IgG1 человека, в которой первый цистеин заменен на серин, и домены CH2 и CH3 человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (10) scFv G28-1 VHL11S mIgE CH2 CH3 CH4, содержащий scFv G28-1 и области CH2, CH3 и CH4 IgE мыши, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; (11) scFv G28-1 VHL11S mIgA WIgACH2 T4CH3, содержащий scFv G28-1, шарнирную область IgA мыши и CH2 IgA дикого типа и укороченный домен CH3 IgA с отсутствием 4 C-концевых аминокислот GTCY (SEQ ID NO:265); (12) scFv G28-1 VHL11S hIgE CH2 CH3 CH4, содержащий scFv G28-1 и области CH2, CH3 и CH4 IgE человека, где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин; и (13) scFv G28-1 VHL11S hIgAH WIgACH2 TCH3, содержащий scFv G28-1, часть шарнирной области IgA человека, CH2 IgA дикого типа и укороченный домен CH3 IgA с отсутствием 4 C-концевых аминокислот GTCY (SEQ ID NO:265), где лейцин в положении 11 вариабельной области тяжелой цепи заменен на серин.

В определенных вариантах осуществления молекулы, специфически связывающиеся с CD37, пригодные для комбинированного лечения с бифункциональным химиотерапевтическим средством, представляют собой гуманизированные молекулы, специфически связывающиеся с CD37, описываемые в настоящем документе, включая гуманизированные антитела к CD37, Fab-фрагменты гуманизированных антител к CD37, гуманизированный специфичный к CD37 белок PIMS, гуманизированный специфичный к CD37 белок SCORPION и другие би- или полиспецифически связывающиеся белки, которые содержат, по меньшей мере, один гуманизированный белок, специфически связывающийся с CD37, в частности, гуманизированный одноцепочечный Fv (scFv), специфичный к CD37, и гуманизированные полипептиды SMIP, специфичные к CD37.

Определенные молекулы, специфически связывающиеся с CD37, рассматриваемые в настоящем описании, обладают аффинностями к CD37 приблизительно от 0,5 до приблизительно 10 нМ. Другим признаком определенных связывающих CD37 молекул, рассматриваемых в настоящем описании, является то, что они обладают временем полужизни в кровотоке приблизительно от 5 до приблизительно 30 суток.

В определенных вариантах осуществления молекулы, специфически связывающиеся с CD37, обладают способностью конкурировать по специфичности связывания с CD37 с мАТ G28-1.

Бендамустин (4-[5-[бис(2-хлорэтил)амино]-1-метилбензимидазол-2-ил]бутановая кислота) представляет собой азотистый иприт с алкилирующей и антиметаболической активностью. Бендамустин содержит алкилирующую группу и бензимидазольное кольцо. Алкилирующая группа позволяет метаболитам бендамустина алкилировать и сшивать макромолекулы, что приводит к ингибированию синтеза ДНК, РНК и белка и впоследствии к апоптозу. Бензимидазольное кольцо может позволять бендамустину выступать в качестве аналога пуринов. Гидрохлорид бендамустина имеет торговые названия ТРЕАНДА® и РИБОМУСТИН®.

Хотя бендамустин или его соли являются предпочтительными терапевтическими средствами, которые можно использовать в комбинации с молекулами, специфически связывающимися с CD37, также в комбинации с молекулами, специфически связывающимися с CD37, по настоящему описанию, можно использовать другие терапевтические средства, которые содержат одну или несколько алкилирующих групп и способны функционировать в качестве аналога пуринов.

Как используют в настоящем документе, термин "алкилирующая группа" относится к группе, которая позволяет соединению, содержащему эту группу, присоединять алкильную группу к ДНК. Соединение, которое содержит алкилирующую группу, можно обозначить как "алкилирующее средство". В определенных вариантах осуществления алкилирующими средствами являются азотистые иприты.

Термин "аналог пуринов" относится к антиметаболиту, который имитирует структуру метаболических пуринов (например, аденина и гуанина) и содержит один, два, три или четыре заместителя в кольце пурина, которые отличаются от метаболических пуринов. Иллюстративные аналоги пурина включают азатиоприн, меркаптопурин, тиогуанин, флударабин, пентостатин и кладрибин.

Терапевтическое средство "способно функционировать в качестве аналога пуринов" если оно обладает, по меньшей мере, одной функцией аналога пуринов. Иллюстративные функции аналогов пуринов включают нарушение или ингибирование синтеза пуриновых нуклеотидов, метаболизм пуриновых нуклеотидов, синтез нуклеиновых кислот, процессинг нуклеиновых кислот или функционирование нуклеиновых кислот, например, ингибирование рибонуклеотидредуктазы, ДНК-полимеразы, аденозиндеаминазы, и встраивание в ДНК или РНК.

Композиции и способы

В одном из аспектов настоящее описание относится к способу уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, включающему введение нуждающемуся в этом индивидууму (т.е., индивидууму, страдающему или предположительно страдающему заболеванием, связанным с аномальной активностью B-клеток) эффективного количества гуманизированной молекулы, специфически связывающейся с CD37, предоставляемой по настоящему документу (например, CAS-024).

В другом аспекте настоящее описание относится к способу уменьшения количества B-клеток или лечения заболевания, связанного с аномальной активностью B-клеток, включающему введение нуждающемуся в этом индивидууму, эффективного количества молекулы, специфически связывающейся с CD37 (например, CAS-024) и бифункционального химиотерапевтического средства (например, бендамустина). Как описано выше, молекулы, специфически связывающиеся с CD37, пригодные для комбинированного лечения с бифункциональным химиотерапевтическим средством, не ограничены гуманизированными молекулами, специфически связывающимися с CD37, но также включают другие молекулы, специфически связывающиеся с CD37, которые не являются гуманизированными.

В одном из вариантов осуществления композиция содержит терапевтическое средство, связывающееся с CD37, и бифункциональное химиотерапевтическое средство, которые действуют синергетически и уменьшают количество B-клеток или лечат заболевание, связанное с аномальной активностью B-клеток. Два или более соединения, которые действуют синергетически, взаимодействуют так, что комбинированный эффект соединений превышает сумму индивидуальных эффектов каждого соединения при раздельном введении (см., например, Berenbaum, Pharmacol. Rev. 41:93, 1989). Например, взаимодействие между иммунофармацевтическим средством на основе модульного белка малого размера, направленного к CD37, и другим средством или соединением, можно анализировать с помощью множества теоретических и эмпирических моделей (см., например, Ouzounov et al., Antivir. Res. 55:425, 2002). В часто используемом способе для анализа взаимодействия между комбинируемыми средствами используют построение изобол (кривых равных эффектов, также обозначаемых как изоболограммы), на которых комбинация средств (da, db) обозначается точкой на графике, оси которого представляют собой оси доз отдельных средств (см., например, Ouzounov et al., выше; также см. Tallarida, J. Pharmacol. Exp. Therap. 298:865, 2001).

Другой известный в данной области способ анализа взаимодействий лекарственных средств (антагонизм, аддитивность, синергизм) включает определение комбинаторных индексов (КИ), соответствующее принципу среднего эффекта с предоставлением оценок значений IC50 соединений, вводимых по отдельности и в сочетании (см., например, Chou. In Synergism and Antagonism Chemotherapy. Eds. Chou and Rideout. Academic Press, San Diego Calif., страницы 61-102, 1991; программное обеспечение CalcuSyn™). Значение КИ менее единицы обозначает синергетическое действие, равное единице обозначает аддитивное действие, а превышающее единицу означает антагонизм.

Еще одним иллюстративным способом является способ независимого действия (Pritchard and Shipman, Antiviral Res. 14:181, 1990; Pritchard and Shipman, Antiviral Therapy 1:9, 1996; программное обеспечение MACSYNERGY™ II, University of Michigan, Ann Arbor, Mich.). Программное обеспечение MACSYNERGY™ II позволяет трехмерный (3D) анализ взаимодействий соединений посредством сравнения вычисленной аддитивной поверхности с наблюдаемыми с получением дифференциальных графиков, которые выявляют участки (в виде объемной области) статистически больше ожидаемых (синергизм) или меньше ожидаемых (антагонизм) взаимодействий соединений. Например, композицию, содержащую молекулу, специфически связывающуюся с CD37, и бифункциональное химиотерапевтическое средство, изменяющую вирусную репликацию, следует рассматривать как обладающую синергетической активностью или обладающей синергетическим эффектом, когда объемная область получаемого синергизма, который вычисляют по объему синергетических пиков, предпочтительно приблизительно на 15% больше чем аддитивный эффект (то есть эффектов каждого средства по отдельности, сложенных вместе), или предпочтительно приблизительно в 2-10 раз больше аддитивного эффекта, или предпочтительно приблизительно в 3-5 или более раз больше аддитивного эффекта.

В дополнительных вариантах осуществления молекулу, специфически связывающуюся с CD37, и бифункциональное химиотерапевтическое средство можно вводить для оказания синергетического действия при лечении B-клеточных злокачественных новообразований или B-клеточных злокачественных опухолей. B-клеточные злокачественные новообразования или B-клеточные злокачественные опухоли включают B-клеточные лимфомы [такие как различные формы болезни Ходжкина, неходжкинская лимфома (НХЛ) или лимфомы центральной нервной системы], лейкозы [такие как острый лимфобластный лейкоз (ОЛЛ), хронический лимфолейкоз (ХЛЛ), волосатоклеточный лейкоз и хронический миобластный лейкоз] и миеломы (такие как множественная миелома). Дополнительные виды B-клеточных злокачественных опухолей включают мелкоклеточную лимфому, B-клеточный пролимфоцитарный лейкоз, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, плазмоцитарную миелому, солитарную плазмацитому кости, экстраоссальную плазмоцитому, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек, нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта, B-клеточную пролиферацию неопределенного онкогенного потенциала, лимфоматоидный гранулематоз и посттрансплантационное лимфопролиферативное нарушение.

Лимфома Беркитта (или "B-клеточное злокачественное новообразование Беркитта", или "опухоль Беркитта", или "злокачественная лимфома Беркитта") представляет собой злокачественную опухоль лимфатической системы (в частности, B-лимфоцитов). Ее можно подразделить на три основных клинических варианта: эпидемический, спорадический и связанный с иммунодефицитом варианты.

Неберкиттовские B-клеточные злокачественные опухоли включают в качестве неограничивающих примеров B-клеточный хронический лимфолейкоз (ХЛЛ)/мелкоклеточную лимфому, B-клеточный пролимфоцитарный лейкоз, острый лимфобластный лейкоз (ОЛЛ), лимфоплазмоцитарную лимфому (включая в качестве неограничивающих примеров, макроглобулинемию Вальденстрема), лимфомы маргинальной зоны (включая в качестве неограничивающих примеров, B-клеточную лимфому маргинальной зоны селезенки, нодальную лимфому маргинальной зоны и экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек), волосатоклеточный лейкоз, плазмоцитарную миелому/плазмоцитому, фолликулярную лимфому, лимфому из клеток мантийной зоны (ЛКМЗ), диффузную B-клеточную крупноклеточную лимфому, трансформирующуюся B-клеточную крупноклеточную лимфому, медиастинальную B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому и неберкиттовскую неходжкинскую лимфому (НХЛ).

Нарушения, характеризующиеся продукцией аутоантител, часто считают аутоиммунными заболеваниями. Аутоиммунные заболевания включают в качестве неограничивающих примеров: артрит, ревматоидный артрит, ювенильный ревматоидный артрит, остеоартрит, полихондрит, псориатический артрит, псориаз, дерматит, полимиозит/дерматомиозит, миозит с включенными тельцами, воспалительный миозит, токсический эпидермальный некролиз, системную склеродермию и склероз, синдром Тибьержа-Вейсенбаха, реакции, связанные с воспалительным заболеванием кишечника, болезнь Крона, язвенный колит, респираторный дистресс-синдром, респираторный дистресс-синдром взрослых (РДСВ), менингит, энцефалит, увеит, колит, гломерулонефрит, аллергические состояния, экзему, астму, состояния, в которые вовлечена инфильтрация T-клетками и хронические воспалительные реакции, атеросклероз, аутоиммунный миокардит, нарушение адгезии лейкоцитов, системную красную волчанку (СКВ), подострую кожную красную волчанку, дискоидную волчанку, миелит при волчанке, энцефалит при волчанке, ювенильный диабет, рассеянный склероз, аллергический энцефаломиелит, нейромиелит зрительного нерва, ревматическую атаку, хорею Сиденгама, иммунные реакции, связанные с острой и замедленной гиперчувствительностью, опосредованной цитокинами и T-лимфоцитами, туберкулез, саркоидоз, гранулематоз, включая гранулематоз Вегенера и болезнь Черджа-Стросса, агранулоцитоз, васкулит (включая васкулит/ангиит при гиперчувствительности, ANCA и ревматоидный васкулит), апластическую анемию, анемию Даймонда-Блекфена, иммунную гемолитическую анемию, включая аутоиммунную гемолитическую анемию (АИГА), пернициозную анемию, истинную эритроцитарную аплазию (ИЭА), недостаточность VIII фактора, гемофилию A, аутоиммунную нейтропению, панцитопению, лейкопению, заболевания, в которых участвует лейкоцитарный диапедез, воспалительные заболевания центральной нервной системы (ЦНС), синдром полиорганной недостаточности, миастению гравис, заболевания, опосредованные комплексами антиген-антитело, антигломерулярное заболевание базальной мембраны, синдром антифосфолипидных антител, аллергический неврит, болезнь Бехчета, синдром Кастлмана, синдром Гудпасчера, миастенический синдром Ламберта-Итона, болезнь Рейно, синдром Сьергена, синдром Стивенса-Джонсона, отторжение трансплантата солиднго органа, реакция "трансплантант против хозяина" (РТПХ), буллезный пемфигоид, обыкновенная пузырчатка, аутоиммунные полиэндокринопатии, серонегативные спондилоартропатии, синдром Рейтера, синдром скованного человека, гигантоклеточный артериит, иммунный нефрит, IgA нефропатию, IgM полинейропатии или IgM-опосредованную нейропатию, идиопатическую тромбоцитопеническую пурпуру (ИТП), тромбическую тромбоцитопеническую пурпуру (ТТП), болезнь Шенлейн-Геноха, аутоиммунную тромбоцитопению, аутоиммунные заболевания яичек или яичников, включая аутоиммунный орхит и оофорит, первичный гипотиреоз; аутоиммунные эндокринные заболевания, включая аутоиммунный тиреоидит, хронический тиреоидит (тиреоидит Хашимото), подострый тиреоидит, идиопатический гипотиреоз, болезнь Аддисона, болезнь Грейва, аутоиммунные полигландулярные синдромы (или полигландулярные эндокринопатические синдромы), диабет I типа, также обозначаемый как инсулинозависимый сахарный диабет (ИЗСД) и синдром Шихана; аутоиммунный гепатит, лимфоидный интерстициальный пневмонит (ВИЧ), облитерирующий бронхит (нетрансплантационный) против NSIP, синдром Гийена-Барре, васкулит крупных сосудов (включая ревматическую полимиалгию и гигантоклеточный артериит (Такаясу)), васкулит средних сосудов (включая болезнь Кавасаки и узелковый полиартериит), узелковый полиартериит (УПА), анкилозирующий спондилит, болезнь Бергера (IgA нефропатия), быстро прогрессирующий гломерулонефрит, первичный билиарный цирроз, глютеновую болезнь, криоглобулинемию, криоглобулинемию, связанную с гепатитом, боковой амиотрофический склероз (БАС), болезнь коронарных артерий, семейную средиземноморскую лихорадку, микроскопический полиангиит, синдром Когана, синдром Вискотта-Олдрича и облитерирующий тромбангиит, аутоиммунные заболевания щитовидной железы (такие как базедова болезнь и тиреоидит Хашимото), синдром Шегрена и идиопатическую воспалительную миопатию (ИВМ), включая дерматомиозит (ДМ) и полимиозит (ПМ). Вышеуказанные аутоиммунные заболевания также можно лечить гуманизированными молекулами, специфически связывающимися с CD37, или сочетанием молекул, специфически связывающихся с CD37, и бифункционального химиотерапевтического средства.

В одном из аспектов настоящего описания, гуманизированную молекулу, специфически связывающуюся с CD37, или комбинацию молекулы, специфически связывающейся с CD37, с бифункциональным химиотерапевтическим средством вводят в фармацевтической композиции. Для введения гуманизированной молекулы, специфически связывающейся с CD37, или комбинации молекулы, специфически связывающейся с CD37, и бифункционального химиотерапевтического средства человеку или тестовым животным, предпочтительно формулировать связывающуюся молекулу или комбинацию в композицию, содержащую один или несколько фармацевтически приемлемых носителей. Фраза "фармацевтически или фармакологически приемлемый" относится к молекулам и композициям, которые не вызывают аллергических или других неблагоприятных реакций при введении с использованием маршрутов, хорошо известных в данной области, как описано ниже. "Фармацевтически приемлемые носители" включают любые или все используемые в клинике растворители, диспергенты, покрытия, противомикробные и противогрибковые средства, изотонические и задерживающие всасывание средства и т.п. Кроме того, соединения могут образовывать сольваты с водой или обычными органическими растворителями. Такие сольваты также предусмотрены.

Фармацевтические композиции по настоящему описанию, содержащие гуманизированную молекулу, специфически связывающуюся с CD37, или комбинацию молекулы, специфически связывающейся с CD37, и бифункционального химиотерапевтического средства, и используемые в способе по настоящему описанию, могут содержать фармацевтически приемлемые носители или добавки в зависимости от пути введения. Примеры таких носителей или добавок включают воду, фармацевтически приемлемый органический растворитель, коллаген, поливиниловый спирт, поливинилпирролидон, карбоксивиниловый полимер, карбоксиметилцеллюлозу натрия, полиакрилат натрия, альгинат натрия, водорастворимый декстран, карбоксиметилкрахмал натрия, пектин, метилцеллюлозу, этилцеллюлозу, ксантановую камедь, аравийскую камедь, казеин, желатин, агар, диглицерин, глицерин, пропиленгликоль, полиэтиленгликоль, вазелин, парафин, стеариловый спирт, стеариновую кислоту, сывороточный альбумин человека (САЧ), маннит, сорбит, лактозу, фармацевтически приемлемое поверхностно-активное вещество и т.п. Применяемые добавки выбраны, но без ограничения, из указанных выше веществ или их сочетаний, как необходимо, в зависимости от лекарственной формы по настоящему описанию.

Состав фармацевтической композиции меняется в соответствии с выбранным способом введения (например, раствор, эмульсия). Соответствующую композицию, содержащую антитело для введения можно получать в физиологически приемлемом наполнителе или носителе. Для растворов или эмульсий подходящие носители включают, например, водные или водно-спиртовые растворы, эмульсии или суспензии, включая физиологический раствор и буферные среды. Парентеральные носители могут включать раствор хлорида натрия, декстрозу Рингера, декстрозу и хлорид натрия, лактат Рингера или нелетучие масла. Внутривенные носители могут включать различные вспомогательные вещества, консерванты или жидкости, питательные вещества или компенсаторы электролитов.

Множество водных носителей, например, вода, забуференная вода, 0,4% раствор хлорида натрия, 0,3% глицин или водные суспензии, могут содержать активное соединение с добавлением эксципиентов, пригодных для производства водных суспензий. Такие эксципиенты представляют собой суспендирующие средства, например, карбоксиметилцеллюлозу натрия, метилцеллюлозу, гидроксипропилметилцеллюлозу, альгинат натрия, поливинилпирролидон, трагакантовую камедь и гуммиарабик; диспергирующие средства или увлажнители могут представлять собой встречающийся в природе фосфатид, например лецитин, или продукты конденсации алкиленоксида с жирными кислотами, например, полиоксиэтиленстеарат, или продукты конденсации этиленоксида с алифатическими длинноцепочечными спиртами, например, гептадекаэтиленоксицетанолом, или продукты конденсации этиленоксида с неполными сложными эфирами, полученными из жирных кислот и гексита, такими как полиоксиэтиленсорбитмоноолеат, или продукты конденсации этиленоксида с неполными сложными эфирами, полученными из жирных кислот и ангидридов гекситов, например, полиэтиленсорбитанмоноолеат. Водные суспензии также могут содержать один или несколько консервантов, например этил, или н-пропил, п-гидроксибензоат.

Молекулу, специфически связывающуюся с CD37, комбинацию молекулы, специфически связывающейся с CD37, с бифункциональным химиотерапевтическим средством или композицию, содержащую связывающую молекулу или сочетание, можно лиофилизировать для хранения и восстановления в подходящем носителе перед использованием. Показано, что этот способ эффективен в отношении стандартных иммуноглобулинов. Можно использовать любые подходящие способы лиофилизации и восстановления. Специалистам в данной области понятно, что лиофилизация и восстановление могут приводить к потере активности в различной степени и что, возможно, для компенсации следует отрегулировать используемые дозы.

Диспергируемые порошки и гранулы, пригодные для получения водной суспензии путем добавления воды, обеспечивают активное соединение в смеси с диспергирующим средством или увлажнителем, суспендирующим средством и одним или несколькими консервантами. Примерами подходящих диспергирующих средств или увлажнителей и суспендирующих средств могут служить средства, уже указанные выше.

Концентрация молекул, специфически связывающихся с CD37, или бифункционального химиотерапевтического средства в этих составах может варьировать в очень широком диапазоне, например, от менее чем приблизительно 0,5%, как правило, от или, по меньшей мере, приблизительно от 1% до 15 или 20% по массе и ее выбирают, в основном, на основе объема жидкости, вязкости и т.д., в соответствии с конкретным выбранным способом введения. Таким образом, типичную фармацевтическую композицию для парентерального введения можно составлять так, чтобы она содержала 1 мл стерильной забуференной воды и 50 мг антитела. Типичную композицию для внутривенного введения можно составлять так, чтобы она содержала до 250 мл стерильного раствора Рингера и 150 мг антитела. Конкретные способы получения композиций для парентерального введения известны или очевидны специалистам в данной области и более подробно описаны, например, в Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980). Эффективная доза молекул, специфически связывающихся с CD37 (включая гуманизированные молекулы, специфически связывающиеся с CD37), находится в диапазоне от 0,01 мг до 1000 мг на кг массы тела на одно введение.

Фармацевтические композиции могут находиться в форме стерильного водного раствора для инъекций, масляной суспензии, дисперсий или стерильных порошков для немедленного получения стерильных растворов для инъекций или дисперсий. Суспензию можно формулировать в соответствии с известным уровнем техники, с использованием таких пригодных диспергирующих средств или увлажнителей и суспендирующих средств, которые указаны выше. Стерильный инъецируемый препарат также может представлять собой стерильные инъецируемые раствор или суспензию в нетоксичных приемлемым для парентерального применения разбавителе и растворителе, например, в виде раствора в 1,3-бутандиоле. Носитель может представлять собой растворитель или диспергирующую среду, содержащую, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и т.п.), их подходящие смеси, растительные масла, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды традиционно используют стерильные нелетучие масла. С этой целью можно использовать любое легкое нелетучее масло, включая синтетические моно- или диглицериды. Кроме того, в получении средств для инъекций находят применение жирные кислоты, такие как олеиновая кислота.

Во всех случаях форма должна быть стерильной и должна быть жидкой до такой степени, чтобы ее легко вводить через шприц. Надлежащую текучесть можно поддерживать, например, посредством использования покрытия, такого как лецитин, посредством поддержания необходимого размера частиц в случае дисперсии и посредством использования поверхностно-активных веществ. Она должна быть стабильной в условиях производства и хранения и ее следует предохранять от загрязняющего действия микроорганизмов, таких как бактерии и грибы. Предотвращение деятельности микроорганизмов можно осуществлять с помощью различных противомикробных или противогрибковых средств, например, парабенов, хлорбутанола, фенола, сорбиновой кислоты, тимеросала и т.п. Во многих случаях желательно включать обеспечивающие изотоничность средства, например, сахара или хлорид натрия. Пролонгированное всасывание композиций для инъекции можно осуществить посредством использования в композициях средств, задерживающих всасывание, например, моностеарата алюминия и желатина.

Композиции, пригодные для введения, для увеличения их эффективности можно формулировать с использованием усилителей захвата или всасывания. Такие усилители включают, например, салицилат, гликохолат/линолеат, гликохолат, апротинин, бацитрацин, SDS, капрат и т.п. См., например, Fix (J. Pharm. Sci., 85:1282-1285, 1996) и Oliyai and Stella (Ann. Rev. Pharmacol. Toxicol., 32:521-544, 1993).

Кроме того, гидрофильные и гидрофобные свойства композиций, предлагаемых для использования по настоящему описанию, хорошо сбалансированы, таким образом увеличивая их применимость in vitro и особенно in vivo, тогда как другие композиции, не обладающие таким балансом, по существу являются менее применимыми. В частности, композиции, предлагаемые для использования по настоящему описанию, обладают соответствующей степенью растворимости в водных средах, что обеспечивает всасывание и биодоступность в организме, при этом также обладая определенной степенью растворимости в липидах, которая позволяет этим соединениям проходить через клеточную мембрану к предполагаемому месту действия. Таким образом, предлагаемые композиции антител максимально эффективны, когда их можно доставлять к месту активности антигена-мишени.

В одном из аспектов, способы по настоящему описанию включают этап введения композиции с молекулой, специфически связывающейся с CD37. В определенных вариантах осуществления комбинации соединений можно вводить одновременно, совместно в одном фармацевтически приемлемом носителе или раздельно (но одновременно). В других вариантах осуществления иммунотерапевтическое средство к CD37 (т.е., молекулу, специфически связывающуюся с CD37,) и бифункциональное химиотерапевтическое средство можно вводить последовательно в любом порядке и в любой комбинации.

Связывающая молекула, бифункциональное химиотерапевтическое средство или комбинированные композиции можно вводить перорально, топически, трансдермально, парентерально, посредством ингалируемого спрея, вагинально, ректально или посредством интракраниальной инъекции или посредством любого сочетания этих путей. В одном из вариантов осуществления молекулу, специфически связывающуюся с CD37, и бифункциональное химиотерапевтическое средство вводят парентерально, одновременно или последовательно. Как применяют в настоящем документе, термин парентеральный, включает подкожные инъекции, внутривенные, внутримышечные, интрацистернальные способы инъекции или вливания. Также предусмотрено введение посредством внутривенной, внутрикожной, внутримышечной, интрастернальной, интраперитонеальной, интратекальной, ретробульбарной, внутрилегочной инъекции и/или хирургической имплантации в конкретном участке. Как правило, композиции по существу не содержат пирогены, а также другие примеси, которые могут быть опасны для реципиента. Предпочтительной является инъекция, в особенности, внутривенная.

В одном из вариантов осуществления введение осуществляют в участке злокачественной опухоли или пораженной ткани, нуждающейся в лечении посредством прямого введения в этот участок или посредством механизма пролонгированной доставки или замедленного высвобождения, который позволяет доставлять состав внутрь организма. Например, в составы по настоящему описанию, имплантируемые рядом с участком злокачественной опухоли, можно включать биоразлагаемые микросферы или капсулы или биоразлагаемые полимерные конфигурации с пролонгированной доставкой композиции (например, растворимого полипептида, антитела или низкомолекулярного соединения).

Терапевтические композиции также можно доставлять пациенту в несколько участков. Можно проводить несколько введений одновременно или через определенный период времени. В определенных случаях полезно обеспечивать непрерывный поток терапевтической композиции. Периодически можно вводить дополнительное лекарственное средство, например, ежечасно, ежедневно, еженедельно или ежемесячно.

Связывающая молекула, бифункциональное химиотерапевтическое средство или комбинированные композиции по настоящему описанию могут содержать одну или несколько связывающих молекул, бифункциональных химиотерапевтических средств или любое их сочетание. Также по настоящему описанию предусмотрено введение связывающей молекулы, бифункционального химиотерапевтического средства или комбинированных композиций в сочетании с дополнительным терапевтическим средством. Дополнительные терапевтические средства, предусмотренные по настоящему описанию, перечислены в приведенных ниже разделах.

Дополнительное терапевтическое средство может представлять собой молекулу, связанную с B-клетками. Другие молекулы, связанные с B-клетками, рассматриваемые в настоящем описании, включают связывающие молекулы, которые связываются с молекулами на поверхности B-клеток, которые не являются CD37. Молекулы, связанные с B-клетками, включают CD19 (антиген B-лимфоцитов CD19, также обозначаемый как поверхностный антиген B4 B-лимфоцитов или Leu-12), CD20, CD21, CD22 (рецептор B-клеток CD22, также обозначаемый как Leu-14, молекула клеточной адгезии B-лимфоцитов или BL-CAM), CD23, CD40 (поверхностный антиген B-клеток CD40, также обозначаемый как представитель 5 суперсемейства рецепторов фактора некроза опухоли, рецептор CD40L или Bp50), CD80 (антиген активации T-лимфоцитов CD80, также обозначаемый как антиген активации B7-1, B7, B7-1 или BB1), CD86 (антиген активации T-лимфоцитов CD86, также обозначаемый как антиген активации B7-2, B70, FUN-1 или BU63), CD137 (также обозначаемый как представитель 9 суперсемейства рецепторов фактора некроза опухоли), CD152 (также обозначаемый как белок цитотоксических T-лимфоцитов 4 или CTLA-4), L6 (связанный с опухолями антиген L6, также обозначаемый как представитель 1 суперсемейства трансмембранных белков 4, поверхностный маркер мембранного компонента 1, или M3S1), CD30 (антиген активации лимфоцитов CD30, также обозначаемый как представитель 8 суперсемейства рецепторов фактора некроза опухоли, рецептор CD30L или Ki-1), CD50 (также обозначаемый как фактор межклеточной адгезии 3 (ICAM3) или ICAM-R), CD54 (также обозначаемый как фактор межклеточной адгезии 1 (ICAM1) или основной рецептор группы ретровирусов), B7-H1 (лиганд иммуноингибирующего рецептора, экспрессируемого активированными T-клетками, B-клетками и миелоидными клетками, также обозначаемый как PD-L1; см. Dong, et al., "B7-H1, a third member of the B7 family, co-stimulates T-cell proliferation and interleukin-10 secretion", Nat. Med., 5:1365-1369 (1999), CD134 (также обозначаемый как представитель 4 суперсемейства рецепторов фактора некроза опухоли, OX40, рецептор OX40L, антиген ACT35 или рецептор транскрипционно активированного TAX гликопротеина 1), 41BB (рецептор лиганда 4-1BB, T-клеточный антиген 4-1 BB или T-клеточный антиген ILA), CD153 (также обозначаемый как представитель 8 суперсемейства лигандов фактора некроза опухоли, лиганд CD30 или CD30-L), CD154 (также обозначаемый как представитель 5 суперсемейства лигандов фактора некроза опухоли, родственный TNF активационный белок, TRAP, или T-клеточный антиген Gp39), рецепторы Toll и т.п.

Примеры химиотерапевтических средств, предусмотренных в качестве дополнительных терапевтических средств, включают алкилирующие средства, такие как азотистые иприты (например, мехлоретамин, циклофосфамид, ифосфамид, мелфалан и хлорамбуцил); нитрозомочевины (например, кармустин (BCNU), ломустин (CCNU) и семустин (метил-CCNU)); этиленимины и метилмеламины (например, триэтиленмеламин (TEM), триэтилентиофосфорамид (тиотепа), и гексаметилмеламин (HMM, алтретамин)); алкилсульфонаты (например, бусулфан); и триазины (например, дакарбазин (DTIC)); антиметаболиты, такие как аналоги фолиевой кислоты (например, метотрексат, триметрексат и пеметрексед (мультитаргетный антифолат)); аналоги пиримидинов (такие как 5-фторурацил (5-FU), фтордезоксиуридин, гемцитабин, арабинозид цитозина (AraC, цитарабин), 5-азацитидин, и 2,2'-дифтордезоксицитидин); и аналоги пуринов (например, 6-меркаптопурин, 6-тиогуанин, азатиоприн, 2'-дезоксикоформицин (пентостатин), эритрогидроксинониладенин (EHNA), фосфат флударабина, 2-хлордезоксиаденозин (кладрибин, 2-CdA)); ингибиторы топоизомеразы I типа, такие как камптотецин (CPT), топотекан и иринотекан; природные продукты, такие как эпиподофилотоксины (например, этопозид и тенипозид); и алкалоиды барвинка (например, винбластин, винкристин и винорельбин); противоопухолевые антибиотики, такие как актиномицин D, доксорубицин и блеомицин; радиосенсибилизирующие средства, такие как 5-бромдезоксиуридин, 5-йоддезоксиуридин и бромдезоксицитидин; координационные комплексы платины, такие как цисплатин, карбоплатин и оксалиплатин; замещенные производные мочевины, такие как гидроксимочевина; и производные метилгидразина, такие как N-метилгидразин (MIH) и прокарбазин.

Дополнительные терапевтические средства, предусмотренные по настоящему описанию для лечения аутоиммунных заболеваний, обозначают как иммунодепрессанты, которые подавляют или маскируют иммунную систему индивидуума, проходящего лечения. Иммунодепрессанты включают, например, нестероидные противовоспалительные лекарственные средства (НПВС), анальгетики, глюкокортикоиды, модифицирующие заболевание противоревматические лекарственные средства (DMARD) для лечения артрита или модификаторы биологического ответа. Композиции в описании DMARD также пригодны для лечения многих других аутоиммунных заболеваний кроме РА.

Иллюстративные НПВС выбраны из группы, состоящей из ибупрофена, напроксена, напроксена натрия, ингибиторов ЦОГ-2, таких как виокс и целебрекс и сиалилаты. Иллюстративные анальгетики выбраны из группы, состоящей из ацетаминофена, оксикодона, трамадола или пропоксифен гидрохлорида. Иллюстративные глюкокортикоиды выбраны из группы, состоящей из кортизона, дексаметазона, гидрокортизона, метилпреднизолона, преднизолона или преднизона. Иллюстративные модификаторы биологического ответа включают молекулы, направленные против поверхностных клеточных маркеров (например, CD4, CD5 и т.д.), ингибиторы цитокинов, такие как антагонисты TNF (например, этанерцепт (энбрел, Enbrel), адалимумаб (гумира, Humira) и инфликсимаб (ремикейд, Remicade)), ингибиторы хемокинов и ингибиторы молекул адгезии. Модификаторы биологического ответа включают моноклональные антитела, а также рекомбинантные формы молекул. Иллюстративные DMARD включают азатиоприн, циклофосфамид, циклоспорин, метотрексат, пеницилламин, лефлуномид, сульфасалазин, гидроксихлорохин, золото (пероральная форма (ауранофин) и внутремышечная форма) и миноциклин.

Полагают, что композицию связывающей молекулы и дополнительного терапевтического средства можно вводить одновременно в одном составе. Альтернативно эти средства вводят в раздельных составах, но одновременно, при этом "одновременно" относится к средствам, вводимым, например, в пределах минут, часов или суток друг относительно друга.

В другом аспекте дополнительное терапевтическое средство вводят перед введением связывающей молекулы, бифункционального химиотерапевтического средства или комбинированной композиции. "Перед введением" относится к введению дополнительного терапевтического средства в диапазоне нескольких минут, часов или одной недели перед лечением с использованием связывающей молекулы, бифункционального химиотерапевтического средства или комбинированной композиции. Дополнительно предусмотрено, что дополнительное терапевтическое средство вводят после введения композиции связывающей молекулы. "Последовательное введение" предназначено для описания введения через промежуток более чем несколько минут, часов или недель после лечения или введения связывающей молекулы, бифункционального химиотерапевтического средства или комбинированной композиции.

Дополнительно предусмотрено, что при введении связывающей молекулы в сочетании с дополнительным терапевтическим средством, где дополнительное терапевтическое средство представляет собой цитокин или фактор роста или химиотерапевтическое средство, введение также может включать использование радиотерапевтического средства или лучевой терапии. Лучевую терапию, проводимую в сочетании с композицией антитела, проводят в соответствии с указаниями лечащего врача и в дозах, обычно назначаемых пациентам, проходящим лечение злокачественной опухоли.

Эти композиции можно вводить однократной дозой или несколькими дозами. В стандартных исследованиях дозы-эффекта, сначала в моделях на животных, а затем при клиническом тестировании, выявили оптимальные дозы для конкретных патологических состояний и групп пациентов.

Введение связывающей молекулы, бифункционального химиотерапевтического средства или комбинированной композиции уменьшает популяцию B-клеток после лечения однократной дозой, по меньшей мере, на 20%. В одном из вариантов осуществления популяция B-клеток уменьшалась, по меньшей мере, приблизительно на 20, приблизительно на 30, приблизительно на 40, приблизительно на 50, приблизительно на 60, приблизительно на 70, приблизительно на 80, приблизительно на 90 или приблизительно на 100%. Уменьшение количества B-клеток определяют как уменьшение абсолютного количества B-клеток ниже нижнего предела нормального диапазона. Восстановление B-клеток определяют как возвращение абсолютного количества B-клеток, например, до 70%, 80%, 90% от исходного значения у индивида или нормального диапазона. Кроме того, введение связывающей молекулы, бифункционального химиотерапевтического средства или комбинированной композиции по настоящему описанию, приводит к желаемым клиническим эффектам при заболевании или нарушении, подлежащих лечению.

В определенных вариантах осуществления пациенты, страдающие заболеванием, связанным с аномальной активностью B-клеток, проходившие лечение по настоящему описанию, могут демонстрировать общий благоприятный ответ на лечение на основе клинических критериев, хорошо известных и широко применяемых в данной области, как описано ниже.

Например, у пациентов, страдающих ревматоидным артритом, введение может улучшить состояние пациента посредством клинически значимого количества [например, "American College of Rheumatology Preliminary Detection of Improvement" (ACR20)] и/или 20% улучшения в болезненных и опухших суставах и 20% улучшения в 3/5 оставшихся критериев ACR (Felson et al., Arthritis Rheum. 1995, 38:727-35). Биологические критерии улучшения у пациентов с РА после введения молекул, специфически связывающихся с CD37 и специфически связывающихся с CD20, включают измерение изменений уровней цитокинов, измеряемых по уровням белка или РНК. Представляющие интерес цитокины включают в качестве неограничивающих примеров, TNF-α, IL-1, интерфероны, Blys и APRIL. Изменения уровней цитокинов могут происходить вследствие снижения количества B-клеток или снижения активированных T-клеток. У пациентов с РА маркеры, относящиеся к метаболизму в костях (резорбция кости или эрозия), измеряют до и после введения CD20-специфически связывающихся молекул. Соответствующие маркеры включают в качестве неограничивающих примеров щелочную фосфатазу, остеокальцин, фрагменты разрушенного коллагена, гидроксипролин, устойчивую к тартратам кислую фосфатазу и лиганд RANK (RANKL). Другие критерии, относящиеся к улучшению РА, включают измерение уровней C-реактивного белка (CRP), скорости оседания эритроцитов (СОЭ), ревматоидного фактора, антител к ЦЦП (циклический цитрулинированный пептид) и оценку системных уровней B-клеток и количества лимфоцитов посредством проточной цитометрии. Также на основании биопсии синовиальной оболочки можно измерить специфические факторы в синовиальной оболочке пациентов с РА, включая оценку уровней B-клеток в синовиальной оболочке, уровней RANKL и других факторов и цитокинов кости, которые описаны выше.

В соответствующем аспекте можно измерить действие комбинированного введения на другие заболевания в соответствии со стандартами, известными в данной области. Например, полагают, что пациенты с болезнью Крона, получавшие лечение по изобретению, достигали улучшения индекса активности при болезни Крона (CDAI) в диапазоне приблизительно от 50 приблизительно до 70 единиц, где ремиссии соответствует 150 единиц (Simonis et al, Scand. J Gastroent. 1998, 33:283-8). Оценка 150 или 200 рассматривается как нормальная, тогда как оценка 450 рассматривается как оценка, соответствующая тяжелой болезни. Кроме того, желательно, чтобы у индивидуумов, пораженных воспалительным заболеванием кишечника введение молекул, специфически связывающихся с CD37 и специфически связывающихся с CD20, приводило к снижению перинуклеарных антинейтрофильных антител (pANCA) и антител против Saccharomyces cervisiae (ASCA).

Кроме того, полагают, что у пациентов с ювенильным миозитом и миозитом взрослых, проходивших лечение по настоящему описанию, можно достигать улучшения оценок из базового набора, например, 3 из 6 оценок базового набора, улучшенных приблизительно на 20% при ухудшении не более чем 2 базовых оценок приблизительно на 25% (см. Rider et al., Arthritis Rheum. 2004, 50:2281-90).

Кроме того, полагают, что у пациентов с СКВ, проходивших лечение по настоящему описанию, можно достигать улучшения оценки критерия активности при системной волчанке (SLAM) или индекса активности при заболевании СКВ (SLEDAI), по меньшей мере, на 1 единицу (Gladman et al, J Rheumatol 1994, 21:1468-71) (Tan et al., Arthritis Rheum. 1982, 25:1271-7). Оценка SLAM ниже 5 или оценка SLEDAI ниже 2 считается соответствующей клинически активному заболеванию. Ответ на лечение можно определять как улучшение или стабилизация по 2 критериям активности заболевания (индекс активности при заболевании СКВ [SLEDAI] и критерий активности при системной волчанке) и 2 критериям качества жизни (общее обследование пациента и шкала тяжести утомляемости Круппа) (Petri et al., Arthritis Rheum. 2004, 50:2858-68.) Кроме того, полагают, что введение связывающей молекулы пациентам с СКВ приводит к уменьшению количества антител к двухцепочечной ДНК. Альтернативно, улучшение можно измерять с использованием группы критериев оценки волчанки Британских островов (BILAG).

Кроме того, полагают, что у пациентов с рассеянным склерозом, проходивших лечение по настоящему описанию, можно достичь улучшения клинической оценки по расширенной шкале недееспособности Куртцке (EDSS) (Kurtzke, F., Neurology 1983, 33:1444-52) по меньшей мере на 0,5, или задержки ухудшения клинического состояния по меньшей мере на 1,0 по шкале Куртцке (Rudick et al., Neurology 1997, 49:358-63).

Кроме того, предполагается, что у пациентов, страдающих от ИВМ, которые проходили лечение по настоящему описанию, можно достигать снижения по меньшей мере по одному из пяти критериев, установленных при оценке критериев идиопатической воспалительной миопатии (IIMC) (Miller, F., выше). Кроме того, полагают, что введение пациентам с ИВМ может приводить к снижению факторов, связанных с ИВМ, которые выбраны из группы, состоящей из креатинкиназы (КК), лактатдегидрогеназы, альдолазы, C-реактивного белка, аспартатаминотрансферазы (АСТ), аланинаминотрансферазы (АЛТ) и антинуклеарных аутоантител (АНА), специфических для миозита антител (МСА) и антител к экстрагируемым ядерным антигенам. Альтернативно, пациенты соответствуют трем из шести критериев, приведенных в Rider et al., Arthritis Rheum., 50(7):2281-2290 (2004), при ухудшении не более чем двух критериев.

В определенных вариантах осуществления пациенты, страдающие B-клеточной злокачественной опухолью, проходящие лечение по настоящему описанию, могут демонстрировать общий благоприятный ответ на лечение на основании хорошо известных и часто используемых в данной области клинических критериев, например, уменьшение размера опухоли, уменьшение числа опухолей и/или улучшение симптомов заболевания, как описано ниже.

Иллюстративные клинические критерии предоставлены National Cancer Institute (NCI) США, в которых некоторые классы злокачественных опухолей разделены на клинические категории "медленно растущих" и "агрессивных" лимфом. Медленно растущие лимфомы включают лимфомы из фолликулярных клеток, подразделенные по цитологическим "степеням", диффузную мелкоклеточную лимфому/хронический лимфолейкоз (ХЛЛ), лимфоплазмацитоидную/макроглобулинемию Вальденстрема, лимфому маргинальной зоны и волосатоклеточный лейкоз. Агрессивные лимфомы включают диффузные смешанные и крупноклеточные лимфомы, лимфому Беркитта/диффузную мелкоклеточную лимфому с нерасщепленным ядром, лимфобластную лимфому, лимфому из клеток мантийной зоны и связанную со СПИД лимфому. В некоторых случаях, в случаях агрессивной и фолликулярной лимфомы, используют международный прогностический индекс (IPI). Факторы, учитываемые в IPI, включают возраст (возраст <60 лет в сопоставлении с возрастом >60 лет), лактатдегидрогеназу сыворотки (нормальные уровни в сопоставлении с повышенными уровнями), общее состояние (0 или 1 в сопоставлении с 2-4) (определение см. ниже), стадию заболевания (I или II в сопоставлении с III или IV) и вовлечение экстранодальной локализации (0 или 1 в сопоставлении с 2-4). Пациенты с 2 или более факторами риска имеют шанс на отсутствие рецидивов и общую выживаемость в течение 5 лет менее 50%.

Общее состояние при агрессивном IPI определяют следующим образом: описание степени: 0 - полная активность, способность без ограничений выполнять все те же действия, что и до заболевания; 1 - ограничение тяжелой физической активности, но амбулаторные и способные выполнять легкую или сидячую работу, например, легкую работу по дому, работу в офисе; 2 - амбулаторные и способные ухаживать за собой, но отсутствие способности выполнять любую работу до и приблизительно более 50% времени бодрствования; 3 - способность ограниченного ухода за собой, нахождение в положении лежа или сидя более 50% времени бодрствования; 4 - полная потеря трудоспособности, неспособность выполнять какой-либо уход за собой, полная прикованность к кровати или стулу; и 5 - смерть. (см. The International Non-Hodgkin's Lymphoma Prognostic Factors Project. A predictive model for aggressive non-Hodgkin's lymphoma. N. Engl. J. Med. 329:987-94, 1993).

Как правило, степень лимфомы клинически оценивают с использованием такого критерия, согласно которому высокодифференцированная лимфома, как правило, присутствует в виде нодального заболевания и часто медленно или слабо растет. Заболевание со средней и низкой степенью дифференцировки обычно присутствует в виде значительно более агрессивного заболевания с большими объемными экстранодальными опухолями.

Для измерения прогрессирования опухолей, в частности, неходжкинских лимфом, также используют систему классификации Ann Arbor. В этой системе стадии I, II, III и IV зрелой НХЛ можно разделить на категории A и B, в зависимости от того, наблюдались ли у пациента четко выраженные генерализованные симптомы (B) или не (A). Обозначение B дается пациентам со следующими симптомами: необъяснимая потеря более чем 10% массы тела за 6 месяцев до диагностики, необъяснимая лихорадка с температурой выше 38°C и обильное ночное потоотделение. Стадии имеют следующие определения: стадия I - вовлечение области одного лимфатического узла или локализованное вовлечение одного экстралимфатического органа или участка. Стадия II - вовлечение областей двух или более лимфатических узлов на одной стороне диафрагмы или локализованное вовлечение одного связанного экстралимфатического органа или участка и его регионарных лимфатических узлов с другими областями лимфатических узлов на той же стороне диафрагмы или без них. Стадия III - вовлечение областей лимфатических узлов на обеих сторонах диафрагмы, возможно сопровождающееся локализованным вовлечением экстралимфатического органа или участка, вовлечение селезенки или обоих. Стадия IV - диссемеринованное (многоочаговое) вовлечение одного или нескольких экстралимфатических участков с вовлечением связанного лимфатического узла или без него или вовлечение выделенного экстралимфатического органа с вовлечением удаленных (нерегионарных) узлов. Более подробно см. The International Non-Hodgkin's Lymphoma Prognostic Factors Project: A predictive model for aggressive non-Hodgkin's lymphoma, New England J. Med. (1993) 329:987-994.

В одном из аспектов, терапевтический эффект способа по настоящему описанию определяют по уровню ответа, например, частичный ответ определяется как уменьшение опухоли менее чем на половину от ее исходного размера. Полный ответ определяется как полное устранение заболевания, подтвержденное клиническим или радиологическим исследованиями. В одном из вариантов осуществления индивидуум, проходящий лечение по изобретению, демонстрирует по меньшей мере частичный ответ на лечение.

Согласно критериям Чейсона для оценки НХЛ, которые разработаны совместно с National Cancer Institute (Cheson et al., J Clin Oncol. 1999, 17:1244; Grillo-Lopez et al., Ann Oncol. 2000, 11:399-408), полный ответ достигается при полном исчезновении детектируемых клинических и радиографических признаков заболевания и связанных с заболеванием симптомов, возвращении всех лимфатических узлов к нормальному размеру, уменьшении размера селезенки и очищении костного мозга от лимфомы.

Неподтвержденный полный ответ достигается, когда пациент демонстрирует полное исчезновение заболевания и селезенка уменьшается в размерах, а лимфатические узлы уменьшаются более чем на 75%, а костный мозг находится в неопределенном состоянии. Неподтвержденный полный ответ отвечает критериям частичного ответа и превосходит их. Общий ответ определяется как снижение общей опухолевой нагрузки по меньшей мере на 50 процентов.

Для различных других форм злокачественных опухолей или гиперпролиферативных заболеваний были разработаны подобные критерии, которые легко доступны профессионалу в данной области. См., например, Cheson et al., Clin Adv Hematol Oncol. 2006, 4:4-5, в которой описаны критерии оценки ХЛЛ; Cheson et al., J Clin Oncol. 2003, 21:4642-9, в которой описаны критерии для AML; Cheson et al., Blood 2000, 96:3671-4, в которой описаны критерии для миелодиспластических синдромов.

В другом аспекте терапевтический ответ пациента с B-клеточной злокачественной опухолью проявляется в виде замедления развития заболевания по сравнению с пациентами, которые не проходят лечение. Измерение замедленного развития заболевания или любого из указанных выше факторов можно осуществить с использованием способов, которые хорошо известны в данной области, включая сканирование костной ткани, КТ-сканирование, сканирование с галлием, лимфангиограмму, ЯМР-томографию, ПЭТ-сканирование, ультразвук и т.п.

В качестве дополнительного аспекта, настоящее описание включает наборы, которые содержат одно или несколько соединений или композиций, пригодных в способах по настоящему описанию, упакованных таким образом, который облегчает их использование для практического осуществления способов по настоящему описанию. В простейшем варианте осуществления такой набор содержит соединение или композицию, описываемую в настоящем документе в качестве используемой для практического осуществления способа по настоящему описанию, которая упакована в контейнер, такой как герметичная бутылка или флакон, с этикеткой, прикрепленной к контейнеру или вложенной в упаковку, в которой описано использование соединения или композиции для практического осуществления способа по настоящему описанию. Предпочтительно соединение или композиция упакована в стандартной лекарственной форме. Набор может дополнительно содержать устройство, которое можно использовать для введения композиции в соответствии с предпочтительным путем введения или для практического осуществления скринингового исследования. Набор может содержать этикетку, в которой описано использование композиции связывающей молекулы (молекул) в способе по настоящему описанию.

ПРИМЕРЫ

ПРИМЕР 1

МОЛЕКУЛЫ, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩИЕСЯ С CD37

Различные белки, специфически связывающиеся с CD37, можно получать с использованием иллюстративных компонентов, предоставленных в таблицах 2-4. Например, можно получить антитела или молекулы SMIP, и эти молекулы могут быть химерными, гуманизированными или принадлежащими человеку. Более конкретно, предпочтительные CDR вариабельной области легкой цепи представлены в SEQ ID NO:236-240 и 247-254, а предпочтительные CDR вариабельной области тяжелой цепи включают SEQ ID NO:241-245 и 247-254. Кроме того, предпочтительные вариабельные области легкой и тяжелой цепей указаны в SEQ ID NO:236-240 и SEQ ID NO:241-245, соответственно. Предпочтительные вариабельные области легкой и тяжелой цепей также представлены в SEQ ID NO:247-254. Предпочтительные линкеры вариабельного домена включают SEQ ID NO:225-229, а предпочтительные шарнирные области включают SEQ ID NO:230-235.

Особенно предпочтительным вариантом осуществления является CAS-024 [G28-1 VH (M99F, Y102S) - VL (T25A) scFv (SSC-P) H WCH2 WCH3], который представляет собой рекомбинантный одноцепочечный слитый белок из 483 аминокислот, который связывается с CD37 человека. Связывающий домен содержит гуманизированный scFv, основанный на CDR вариабельной области антитела G28-1, включая мутации в CDR3 тяжелой цепи и в CDR1 легкой цепи. Вариабельные домены соединены с последовательностью (G4S)5 (25 аминокислот) (SEQ ID NO:229), которая соединена через участок соединения из трех аминокислот (GDQ) с N-концом модифицированной верхней и центральной шарнирной области IgG1 (где первые два цистеина из трех, найденных в этих шарнирных областях, заменены на серин). C-конец шарнирной области слит с эффекторным доменом, содержащим домены CH2 и CH3 из IgG1. Аминокислотная последовательность CAS-024 приведена в SEQ ID NO:253. На фиг. 1 представлены выравнивания аминокислотных последовательностей вариабельных областей тяжелой и легкой цепи из последовательностей G28.1 мыши и CAS-024, вместе с консенсусной последовательностью.

Таблица 1
Иллюстративные конструкции SMIP, специфичные к CD37
Конструкция Описание† Линкер Шарнирная область* SEQ ID NO: аминокислотной последовательности
CAS-001 Vk3:VH5-51 16 а.к.
(G4S)2(G4T)G
SSC-P 6
CAS-002 Vk3:VH5 JH4 CDRL1 (T25A); CDRH3 (M99F) 16 а.к.
(G4S)2(G4T)G
SSC-P 48
CAS-003 Vk3:VH5 JH5a CDRL1 (T25A); CDRH3 (M99F; Y102S) 16 а.к.
(G4S)2(G4T)G
SSC-P 52
CAS-007 Vk3:VH5-51 (Линкер TG→SS) 16 а.к.
(G4S)3S
SSC-P 8
CAS-008 Vk3:VH5-51 VH V11S 16 a.к.
(G4S)2(G4T)G
SSC-P 10
CAS-009 Vk3:VH5-51 CDRL1 (E27Q) 16 а.к.
(G4S)2(G4T)G
SSC-P 12
CAS-010 Vk3:VH5-51 CDRL1 (N28S) 16 a.к.
(G4S)2(G4T)G
SSC-P 14
CAS-011 Vk3:VH5-51 CDRL1 (T25A) 16 a.к.
(G4S)2(G4T)G
SSC-P 16
CAS-012 mVk:VH5-5a 16 a.к.
(G4S)2(G4A)S
SSC-P 18
CAS-013 Vk3:VH5 VH3 FW1 16 a.к.
(G4S)2(G4A)S
SSC-P 22
CAS-014 mVH:Vk3 22 a.к.
(G4S)4AS
SSC-P 24
CAS-015 Vk3:mVH (Лидерная последовательность 2H7) 16 a.к.
(G4S)2(G4A)S
SSC-P 26
CAS-016 mVH:Vk3 22aa
(G4S)4AS
SCC-P 28
CAS-017 Vk3:mVH 16 a.к.
(G4S)2(G4A)S
SSC-P 30
CAS-018 Vk3:mVH 16 a.к.
(G4S)2(G4A)S
SCC-P 32
CAS-019 Vk3:VH5 VH3 FW1 16 a.к.
(G4S)2(G4A)S
SCC-P 34
CAS-020 Vk3:VH5 VH3-13 FW1 16 a.к.
(G4S)2(G4A)S
SSC-P 38
CAS-021 Vk3:VH5 VH3-13 FW1 16 a.к.
(G4S)2(G4A)S
SCC-P 40
CAS-022 Vk3:VH5 VH3-13 V11S FW1 16 a.к.
(G4S)2(G4A)S
SSC-P 42
CAS-023 Vk3:VH5 VH3-13 V11S FW1 16 a.к.
(G4S)2(G4A)S
SCC-P 44
CAS-024 VHVL 25 a.к.
(G4S)5
SSC-P 253
CAS-060 Vk3:VH5 VH3 FW1 16 a.к.
(G4S)2(G4A)S
SSC-P 36
CAS-061 Vk3:VH5 CDRL1 (T25A, E27Q) 16 a.к.
(G4S)2(G4T)G
SSC-P 46
CAS-062 Vk3:CDR-H3 JH6 CDRL1 (T25A); CDRH3 (Y102V) 16 a.к.
(G4S)2(G4T)G
SSC-P 254
CAS-063 Vk3:VH5 JH5b CDRL1 (T25A); CDRH3 (M99F; Y102P) 16 a.к.
(G4S)2(G4T)G
SSC-P 266
CAS-064 Vk3:VH5 JH1 CDRL1 (T25A) CDRH3 (D101E; Y102H) 16 a.к.
(G4S)2(G4T)G
SSC-P 267
CAS-065 Vk3:CDR-H3 JH3a CDRL1 (T25A) CDRH3 (M99F; Y102V) 16 a.к.
(G4S)2(G4T)G
SSC-P 268
CAS-066 Vk3:CDR-H3 JH3b CDRL1 (T25A) CDRH3 (M99F; Y102I) 16 a.к.
(G4S)2(G4T)G
SSC-P 269
CAS-067 Vk3:CDR-H3 JH2 CDRL1 (T25A) CDRH3 (M99F; Y102L) 16 a.к.
(G4S)2(G4T)G
SSC-P 80
CAS-068 Vk3:VH5 JH2 CDRL1 (T25A) CDRH2 (T59N; N61A; R62Q; K65Q) 16 a.к.
(G4S)2(G4A)S
SSC-P 82
CAS-069 Vk3:VH5 JH2 CDRL1 (T25A) CDRH2 (T59G; N61A; R62Q; K65Q) 16 a.к.
(G4S)2(G4A)S
SSC-P 262
CAS-070 Vk3:VH5 JH5a CDRL1 (T25A); CDRH3 (M99F; Y102S) 20 a.к.
(G4S)3(G3A)S
CPPCP 84
* Записи обозначают сокращения, относящиеся к шарнирным областям IgG1, содержащим мутации только в первом или в первом и во втором цистеинах, находящихся в верхней и центральной области. Единственным исключением является SEQ ID NO:84, которая представляет используемую полноразмерную аминокислотную последовательность шарнирной области (CPPCP, SEQ ID NO:230) (по существу, просто центральная последовательность IgG1 с пролином на конце).
†Нумерация мутаций CDR основана на схеме нумерации по Kabat.

В представленной ниже таблице приведены дополнительные шарнирные области, которые можно использовать в молекулах, специфически связывающихся с CD37, таких как молекулы SMIP или антитела.

Таблица 2
Иллюстративные шарнирные области для белков, специфически связывающихся с CD37
Описание шарнирной области Аминокислотная последовательность SEQ ID NO:
ccc(p)-hIgG1 EPKSCDKTHTCPPCP 90
scc(p)-hIgG1 EPKSSDKTHTCPPCP 92
scc(s)-hIgG1 EPKSSDKTHTCPPCS 94
csc(p)-hIgG1 EPKSCDKTHTSPPCP 102
csc(s)-hIgG1 EPKSCDKTHTSPPCS 104
ccs(p)-hIgG1 EPKSCDKTHTCPPSP 255
ccs(s)-hIgG1 EPKSCDKTHTCPPSS 256
ssc(p)-hIgG1 EPKSSDKTHTSPPCP 106
ssc(s)-hIgG1 EPKSSDKTHTSPPCS 108
scs(p)-hIgG1 EPKSSDKTHTCPPSP 257
scs(s)-hIgG1 EPKSSDKTHTCPPSS 96
css(p)-hIgG1 EPKSCDKTHTSPPSP 110
css(s)-hIgG1 EPKSCDKTHTSPPSS 112
sss(p)-hIgG1 EPKSSDKTHTSPPSP 98
sss(s)-hIgG1 EPKSSDKTHTSPPSS 100
hIgA1 VPSTPPTPSPSTPPTPSPS 115
hIgA2 VPPPPP 116
hIgG3 ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCP 118
hIgG3(ccc) EPKSCDTPPPCPRCP 258
hIgG3(scc) EPKSSDTPPPCPRCP 120
hIgG3(csc) EPKSCDTPPPSPRCP 126
hIgG3(ccs) EPKSCDTPPPCPRSP 259
hIgG3(ssc) EPKSCDTPPPSPRCP 260
hIgG3(scs) EPKSCDTPPPCPRSP 261
hIgG3(css) EPKSCDTPPPSPRSP 122
hIgG3(sss) EPKSSDTPPPSPRSP 124
hIgD ESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTP 127

В представленных ниже таблицах представлены дополнительные каркасные области, которые можно использовать в молекулах, специфически связывающихся с CD37, таких как молекулы SMIP или антитела.

Таблица 3A
Каркасные области тяжелых цепей человека для белков, специфически связывающихся с CD37
V-область Каркасные области VH человека SEQ ID NO:
FR1
VH1 QVQLVQSGAEVKKPGASVKVSCKASGYTFT 140
VH1 QVQLVQSGAEVKKPGSSVKVSCKASGGTFS 141
VH1 EVQLVQSGAEVKKPGATVKISCKVSGYTFT 143
VH5 EVQLVQSGAEVKKPGESLKISCKGSGYSFT 144
VH5 EVQLVQSGAEVKKPGESLRISCKGSGYSFT 145
VH7 QVQLVQSGSELKKPGASVKVSCKASGYTFT 146
FR2
VH1 WVRQAPGQGLEWMG 147
VH1 WVQQAPGKGLEWMG 150
VH5 WVRQMPGKGLEWMG 151
FR3
VH1 RVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR 154
VH1 RVTITADESTSTAYMELSSLRSEDTAVYYCAR 155
VH1 RVTITADKSTSTAYMELSSLRSEDTAVYYCAR 156
VH1 RVTITADTSTDTAYMELSSLRSEDTAVYYCAT 157
VH5 QVTISADKSISTAYLQWSSLKASDTAMYYCAR 158
VH5 HVTISADKSISTAYLQWSSLKASDTAMYYCAR 159
VH7 RFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR 160
FR4
JH1, JH4, JH5a, JH5b WGQGTLVTVSS 161
JH2 WGRGTLVTVSS 162
JH3a, JH3b WGQGTMVTVSS 163
JH6 WGQGTTVTVSS 168
WGKGTTVTVSS 169
Таблица 3B
Каркасные области легких цепей человека для белков, специфически связывающихся с CD37
V-область Каркасные области VK человека SEQ ID NO:
FR1
VK3 EIVMTQSPATLSVSPGERATLSC 170
VK3 EIVLTQSPATLSLSPGERATLSC 171
VK1 DIQMTQSPSSLSASVGDRVTITC 172
VK1 NIQMTQSPSAMSASVGDRVTITC 175
VK1 AIQLTQSPSSLSASVGDRVTITC 177
VK1 DIQLTQSPSFLSASVGDRVTITC 178
VK1 AIRMTQSPFSLSASVGDRVTITC 179
VK1 AIQMTQSPSSLSASVGDRVTITC 180
VK1 DIQMTQSPSTLSASVGDRVTITC 181
FR2
VK3 WYQQKPGQAPRLLIY 182
VK1 WYQQKPGKAPKLLIY 184
VK1 WYQQKPGKVPKLLIY 185
VK1 WYQQKPGKAPKRLIY 186
VK1 WFQQKPGKVPKHLIY 187
VK1 WFQQKPGKAPKSLIY 188
VK1 WYQQKPAKAPKLFIY 191
FR3
VK3 GIPARFSGSGSGTEFTLTISSLQSEDFAVYYC 194
VK3 GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 195
VK1 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC 196
VK1 GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC 197
VK1 GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC 198
VK1 GVPSRFSGSGSGTDYTLTISSLQPEDFATYYC 203
VK1 GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC 205
FR4
JK1 FGQGTKVEIK 206
FGQGTKLEIK 207
FGPGTKVDIK 208
FGGGTKVEIK 209
FGQGTRLEIK 210

Предпочтительные иллюстративные составляющие части специфичных к CD37 молекул SMIP (включая лидерные последовательности, использованные для экспрессии и экспорта, но которые удаляются из зрелого слитого белка при экспорте из клетки; линкерные последовательности, использованные для соединения вариабельных доменов легкой и тяжелой цепи, чтобы получить связывающие домены scFv; шарнирные области, использованные для соединения связывающих доменов scFv с эффекторными доменами; и эффекторные домены), а также определенные молекулы SMIP, специфичные к CD37, включая предпочтительный слитый белок CAS-024, предоставлены в таблице 4.

Таблица 4
Составляющие части SMIP и выбранные полипептиды SMIP, специфичные к CD37
№ Конструкции SEQ ID NO: Аминокислотная последовательность
Лидерная последовательность 223 MDFQVQIFSFLLISASVIIARGV
Лидерная последовательность 224 MEAPAQLLFLLLLWLPDTTG
Линкер вариабельного домена 225 GGGGSGGGGSGGGGSS
Линкер вариабельного домена 226 GGGGSGGGGSGGGGAS
Линкер вариабельного домена 227 GGGGSGGSGSGGGGAS
Линкер вариабельного домена 228 GGGGSGGGGSGGGGTG
Линкер вариабельного домена 229 GGGGSGGGGSGGGGSGGGGSGGGGS
Шарнирная область 230 CPPCP
Шарнирная область (соединяющие аминокислоты выделены курсивом) 231 SEPKSSDKTHTSPPCP
Шарнирная область (соединяющие аминокислоты выделены курсивом) 232 DLEPKSSDKTHTSPPCP
Шарнирная область (соединяющие аминокислоты выделены курсивом) 233 DQEPKSSDKTHTSPPCP
Шарнирная область (соединяющие аминокислоты выделены курсивом) 234 GDQEPKSSDKTHTSPPCP
Шарнирная область (соединяющие аминокислоты выделены курсивом) 235 GSSEPKSSDKTHTSPPCP
VL мыши к CD37 (CDR выделены) 236 DIQMTQSPASLSASVGETVTITC RTSENVYSYLA WYQQKQGKSPQLLVS FAKTLAE GVPSRFSGSGSGTQFSLKISSLQPEDSGSYFC QHHSDNPWT FGGGTELEIK
Гуманизированный VL к CD37 (CDR выделены)a 237 EIVLTQSPATLSLSPGERATLSC RTSENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIK
Гуманизированный VL к CD37 (CDR выделены)b 238 EIVLTQSPATLSLSPGERATLSC RASENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEP
EDFAVYYC QHHSDNPWT FGQGTKVEIK
Гуманизированный VL к CD37 (CDR выделены)c 239 EIVLTQSPATLSLSPGERATLSC RTSQNVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIK
Гуманизированный VL к CD37 (CDR выделены)d 240 EIVLTQSPATLSLSPGERATLSC RTSESVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIK
VH мыши к CD37 (CDR выделены) 241 AVQLQQSGPESEKPGASVKISCKASGYSFT GYNMN WVKQNNGKSLEWIG NIDPYYGGTTYNRKFKG KATLTVDKSSSTAYMQLKSLTSEDSAVYYCAR SVGPMDY WGQGTSVTVSS
Гуманизированный VH к CD37 (CDR выделены)a 242 EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPMDY WGQGTLVTVSS
Гуманизированный VH к CD37 (CDR выделены)a 243 EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPMDV WGQGTLVTVSS
Гуманизированный VH к CD37 (CDR выделены)b 244 EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPFDY WGQGTLVTVSS
Гуманизированный VH к CD37 (CDR выделены)c 245 EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPFDS WGQGTLVTVSS
CH2CH3 IgG1 246 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-006 (химерный SMIP к CD37) 247 DIQMTQSPASLSASVGETVTITC RTSENVYSYLA WYQQKQGKSPQLLVS FAKTLAE GVPSRFSGSGSGTQFSLKISSLQPEDSGSYFC QHHSDNPWT FGGGTELEIKGGGGSGGGGSGGGGSSAVQLQQSGPESEKPGASVKISCKASGYSFT GYNMN WVKQNNGKSLEWIG NIDPYYGGTTYNRKFKG KATLTVDKSSSTAYMQLKSLTSEDSAVYYCAR SVGPMDY WGQGTSVTVSS DLEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-001 248 EIVLTQSPATLSLSPGERATLSC RTSENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIKGGGGSGGGGSGGGGTGEVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPMDY WGRGTLVTVSS DQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-002 249 EIVLTQSPATLSLSPGERATLSC RASENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIKGGGGSGGGGSGGGGTGEVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPFDY WGQGTLVTVSS DQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-003 250 EIVLTQSPATLSLSPGERATLSC RASENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIKGGGGSGGGGSGGGGTGEVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPFDS WGQGTLVTVSS DQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-014
(гибрид человек-мышь)
251 AVQLQQSGPESEKPGASVKISCKASGYSFT GYNMN WVKQNNGKSLEWIG NIDPYYGGTTYNRKFKG KATLTVDKSSSTAYMQLKSLTSEDSAVYYCAR SVGPMDY WGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSASEIVLTQSPATLSLSPGERATLSC RTSENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIK GSSEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-017
(гибрид человек-мышь)
252 EIVLTQSPATLSLSPGERATLSC RTSENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIKGGGGSGGGGSGGGGASAVQLQQSGPESEKPGASVKISCKASGYSFT GYNMN WVKQNNGKSLEWIG NIDPYYGGTTYNRKFKG KATLTVDKSSSTAYMQLKSLTSEDSAVYYCAR SVGPMDY WGQGTSVTVSS SEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
CAS-024 253 EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN WVRQMPGKGLEWMG NIDPYYGGTTYNRKFKG QVTISADKSISTAYLQWSSLKASDTAMYYCAR SVGPFDS WGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLSC RASENVYSYLA WYQQKPGQAPRLLIY FAKTLAE GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QHHSDNPWT FGQGTKVEIK GDQEPKSSDKTHTSPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

ПРИМЕР 2

ЭКСПРЕССИЯ CAS-024 И ДРУГИХ БЕЛКОВ, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩИХСЯ С CD37

CAS-024 и другие молекулы SMIP, специфически связывающиеся с CD37, клонировали в клеточной системе экспрессии млекопитающего в клетках яичника китайского хомяка (CHO). Трансфицированные клетки CHO, продуцирующие молекулы SMIP, культивировали во встряхиваемых колбах и собранные клеточные культуральные супернатанты титровали с использованием датчика Octec Q Protein A.

В таблице 5 показано, что конструкция CAS-024 (в формате VHVL с линкером вариабельного домена из 25 аминокислот) имела неожиданно очень высокий уровень экспрессии, приблизительно до величины, в 10 раз превосходящей другие гуманизированные молекулы SMIP к CD37 (главным образом, в формате VLVH с линкером вариабельного домена из 15 аминокислот). Действительно, все полностью гуманизированные конструкции VLVH экспрессировались плохо (данные не приведены), так же как и гибридные молекулы мыши-человека в любой ориентации (см. пример 5).

Таблица 5
Экспрессия SMIP
Белок SMIP Клонов прошло скрининг Диапазон титров белка (мкг/мл)
CAS-001 492 65-80
CAS-002 425 200-280
CAS-003 611 300-360
CAS-024 203 500-650

ПРИМЕР 3

ОЧИСТКА И ЭКСКЛЮЗИОННАЯ ХРОМАТОГРАФИЯ CAS-024 И ДРУГИХ БЕЛКОВ, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩИХСЯ С CD37

Для получения большего количества белка нуклеиновую кислоту, кодирующую CAS-024 и некоторые другие молекулы SMIP, специфически связывающиеся с CD37 клонировали в клеточной системе экспрессии млекопитающего в клетках яичника китайского хомяка (CHO). Трансфицированные клетки CHO, продуцирующие молекулы SMIP, культивировали во встряхиваемых колбах.

Все молекулы SMIP, специфически связывающиеся с CD37, очищали от супернатантов культуры CHO посредством аффинной хроматографии с белком A. 50 мл колонку rProtein A Sepharose FF (GE Healthcare) уравновешивали при скорости потока 5,0 мл/мин (150 см/ч) в 1,5 объемах колонки (ОК) буфером dPBS. Супернатант культуры загружали на колонку rProtein A Sepharose FF при скорости потока 1,7 мл/мин с применением AKTA Explorer 100 Air (GE healthcare), захватывая рекомбинантные молекулы SMIP. Колонку промывали 5 объемами колонки (ОК) буфером dPBS, затем 1,0 M NaCl, 20 мМ фосфатом натрия, pH 6,0, а затем 25 мМ NaCl, 25 мМ NaOAc, pH 5,0. Рекомбинантные молекулы, специфически связывающиеся с CD37, элюировали с колонки 100 мМ глицином, pH 3,5. Фракции (10 мл) элюированного продукта собирали, а затем pH доводили до 5,0 0,5 M 2-(N-морфолино)этансульфоновой кислотой (MES) в объеме 20% от элюированного объема, pH 6,0. Этот элюированный продукт концентрировали приблизительно до 25 мг/мл белка и стерилизовали фильтрованием.

Этот концентрированный и стерилизованный белок дополнительно очищали эксклюзионной хроматографией (ЭХ) GPC с получением молекулы SMIP (димера), отделенной от высокомолекулярных агрегатов. Колонку XK 50/100 (GE healthcare), содержащую 1 л Superdex 200 Sepharose FF, уравновешивали при скорости 12,6 мл/мин (38 см/ч) в 1,5 объемах колонки (ОК) буфером dPBS. На колонку наносили максимальный объем 54 мл (3% ОК). Скорость потока в колонке продолжали поддерживать при 12,6 мл/мин и элюированный белок разделяли на фракции по 40 мл. В каждой фракции анализировали качество продукта с использованием аналитической ВЭЖХ, и элюированные фракции объединяли до количества приблизительно более 95% представляющего интерес белка (неагрегированного). Полученный объединенный образец стерилизовали фильтрованием через 0,22 мкм фильтр, концентрировали, а затем формулировали в состав, содержащий 20 мМ фосфат натрия, 240 мМ сахарозу, pH 6,0.

На фиг. 2A-2D представлены кривые ЭХ, демонстрирующие пики, содержащие представляющий интерес белок (POI) для CAS-001 (SEQ ID NO:6), CAS-002 (SEQ ID NO:48), CAS-003 (SEQ ID NO:52) и CAS-024 (SEQ ID NO:253), соответственно. Пик CAS-024 является самым узким и более симметричным, чем в образцах CAS-001, CAS-002 и CAS-003 (более широкие и несимметричные). Молекула CAS-006 (химерная) дает острый пик, сходный с CAS-024. Образцы CAS-001, CAS-002 и CAS-003 имеют небольшое концевое плечо, на долю которого при интегрировании приходится приблизительно 35% площади POI. Это "плечо" трудно отделить от POI и, возможно, оно представляет неправильно уложенные конформеры или гетерогенную группу молекул (например, имеющих различные уровни гликозилирования). Это указывает на то, что CAS-024 не только лучше экспрессировался, но также что эта конструкция позволят получать более гомогенную популяцию молекул.

ПРИМЕР 4

СВЯЗЫВАНИЕ CAS-024 С КЛЕТКАМИ ЯВЛЯЕТСЯ НЕОЖИДАННО ВЫСОКИМ ОТНОСИТЕЛЬНО ДРУГИХ БЕЛКОВ, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩИХСЯ С CD37

Для сравнения аффинности связывания различных молекул иммунофармацевтических средств на основе модульных белков малого размера (SMIP) к CD37, найденных на клетках линии Ramos (B-лимфобластоидная клеточная линия, полученная из лимфомы Беркитта) использовали анализ конкурентного связывания. Очищенную с помощью ЭХ химерную молекулу SMIP к CD37 (CAS-006, SEQ ID NO:247) метили флуоресцентным красителем FMAT Blue® (Applied Biosystems) и использовали в качестве стандарта для конкуренции с очищенной немеченой химерной молекулой SMIP к CD37 (положительный контроль) и очищенными немечеными гуманизированными тестируемыми молекулами SMIP к CD37. Более высокая аффинность проявлялась в виде более слабого сигнала флуоресценции, а значение флуоресценции FL1 использовали для получения кривой конкурентного связывания. В кратком изложении, меченую реактивом FMAT Blue® химерную молекулу SMIP к CD37 разбавляли до концентрации 2 мкг/мл блокирующим буфером FACS и очищенные образцы белка (CAS-001 (SEQ ID NO:6), CAS-002 (SEQ ID NO:48), CAS-003 (SEQ ID NO:52) и CAS-024 (SEQ ID NO:253)) серийно разводили 1:2 до концентрации в диапазоне от 50 мкг/мл до 0,02 мкг/мл. Клетки линии Ramos собирали при скорости 1000 об/мин в течение 5 минут и ресуспендировали в блокирующем буфере FACS с концентрацией 4×106 клеток/10 мл буфера. В каждую лунку черного 96-луночного планшета добавляли следующее: 50 мкл образца, 50 мкл химерной молекулы SMIP к CD37, меченого FMAT Blue® и 50 мкл клеток линии Ramos (4×104/лунку). Планшеты инкубировали при комнатной температуре в течение 30 мин и считывали на 8200 Cellular Detection System (Applied Biosystems), настроенном на средний размер клеток и слабый сигнал.

Этот анализ конкурентного связывания с FMAT показал, что CAS-024 (гуманизированная молекула SMIP к CD37, содержащая VHVL scFv с линкером вариабельного домена длиной 25 аминокислот) имеет такую же аффинность к CD37, что и исходная химерная молекула SMIP к CD37 и, в отличие от нее, имеет неожиданно более высокую, до 4 кратной, аффинность к CD37 по сравнению с гуманизированными молекулами SMIP к CD37, содержащими обратную структуру VLVH и более короткий линкер вариабельного домена длиной 16 аминокислот (см. фиг. 3). Наилучшее связывание, хотя и все еще значительно меньшее, чем у CAS-006 или CAS-024, выявили у конструкции VLVH, не содержащей каких-либо мутаций в CDR (CAS-001). Однако при этом CAS-001 являлся самой плохо экспрессирующейся конструкцией и давал негомогенную группу очищенных молекул - даже в сравнении с этой конструкцией CAS-024 связывался в 1,5-2 раза лучше, чем CAS-001.

Этот результат являлся неожиданным также и потому, что M99 и Y102 в CDR3 тяжелой цепи CAS-024 подверглись мутации - положение Y102, как правило, является консервативным, и следовало ожидать, что изменение только в этом положении будет ослаблять или даже прекращать связывание (например, CAS-062, мутантный в положении Y102, обладает детектируемым, но значительно меньшим связыванием, по сравнению с CAS-001 или CAS-024, тогда как каждая от CAS-063 до CAS-067 в этом анализе обладают от слабо детектируемой до отсутствующей связывающей активностью при введении мутации в положение M99 или D101, данные не приведены). Таким образом, структура CAS-024 обеспечивает получение молекулы, которая неожиданно связывается так же, как и химерная молекула CAS-006.

ПРИМЕР 5

ЭКСПРЕССИЯ И СВЯЗЫВАНИЕ CAS-024 С КЛЕТКАМИ ПО СРАВНЕНИЮ С ГИБРИДНЫМИ БЕЛКАМИ МЫШИ-ЧЕЛОВЕКА, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩИМИСЯ С CD37

CAS-024 и другие молекулы SMIP, специфически связывающиеся с CD37, получали посредством технологии рекомбинантных ДНК и трансфицировали в клетки линии HEK293 в течение 7 суток. Супернатанты клеточных культур собирали на сутки 7 и титровали с использованием датчика Octec Q Protein A.

Подобно результатам, полученным в примере 2, здесь в таблице 6 показано, что CAS-024 (в формате VHVL с линкером вариабельного домена длиной 25 аминокислот) экспрессировался приблизительно в 5-27 раз лучше, чем другие гуманизированные или гибридные молекулы SMIP мыши-человека к CD37. Гибридные молекулы человека-мыши не экспрессировались достаточно хорошо вне зависимости от ориентации VHVL или VLVH.

Таблица 6
Экспрессия SMIP
Белок SMIP Титр белка (мкг/мл)
CAS-002 (hVLhVH) 0,47
CAS-003 (hVLhVH) 2,39
CAS-014 (mVHhVL) 2,16
CAS-017 (hVLmVH) 0,70
CAS-006 (mVLmVH) 9,3
CAS-024 (hVHhVL) 12,7

Для сравнения аффинности связывания различных гибридных молекул SMIP человека-мыши к CD37 по сравнению со связыванием CAS-024 с клетками линии Ramos использовали анализ конкурентного связывания, описанный в примере 4. Очищенную с помощью ЭХ химерную молекулу SMIP к CD37 (CAS-006, SEQ ID NO:247) метили флуоресцентным красителем FMAT Blue® (Applied Biosystems) и использовали в качестве стандарта для конкуренции с очищенной немеченой химерной молекулой SMIP к CD37 (CAS-006, положительный контроль) и очищенными немечеными гуманизированными тестируемыми молекулами SMIP к CD37 - CAS-002 (SEQ ID NO:48), CAS-003 (SEQ ID NO:52), CAS-014 (SEQ ID NO:251), CAS-017 (SEQ ID NO:252) и CAS-024 (SEQ ID NO:253).

Этот анализ конкурентного связывания с FMAT снова показал, что CAS-024 (гуманизированная молекула VHVL с линкером длиной 25 аминокислот) обладал такой же аффинностью к CD37, что и исходная химерная молекула SMIP к CD37 (CAS-006), тогда как CAS-002 и CAS-003 (гуманизированные молекулы VLVH с линкером длиной 16 аминокислот) не связывались также хорошо (демонстрируя 2-3-кратное снижение) (см. фиг. 4A). Гибридные молекулы человека-мыши, независимо от ориентации вариабельного домена (VH мыши-гуманизированный VL с линкером длиной 22 аминокислоты или гуманизированный VL-VH мыши с линкером длиной 16 аминокислот), связывались также или даже лучше (в 1,5-2 раза), чем CAS-006 и CAS-024 (см. фиг. 4B). Эти данные показывают, что гибридная молекула мыши-человека без мутаций, независимо от ориентации, связывается также или даже лучше, чем CAS-006, и что полностью гуманизированная VLVH конструкция без мутаций в CDR связывается лучше, чем гуманизированные молекулы, но все еще обладают сниженным связыванием по сравнению с CAS-006 или CAS-024. Совместно эти данные указывают на то, что более сильным связыванием обладают те молекулы, которые не содержат мутаций в CDR. Также, по-видимому, конкретный порядок (VLVH или VHVL) не решает проблемы с экспрессией, даже когда используется более длинный линкер вариабельного домена (см. CAS-014). Таким образом, выбор молекулы со структурой CAS-024 и свойствами, схожими с исходной молекулой CAS-006, прогнозу не поддавался.

ПРИМЕР 6

CAS-006 И РАЗЛИЧНЫЕ АНТИТЕЛА, СПЕЦИФИЧНЫЕ К CD37, СВЯЗЫВАЮТСЯ С ОДНИМ ИЛИ С ПЕРЕКРЫВАЮЩИМСЯ ЭПИТОПОМ НА CD37

Для идентификации эпитопа CD37, с которым связывается CAS-006 и другие ранее описанные антитела, специфичные к CD37, проводили эксперименты. Неконъюгированное MB371 (#555457) и конъюгированное с ФИТЦ MB371 (#555456) получали из BD Pharmingen (San Jose, CA), конъюгированное с ФИТЦ BL14 (#0457) из Immunotech/Beckman Coulter (Fullerton, CA), конъюгированное с ФИТЦ NMN46 (#RDI-CBL 136FT) и неконъюгированное NMN46 (#RDI-CBL 136) из RDI (Flanders, NJ), конъюгированное с ФИТЦ IPO24 (#186-040) и неконъюгированное IPO-24 (#186-020) из Ancell Corporation (Bayport, MN), конъюгированное с ФИТЦ HHI (#3081) и неконъюгированное HH1 (#3080) из DiaTec.Com (Oslo, Norway) и конъюгированное с ФИТЦ WR17 (YSRTMCA483F) и неконъюгированное WR17 (YSRTMCA483S) из Accurate Chemical & Scientific (Westbury, NY). Белок SMIP CAS-006 получали, как описано в примере 2.

CAS-006 конъюгировали с ФИТЦ с использованием набора “Molecular Probes Flouroreporter FITC Labeling” (F6434) в соответствии с инструкциями производителя следующим образом: пик представляющего интерес белка (POI) CAS-006 с концентрацией 13,5 мг/мл доводили до 5 мг/мл посредством PBS. Один мг (200 мкл) добавляли в пробирки из набора, содержащие мешалку, и добавляли 1 M NaHCO3 (доводили до pH 8,5 с использованием 6 н. NaOH) до конечной концентрации 0,1 M. К 370 мкг ФИТЦ добавляли 50 мкл DMSO и добавляли в пробирки в молярном отношении ФИТЦ:белок 15, 20, 30 и 40 с следуя формуле для определения количества мкл ФИТЦ для добавления: [количество мкл раствора ФИТЦ для добавления=5 мг/мл белка×0,2 мл×389×100×желаемое молярное отношение/молекулярная масса CAS-006 (110000)].

Реакционные смеси защищали от света и непрерывно перемешивали в течение 75 минут при комнатной температуре. Реакционные смеси добавляли в центрифужные колонки, подготовленные как описано в наборе, и центрифугировали при 1100 g в течение 5 минут с заменой буфера на PBS с азидом и удалением неконъюгированного ФИТЦ. ОП при 280 нМ и 494 нМ определяли с использованием 2 мкл капель на Nanodrop; коэффициент экстинкции для CAS-016 для этого устройства определяли экспериментально посредством считывания разведений исходной неконъюгированной молекулы SMIP, концентрация каждого конъюгата составляла 4,25 мг/мл и определяли следующие отношения ФИТЦ:белок: 2,7 ФИТЦ/CAS-016 при отношении 15; 3,7 ФИТЦ/CAS-016 при отношении 20; 4,4 ФИТЦ/CAS-016 при отношении 30 и 5,1 ФИТЦ/CAS-016 при отношении 40.

Добавляли BSA до 3 мг/мл, чтобы помочь стабилизировать белок. Связывание каждой фракции оценивали при разведениях в диапазоне 100-24300× на Ramos и 3200-25600× на PBMC человека. Все фракции связывались, но для дальнейшего использования выбрано отношение MR30, поскольку оно давало высокий MFI, который хорошо поддерживался во всем использованном диапазоне титрования, указывая на то, что в этой реакции авидность связывания затрагивалась менее всего.

Для определения оптимального количества для использования в исследованиях по блокированию в исходном исследовании связывания конъюгаты меченых ФИТЦ антител титровали начиная от 10 нг/мл до 10 мкг/мл. Выбранный уровень был несколько ниже насыщающего количества и сохранялся постоянным в последующих тестах, тогда как уровни блокирующего антитела увеличивались в 10-кратном диапазоне. Строили графики данных в виде процента максимального связывания в зависимости от концентрации блокирующего антитела, так что более высокие уровни указывают на менее эффективное блокирование, тогда как более низкие уровни указывают на более эффективную блокирующую активность. Все протестированные антитела проявляли блокирующую активность максимального связывания, наблюдавшегося без немеченых реактивов (фиг. 5).

Затем с использованием панели различных клонов мАТ к CD37, включая MB371, BL14, NMN46, IPO24, HH1, WR17 и химерный SMIP CAS-006 окрашивали клетки BJAB, линии лимфобластоидных B-клеток.

Для анализа конкурентного связывания инкубировали 2,5×105 клеток BJAB в 96-луночных планшетах с V-образным дном в среде для окрашивания (PBS с 2% сывороткой мыши) с конъюгированными с ФИТЦ мАТ к CD37 в концентрации 1,25 мкг/мл в присутствие неконъюгированного мАТ к CD37 в указанных концентрациях (2,5, 1,25, 0,6 или 0,3 мкг/мл) или в среде для окрашивания в течение 45 минут на льду в темноте. Перед добавлением клеток в реакционные смеси добавляли блокирующие антитела и конъюгаты меченых ФИТЦ антител. Затем клетки отмывали в 2,5-кратном PBS и фиксировали в 1% параформальдегиде (USB, Cleveland, Ohio). Обработанные клетки анализировали проточной цитометрией с использованием устройства FACsCalibur и программного обеспечения CellQuest (BD Biosciences, San Jose, CA).

Для анализа перекрестного блокирования FACs инкубировали 2,5×105 клеток BJAB в 96-луночных планшетах с V-образным дном в среде для окрашивания (PBS с 2% мышиной сывороткой) в присутствие неконъюгированного мАТ к CD37 в концентрации 5 мкг/мл в среде для окрашивания в течение 45 минут при комнатной температуре в темноте. Добавляли конъюгированные с ФИТЦ мАТ к CD37 до конечной концентрации 2 мкг/мл, что приводило к разбавлению немеченых реактивов до 3,3 мкг/мл. Реакционные смеси дополнительно инкубировали в темноте в течение 45 минут при комнатной температуре, затем промывали 2,5 раза в PBS и в заключение фиксировали в 1% параформальдегиде в PBS (USB, Cleveland, Ohio). Клетки анализировали проточной цитометрией на устройстве FACsCalibur с использованием программного обеспечения Cell Quest (BD Biosciences, San Jose, CA).

Для анализа связывания с клетками, клетки суспендировали в PBS (Gibco/Invitrogen, Grand Island NY), содержащем 2% FBS (Gibco/Invitrogen) (среда для окрашивания) в концентрации приблизительно 4×106 клеток/мл. Затем клетки переносили в планшеты, а затем добавляли 1:1 тестируемые образцы, разбавленные средой для окрашивания, до определенной конечной концентрации. Реакционные смеси инкубировали в течение 45 минут на льду. Образцы центрифугировали и промывали 2 раза в PBS. Добавляли меченое ФИТЦ антитело козы к IgG человека (CalTag, Burlingame CA) при конечном разведении 1:50 и инкубировали 45 минут на льду. Образцы центрифугировали, промывали в PBS, затем фиксировали в 200 мкл 1% параформальдегида в PBS (USB, Cleveland, Ohio). Клетки анализировали проточной цитометрией на устройстве FACsCalibur с использованием программного обеспечения Cell Quest (BD Biosciences, San Jose, CA).

Каждое антитело продемонстрировало зависимое от дозы ингибирование связывания, что указывало на то, что все протестированные молекулы связывались с одинаковым или сильно сходными эпитопами. У каждого антитела наблюдали отличающуюся активность ингибирования связывания. SMIP CAS-006 обладала самым высоким уровнем блокирующей активности среди всех протестированных молекул, тогда как HH1 обеспечивала промежуточный уровень блокирующей активности, а WR17, IPO24 блокировали лучше, чем MB371, но показали менее эффективное блокирование, чем другие две немеченые молекулы (фиг. 5).

В дополнение к анализу блокирующей активности проводили подобные серии экспериментов, в которых различные направленные к CD37 антитела тестировали на их способность конкурировать с другими антителами за связывание с рецептором CD37. Результаты этих экспериментов, подобно результатам, полученным в исследованиях блокирования для всех протестированных молекул, указывают на то, что различные направленные на CD37 антитела и CAS-006 имеют одинаковые или тесно перекрывающиеся эпитопы.

ПРИМЕР 7

ЭФФЕКТ ДОЗЫ CAS-024 В МОДЕЛИ ВВОДИМОГО ПОДКОЖНОГО КСЕНОТРАНСПЛАНТАТА ОПУХОЛИ ЧЕЛОВЕКА (DOHH2) НА SCID-МЫШАХ

Целью этого эксперимента была проверка эффекта дозы в лечении с использованием CAS-024 в модели вводимого подкожного ксенотрансплантата опухоли человека (DOHH2) на SCID-мышах. DOHH2 представляет собой CD20+CD37+ B-лимфобластоидную клеточную линию человека, полученную у пациента с фолликулярной лимфомой (Kluin-Nelemans et al., Leukemia 5:221, 1991). Таким образом, DOHH2 получали у пациента с неберкиттовской НХЛ.

Пять миллионов клеток DOHH2 инъецировали подкожно в бок самкам мышей CB-17SCID (Harlan, Somerville, NJ) в возрасте 6,5 недель и при средней массе 18,0±0,1 г (в диапазоне от 14,6 до 22,6 г). На сутки 8 после инокуляции опухоли, пальпируемые опухоли были различимы у большинства мышей. Несущих опухоли мышей рассортировали на четыре группы с равными средними объемами опухолей (n=14 в группе; 2 клетки по 5 мышей и 1 клетка с 4-мя мышами для каждой группы). Сутки, когда проводили сортировку, определили как сутки 0. Диаметры опухолей определяли с помощью пары циркулей, а объемы опухолей вычисляли с помощью формулы: V=1/2[длина×(ширина)2]. Исходный средний объем опухоли составлял 228 мм3, средний исходный размер опухоли составлял 224 мм3, а диапазон составлял от 179 до 284 мм3.

Таблица 7
Реактивы для использования in vivo
Реактив % POI Концентрация и эндотоксин Препарат для инъекции
PBS н.п.
Эндотоксин <0,03 ЭЕ/мг
н.п.
IgG человека (huIgG) Не тестировали 10 мг/мл
Эндотоксин= 10 ЭЕ/мг
Разбавленный до 1,0 мг/мл в PBS
CAS-024 100 9,6 мг/мл
Эндотоксин= 0,01 ЭЕ/мг
Разбавленный до 1,0 мг/мл в PBS для получения дозы 200 мкг; затем разбавленный 1:2 для получения дозы 100 мкг, затем серийно разведенный 1:3 c получением растворов других доз.

Несущие опухоль группы SCID-мышей обрабатывали на сутки 0, 4 и 8 посредством интраперитонеальных инъекций 0,2 мл PBS, содержащего 200 мкг huIgG (отрицательный контроль) или 200, 100, 30, 10 или 3 мкг CAS-024. В сутки введения получали два раствора с наименьшей дозой CAS-024, чтобы избежать необходимости добавлять белок-носитель в самые разбавленные растворы. Растворы лекарственного средства имели цветовое кодирование, как описано ниже (см. таблицу 8 ниже).

Таблица 8
Постановка эксперимента
Идентификатор группы Количество мышей, путь введения и сутки введения Доза на инъекцию (мкг) мг/кг на инъекциюа Суммарная доза (мкг) Суммарная доза (~мг/кг)а
huIgG 14 на группу
и/п инъекция
инъекция на сутки 0, 4 и 8
200 11,1 600 33
CAS-024
200
200 11,1 600 33
CAS-024
100
100 5,6 300 16,7
CAS-024
30
30 1,7 90 5,0
CAS-024
10
10 0,6 30 1,7
CAS-024
3
3 0,2 9 0,5
a Следует отметить, что huIgG и CAS-024 доставляли в мкг на мышь, а не в мг/кг. Приблизительные мг/кг приведены для удобства и основаны на средней массе (18,0±0,1 г) мышей на сутки 0. Диапазон масс в этом эксперименте составил от 14,6 до 22,6 г.

Получали дозированные растворы в сходных объемах и содержимое пробирок указывали на снимающихся ярлыках. Исследователь, не принимавший участие в лечении или оценке мышей, помещал на каждую пробирку цветовой код и указывал код и соответствующее ему содержимое пробирки в лабораторном журнале. Мышей подвергали ежедневному мониторингу посредством визуального осмотра. Массу определяли еженедельно, а диаметр опухолей по меньшей мере 3 раза в неделю (пн, ср, пт) определял наблюдатель, не владеющий сведениями о группах лечения (см. выше). Объем опухоли вычисляли, как описано выше. Мышь подвергали эвтаназии, если объем опухоли у нее достигал более 1500 мм3 (или 1200 мм3 в пятницу). Смерть не являлась конечной точкой в протоколах течения опухоли и, если не указано иначе, "выживаемость" мыши определяли по моменту времени, когда ее подвергали эвтаназии вследствие превышения у нее опухолью объема предварительно определенных пределов. (По протоколу требовалось подвергать мышей эвтаназии, если (1) объемы опухоли у них превышал указанные выше параметры, (2) происходило изъязвление опухоли, (3) опухоль препятствовала подвижности мыши, и (4) потеря массы превышала 20% массы тела.)

Одну из мышей в группе лечения CAS-024 100 мкг подвергли эвтаназии на сутки 35 из-за потери массы >20%. В этот момент времени объем опухоли у этой мыши составлял 266 мм3, и ее обработали как цензурированные данные для анализа выживаемости (мышь не подвергнута эвтаназии по состоянию на сутки 35 вследствие роста опухоли). При расчете частоты отсутствия опухолей в конце исследования эту мышь классифицировали как мышь, которую подвергали эвтаназии в ходе исследования вследствие роста у нее опухоли (ее опухоль снова росла в момент ее смерти). Ни одну другую мышь не обнаружили мертвой и ни одну не подвергали эвтаназии вследствие потери массы, изъязвления опухоли или сниженной подвижности. Ни в одной группе лечения не наблюдали явных признаков токсичности или потери массы (данные не приведены).

Все статистические исследования проводили с использованием программного обеспечения GraphPad Prism. Значимые различия по средним объемам опухолей и средним относительным объемам опухолей определяли с использованием однофакторного дисперсионного анализа для непараметрических данных (критерий Крускала-Уоллиса) с апостериорным критерием множественного сравнения Данна. Для проверки различий между всеми группами лечения CAS-024 и группой huIgG, сравнивали все группы. Для сравнения только между группами CAS-024 группу huIgG исключали. Кроме того, группы с высокими и средними дозами (200, 100 и 30 мкг) анализировали как один набор данных, а группы со средними и низкими дозами (30, 10 и 3 мкг) анализировали как другой набор данных. Значимые различия по выживаемости мышей с течением времени определяли с использованием анализа выживаемости Каплана-Мейера с логарифмическим ранговым критерием для сравнения кривых выживаемости. Значимые различия по частоте отсутствия опухолей у мышей определяли с использованием точного критерия Фишера, значимыми считали значения p<0,05.

CAS-024 обладал зависимым от дозы ингибирующим действием на рост опухолей DOHH2. За исключением группы лечения низкой дозой (3 мкг), средний объем опухоли в каждой группе лечения CAS-024 был значительно ниже, чем в группе лечения IgG человека уже на сутки 5 и оставался более низким до суток 12. Мышей, которых лечили с использованием huIgG, подвергали эвтаназии, начиная с суток 12; таким образом, сравнение объемов опухолей в группах лечения CAS-024 и в группе huIgG в более поздние моменты времени не проводил. В терминах доза-ответ, значимых различий в средних объемах опухолей в двух группах с самыми высокими дозами не наблюдали в любой момент исследования. В отличие от этого, средние объемы опухолей в этих двух группах значимо отличались от средних объемов опухолей в каждой из трех групп с более низкими дозами с 12 по 16 сутки (16 сутки были последним оцениваемым моментом времени для группы с низкой дозой). Подобным образом, средние объемы опухолей у мышей из групп дозирования 30 мкг и 10 мкг отличались друг от друга и от группы с низкой дозой в течение данного периода времени.

Опухоли у мышей, которых лечили с использованием huIgG, росли быстро и всех мышей в этой группе подвергли эвтаназии на сутки 19. Как обобщено в таблицах 9 и 10 ниже, выживаемость мышей, которых лечили любой дозой CAS-024, была пролонгирована относительно группы лечения huIgG (p<0,0001 во всех случаях). В терминах дозы-эффекта, отсутствовали значимые различия в кривых выживаемости мышей, которых лечили с использованием режимов самых высоких доз (200 и 100 мкг) (p=0,7091). За исключением этого сравнения групп, имели место значимые различия между кривой выживаемости для каждой группы дозирования и кривой выживаемости для каждой группы, которую лечили в режиме более низкой дозы (значения p находились в диапазоне от 0,0132 до <0,0001).

Таблица 9
Среднее время выживаемости и частота отсутствия опухолей у мышей
Идентификатор группыa Суммарная доза Среднее время выживаемости (сутки)b Смерть (не по причине большого объема опухоли) Частота отсутствия опухолей в конце исследованияc Значение p для точного критерия Фишера (сравнение частоты отсутствия опухолей)d
huIgG
200
600 мкг 14 0/14 0/14 (0%) Н.п.
CAS-024
200
600 мкг Не определено ef 0/14 11/14 (79%) g < 0,0001
CAS-024
100
300 мкг Не определено 1/14 h 11/14 (79%) < 0,0001
CAS-024
30
90 мкг 35 0/14 5/14 (36%) 0,0407
CAS-024
10
30 мкг 28 0/14 0/14 (0%) Н.п.
CAS-024
3
9 мкг 19 0/14 0/14 (0%) Н.п.
a Мышей лечили указанным белком посредством и/п инъекций на сутки 0, 4 и 8. Числа указывают количество белка (мкг), инъецированное в сутки.
b "Выживаемость" мыши определялась теми сутками, когда ее подвергли эвтаназии вследствие роста опухоли. Одну мышь в группе дозирования CAS-024 100 мкг подвергли эвтаназии на сутки 35 вследствие потери массы >20%. В этот момент объем опухоли мыши составлял 266 мм3, и ее обработали как цензурированные данные (объем опухоли не достиг предварительно заданного предела на сутки 35) для анализа Каплана-Мейера. Ни одну другую мышь не подвергали эвтаназии по причине, отличной от достижения предварительно заданного предела объема опухоли.
c У мышей без опухолей отсутствовали пальпируемые подкожные опухоли.
Отсутствие опухолевых клеток не подтверждали гистологическим исследованием. Исследование завершали на сутки 61.
d Каждую группу сравнивали с контрольной группой, которую лечили с использованием huIgG.
e Среднее время выживаемости не определяли, когда >50% мышей были живы к концу периода наблюдения.
f Значения, выделенные полужирным шрифтом, указывают на то, что кривые выживаемости для указанной группы значительно отличались от кривых выживаемости для контроля с huIgG (p<0,0001 в каждом случае, логарифмический ранговый критерий).
g Значения, выделенные полужирным шрифтом, значительно отличаются от контрольной группы, которую лечили с использованием huIgG.
h Одну мышь подвергли эвтаназии на сутки 35 вследствие потери массы >20%. В этот момент объем опухоли у этой мыши составлял 266 мм3 и ее обработали как цензурированные данные для анализа Каплана-Мейера.
Таблица 10
Значения p для сравнения кривых выживаемости и частоты отсутствия опухолей среди групп лечения CAS-024
Сравнение группa Значения p для указанных сравнений
Логарифмический ранговый критерий (сравнение кривых выживаемости) Точный критерий Фишера (сравнение частоты отсутствия опухолей)
200 в сравнении с 100 0,7091 1,0000
200 в сравнении с 30 0,0132 b 0,0542
200 в сравнении с 10 <0,0001 <0,0001
200 в сравнении с 3 <0,0001 <0,0001
100 в сравнении с 30 0,0035 0,0542
100 в сравнении с 10 <0,0001 <0,0001
100 в сравнении с 3 <0,0001 <0,0001
30 в сравнении с 10 0,0002 0,0407
30 в сравнении с 3 <0,0001 0,0407
10 в сравнении с 3 <0,0001 Н.п.
a Для информации о группах см. подписи к таблице 7.
b Значения p<0,05 выделены полужирным шрифтом для выделения.

Все мыши в группе лечения huIgG и в двух группах с самыми низкими дозами CAS-024 (10 и 3 мкг) подвергнуты эвтаназии вследствие роста у них опухолей. В отличие от этого, большинство опухолей в группах мышей, которых лечили с использованием 200 или 100 мкг CAS-024, регрессировали до состояния, в котором пальпируемые опухоли отсутствовали. К концу исследования 11/14 (79%) мышей в каждой из двух групп с самыми высокими дозами и 5/14 (36%) мышей в группе дозирования 30 мкг оставались без опухолей (p<0,0001 и 0,0407, соответственно, в сравнении с группой huIgG).

Таким образом, CAS-024 оказывал зависимое от дозы ингибирующее действие на рост вводимых подкожных ксенотрансплантатов опухоли человека (DOHH2) у SCID-мышей. Два режима с наиболее высокими дозами (100 или 200 мкг в одной интраперитонеальной инъекции; суммарная доза 300 или 600 мкг, которая соответствует приблизительно 16,7 или 33 мг/кг, соответственно) обладали сходным ингибирующим эффектом и были наиболее эффективными среди протестированных режимов с точки зрения ингибирования роста опухоли, продления выживаемости и индукции полной регрессии опухоли.

ПРИМЕР 8

ЭФФЕКТИВНОСТЬ CAS-024 И РИТУКСАНА® В КАЧЕСТВЕ ОТДЕЛЬНЫХ СРЕДСТВ В МОДЕЛИ ВВОДИМОГО КСЕНОТРАНСПЛАНТАТА ОПУХОЛИ ЧЕЛОВЕКА (DOHH2) НА SCID-МЫШАХ

Целью данного исследования являлось изучение эффективности CAS-024 и ритуксана в качестве отдельных средств в модели вводимого ксенотрансплантата опухоли человека (DOHH2) на SCID-мышах. Как указано выше, DOHH2 представляет собой CD20+CD37+ B-лифмобластоидную клеточную линию человека, полученную у пациента с фолликулярной лимфомой.

Пять миллионов клеток DOHH2 инъецировали подкожно в бок самкам мышей CB-17SCID (Harlan, Somerville, NJ) в возрасте 6,5 недель. На сутки 8 после инокуляции опухоли, пальпируемые опухоли у большинства мышей присутствовали различимые опухоль. Несущих опухоль мышей рассортировывали на четыре группы (n=15 в группе; 3 клетки по 5 мышей для каждой группы) с равными средними объемами опухолей. Сутки, когда проводили сортировку, определили как сутки исследования 0. Диаметры опухолей определяли с помощью пары циркулей, а объемы опухолей вычисляли с помощью формулы: V=1/2[длина×(ширина)2]3. Исходный средний объем опухоли составлял 228 мм3; средний исходный размер опухоли составлял 227 мм3, а диапазон составлял от 181 до 272 мм3. Мышей (по 15 на группу лечения) лечили на сутки 0, 4 и 8 посредством интраперитонеальной инъекции 0,2 мл PBS, содержащего 200 мкг IgG человека, CAS-024 или ритуксана® (всего 600 мкг после трех введений). Для групп с интраперитонеальным лечением с использованием huIgG, CAS-024 и ритуксана® интраперитонеально, получали схожие объемы растворов и содержимое пробирок указывали на снимающихся ярлыках. Исследователь, не принимавший участие в лечении или оценке мышей, помещал на каждую пробирку цветовой код и указывал код и соответствующее ему содержимое пробирки в лабораторном журнале.

Мышей подвергали ежедневному мониторингу посредством визуального осмотра. Массу определяли еженедельно, а диаметр опухолей по меньшей мере 3 раза в неделю (пн, ср, пт) определял наблюдатель, не владеющий сведениями о группах лечения (см. выше). Объем опухоли вычисляли, как описано выше. Объемы опухолей в последние сутки, когда все мыши были живы, в каждой группе также выражали в единицах объема опухоли относительно суток 0, используя следующую формулу:

Относительный объем опухоли в представляющие интерес сутки=(объем в представляющие интерес сутки - объем в сутки 0)/объем в сутки 0

Мышей подвергали эвтаназии, если объем опухоли у них достигал более 1500 мм3 (или 1200 мм3 в пятницу). Смерть не являлась конечной точкой в протоколах течения опухоли и, если не указано иначе, "выживаемость" мыши определяли по моменту времени, когда ее подвергали эвтаназии вследствие превышения у нее опухолью объема предварительно определенных пределов. (Протокол авторов изобретения требовал подвергать мышей эвтаназии, если объемы опухоли у них превышали вышеуказанные величины, происходило изъязвление опухоли, опухоль препятствовала подвижности мыши или потеря массы превышала 20% массы тела.)

Все статистические исследования проводили с использованием программного обеспечения GraphPad Prism. Значимые различия по средним объемам опухолей и средним относительным объемам опухолей определяли с использованием однофакторного дисперсионного анализа для непараметрических данных (критерий Крускала-Уоллиса) с апостериорным критерием множественного сравнения Данна. Значимые различия по выживаемости мышей с течением времени определяли с использованием анализа выживаемости Каплана-Мейера с логарифмическим ранговым критерием для сравнения кривых выживаемости. Значимые различия по частоте отсутствия опухолей у мышей определяли с использованием точного критерия Фишера (значимыми считали значения p<0,05).

Когда объемы опухолей у мышей достигали указанных выше пределов их подвергали эвтаназии. Одну мышь в группе лечения CAS-024 подвергли эвтаназии на сутки 45 вследствие потери массы >20%. У этой мыши не было явной подкожной опухоли в этот момент времени, и ее обработали как цензурированные данные для анализа выживаемости (мышь не подвергнута эвтаназии на сутки 45 вследствие роста опухоли) и не включили в сравнение частот отсутствия опухолей в конце исследования. Ни одна другая мышь не была найдена мертвой и ни одну не подвергли эвтаназии вследствие потери массы, изъязвления опухоли или сниженной подвижности. Ни в одной группе лечения не наблюдали явных признаков токсичности или потери массы (данные не приведены).

Мыши, которых лечили с использованием CAS-024 и ритуксана, демонстрировали быстрый ответ на лечение. Средние объемы опухоли в группах лечения CAS-024 и ритуксаном® были значительно ниже, чем средние объемы опухоли в группе лечения IgG человека, уже на сутки 4 (после одной инъекции лекарственного средства) и оставались более низкими до суток 11. Значимые различия по средним объемам опухоли или по средним относительным объемам опухолей между группами лечения CAS-024 и Ритуксаном® до суток 11 отсутствовали. Мышей, которых лечили с использованием huIgG, подвергали эвтаназии, начиная с суток 11; таким образом, для более поздних моментов времени сравнение объемов опухолей не проводили.

У мышей, которых лечили с использованием huIgG, опухоли росли быстро и все мыши в этой группе подвергнуты эвтаназии на сутки 15. В отличие от этого, большинство опухолей в группах лечения CAS-024 и ритуксаном на сутки 15 регрессировало до состояния, в котором отсутствовали пальпируемые опухоли. Примечательно, что ответ на лечение был долговременным только в группе лечения CAS-024. К концу исследования все мыши, которых лечили ритуксаном, подвергнуты эвтаназии вследствие роста у них опухолей, тогда как 10/14 (71%) мышей в группе лечения CAS-024 остались без опухолей. См. таблицу 9. Таким образом, в конце исследования кривые выживаемости и частота отсутствия опухолей у мышей в группе лечения CAS-024 значимо отличалась от контрольной группы huIgG и группы лечения ритуксаном®. На фиг. 6 показано, что CAS-024 статистически превосходил ритуксан в лечении этой модели фолликулярной лимфомы на животных in vivo.

Таблица 11
Среднее время выживаемости и частота отсутствия опухолей у мышей
Группа лечения Сутки лечения и суммарная доза Среднее время выживаемости (сутки)a Значение p в логарифмическом ранговом критерииb Смерть (кроме эвтаназии в связи с размером опухоли) Мыши без опухолей на сутки 81c Точный критерий Фишера (сравнение частоты отсутствия опухолей)b
huIgG сутки 0, 4 и 8 день
600 мкг
13 - 0/15 0/15 (0%) н.п.
CAS-024
POI
сутки 0, 4 и 8
600 мкг
Не определено d,e <0,0001 1/15f 10/14 (71%) f <0,0001
ритуксан® POI сутки 0, 4 и 8
600 мкг
43 <0,0001 0/15 0/15 (0%) н.п.
a "Выживаемость" определяли теми сутками, когда мышь подвергли эвтаназии вследствие роста опухоли. За исключением одной мыши в группе дозирования CAS-024 (смотри (f)), ни одна мышь не была подвергнута эвтаназии по причинам, отличным от той, что объем опухоли достиг предварительно
заданного предела.
b Каждую группу сравнивали с контрольной группой, которую лечили с использованием huIgG.
c Мыши без опухолей не имели пальпируемых подкожных опухолей; отсутствие опухолевых клеток не подтверждали гистологическим исследованием.
d Среднее время выживаемости не определяли, когда >50% мышей оставались живы в конце периода наблюдения.
e Значения, выделенные полужирным шрифтом, значительно отличаются от значений для контроля huIgG.
f Одну мышь подвергли эвтаназии на сутки 45 вследствие потери массы >20%. У этой мыши не было явной подкожной опухоли в этот момент и ее исключили из группы для сравнения мышей без опухолей на сутки 81.

В заключение следует указать, что CAS-024 и ритуксан продемонстрировали эффективность в качестве отдельных средств в модели ксенотрансплантата опухоли человека (DOHH2) на SCID-мышах. Несмотря на то, что оба средства вызывали регрессию опухоли у большинства мышей, длительная регрессия опухоли наблюдалась только в группе мышей, которых лечили с использованием CAS-024, поскольку опухоли рецидивировали после оптимального лечения против CD20. Таким образом, CAS-024, гуманизированное SMIP к CD37, демонстрирует значимую эффективность в доклинических моделях ксенотрансплантатов опухолей, включая модели, которые демонстрируют, что лечение ритуксаном® с течением времени оказывается неудачным. Таким образом, эти результаты указывают на то, что лечение пациентов с B-клеточной лимфомой и лейкозом с использованием CAS-024 является эффективным и представляет собой пригодную альтернативу лечения пациентов, у которых лечение ритуксаном® было неудачным.

ПРИМЕР 9

ОЦЕНКА CAS-024, КОМБИНИРОВАННОГО С ХИМИОТЕРАПЕВТИЧЕСКИМИ СРЕДСТВАМИ, IN VITRO

Ранее было показано, что CAS-006 в комбинации с химиотерапевтическим средством флударабин действует синергетически, уничтожая клетки хронического лимфолейкоза (ХЛЛ) in vitro (см., например, публикацию патентной заявки США № 2007/0059306). Поскольку клетки ХЛЛ активно не делятся в клеточной культуре in vitro, эти данные указывают на то, что клеточная пролиферация не является необходимой для проапоптотического эффекта CAS-006 или CAS-024 для их синергетического взаимодействия с химиотерапевтическими средствами. Таким образом, целью данного исследования являлось определение эффективности CAS-024 и различных химиотерапевтические средства в отношении линии клеток лимфомы из клеток мантийной зоны (ЛКМЗ), Rec-1, которые активно растут и делятся в клеточной культуре in vitro, и определение того, будет ли комбинация CAS-024 и химиотерапевтического средства (лекарственного средства) снижать чувствительность или усиливать ответ клеток лимфомы из клеток мантийной зоны на различные химиотерапевтические средства. Тестировали химиотерапевтические средства доксорубицин, винкристин и флударабин, которые используются для лечения неходжкинской лимфомы и других лимфоидных злокачественных опухолей.

Клетки Rec-1, CD37+ B-клеточную линию человека, полученную у пациента с лимфомой из клеток мантийной зоны, тестировали на ингибирование роста в ответ на сшитый CAS-024 в присутствии или в отсутствии доксорубицина, винкристина или флударабина (см. фиг. 7). CAS-024 предварительно инкубировали с F(ab)'2 к IgG человека для сшивания белков. Клетки культивировали только в среде или в среде, содержащей различные концентрации сшитого белка CAS-024, в присутствие или в отсутствие различных концентраций доксорубицина, винкристина или флударабина. Культуры инкубировали в течение 96 часов, а ингибирование роста оценивали с использованием системы детекции АТФ жизнеспособных клеток (т.е., количество жизнеспособных клеток определяли по высвобождению АТФ).

Для анализа данных использовали способ среднего эффекта/комбинационного индекса (КИ) Chou и Talalay (Adv. Enzyme Regul. 22:27, 1984). Численное значение, присвоенное каждой комбинации лекарственных средств с предварительно заданными уровнями доз, позволяет проводит количественные сравнения взаимодействия лекарственных средств между различными комбинациями лекарственных средств. Результаты выражали в виде комбинационных индексов (КИ) в зависимости от уровня эффекта, где уровень эффекта представлял собой процент ингибирования клеточного роста. Средний КИ±стандартная ошибка среднего для каждого уровня эффекта усредняли по трем экспериментам. КИ<1,0 рассматривали как синергизм, КИ=1,0 как аддитивное действие и КИ >1,0 как антагонизм. Приведенные значения представляют собой среднее значение±стандартная ошибка среднего для каждого уровня эффекта, усредненного по трем независимым тестам.

Комбинация CAS-024 с винкристином или флударабином была синергетической (КИ<1,0), а комбинация CAS-024 и доксорубицина была аддитивной (КИ незначительно отличался от 1,0). Ни одна из комбинаций CAS-024 и химиотерапевтического средства не была антагонистической (КИ>1,0) при всех уровнях эффекта. Таким образом, протестированные комбинации CAS-024 с каждым из трех химиотерапевтических средств не снижали чувствительность клеток-мишеней к ингибированию роста, индуцированному лекарственным средством, но вместо этого обеспечивали в результате синергетическое или аддитивное ингибирующее действие на рост клеток-мишеней. Предпочтительным вариантом осуществления является комбинация CAS-024 (SEQ ID NO:253) с винкристином или флударабином. Эти данные указывают на то, что эффективность установленных химиотерапевтических средств увеличивается при использовании в сочетании с CAS-024.

ПРИМЕР 10

РЕЗУЛЬТАТЫ ПРЕДВАРИТЕЛЬНОЙ ФАЗЫ 1/2 КЛИНИЧЕСКИХ ИССЛЕДОВАНИЙ

Как указано в настоящем документе, доклинические исследования показали, что молекулы SMIP к CD37 опосредуют значительно лучше прямое и опосредованное натуральными киллерами (NK) уничтожение клеток хронического лимфолейкоза (ХЛЛ) по сравнению с другими терапевтическими антителами, используемыми при ХЛЛ. Вследствие этого у пациентов с рецидивом хронического лимфолейкоза (ХЛЛ) приступили к фазе 1/2, открытому исследованию с повышением дозы.

Отбирали пациентов с рецидивирующими/резистентными ХЛЛ или мелкоклеточной лимфомой (SLL) c адекватной функцией органов, тромбоцитами >30000/мм3. Исследовали или исследуют шесть доз и две различных схемы (группы 1-10). Планируемые дозы находятся в диапазоне от 0,03 мг/кг до 10 мг/кг в/в раз в неделю 4 дозы (группы 1-6 и 9). По второй схеме (группы 7, 8 и 10) тестируют 3,0, 6,0 или 10,0 мг/кг на сутки 1, 3 и 5 первой недели, после чего следуют 3 недельных дозы. Повышение и снижение дозы основано на степенях токсичности по Common Toxicity Criteria Adverse Events (CTC AE). Пациенты могут проходить 2 дополнительных цикла в случае положительного биологического эффекта после первого цикла.

Результаты: В настоящее время зарегистрированы и закончили лечение (все предварительно получали лечение флударабином и ритуксимабом) 22 пациента (группы 1-7 и 9). Шесть пациентов начали второй цикл и два пациента начали третий цикл. Пациенты, проходившие лечение, прошли через ряд предыдущих режимов (например, пациенты из 4 группы прошли от 6 до 10 (медиана 6), а из группы 5 от 5 до 13 (медиана 9,5) предыдущих режимов). У восьми из десяти существовал риск геномных поражений [del(17p13.1), n=5 и del(11q22.3), n=3]. Токсические явления, ограничивающие дозу, или серьезные нежелательные последствия не развивались. У трех пациентов наблюдали среднюю инфузионную токсичность (1-2 степени). Начиная с дозы 0,3 мг/кг, все восемь пациентов продемонстрировали признаки биологической активности, включая пациентов с del(17p13.1). У двух пациентов наблюдалось частичное исчезновение гематодерматоза, и среднее снижение количества периферических лимфоцитов составило 64% (см. фиг. 5). Один пациент продемонстрировал снижение количества периферических лимфоцитов на 99% без серьезных нежелательных явлений и продолжал отвечать после 3 месяцев лечения (см. фиг. 6). У одного пациента произошло увеличение гемоглобина на 40% и уменьшение размеров лимфатических узлов на 36%, которое определили с помощью КТ-сканирования, и он продолжает отвечать после 3 месяцев лечения (см. фиг. 7). У двух пациентов произошло значительное увеличение количества тромбоцитов.

Заключение: На настоящий момент эта молекула SMIP к CD37 представляет собой хорошо переносимое лекарственное средство с минимальной инфузионной токсичностью и без выявленной токсичности, ограничивающей дозу. Также, по-видимому, в определенной степени вовлечен комплемент, так как пациенты с сильным уменьшением количества лимфоцитов не демонстрируют признаков синдрома лизиса опухоли. Обнадеживающее снижение количества лимфоцитов опухоли в крови, уменьшение размеров лимфатических узлов/селезенки, исчезновение гематодерматоза и/или частичное исчезновение заболевания костного мозга и/или улучшение нормальной гемопоэтической функции у пациентов с высоким риском геномного ХЛЛ наблюдали уже при низких ненасыщающих дозах молекулы SMIP к CD37.

ПРИМЕР 11

ЭФФЕКТИВНОСТЬ CAS-024 В КОМБИНАЦИИ С БЕНДАМУСТИНОМ IN VITRO

Данное исследование проводили для определения действия CAS-024, бендамустина и комбинации CAS-024 и бендамустина на клетки Rec-1 (клеточная линия лимфомы из клеток мантийной зоны) и SU-DHL-6 (клеточная линия диффузной крупноклеточной лимфомы).

Использовали следующие клеточные линии человека, экспрессирующие CD37: Rec-1 и SU-DHL-6 (обе из DSMZ, Braunschweig, Germany). Бендамустин (ТРЕАНДА®) приобретали в University of Washington Pharmacy (Seattle, WA), растворяли в PBS и хранили при -20°C до использования.

Клетки Rec-1 и SU-DHL-6 высевали в концентрации 1×104 клеток/лунку в 100 мкл среды в 96-луночные планшеты с черными стенками и дном. Клетки обрабатывали различными концентрациями CAS-024, которые предварительно инкубировали с F(ab)'2 к IgG человека, и планшеты инкубировали в течение 96 часов при 37°C, в 5% CO2 в присутствие серийных разведений бендамустина. Конечный объем в каждой лунке составлял 150 мкл. После инкубирования планшеты охлаждали до комнатной температуры и метили с использованием детектирующего реактива ATPlite в концентрации 100 мкл/лунку (Perkin Elmer, Boston, MA). В данном тесте изменяли клеточную АТФ в качестве маркера жизнеспособных клеток. Образцы анализировали посредством детекции люминесценции с использованием сканера планшетов Topcount NXT (Perkin Elmer, Waltham, MA). Данные преобразовывали, используя интерполяцию 4-параметрической кривой в Prism (версия 4.0, Graphpad Software, San Diego, CA) и определяли IC50 как концентрацию, приводящую к 50% ингибированию по сравнению с необработанными культурами.

Для определения синергизма, для анализа данных использовали способ среднего эффекта/комбинационного индекса (КИ) (Chou and Talalay). Численное значение, присвоенное каждой комбинации лекарственных средств с предварительно заданными уровнями дозы, делает возможным количественное сравнение взаимодействия лекарственных средств для различных комбинаций лекарственных средств. По значениям КИ взаимодействиям присваивали одну из трех категорий: синергизм, аддитивность и антагонизм (КИ<1,0, =1 или >1,0, соответственно). После мечения и преобразования данных, определяли значения комбинационного индекса (КИ) с использованием пакета программного обеспечения Calcusyn (Biosoft, Cambridge, UK). Результаты двух отдельных экспериментов показывают, что комбинация CAS-024 с бендамустином оказывала синергетическое ингибирующее действие на рост клеток-мишеней (см. фиг. 11). Были получены подобные результаты, которые показывают, что комбинация CAS-024 с бендамустином также синергетически ингибировала рост клеток SU-DHL-6.

Также с использованием описанного выше способа определяли действие комбинации CAS-024 с другим алкилирующим средством, хлорамбуцилом, а концентрации приведены на фиг. 12. В отличие от бендамустина, хлорамбуцил в сочетании с CAS-024 не оказывал синергетического ингибирующего действия на рост клеток SU-DHL-6 (см. фиг. 13)

ПРИМЕР 12

ЭФФЕКТИВНОСТЬ CAS-024 В КОМБИНАЦИИ С БЕНДАМУСТИНОМ НА МОДЕЛИ КСЕНОТРАНСПЛАНТАТА ОПУХОЛИ ЧЕЛОВЕКА

Данное исследование проводили для сравнения эффективности комбинации CAS-024 и бендамустина с каждым средством, вводимым отдельно, против подкожных ксенотрансплантатов опухоли человека DOHH2 у SCID-мышей.

Введение опухолевых ксенотрансплантатов и сортировка на группы лечения

Как описано выше, DOHH2 представляет собой CD20+CD37+ B-лимфобластоидную клеточную линию человека, полученную у пациента с фолликулярной лимфомой. Пять миллионов клеток DOHH2 подкожно инъецировали в бок самкам мышей CB-17SCID. На 8 сутки после инокулирования опухоли, пальпируемые опухоли были различимы у большинства мышей. Несущих опухоль мышей рассортировали на пять групп с равными средними объемами опухоли (n=15 в группе; 3 клетки по 5 мышей для каждой группы). Сутки сортировки определили как сутки 0. Диаметры опухолей определяли с помощью пары циркулей, а объемы опухолей вычисляли с помощью формулы: V=1/2[длина×(ширина)2]. Исходный средний объем опухоли составлял 231 мм3, средний исходный размер опухоли составлял 229 мм3, а диапазон составил от 201 до 261 мм3.

Лечение in vivo

Группы мышей лечили инъекциями по 0,2 мл PBS, содержащими 10 мкг huIgG (сутки 0, 4, 8 внутривенно), 10 мкг CAS-024 (сутки 0, 4, 8 внутривенно), 10 мг/кг бендамустина (0, 2, 4, 7, 9 интраперитонеально) или 10 мкг CAS-024 (сутки 0, 4, 8 внутривенно) и 10 мг/кг бендамустина (0, 2, 4, 7, 9 интраперитонеально).

Наблюдение и конечные точки

Мышей подвергали ежедневному мониторингу посредством визуального осмотра. Массу определяли еженедельно, а диаметр опухоли по меньшей мере 3 раза в неделю (пн, ср, пт) определял наблюдатель, не владеющий сведениями о группах лечения (см. выше). Объем опухоли вычисляли, как описано выше.

Мышей подвергали эвтаназии, если объем опухоли у них достигал более 1500 мм3 (или 1200 мм3 в пятницу). Смерть не являлась конечной точкой в протоколах течения опухоли и, если не указано иначе, "выживаемость" мыши определяли по моменту времени, когда ее подвергали эвтаназии вследствие превышения у нее опухолью объема предварительно определенных пределов. Мышей подвергали эвтаназии, если объемы опухолей у них превышали указанные выше величины, происходило изъязвление опухоли, опухоль препятствовала подвижности мыши или потеря массы превышала 20%.

Статистический анализ

Все статистические исследования осуществляли с использованием программного обеспечения GraphPad Prism. Значимые различия по средним объемам опухолей и средним относительным объемам опухолей определяли с использованием однофакторного дисперсионного анализа для непараметрических данных (критерий Крускала-Уоллиса) с апостериорным критерием множественного сравнения Данна. Значимые различия по выживаемости мышей с течением времени определяли с использованием анализа выживаемости Каплана-Мейера с логарифмическим ранговым критерием для сравнения кривых выживаемости. Значимые различия по частоте отсутствия опухолей у мышей определяли с использованием точного критерия Фишера, значимыми считали значения p<0,05.

В группах лечения бендамустином неухоженную шерсть и диарею наблюдали, начиная приблизительно с 6 суток. На 10 сутки одну мышь в группе лечения бендамустином+CAS-024 подвергли эвтаназии вследствие потери более >20% массы. Эту мышь обрабатывали как цензурированные данные для анализа кривых выживаемости. В группе лечения одним CAS-024 клинических признаков токсичности не наблюдали.

Все лекарственные средства продемонстрировали ингибирующее действие на рост DOHH2 по сравнению с huIgG. На 13 сутки (которые являлись последними сутками, когда все мыши были живы) средний объем опухоли и средний относительный объем опухоли во всех группах лечения статистически значимо отличались от контрольной группы мышей, получавших huIgG (фиг. 14A и 14B). Также между группами лечения бендамустином и комбинацией бендамустина+CAS-024 наблюдали значимые различия по средним объемам опухолей и средним относительным объемам опухолей. Между любыми другими двумя группами лечения значимые различия по средним объемам опухолей и средним относительным объемам опухолей отсутствовали. Динамика средних объемов опухолей для четырех групп приведена на фиг. 15.

У мышей, которых лечили с использованием huIgG, опухоли росли быстро, и все мыши в этой группе подвергнуты эвтаназии на сутки 17. Как показано на фиг. 16 и подытожено в таблицах 12 и 13, выживаемость мышей в любой группе лечения по сравнению с группой лечения huIgG увеличена (p<0,0001 для всех групп). Также существовало значимое различие между кривыми выживаемости всех трех групп лечения и любой другой, причем комбинация CAS-024/бендамустин превосходила любое отдельное средство.

Ни одна из мышей, обрабатываемых с использованием huIgG, не выжила (таким образом, ни у одной не отсутствовала опухоль) до конца исследования (34 день) (фиг. 17 и таблица 12). Частота отсутствия опухолей у мышей в других группах составляла 0/15 (0%) в группах лечения CAS-024 и бендамустином и 2/14 (14%) в группе лечения комбинацией CAS-024+бендамустин. Между любыми другими группами лечения значимые различия по частоте отсутствия опухолей у мышей отсутствовали.

Таблица 12
Среднее время выживаемости и частота отсутствия опухолей у мышей в конце периода наблюдения
Группа леченияa Сутки лечения Среднее время выживаемости (дни)a Частота отсутствия опухолей в конце исследования
huIgG сутки 0, 4, 8 15 0/15 (0%)
CAS-024
10 мкг
сутки 0, 4, 8 17 b 0/15 (0%)
Бендамустин 10 мг/кг сутки 0, 2, 4, 7, 9 17 0/15 (0%)
CAS-024+ бендамустин сутки 0, 4, 8
0, 2, 4, 7, 9
24 2/14 (14%)d
a "Выживаемость" мыши определялась теми сутками, когда ее подвергли эвтаназии вследствие роста опухоли. Одну мышь в группе лечения комбинацией CAS-024+бендамустин подвергли эвтаназии на сутки 10 вследствие потери >20% массы. Эту мышь обрабатывали как цензурированные данные при вычислении кривых выживаемости. Ни одну другую мышь не подвергли эвтаназии по причине, отличной от достижения предварительно заданного предела объема опухоли.
b Значения, выделенные полужирным шрифтом, указывают на то, что кривые выживаемости указанной группы значимо отличаются от кривых выживаемости для контроля huIgG (p<0,0001 для всех групп лечения; логарифмический ранговый критерий).
c Мыши, у которых отсутствовали опухоли, не имели пальпируемых подкожных опухолей. Отсутствие опухолевых клеток не подтверждали гистологическим исследованием. Исследование заканчивали на сутки 34.
d В группе лечения комбинацией CAS-024+бендамустин одну мышь подвергли эвтаназии на сутки 10 вследствие потери >20% массы. Ни одну другую мышь не подвергли эвтаназии в связи с токсичностью.
Таблица 13
Значения p при сравнении кривых выживаемости между группами лечения
Значения p для сравнения кривых выживаемости (логарифмический ранговый критерий)
huIgG TRU-016 Бендамустин TRU-016 + бендамустин
huIgG н.п. <0,0001 <0,0001 <0,0001
TRU-016 <0,0001 a н.п. 0,0050 0,01
Бендамустин <0,0001 0,0050 н.п. <0,0001
TRU-016+ бендамустин <0,0001 0,01 <0,0001 н.п.

Данное исследование показывает, что CAS-024 в комбинации с бендамустином оказывал ингибирующее действие на рост опухолей DOHH2 у SCID-мышей в большей степени по сравнению с тем, что наблюдали для каждого средства в отдельности.

Различные описанные выше варианты осуществления можно объединять для предоставления дополнительных вариантов осуществления. Все патенты США, публикации патентных заявок США, патентные заявки США, иностранные патенты, иностранные патентные заявки и непатентные публикации, указанные в настоящем описании и/или перечисленные в Application Data Sheet, включены в настоящий документ в качестве ссылки в полном объеме. Аспекты вариантов осуществления, при необходимости, можно модифицировать для использования концепций различных патентов, заявок и публикаций, чтобы предоставить другие дополнительные варианты осуществления.

Эти и другие изменения можно осуществлять в вариантах осуществления в свете приведенного выше подробного описания. В основном, термины, использованные в следующих пунктах формулы изобретения, не следует рассматривать, как ограничивающие формулу изобретения конкретными вариантами осуществления, описанными в настоящем описании и формуле изобретения, но следует рассматривать как включающие все возможные варианты осуществления вместе с полным объемом эквивалентов, к которым такие пункты формулы изобретения относятся. Таким образом, формула изобретения не ограничена настоящим описанием.

1. Молекула, специфически связывающаяся с CD37, содержащая от N-конца до С-конца:
(a) CD37-специфическую одноцепочечную Fv (scFV), содержащую от N-конца до С-конца: (i) гуманизированную вариабельную область тяжелой цепи, содержащую CDR1 тяжелой цепи с последовательностью SEQ ID NO:63, CDR2 тяжелой цепи с последовательностью SEQ ID NO:65 и CDR3 тяжелой цепи с последовательностью SEQ ID NO:68,
(ii) линкер, имеющий от 5 до 30 аминокислот, включительно, и
(iii) гуманизированную вариабельную область легкой цепи, содержащую CDR1 легкой цепи с последовательностью SEQ ID NO:61, CDR2 легкой цепи с последовательностью SEQ ID NO:64 и CDR3 легкой цепи с последовательностью SEQ ID NO:66;
(b) шарнирную область; и
(c) иммуноглобулиновые области CH2 и СН3.

2. Молекула, специфически связывающаяся с CD37, по п.1, где линкер содержит последовательность SEQ ID NO:229.

3. Молекула, специфически связывающаяся с CD37, по п.1, где иммуноглобулиновые области CH2 и CH3 представляют собой области CH2 и CH3 IgG1 человека.

4. Молекула, специфически связывающаяся с CD37, по п.1, содержащая аминокислотную последовательность SEQ ID NO:253.

5. Выделенная молекула нуклеиновой кислоты, кодирующая молекулу, специфически связывающуюся с CD37, по п.1.

6. Вектор, содержащий молекулу нуклеиновой кислоты по п.5, где вектор способен экспрессировать молекулу, специфически связывающуюся с CD37, по п.1.

7. Выделенная клетка-хозяин, содержащая вектор по п.6, где клетка-хозяин способна продуцировать молекулу, специфически связывающуюся с CD37, по п.1.

8. Композиция для лечения заболевания или расстройства, связанного с аномальной активностью B-клеток, содержащая эффективное количество молекулы, специфически связывающейся с CD37, по п.1 и фармацевтически приемлемый носитель, для лечения заболевания или расстройства, связанного с аномальной активностью B-клеток.

9. Композиция, содержащая эффективное количество молекулы, специфически связывающейся с CD37, по п.1, для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток.

10. Композиция по п.9, где B-клеточное заболевание или расстройство представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, ювенильный ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, антигломерулярное заболевание базальной мембраны, быстро прогрессирующий гломерулонефрит, болезнь Бергера (IgA нефропатию), системную красную волчанку (СКВ), болезнь Крона, язвенный колит, идиопатическую тромбоцитопеническую пурпуру (ИТП), синдром антифосфолипидных антител, нейромиелит зрительного нерва, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит, макроглобулинемию Вальденстрема, хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ), волосатоклеточный лейкоз, мелкоклеточную лимфому, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек (MALT), нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта.

11. Применение молекулы, специфически связывающейся с CD37, по п.1 для получения лекарственного средства для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток.

12. Применение по п.11, где B-клеточное заболевание или расстройство представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, ювенильный ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, антигломерулярное заболевание базальной мембраны, быстро прогрессирующий гломерулонефрит, болезнь Бергера (IgA нефропатию), системную красную волчанку (СКВ), болезнь Крона, язвенный колит, идиопатическую тромбоцитопеническую пурпуру (ИТП), синдром антифосфолипидных антител, нейромиелит зрительного нерва, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит, макроглобулинемию Вальденстрема, хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ), волосатоклеточный лейкоз, мелкоклеточную лимфому, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек (MALT), нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта.

13. Лекарственное средство, содержащее эффективное количество молекулы, специфически связывающейся с CD37, по п.1, для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток.

14. Лекарственное средство по п.13, где B-клеточное заболевание или расстройство представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, ювенильный ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, антигломерулярное заболевание базальной мембраны, быстро прогрессирующий гломерулонефрит, болезнь Бергера (IgA нефропатию), системную красную волчанку (СКВ), болезнь Крона, язвенный колит, идиопатическую тромбоцитопеническую пурпуру (ИТП), синдром антифосфолипидных антител, нейромиелит зрительного нерва, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит, макроглобулинемию Вальденстрема, хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ), волосатоклеточный лейкоз, мелкоклеточную лимфому, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек (MALT), нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта.

15. Композиция, содержащая эффективное количество молекулы, специфически связывающейся с CD37, по п.1 и бендамустин, для лечения заболевания или расстройства, связанного с аномальной активностью B-клеток.

16. Композиция по п.15, где молекула, специфически связывающаяся с CD37, конкурирует с моноклональным антителом G28-1 при специфичном связывании с CD37.

17. Композиция по п.15, где молекула, специфически связывающаяся с CD37, является гуманизированной.

18. Композиция по п.15, где молекула, специфически связывающаяся с CD37, содержит от N-конца до С-конца:
(a) CD37-специфическую одноцепочечную Fv (scFV), содержащую от N-конца до С-конца: (i) гуманизированную вариабельную область тяжелой цепи, содержащую CDR3 тяжелой цепи с последовательностью SEQ ID NO:68, (ii) линкер, и (iii) гуманизированную вариабельную область легкой цепи;
(b) шарнирную область; и
(c) иммуноглобулиновые области CH2 и CH3.

19. Композиция по п.15, где молекула, специфически связывающаяся с CD37, содержит аминокислотную последовательность SEQ ID NO:253.

20. Лекарственное средство, содержащее эффективное количество молекулы, специфически связывающейся с CD37, по п.1, для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток, отличающееся тем, что лекарственное средство получено для введения до, одновременно или после бендамустина.

21. Лекарственное средство, содержащее эффективное количество молекулы, специфически связывающейся с CD37, по п.1, для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток, отличающееся тем, что лекарственное средство получено для введения до, одновременно или после второго средства, выбранного из группы, состоящей из флударабина и винкристина.

22. Лекарственное средство по п.20, дополнительно отличающееся тем, что лекарственное средство получено для введения до, одновременно или после второго средства, выбранного из группы, состоящей из флударабина и винкристина.

23. Лекарственное средство по п.20 или 21, где молекула, специфически связывающаяся с CD37, содержит от N-конца до С- конца:
(a) CD37-специфическую одноцепочечную Fv (scFV), содержащую от N-конца до С-конца: (i) гуманизированную вариабельную область тяжелой цепи, содержащую CDR3 тяжелой цепи с последовательностью SEQ ID NO:68, (ii) линкер, и (iii) гуманизированную вариабельную область легкой цепи;
(b) шарнирную область; и
(c) иммуноглобулиновые области CH2 и CH3.

24. Лекарственное средство по п.20 или 21, где молекула, специфически связывающаяся с CD37, содержит аминокислотную последовательность SEQ ID NO:253.

25. Лекарственное средство по п.20 или 21, где B-клеточное заболевание или расстройство представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, ювенильный ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, антигломерулярное заболевание базальной мембраны, быстро прогрессирующий гломерулонефрит, болезнь Бергера (IgA нефропатию), системную красную волчанку (СКВ), болезнь Крона, язвенный колит, идиопатическую тромбоцитопеническую пурпуру (ИТП), синдром антифосфолипидных антител, нейромиелит зрительного нерва, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит, макроглобулинемию Вальденстрема, хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ), волосатоклеточный лейкоз, мелкоклеточную лимфому, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек (MALT), нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта.

26. Применение молекулы, специфически связывающейся с CD37, по п.1 для получения лекарственного средства для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток,
где лекарственное средство состоит из эффективного количества молекулы, специфически связывающейся с CD37, и отличается тем, что лекарственное средство получено для введения до, одновременно или после введения эффективного количества бендамустина.

27. Применение молекулы, специфически связывающейся с CD37, по п.1 для получения лекарственного средства для снижения количества B-клеток или лечения заболевания или расстройства, связанного с аномальной активностью B-клеток,
где лекарственное средство состоит из эффективного количества молекулы, специфически связывающейся с CD37, и отличается тем, что лекарственное средство получено для введения до, одновременно или после средства, выбранного из группы, состоящей из флударабина и винкристина.

28. Применение по п.26, дополнительно отличающееся тем, что лекарственное средство получено для введения до, одновременно или после второго средства, выбранного из группы, состоящей из флударабина и винкристина.

29. Применение по п.26 или 27, где молекула, специфически связывающаяся с CD37, содержит от N-конца до С-конца:
(a) CD37-специфическую одноцепочечную Fv (scFV), содержащую от N-конца до С-конца: (i) гуманизированную вариабельную область тяжелой цепи, содержащую CDR3 тяжелой цепи с последовательностью SEQ ID NO:68, (ii) линкер, и (iii) гуманизированную вариабельную область легкой цепи;
(b) шарнирную область; и
(с) иммуноглобулиновые области CH2 и CH3.

30. Применение по п.26 или 27, где молекула, специфически связывающаяся с CD37, содержит аминокислотную последовательность SEQ ID NO:253.

31. Применение по п.26 или 27, где B-клеточное заболевание или расстройство представляет собой идиопатическую воспалительную миопатию, ревматоидный артрит, ювенильный ревматоидный артрит, миастению гравис, болезнь Грейва, сахарный диабет I типа, антигломерулярное заболевание базальной мембраны, быстро прогрессирующий гломерулонефрит, болезнь Бергера (IgA нефропатию), системную красную волчанку (СКВ), болезнь Крона, язвенный колит, идиопатическую тромбоцитопеническую пурпуру (ИТП), синдром антифосфолипидных антител, нейромиелит зрительного нерва, рассеянный склероз, аутоиммунное заболевание, дерматомиозит, полимиозит, макроглобулинемию Вальденстрема, хронический лимфолейкоз (ХЛЛ), неходжкинскую лимфому (НХЛ), волосатоклеточный лейкоз, мелкоклеточную лимфому, лимфоплазмоцитарную лимфому, лимфому маргинальной зоны селезенки, экстранодальную B-клеточную лимфому маргинальной зоны лимфоидной ткани слизистых оболочек (MALT), нодальную B-клеточную лимфому маргинальной зоны, фолликулярную лимфому, лимфому из клеток мантийной зоны, диффузную B-клеточную крупноклеточную лимфому, медиастинальную (тимическую) B-клеточную крупноклеточную лимфому, интраваскулярную B-клеточную крупноклеточную лимфому, первичную экссудативную лимфому, лимфому/лейкоз Беркитта.



 

Похожие патенты:

Изобретение относится к области иммунологии и биотехнологии. Представлены вариантные рекомбинантные антитела против VEGF человека, имеющие вариабельные области тяжелой и легкой цепей, содержащие гипервариабельне участки (CDR) антител кролика.

Изобретение относится к биохимии, в частности к моноклональному антителу человека, специфичному к альфа-токсину S. aureus.

Изобретение относится к области иммунологии и биотехнологии. Представлены выделенное, искусственное или рекомбинантное антитело или его функциональная часть, способные специфически связывать F-антиген респираторно-синцитиального вируса, которые включают: вариабельную последовательность тяжелой цепи, содержащую CDR1 NYIIN (SEQ ID NO:1), CDR2 GIIPVLGTVHYAPKFQG (SEQ ID NO:2), CDR3 ETALVVSTTYLPHYFDN (SEQ ID NO:3), и вариабельную последовательность легкой цепи, содержащую CDR1 QASQDIVNYLN (SEQ ID NO:4), CDR2 VASNLET (SEQ ID NO:5), CDR3 QQYDNLP (SEQ ID NO:6); а также нуклеотидная последовательность, кодирующая указанное антитело.

Изобретение относится к области биотехнологии и иммунологии. Описаны варианты антител, связывающих молекулу GRM, а также их антигенсвязывающие фрагменты, аминокислотные последовательности вариабельных областей которых представлены в материалах заявки.

Изобретение относится к биохимии. Описан способ иммунологического анализа белка CXCL1 человека.

Изобретение относится к области биотехнологии и иммунологии. Представлено антитело, которое представляет собой нейтрализующее антитело против VEGFR-2/KDR, гипервариабельные участки которого являются идентичными гипервариабельным участкам антитела TTAC 0001 против VEGFR-2/KDR, слитое со связывающим доменом ангиопоэтина 2, являющимся лигандом Tie-2, для лечения рака посредством ингибирования ангиогенеза.

Изобретение относится к новым соединениям общей формулы 1 или 2 или их фармацевтически приемлемым солям, обладающим сродством к CD16а рецептору. Изобретение также относится к модифицированным этими соединениями белкам (конъюгатам), усиливающим и направляющим антителозависимую клеточную цитотоксичность.

Изобретение относится к области биотехнологии и иммунологии. Описано химерное рекомбинантное антитело, специфически связывающееся с эритропоэтином человека, характеризующееся следующими признаками: а) Kd=2,4×10-9 М, изоэлектрическая точка в диапазоне рН 7,5-8,0; б) последовательность тяжелой цепи SEQ ID NO:12; в) последовательность легкой цепи SEQ ID NO:14.

Изобретение относится к области биотехнологии и иммунологии. Представлены варианты биспецифичных антител, специфически связывающихся с EGFR и HER3, которые содержат аминокислотные последовательности вариабельных областей тяжелой и легкой цепей, соответственно, SEQ ID NO:30 и 29; или SEQ ID NO:28 и 27; или SEQ ID NO:28 и 29; или содержат комплементарные регионы CDR тяжелой и легкой цепей из указанных последовательностей вариабельных областей.

Изобретение относится к области иммунологии. Представлены два антитела против IL-21 человека.

Настоящее изобретение относится к биотехнологии и представляет собой фармацевтическую комбинацию для лечения ревматического заболевания, содержащую гуманизированное анти-CD4 антитело, способное к активации CD4+CD25+ регуляторных Т-клеток, и метотрексат.

Настоящее изобретение относится к области иммунологии. Предложены варианты антител против NR10 человека или яванского макака, в том числе гуманизированные.

Настоящее изобретение относится к области иммунологии. Предложено антитело, специфически связывающееся с эпитопом на CD43 и CEA и имеющее модификации в константной области тяжелой и/или легкой цепи.

Настоящее изобретение относится к области иммунологии. Предложено выделенное моноклональное антитело к интегрину α5β1 человека.

Настоящее изобретение относится к области иммунологии. Предложено лекарственное средство для лечения ревматоидного артрита, хронического артрита у детей или болезни Кастлемена, представляющее собой антитело против рецептора IL-6, полученное на основе антитела TOCILIZUMAB.

Настоящее изобретение относится к области иммунологии. Предложено однодоменное мини-антитело, специфически связывающее белок-рецептор эпидермального фактора роста HER2/ERBB2/neu человека, полученное при иммунизации двугорбого верблюда (Camelus bactrianus) препаратом опухолевых клеток SKBR3, и охарактеризованное аминокислотной последовательностью.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены: фармацевтическая композиция и способ, основанные на введении пациенту терапевтически эффективного количества антитела против CD200, содержащего константный участок G2/G4, для лечения больного злокачественным новообразованием, содержащим положительные по CD200 злокачественные клетки.

Группа изобретений относится к применению агента, уменьшающего количество B-клеток, для лечения синдрома хронической усталости, а также к способу лечения синдрома хронической усталости, включающему стадию введения агента, уменьшающего количество В-клеток, страдающему им индивидууму.

Изобретение относится к области биотехнологии, конкретно к выделенным моноклональным антителам, в частности CDR-привитым гуманизированным антителам, которые связываются с эпитопом молекулы RAGE человека и, в частности обладают способностью ингибировать связывание RAGE с различными лигандами.

Изобретение относится к области биохимии, в частности к антителам, которые специфично связываются с рецепторами эпидермального фактора роста (EGFR), а также к ДНК, которые кодируют вариабельные области тяжелой цепи указанных антител, ДНК, которые кодируют вариабельные области легкой цепи указанных антител.

Настоящее изобретение относится к биотехнологии и представляет собой фармацевтическую комбинацию для лечения ревматического заболевания, содержащую гуманизированное анти-CD4 антитело, способное к активации CD4+CD25+ регуляторных Т-клеток, и метотрексат.
Наверх