Моноклональные антитела против il-21 человека



Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека
Моноклональные антитела против il-21 человека

 


Владельцы патента RU 2504552:

ЗАЙМОДЖЕНЕТИКС, Инк. (US)

Изобретение относится к области иммунологии. Представлены два антитела против IL-21 человека. Первое антитело содержит вариабельную область тяжелой цепи, включающую SEQ ID NO: 31, 33 и 35, и вариабельную область легкой цепи, включающую SEQ ID NO: 39, 41 и 43. Второе антитело содержит вариабельную область тяжелой цепи, включающую SEQ ID NO: 47, 49 и 51, и вариабельную область легкой цепи, включающую SEQ ID NO: 55, 57 и 59. Кроме того, описаны гибридомы, продуцирующие первое и второе антитело против IL-21 человека и депонированные в коллекции культур «American Type Culture Collection» под номерами «АТСС Patent Deposit Designation РТА-8790» и «АТСС Patent Deposit Designation РТА-8786» соответственно. Изобретение позволяет получить антитела к IL-21 человека. 6 н. и 42 з.п. ф-лы, 4 ил., 16 табл., 23 пр.

 

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

[1] Иммунная система является первичной защитой организма от заболеваний, вызываемых патогенами, а именно бактериями, вирусами, грибами и т.д., а также от заболеваний, вызываемых аномальным ростом собственных клеток и тканей организма (т.е. злокачественных опухолей). Обычно иммунная система обладает способностью различать нормальные клетки организма или "свои" и чужеродные патогены или аномальные клетки или "не свои, чужие". Процессы, посредством которых иммунная система воздерживается от реагирования на собственное тело, называют толерантностью. Иногда иммунная система теряет способность узнавать "свое" как нормальное и последующий ответ, направленный против ткани или клеток, приводит к потере толерантности, состояние аутоиммунитета. Патологии, возникающие вследствие аутоиммунитета, часто имеют серьезные клинические последствия и являются одной из основных проблем со здоровьем в мире, особенно в промышленно развитых странах.

[2] IL-21 представляет собой мощный иммуномодулирующий цитокин I типа из четырех α-спиральных тяжей, который связывается с гетеродимерным рецептором, состоящим из IL-21 R и общей гамма-цепи (обзор, Spolski and Leonard, Annu Rev Immunol. Nov 8; 2007). IL-21 продуцируется NK-T-клетками и CD4+Т-клетками (в том числе провоспалительными клетками Th17 и фолликулярными Т-клетками-хелперами, TFN, которые являются важными для ответов герминального центра) и обладает плейотропными эффектами как на врожденные, так и на адаптивные иммунные ответы, в том числе усиленную пролиферацию В-клеток и Т-клеток, повышенную цитотоксичность CD8+Т-клеток и натуральных (естественных) киллерных (NK) клеток, дифференцировку В-клеток в иммуноглобулин-секретирующие плазматические клетки, и регуляцию клеточной линии Th17 (см. ниже). IL-21 также может ингибировать антигенпрезентирующую функцию дендритных клеток и при определенных условиях может индуцировать апоптоз в В-клетках и NK-клетках. IL-21 обладает мощной противоопухолевой активностью, но также был ассоциирован с развитием различных аутоиммунных заболеваний, в том числе системной красной волчанкой (SLE), ревматоидным артритом (RA), воспалительным заболеванием кишечника (IBD) и псориазом (обзор, Spolski and Leonard, Anna Rev Immunol. Nov. 8. 2007).

[3] Было показано, что IL-21 модулировал ответы антител прямым действием на В-клетки (Mehta et al., J. Immunol., 170:4111-4118, 2003; Ozaki et al., Science, 298:1630-1634, 2002; Suto et al., Blood. 100:4565-4573, 2002). IL-21 может индуцировать дифференцировку наивных В-клеток в антителосекретирующие плазматические клетки (Ozaki et al., J. Immunol. 173:5361, 2004; Ettinger et al., J. Immunol. 175:7867-79, 2005; Ettinger et al., J. Immunol. 128:2872-82, 2007; Kuchen et al., J. Immunol. 179:5886-96, 2007) и стимулировать продуцирование IgE в В-клетках человека (Kobayashi et al., Human Immunol, doi: 10:1016/j.humimm.2008.10.). У животных, лишенных IL-21 или IL-21 R, меньше антителосекретирующих клеток образуется в результате реакции герминального центра и снижается созревание аффинности (Zotos et al., представлено к публикации). Экстрафолликулярные антителообразующие клетки, которые вовлечены в аутоиммунитет, требуют когнатной помощи от субпопуляции специализированных CD4 Т-клеток, которые секретируют IL-21 (Odegard, et al., JEM 205(12): 2873-2886. 2008).

[4] Образование антител против аллогенного МНС является основным феноменом в отторжении трансплантата. Реципиенты с трансплантатом, у которых нарастают титры анти-МНС антител (высокочувствительные пациенты с трансплантацией), находятся во временном риске t в отношении хронического отторжения и являются плохими кандидатами для новых трансплантатов вследствие вероятности опосредованного антителами отторжения нового трансплантата (Smith, et al., Am J Transplantation 8: 1-11, 2008). В модели на крысах острого отторжения почечного аллотрансплантата IL-21 и IL-21 R были однозначно повышены в интраваскулярных мононуклеарных клетках почечных аллотрансплантатов, но не изотрансплантатов (Hecker, et al., Immunobiology: doi: 10.1016/i.imbio.2008.04.004. (2008)). У пациентов с трансплантатами сердца, подвергающихся отторжению, уровни экспрессии IL-21 и IL-21 R коррелируют со степенью отторжения согласно ISHLT (пер., ISHLT - Международное Общество трансплантации сердца и легких) и наивысшая экспрессия находится в степенях 1R и 2R (Baan, et al., Transplantation 83 (11): 1485-1492, 2007).

[5] В реакции "трансплантат против хозяина" (GVHD), ответ анти-алло опосредуется неконтролируемой активацией Т-лимфоцитов от трансплантата, которые контролируют воспалительный ответ против тканей хозяина. Регуляторные Т-клетки (Treg) могут модулировать данный ответ в моделях на животных. Было показано, что IL-21 нейтрализовал регуляторные функции Treg (Clough et al., J. Immunol. 180: 5395-5401, 2008). В мышиных моделях GVHD перенос Т-клеток, лишенных IL-21, приводила к существенно сниженным клиническим симптомам и гистологическим показателям и повышенной выживаемости по сравнению с Т-клетками WT. Пониженную частоту Т-клеток, секретирующих IFN-гамма, и повышенную Tregs наблюдали в слизистой оболочке ободочной кишки. Блокада IL-21 с использованием анти-mIL-21 mAb и перенос Т-клеток WT продуцировали подобные результаты (Bucher et al., Blood (ASH Annual Meeting Abstracts) 2008 112: Abstract #2342).

[6] Также недавно было показано, что IL-21 и продуцируется провоспалительными Th17-клетками мыши, и требуется для дифференцировки провоспалительных Th17-клеток мыши (Korn et al., Nature, 448:484-487, 2007; Nurieva et al., Nature, 448:480-483, 2007; Zhou et al., Nat. Immunol., 8:967-974, 2007; Wei et al., J. Biol. Chem. 282:34605-34610, 2007). Человеческие Th17-клетки также продуцируют IL-21 и исследования продолжаются для определения, действует ли IL-21 как аутокринный фактор для человеческих Th17-клеток, так же как и IL-21 действует для Th17-клеток мыши. Ozaki et al. (J. Immunol. 173:5361, 2004) показали, что экспрессия IL-21 является повышенной у предрасположенных к волчанке мышей BXSB-Yaa, модель системной красной волчанки (SLE), в возрасте, при котором начальные признаки аутоиммунных процессов в первую очередь становятся выраженными. Лечение данных мышей BXSB-Yaa с помощью растворимого рецептора IL-21 мыши (mIL-21R-Fc) частично ингибирует различные параметры заболевания, в том числе гломерулонефрит (Bubier et al., Ann N Y Acad. Sci. 1110:590-601. 2007). Также было показано, что лечение с помощью mIL-21R-Fc являлось эффективным в другой доклинической мышиной модели заболевания SLE, MRL/lpr (Herber et al., J. Immunol. 178: 3822-3830, 2007), а также в модели коллаген-индуцированного артрита (CIA) ревматоидного артрита (Young et al., Arthr. Rheum. 56: 1152-1163, 2007). Предварительные данные в отношении человека также наводят на мысль о дисрегуляции IL-21 и IL-21 R в SLE (Mitoma et al., Int. J. Mol. Med. 16: 609-615. 2005; Wang et al., Chinese J. Cell. Mol. Immunol. 23(11):1041-1042. 2007; Sawalha et al., Ann Rheum. Dis. 67: 458-461, 2008). Совсем недавно, данные Rus et al., полученные от 24 SLE пациентов и 15 здоровых контролей (Nguyen et al., ACR/ARHP Scientific Meeting, 1760/482, 2008 Oct 24-29 San Francisco, CA). Rus et al. показали, что 1) экспрессия мРНК IL-21 является существенно повышенной в CD4+Т-клетках пациентов с волчанкой по сравнению с контролями, 2) уровни IL-21 являются существенно повышенными в сыворотках пациентов с активными SLE по сравнению с неактивными SLE или контролями, 3) IL-21 повышает пролиферацию CD4+Т-кпеток и CD19+В-клеток у пациентов и контролей дозозависимым образом, 4) IL-21 усиливает дифференцировку плазматических клеток, индуцированную анти-CD40, у обычных контрольных пациентов и SLE пациентов, и 5) повышенные уровни IL-21 могут вносить вклад в пролиферацию аутореактивных CD4+Т-клеток и дифференцировку плазматических клеток у SLE.

[7] Monteleone et al. показали, что экспрессия РНК и белка IL-21 является повышенной в воспаленной, но не в невоспаленной ткани пациентов с болезнью Крона (CD) (и, в меньшей степени, с язвенным колитом) и что продуцирование IL-21 CD3+-клетками монононуклеарных клеток собственной пластинки пациентов с CD также является повышенным (Monteleone et al. Gastroenterology 128:687-694, 2005; Monteleone et al. Gut 55: 1774-1780, 2006; Peluso et al., J. Immunol. 178:732-739, 2007). Эти авторы предположили, что IL-21 регулирует экспериментальный колит модуляцией баланса между регуляторными Т-клетками (Tregs) и Th17-клетками (Fantini et al., Eur. J. Immunol. 37:3155-3163, 2007). Ингибирование IL-21 in vivo с использованием растворимого рецептора IL-21 как в мышиной, так и в крысиной моделях колита приводит к существенным снижениям клинических симптомов колита (Young et al. US 2006/0039902).

[8] Рецептор IL-21 экспрессируется NK-клетками, и было показано, что NK-клетки являются ответственными за лечение с помощью IL-21 как in vivo, так и in vitro. У онкологических пациентов, леченных с помощью рекомбинантного человеческого IL-21, наблюдали измененные распределения субпопуляций лимфоцитов, в том числе NK-клеток, и повышенную экспрессию маркеров активации NK-клеток и активность цитолитических эффекторов (Frederiksen, et al., Cancer Immunol Immunother 57(10); 1439-1449, 2008). При аутоиммунных заболеваниях активность NK-клеток может играть роль в активации воспаления и сопутствующего повреждения ткани. Хоуминг NK-клеток в ткани управляется хемоаттрактантами, высвобождаемыми в месте воспаления (Morris and Ley, Curr Mol Med.; 4(4):431-8. 2004). NK-клетки собственной пластинки пациентов с болезнью Крона высвобождали более значительные количества IFN-γ и TNF-α при стимуляции in vitro с помощью IL-21 и IgG по сравнению с клетками LPNK контролей (Liu and Jiu, Chronic Inflammation of Liver and Gut. Falk Symposium abst. No.163. 2008 Mar 14-15). Также сообщают, что NK-клетки регулируют аутоиммунитет и отторжение трансплантата посредством их взаимодействий с дендритными клетками (DC), путем уничтожения незрелых или активированных DC и путем высвобождения цитокинов, которые нарушают состояние активации и функции презентации антигена DC (Vivier et al., Nat. Immunol. 9(5):503-510. 2008; Laffont et al., Blood 112:661-671. 2008). Сравнение мононуклеарных клеток периферической крови толерантных и нетолерантных реципиентов с аллотрансплантатом печени показало изменения в транскрипционной программе NK-клеток (Martinez-Llordella et al., J. Clin. Invest. 118(8):2845-2857. 2008). Таким образом, блокада IL-21 может модулировать активационный статус NK-клеток, снижать их вклад в воспаление ткани в аутоиммунных заболеваниях и изменять течение болезни отторжения трансплантата. Также сообщается, что NK-клетки регулируют аутоиммунитет и отторжение трансплантата путем их взаимодействий с дендритными клетками (DC), путем уничтожения (пер., киллинга) незрелых или активированных DC и путем высвобождения цитокинов, которые нарушают состояние активации и изменяют функции презентации антигена DC. Таким образом, блокада IL-21 может модулировать активационный статус NK-клеток и снижать их вклад в воспаление ткани в аутоиммунных заболеваниях.

[9] Данное изобретение обеспечивает моноклональные антитела против IL-21 человека и способы применения данных антител, которые ингибируют симптомы и биологические активности, которые обнаруживают в виде аутоиммунных и воспалительных нарушений и являются ассоциированными с взаимодействиями IL 21/IL-21 рецептор.

КРАТКОЕ ОПИСАНИЕ ФИГУР

[10] Фигура 1 представляет собой выравнивание аминокислотных остатков, содержащих вариабельные области тяжелых цепей антител, обозначенных номерами клонов 362.78.1.44 (78), 362.597.3 (597), 362.75.1.1 (75), 366.552.11 (552), 366.328.10 (328).

[11] Фигура 2 представляет собой выравнивание аминокислотных остатков, содержащих вариабельную область легких цепей антител, описанных выше.

[12] Фигура 3 иллюстрирует масс-спектры MALDI/TOF областей пептидных последовательностей IL-21, полученных из IL-21 в чистом виде и иммунного комплекса IL-21. Пептидные последовательности IL-21, EKKPPKEF (SEQ ID NO: 2 от остатка 129 до 136) (m/z (пер., масса/заряд), 1002.5619 Да) и LERFKSLL (SEQ ID NO: 2 от остатка 137 до 144) (m/z, 1005.6091 Да) свободного состояния IL-21 (А). Сдвиг масс пептидов, обусловленный удерживанием дейтерирования амидов в присутствии IL-21 mAb (В). Другая область пептидной последовательности IL-21, KSLLQKMIHQHLSSRTHGSEDS (SEQ ID NO: 2 от остатка 141 до 162) (m/z, 2519.2451) свободного состояния IL-21 (С). Частичный сдвиг масс пептидов, обусловленный удерживанием дейтерирования амидов в присутствии IL-21 mAb (D).

[13] Фигура 4 иллюстрирует выбранные ионные хроматограммы ацетилированных и неацетилированных пептидов. Выбранная одна ионная хроматограмма ацетилированного TCPSCDSYEKKPPKEF (SEQ ID NO: 2 от остатка 119 до 136) (m/z, 1986 Да), выделенного из IL-21 в чистом виде (А) и аналогичная хроматографическая кривая иммунного комплекса IL-21 (В). Вложенный масс-спектр представляет собой трехзарядное состояние массы пептида (m/z, 662.9). Третья кривая демонстрирует выбранную ионную хроматограмму иона пептида при m/z 1018 Да, который представляет собой ацетилированный KSLLQKMI (SEQ ID NO: 2 от остатка 141 до 148), выделенного из IL-21 в чистом виде (С) и аналогичная хроматографическая кривая иммунного комплекса IL-21 (D). Вложенный масс-спектр представляет собой двухзарядное состояние массы пептида (m/z, 509.1).

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[14] В одном аспекте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее по меньшей мере 80% идентичность с аминокислотными остатками 20-145 SEQ ID NO: 29 и по меньшей мере 80% идентичность с аминокислотными остатками 21-126 SEQ ID NO: 37. В некоторых вариантах антитела содержат изменения по меньшей мере 80% идентичности, которые существуют в вариабельной области тяжелой цепи CDRI SEQ ID NO: 31.

[15] В другом аспекте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее: (а) область тяжелой цепи, содержащую: (i) вариабельную область тяжелой цепи CDR1, содержащую SEQ ID NO: 31; (ii) вариабельную область тяжелой цепи CDR2, содержащую SEQ ID NO: 33; и (iii) вариабельную область тяжелой цепи CDR3, содержащую SEQ ID NO: 35; и (b) область легкой цепи, содержащую: (i) вариабельную область легкой цепи CDRI, содержащую SEQ ID NO: 39; (ii) вариабельную область легкой цепи CDR2, содержащую SEQ ID NO: 41; и (iii) вариабельную область легкой цепи CDR3, содержащую SEQ ID NO: 43. В конкретных вариантах изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее аминокислотные остатки 20-145 SEQ ID NO: 29 и аминокислотные остатки 21-126 SEQ ID NO: 37. В других вариантах антитело является дополнительно содержащим аминокислотные остатки 1-145 SEQ ID NO: 29 и аминокислотные остатки 1-126 SEQ ID NO: 37. Другой вариант данного изобретения обеспечивает гибридому, обозначенную 362.78.1.44, где гибридому депонируют в Американской коллекции типовых культур, имеющую патентное депонированное обозначение в АТСС РТА-8790, и изобретение включает в себя антитело, продуцируемое гибридомой.

[16] Другой аспект данного изобретения обеспечивает моноклональное антитело против IL-21 человека, содержащее: (а) область тяжелой цепи, содержащую: (i) вариабельную область тяжелой цепи CDR1, содержащую SEQ ID NO: 47; (ii) вариабельную область тяжелой цепи CDR2, содержащую SEQ ID NO: 49; и (iii) вариабельную область тяжелой цепи CDR3, содержащую SEQ ID NO: 51; и (b) область легкой цепи, содержащую: (i) вариабельную область легкой цепи CDR1, содержащую SEQ ID NO: 55; (ii) вариабельную область легкой цепи CDR2, содержащую SEQ ID NO: 57; и (iii) вариабельную область легкой цепи CDR3, содержащую SEQ ID NO: 59. В некоторых вариантах изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее аминокислотные остатки 20-145 SEQ ID NO: 45 и аминокислотные остатки 21-126 SEQ ID NO: 53. В других вариантах изобретение является дополнительно содержащим аминокислотные остатки 1-145 SEQ ID NO: 45 и аминокислотные остатки 21-126 SEQ ID NO: 53. Другой вариант данного изобретения обеспечивает гибридому, обозначенную 362.597.3, где гибридому депонируют в Американской коллекции типовых культур, имеющую патентное депонированное обозначение в АТСС РТА-8786, и изобретение включает в себя антитело, продуцируемое гибридомой.

[17] В другом аспекте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее по меньшей мере 80% идентичность с аминокислотными остатками 20-141 SEQ ID NO: 13 и по меньшей мере 80% идентичность с аминокислотными остатками 21-126 SEQ ID NO: 21. В одном варианте изобретение включает в себя моноклональное антитело, где аминокислотные замены представляют собой консервативные аминокислотные замены.

[18] В другом аспекте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее: (а) область тяжелой цепи, содержащую: (i) вариабельную область тяжелой цепи CDR1, содержащую SEQ ID NO: 15; (ii) вариабельную область тяжелой цепи CDR2, содержащую SEQ ID NO: 17; и (iii) вариабельную область тяжелой цепи CDR3, содержащую SEQ ID NO: 19; и (b) область легкой цепи, содержащую: (i) вариабельную область легкой цепи CDR1, содержащую SEQ ID NO: 23; (ii) вариабельную область легкой цепи CDR2, содержащую SEQ ID NO: 25; и (iii) вариабельную область легкой цепи CDR3, содержащую SEQ ID NO: 27. В некоторых вариантах данное изобретение включает в себя моноклональное антитело против IL-21 человека, содержащее аминокислотные остатки 20-141 SEQ ID NO: 13 и аминокислотные остатки 21-126 SEQ ID NO: 21. В другом варианте изобретение является дополнительно содержащим аминокислотные остатки 1-141 SEQ ID NO: 13 и аминокислотные остатки 1 -126 SEQ ID NO: 21. Другой вариант данного изобретения обеспечивает гибридому, обозначенную 362.75.1.1, где гибридому депонируют в Американской коллекции типовых культур, имеющую патентное депонированное обозначение в АТСС РТА-8791, и антитело продуцируется гибридомой.

[19] В другом аспекте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее: (а) область тяжелой цепи, содержащую: (i) вариабельную область тяжелой цепи CDR1, содержащую SEQ ID NO: 79; (ii) вариабельную область тяжелой цепи CDR2, содержащую SEQ ID NO: 81; и (iii) вариабельную область тяжелой цепи CDR3, содержащую SEQ ID NO: 83; и (b) область легкой цепи, содержащую: (i) вариабельную область легкой цепи CDR1, содержащую SEQ ID NO: 87; (ii) вариабельную область легкой цепи CDR2, содержащую SEQ ID NO: 89; и (iii) вариабельную область легкой цепи CDR3, содержащую SEQ ID NO: 91. В одном варианте данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее аминокислотные остатки 20-136 SEQ ID NO: 77 и аминокислотные остатки 23-129 SEQ ID NO: 85. В другом варианте изобретение является дополнительно содержащим аминокислотные остатки 1-136 SEQ ID NO: 77 и аминокислотные остатки 1-129 SEQ ID NO: 85. Другой вариант данного изобретения обеспечивает гибридому, обозначенную 366.552.11, где гибридому депонируют в Американской коллекции типовых культур, имеющую патентное депонированное обозначение в АТСС РТА-8787, и антитело продуцируется гибридомой.

[20] В другом аспекте данное изобретение обеспечивает моноклональное антитело против IL-21, содержащее: (а) область тяжелой цепи, содержащую: (i) вариабельную область тяжелой цепи CDR1, содержащую SEQ ID NO: 63; (ii) вариабельную область тяжелой цепи CDR2, содержащую SEQ ID NO: 65; и (iii) вариабельную область тяжелой цепи CDR3, содержащую SEQ ID NO: 67; и (b) область легкой цепи, содержащую: (i) вариабельную область легкой цепи CDR1, содержащую SEQ ID NO: 71; (ii) вариабельную область легкой цепи CDR2, содержащую SEQ ID NO: 73; и (iii) вариабельную область легкой цепи CDR3, содержащую SEQ ID NO: 75. В некоторых вариантах данное изобретение обеспечивает моноклональное антитело против IL-21 человека, содержащее аминокислотные остатки 20-139 SEQ ID NO: 61 и аминокислотные остатки 23-129 SEQ ID NO: 69. В других вариантах данное изобретение является дополнительно содержащим аминокислотные остатки 1-139 SEQ ID NO: 61 и аминокислотные остатки 1-129 SEQ ID NO: 69. Другой вариант данного изобретения обеспечивает гибридому, обозначенную 366.328.10, где гибридому депонируют в Американской коллекции типовых культур, имеющую патентное депонированное обозначение в АТСС РТА-8789, и антитело продуцируется гибридомой.

[21] В другом аспекте данное изобретение обеспечивает гибридому, обозначенную 366.345.6.11, где гибридома является депонированной в Американской коллекции типовых культур, имеющей патентное депонированное обозначение в АТСС РТА-8788, и включает в себя антитело, продуцируемое гибридомой.

[22] В другом аспекте данного изобретения данное изобретение обеспечивает выделенное моноклональное антитело, которое связывается с прерывистым эпитопом, содержащим по меньшей мере две области в белке IL-21, где первая область состоит из по меньшей мере одной аминокислоты от остатка Ile45 до остатка Leu56 SEQ ID NO: 2 и вторая область состоит по меньшей мере из одного аминокислотного остатка Glul29 до остатка Leul44 SEQ ID NO: 2. В одном варианте изобретение обеспечивает, что первая область состоит из от 1 до 12 аминокислот от остатка Ile45 до остатка Leu56 SEQ ID NO: 2, и вторая область состоит из от 1 до 16 аминокислот от остатка Glul29 до остатка Leul44 SEQ ID NO: 2.

[23] В каждом аспекте включенных изобретений, описанных выше, находится вариант, в котором моноклональное антитело дополнительно содержит Fc-часть, и другой вариант, в котором Fc-часть выбрана из группы, состоящей из IgG1, IgG2 и IgG4, и другой вариант, в котором Fc-часть имеет сниженную эффекторную функцию.

[24] В другом аспекте данное изобретение обеспечивает способ лечения заболеваний, опосредованных фолликулярными Т-клетками-хелперами или опосредованных В-клетками у субъекта, путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь, где заболевания, опосредованные фолликулярными Т-клетками-хелперами и опосредованные В-клетками, выбраны из группы, состоящей из системной красной волчанки, аутоиммунной потери слуха, болезни Грейвса, обыкновенной пузырчатки, миастении гравис, нейромиелита зрительного нерва, синдрома Гудпасчера, аутоиммунного нефрита, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии и идиопатической тромбоцитопенической пурпуры (IТР).

[25] В другом аспекте данное изобретение обеспечивает способ лечения заболеваний, опосредованных ТН1-клетками или опосредованных ТН17-клетками у субъекта, путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь, где заболевания, опосредованные THI-клетками или опосредованные ТН17-клетками, выбраны из группы, состоящей из псориаза, спондилоартропатии, реактивного артрита, энтеропатического артрита, аутоиммунного миокардита, синдрома Кавасаки, глютеновой энтеропатии, увеита, болезни Бехчета, болезни коронарных артерий, хронического обструктивного легочного заболевания (COPD) и интерстициального заболевания легких.

[26] В другом аспекте данное изобретение обеспечивает способ лечения воспалительного заболевания кишечника (IBD) у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь, где воспалительное заболевание кишечника выбрано из группы, состоящей из болезни Крона, язвенного колита и синдрома раздраженной толстой кишки.

[27] В другом аспекте данное изобретение обеспечивает способ лечения ревматоидного артрита у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь.

[28] В другом аспекте данное изобретение обеспечивает способ лечения рассеянного склероза у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь.

[29] В другом аспекте данное изобретение обеспечивает способ лечения сахарного диабета I типа (IDDM) у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека.

[30] В другом аспекте данное изобретение обеспечивает способ лечения синдрома Шегрена у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь.

[31] В другом аспекте данное изобретение обеспечивает способ лечения субъекта с трансплантацией путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь, где подавляют отторжение трансплантата, устанавливают толерантность в схеме лечения перед трансплантацией или снижают титры аллоантител у субъекта.

[32] В другом аспекте данное изобретение обеспечивает способ лечения аутоиммунного заболевания у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь, где аутоиммунное заболевание выбрано из группы, состоящей из панкреатита, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, анкилозирующего спондилоартрита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции трансплантат против хозяина (GVHD), кожной Т-клеточной лимфомы (CTCL), гломерулонефрита, нефропатии IgA-типа, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома и астмы и других аутоиммунных заболеваний или других заболеваний, опосредованных антагонистами IL-21 и рецептора IL-21.

[33] В другом аспекте данное изобретение обеспечивает способ лечения системной эритематозной волчанки (SLE) у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь.

[34] В другом аспекте данное изобретение обеспечивает способ лечения псориаза у субъекта путем введения терапевтического количества заявляемых моноклональных антител против IL-21 человека, описанных здесь.

ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[35] Нижеследующие определения обеспечивают для облегчения понимания изобретений, описанных здесь.

[36] Термины "амино-концевой" и "карбокси-концевой" используются здесь для обозначения положений внутри полипептидов. Там, где позволяет контекст, эти термины используются со ссылкой на конкретную последовательность или часть полипептида для обозначения близости или относительного положения. Например, некоторая последовательность, расположенная карбоксил-терминально относительно ссылочной последовательности в полипептиде, расположена проксимально относительно карбоксил-конца ссылочной последовательности, но не обязательно находится при карбоксил-конце полного полипептида.

[37] Термин "антагонист" относится к любому соединению, в том числе белку, полипептиду, пептиду, антителу, фрагменту антитела, крупной молекуле или небольшой молекуле (менее чем 10 кДа), которая снижает активность, активирование или функцию другой молекулы. Антагонисты IL-21 вызывают по меньшей мере одно из нижеуказанных: сниженную иммунную функцию NK-клеток, дендритных клеток, субпопуляций Т-клеток и субпопуляций В-клеток; связывание IL-21, при котором взаимодействие белка IL-21 со своим рецептором блокируется, ингибируется, снижается или нейтрализуется.

[38] "Антитела" (Abs) и "иммунноглобулины" (Igs) представляют собой гликопротеины, обладающие одинаковыми структурными характеристиками. Тогда как антитела проявляют специфичность связывания с конкретным антигеном, иммуноглобулины включают в себя как антитела, так и другие подобные антителам молекулы, у которых отсутствует антигенная специфичность. Полипептиды последнего типа, например, продуцируются на низких уровнях лимфатической системой и на повышенных уровнях миеломами. Таким образом, как используют здесь, термин "антитело" или "пептид (пептиды) антитела" относится к интактному антителу или его связывающему фрагменту, который конкурирует с интактным антителом при специфическом связывании и включает в себя химерные, гуманизированные, полностью человеческие и биспецифические антитела. В некоторых вариантах связывающие фрагменты получают технологиями рекомбинантных ДНК. В дополнительных вариантах связывающие фрагменты получают ферментативным или химическим расщеплением интактных антител. Связывающие фрагменты включают в себя, но без ограничения, Fab, Fab', F(ab')2, Fv и одноцепочечные антитела, ScFv. Как правило, "природные антитела и иммуноглобулины" представляют собой гетеротетрамерные гликопротеины приблизительно 150000 дальтон, состоящие из двух одинаковых легких (L) цепей и двух одинаковых тяжелых (Н) цепей. Каждая легкая цепь связана с тяжелой цепью одной ковалентной дисульфидной связью, тогда как между тяжелыми цепями различных изотипов иммуноглобулинов количество дисульфидных связей различается. Также каждая тяжелая и легкая цепь имеет равномерно расположенные внутрицепочечные дисульфидные мостики. Каждая тяжелая цепь на одном конце имеет вариабельный домен (VH) с последующим некоторым количеством константных доменов. Каждая легкая цепь имеет на одном конце вариабельный домен (VL) и константный домен на другом ее конце; константный домен легкой цепи ориентирован к первому константному домену тяжелой цепи, а вариабельный домен легкой цепи ориентирован к вариабельному домену тяжелой цепи. Предполагают, что поверхность раздела между вариабельными доменами легкой и тяжелой цепей образуют конкретные аминокислотные остатки. (Chothia et al., J. Mol. Biol. 186:651 (1985); Novotny and Haber, Proc. Natl. Acad. Sci. U.S.A. 82:4592 (1985)).

[39] Термин "химерное антитело" или "химерные антитела" относится к антителам, гены легкой и тяжелой цепи которых были сконструированы, обычно генной инженерией, из генов константной и вариабельной области иммуноглобулина, принадлежащих к различным видам. Например, вариабельные сегменты генов мышиного моноклонального антитела могут быть присоединены к человеческим константным сегментам, таким как гамма 1 и гамма 3. Таким образом, типичное терапевтическое химерное антитело является гибридным белком, состоящим из вариабельного или антигенсвязывающего домена мышиного антитела и константного домена человеческого антитела, хотя другие виды млекопитающих могут быть использованы. Конкретно, химерное антитело получают методами на основе рекомбинантной ДНК, в которой все или часть шарнирных и константных областей легкой цепи, тяжелой цепи или обеих цепей иммуноглобулина были замещены на соответствующие области другой легкой цепи или тяжелой цепи иммуноглобулина животного. Таким образом, антигенсвязывающую часть родительского моноклонального антитела пересаживают в остов антитела другого вида.

[40] Термин "эпитоп" относится к любой белковой детерминанте, способной к специфическому связыванию с иммуноглобулином или Т-клеточным рецептором. Эпитопные детерминанты обычно состоят из химически активных поверхностных групп молекул, таких как боковые цепи аминокислот или сахаров, и обычно имеют специфические трехмерные структурные характеристики, а также специфические характеристики заряда. Более конкретно, термин "эпитоп IL-21", в применении здесь, относится к части полипептида IL-21, имеющей антигенную или иммуногенную активность в животном, предпочтительно в млекопитающем, и наиболее предпочтительно в мыши или в человеке. Эпитоп, имеющий иммуногенную активность, представляет собой часть полипептида IL-21, которая вызывает образование антител в животном. Эпитоп, имеющий антигенную активность, представляет собой часть полипептида IL-21, с которой антитело иммуноспецифически связывается, что установлено любым методом, хорошо известным в данной области, например иммунологическими анализами. Антигенные эпитопы необязательно должны быть иммуногенными. "Прерывистые эпитопы" представляют собой конформационные эпитопы, образованные из по меньшей мере двух раздельных областей первичной последовательности белка IL-21. Конформационные эпитопы теряют способность специфически связывать в присутствии денатурирующих растворителей (например, в Вестерн-блот анализе).

[41] Данное изобретение обеспечивает моноклональные антитела и фрагменты антител, которые специфически связываются с белками и полипептидами IL-21. Полипептиды IL-21 человека и мыши, белки и полинуклеотиды, кодирующие полипептиды, описывают в Parrish-Novak et al., Nature 408:57- 63, 2003; патенты США №№6307024 и 6686178; и 7250274. Описанные здесь представляют собой структурные и функциональные характеристики, определяющие области (эпитопы) белка IL-21 человека, которые были идентифицированы в виде мишеней для терапевтического моноклонального антитела. Представляют приводимые в качестве примера моноклональные антитела против IL-21 человека. Некоторые из этих антител имеют способность связывать природный IL-21 человека, рекомбинантный дикого типа IL-21 человека, рекомбинантный мутантный белок IL-21 и/или пептидные области IL-21 человека.

[42] Данное изобретение обеспечивает анти-IL-21 антитела, которые применимы для терапевтического лечения аутоиммунных и воспалительных заболеваний. Например, анти-IL-21 антитела применимы для лечения псориаза, панкреатита, сахарного диабета I типа (IDDM), болезни Грейвса, воспалительного заболевания кишечника (IBD), болезни Крона, язвенного колита, синдрома раздраженной толстой кишки, рассеянного склероза, ревматоидного артрита, реактивного артрита, энтеропатического артрита, спондилоартропатии, аутоиммунного миокардита, синдрома Кавасаки, целиакии, увеита, болезни Бехчета, болезни коронарных артерий, хронического обструктивного легочного заболевания (COPD), интерстициального заболевания легких, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, системной красной волчанки, анкилозирующего спондилита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции "трансплантат против хозяина" (GVHD), кожной Т-клеточной лимфомы (CTCL), синдрома Шегрена, гломерулонефрита, нефропатии IgA-типа, аутоиммунного нефрита, обыкновенной пузырчатки, миастении гравис, аутоиммунной потери слуха, нейромиелита зрительного нерва, синдрома Гудпасчера, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии, идиопатической тромбоцитопенической пурпуры (ITP), отторжения трансплантата, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома, аллергии и астмы и других аутоиммунных заболеваний или других заболеваний, опосредованных IL-21 и агонистами рецептора IL-21.

[43] Пять классов иммуноглобулина, IgG, IgA, IgM, IgD и IgE, были идентифицированы у высших позвоночных. Белки IgG, IgD и IgE обычно являются сшитыми дисульфидными связями гетеротетрамерами, состоящими из двух одинаковых тяжелых цепей и двух одинаковых легких цепей. Обычно IgM обнаруживается в виде пяти тетрамеров, тогда как IgA встречается в виде двух тетрамеров. Модификации могут быть введены в молекулу иммуноглобулина.

[44] IgG охватывает основной класс, который обычно существует в виде второго наиболее распространенного белка, обнаруженного в плазме. У людей IgG состоит из четырех подклассов, обозначенных IgG1, IgG2, IgG3 и IgG4. Каждая тяжелая цепь иммуноглобулинов содержит константную область, которая состоит из доменов константной области белка (CH1, шарнира, CH2 и CH3), которые являются неизменными для данного подкласса. Константные области тяжелой цепи класса IgG идентифицируют с использованием греческого символа γ. Например, иммуноглобулины подкласса IgG1 содержат константную область тяжелой цепи γI.

[45] Fc-фрагмент или Fc-домен состоит из сшитых дисульфидными связями шарнирных участков тяжелой цепи, CH2, и CH3 доменов. В слитых белках иммуноглобулинов Fc-домены подкласса IgG1 часто используют в виде части молекулы иммуноглобулина, поскольку IgG1 имеют наиболее продолжительное время полужизни в сыворотке любого из сывороточных белков. Протяженное время полужизни в сыворотке может быть желаемой характеристикой белка при исследованиях на животных и потенциальном терапевтическом применении для человека. Кроме того, подкласс IgG1 обладает наиболее сильной способностью реализации эффекторных функций, опосредованных антителом. Первичная эффекторная функция, которая может быть наиболее пригодной в слитом белке иммуноглобулина, представляет собой способность для IgG1 антитела опосредовать антителозависимую клеточную цитотоксичность. С другой стороны, это могло быть нежелательной функцией для слитого белка, который функционирует в первую очередь в виде антагониста. Было идентифицировано несколько из аминокислотных остатков, которые являются важными для активности в подклассе IgG1, опосредованной константной областью антитела. Таким образом, введение или удаление этих специфических аминокислот обеспечивает включение или выключение специфической активности, опосредованной константной областью иммуноглобулина (см. патенты США №№5648260; 5624821).

[46] Модифицированный IgG1 Fc человека был сконструирован для создания слитых белков с Fc. Например, мутации Fc4, Fc5 и Fc6 для снижения эффекторных функций, опосредованных Fc путем уменьшения связывания FcγRI и связывания комплемента C1q, описывают в патентной заявке США 2006-0034852, включенной в качестве ссылки в ее полном виде. Конкретно, три аминокислотные замены вводили для уменьшения связывания FcγRI. Данные замены являются заменами в положениях 234, 235 и 237 по индексу ЕС. Было показано, что замены в этих положениях уменьшают связывание с FcγRI (Duncan et al., Nature 332:563 (1988)). Эти аминокислотные замены также могут понижать связывание FcγRIIa, а также связывание FcγRIII (Sondermann et al., Nature 406:267 (2000); Wines et al., J. Immunol. Д64:5313 (2000)). Эти мутации не изменяют связывание с FcRn, которое способствует продолжительному времени полужизни в сыворотке путем утилизации IgG на протяжении эндоцитозного пути рециклизации.

[47] Несколько групп описали значимость положений 330 и 331 по индексу ЕС в связывании комплемента C1q и последующей фиксации комплемента (Canfield and Morrison, J. Exp. Med. 173: 1483 (1991); Tao et al., J. Exp. Med. 128:661 (1993)). Аминокислотные замены в этих положениях были введены в Fc4 для снижения фиксации комплемента. CH3 домен Fc4 является идентичным домену, который обнаружили в соответствующем полипептиде дикого типа за исключением стоп-кодона, который заменили с TGA на ТАА для элиминации потенциального сайта метилирования dam при выращивании клонированной ДНК в штаммах Е. coli (dam+). В Fc5 остаток аргинина в положении 218 по индексу ЕС представляет собой лизин и оставшаяся последовательность Fc5 совпадает с вышеуказанным описанием для Fc4.

[48] Данное изобретение также включает в себя генетически измененные антитела, которые являются функционально эквивалентными описанным выше антителам. Предпочтительными являются модифицированные антитела, обеспечивающие улучшенную стабильность и/или терапевтическую эффективность. Примеры модифицированных антител включают в себя антитела с консервативными заменами аминокислотных остатков и одной или несколькими делениями или вставками аминокислот, которые не изменяют, по существу, губительно антигенсвязывающую ценность. Замены могут находиться в пределах от изменения или модификации одной или нескольких аминокислотных остатков до полного изменения конструкции области, при условии сохранения терапевтической ценности. Антитела данного изобретения могут быть модифицированы посттрансляционно (например, ацетилированием и фосфорилированием) или могут быть модифицированы синтетическим путем (например, присоединением меченной группы).

[49] Антитела данного изобретения могут быть описаны или указаны исходя из эпитопа (эпитопов) или части (частей) полипептида IL-21 данного изобретения, которые они узнают или специфически связывают. Эпитоп (эпитопы) или часть (части) полипептида могут быть указаны, как описано здесь, например, при помощи N-концевых и С-концевых положений, или по размеру в заменимых аминокислотных остатках. Антитела данного изобретения также могут быть описаны или указаны исходя из их перекрестной реактивности. Антитела, которые не связывают любой другой аналог, ортолог или гомолог полипептида данного изобретения, включены.

[50] Сортировка эпитопов (или эпитоп-специфическая сортировка, в оригинале текста «epitope binning) относится к использованию конкурентных анализов связывания для идентификации пар антител, которые способны, или не способны, связываться вместе с белком IL-21, посредством чего идентифицируют антитела, которые связываются с одинаковыми или перекрывающимися эпитопами на белке. Затем семейства антител (или bins), имеющие одинаковую или перекрывающуюся специфичность связывания могут быть использованы для облегчения выявления специфических эпитопов на IL-21. Эксперименты эпитоп-специфической сортировки обеспечивают доказательство того, что существуют антигенно различимые эпитопы. Однако, сами по себе, они не идентифицируют, или "картируют", эпитоп по отношению к специфической аминокислотной последовательности или расположение на белковой молекуле IL-21.

[51] Конкуренция связывания может быть оценена для любой пары антител или фрагментов. Например, с помощью подходящих реагентов для обнаружения, специфичность связывания антител или связывающих фрагментов любых видов/источника может быть сравнена со специфичностью связывания моноклональных антител, раскрытых здесь. Эпитоп-специфическая сортировка может быть выполнена с использованием "выделенных антител" или с использованием супернатантов культуры клеток. Часто сортировку выполняют с использованием клональных супернатантов первого этапа для ведения выбора клонов, которые дополнительно проявляются. Антитела, которые сравнивают, должны иметь, по существу, гомогенные антигенсвязывающие домены. В случае "биспецифических" или "бифункциональных" антител специфичность связывания двух различных связывающих сайтов нужно оценить или сортировать (binned) независимо.

[52] Данное изобретение характеризует лиганд-специфические антитела. В дополнение к конкурентному связыванию антител также может быть использована сортировка эпитопов для идентификации эпитоп-специфической сортировки антител или с рецептором, или с лигандом, которые конкурентно препятствуют связыванию лиганда со своим рецептором или активации своего рецептора, опосредованной лигандом. Часто, благоприятные свойства семейства (или bin) антител могут коррелировать со связыванием со специфическим эпитопом, определенным эпитопным семейством (epitope bin).

[53] Эксперименты по конкурентному связыванию не измеряют непосредственно аффинность связывания, однако антитела, подлежащие тестированию, должны связываться достаточно сильно, чтобы действовать в виде конкурентов. Обычно условия экспериментов планируют для минимизации эффектов различий аффинности связывания.

[54] Анти-IL-21 антитела также могут быть применимы в диагностических анализах на белок IL-21, например, обнаружение его экспрессии в специфических клетках, тканях или сыворотке. Антитела, отнесенные к различным семействам (bins) и способные связываться с различными иммуногенными участками IL-21, или эпитопами, могут быть использованы в виде реагентов для сэндвич-анализов. В сэндвич-анализе тест-пробу захватывают первым антителом, которое иммобилизуют на твердой подложке, и затем обнаруживают с помощью вторичного антитела, которое также связывается с анализируемым веществом, таким образом формируя нерастворимый трехкомпонентный комплекс. См., например, патент США №4376110. Вторичное антитело само по себе может быть меченным детектируемой группой (прямые сэндвич-анализы) или может быть измерено с использованием антииммуноглобулинового антитела, меченного детектируемой группой (непрямой сэндвич-анализ). Например, одним из типов сэндвич-анализа является анализ ELISA, в случае которого детектируемая группа представляет собой фермент.

[55] Антитела данного изобретения могут быть проанализированы на специфическое связывание с помощью метода, известного в данной области. Многие различные форматы конкурентного анализа связывания могут быть использованы для эпитоп-специфической сортировки. Иммуноанализы, которые могут быть использованы, включают в себя, но не ограничиваются ими, конкурентные и неконкурентные системы анализов с помощью способов, таких как Вестерн-блоты, радиоиммунологические анализы, (твердофазный иммуноферментный анализ), "сэндвич" иммуноанализы, методы иммунопреципитации, реакции преципитации, гель-диффузные реакции преципитации, иммунодиффузные анализы, реакции агглютинации, реакции фиксации комплемента, иммунорадиометрические анализы, флуоресцентные иммуноанализы, иммуноанализы с использованием протеина А, названы только некоторые. Такие анализы являются рутинными и общеизвестны в данной области (см., например, Ausubel et al., eds, 1994, Current Protocols in Molecular Biology. Vol.1, John Wiley & Sons, Inc., New York). Приводимые в качестве примера иммуноанализы описывают вкратце ниже (но не предназначены ради ограничения). Кроме того, может быть выполнен рутинный перекрестноблокирующий анализ, такой как описан в Antibodies. A Laboratory Manual. Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988).

[56] BIACORE® (GE Healthcare, Piscataway, NJ) представляет собой только один из различных форматов анализа поверхностного плазмонного резонанса, который является рутинно применяемым для панелей семейств эпитопов (epitope bin panels) моноклональных антител. Многие ссылки (например, The Epitope Mapping Protocols, Methods in Molecular Biology. Volume 66 Glenn E.Morris ed. Humana Press, 1996) описывают альтернативные методы, которые могли быть использованы для сортировки антител (bin antibodies) и, можно было бы ожидать, для обеспечения сравнимой информации относительно специфичности связывания антител с белком IL-21. При использовании системы BIACORE® эксперименты по эпитоп-специфической сортировке (epitope binning experiments) выполняют с использованием растворимого, природного или рекомбинантного антигена. Изучение эпитоп-специфической сортировки (epitope binning studies) может быть выполнено на системе BIACORE 1000® system (GE Healthcare, Piscataway, NJ). Программное обеспечение BIAIogue® v. 1.2 может быть использовано для программирования режимов методов. Примером использования BIACORE® для сортировки (to bin) мышиных моноклональных антител, полученных против IL-21, поликлональное козье антимышиное антитело к Fc IgG (Jackson ImmunoResearch Laboratories, West Grove, PA) может быть ковалентно иммобилизовано к сенсорному чипу BIACORE® CM5 и использовано для связывания (захвата) первичного моноклонального антитела серии тестов с чипом. Затем незанятые сайты связывания Fc на чипе блокируют с помощью поликлонального Fc-фрагмента IgG (Jackson ImmunoResearch Laboratories, West Grove, PA). Затем вносят белок IL-21 и дают специфически связаться с захваченным (пер., нанесенным на чип) первичным моноклинальным антителом. Прибор BIACORE® измеряет массу белка, связанного с сенсорным чипом, и связывание как первичного антитела, так и IL-21 антигена может быть подтверждено для каждого цикла. После связывания первичного антитела и антигена с чипом вносят растворимое вторичное антитело и дают связаться с предварительно связанным антигеном. Если вторичное моноклональное антитело способно связываться с IL-21 антигеном одновременно с первичным моноклональным антителом, то его связывание детектируется BIACORE®. Однако если вторичное моноклональное антитело не способно связываться с IL-21 антигеном одновременно с первичным моноклональным антителом, то никакого дополнительного связывания не детектируют. Каждое моноклональное антитело тестируют против самого себя в качестве негативного контроля для установления уровня фонового (отсутствие связывания) сигнала.

[57] Формат конкурентного - теста (LFC-), не несущего метку, также может быть использован для сортировки антител (to bin antibodies). Этот метод описан Nagata et al., J. Immuno Methods 292: 141-155, 2004. Этот метод эпитоп-специфической сортировки (epitope binning) использовал биотинилированный IL-21. В качестве примера сортировки (binning) мышиные моноклональные антитела получали против IL-21, планшеты для микротитрования покрывали при 100 мкл/лунку с использованием 1 мкг/мл специфического козьего антимышиного антитела к Fc-γ IgG (Jackson ImmunoResearch), разбавленного в В (PBS, 0,1% Твин 20, 1% БСА). После связывания данного покрывающего антитела в течение 3 часов при температуре окружающей среды каждую кондиционированную среду, содержащую mAb, разбавляют в В для получения приблизительной концентрации mAb 0,5 мкг/мл и дают им связаться с планшетами, покрытыми козьим антимышиным IgG, в течение ночи при 4°С (mAb#1). Параллельно второй набор кондиционированных сред (mAb#2) разбавляют в полистирольных пробирках для анализа до приблизительно 0,5 мкг/мл mAb в В, смешивают с 50 нг/мл биотинилированного IL-21 антигена и инкубируют в течение ночи при 4°С. После инкубирования mAb#1 с покрывающим антителом планшеты блокируют с помощью неродственного антитела для насыщения незанятых сайтов связывания на планшете. Смеси mAb#2-биотин-IL-21 прибавляют к планшету и дают связаться. В качестве контроля для (неконкурентного) анализа, 50 нг/мл биотинилированного IL-21 прибавляют сразу (без предварительной инкубации с mAb#2) в лунки, содержащие иммобилизованное mAb#1. После инкубации с комплексом биотинилированный-IL-21-mAb#2, прибавляют стрептавидин-HRP (Pierce, Rockford, IL) в планшет при 0,5 мкг/мл. Планшеты проявляют субстратом ТМВ (BioFX Laboratories, Owings Mills, MD) и измеряют поглощение отдельных лунок при 450 нм с помощью спектрофотометра для прочтения планшетов (планшет-ридера) (Molecular Devices SPECTRAMAX®340, Sunnyvale, CA). Если mAb#1 связывается с другим эпитопом mAb#2, то комплекс биотин-IL-21-mAb#2 свяжется с планшетом, приводящим к высокому показанию поглощения. Если mAb#1 связывается с тем же самым эпитопом, что и mAb#2, то комплекс биотин-IL-21-mAb#2 не будет связываться с планшетом, что приведет к низкому показанию поглощения.

[58] Лиганд-специфические антитела данного изобретения могут легко связываться IL-21 или действовать в виде антагонистов IL-21. Например, данное изобретение включает в себя антитела, которые не разрушают взаимодействия рецептора IL-21 с лигандом или разрушают взаимодействия рецептора IL-21 с лигандом или частично, или полностью. Изобретение предоставляет лиганд-специфические антитела, которые препятствуют активации рецептора. Изобретение включает в себя нейтрализующие антитела, которые связывают лиганд и препятствуют связыванию лиганда с рецептором, а также антитела, которые связывают лиганд, посредством чего предотвращается активация рецептора, но не предохраняют лиганд от связывания рецептора. Активация рецептора (т.е. передача сигнала) может быть определена способами, описанными здесь, или другими, известными в данной области. Например, активация рецептора может быть определена обнаружением фосфорилирования (например, тирозина или серина/треонина) рецептора или его субстрата путем иммунопреципитации с последующим Вестерн-блотом или анализом на основе люминекса (например, как описано выше). В специфических вариантах воплощения данного изобретения обеспечивают антитела, которые ингибируют активность лиганда или рецептора по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60% или по меньшей мере на 50% активности в отсутствие антитела.

Получение антител против IL-21 (анти-IL-21 антител)

[59] Антитела к IL-21 могут быть произведены, например, с использованием белка, который является продуктом вектора, экспрессирующего IL-21, или IL-21, выделенного из природного источника, в качестве антигена. Анти-IL-21 антитела данного изобретения "связываются специфически" с IL-21. Считается, что антитела являются специфически связанными, если антитела обнаруживают по меньшей мере одно из следующих двух свойств: (1) антитела связываются с IL-21 с пороговым значением связывающей активности, и (2) антитела не дают существенную перекрестную реакцию с полипептидами, родственными к IL-21. Родственные полипептиды могли бы включать в себя полипептиды других членов цитокинов 1 типа, которые связывают рецепторы, содержащие общую гамма-цепь (γс), таких как IL-2, IL-4, IL-7, IL-9 и IL-15.

[60] Что касается первой характеристики, то антитела связываются специфически, если они связываются с полипептидом IL-21, пептидом или эпитопом с аффинностью связывания, в виде выраженных констант аффинности. Для определения характеристик аффинности, значения кинетических констант скорости, равновесных констант ассоциации и равновесных констант диссоциации вычисляли для взаимодействия антагонистов IL-21 с IL-21 антигеном посредством поверхностного плазменного резонанса. Константа скорости ассоциации (ka(M-1s-1)) представляет собой величину, которая отражает скорость образования комплекса антиген-антагонист. Константа скорости диссоциации (kd(s-1)) представляет собой величину, которая отражает стабильность данного комплекса. Равновесную аффинность связывания обычно выражают или в виде равновесной константы диссоциации (KD(M)) или равновесной константы ассоциации (KA(M-1)). KD получают делением константы скорости диссоциации на константу скорости ассоциации (kd/ka), тогда как KA получают делением константы скорости ассоциации на константу скорости диссоциации (ka/kd). Антагонисты с аналогичными KD (или аналогичными KA) могут иметь значительно различающиеся константы скорости ассоциации и диссоциации. Следовательно, измерение ka и kd, a также kА или KD, помогает более однозначно описать аффинность взаимодействия антагонист-антиген. Предпочтительную аффинность антитела отражают в KA (равновесная константа ассоциации) 106 M-1 или выше, предпочтительно 107 M-1 или выше, более предпочтительно 108 M-1 или выше и наиболее предпочтительно 109 M-1 или выше. Аффинность связывания антитела может быть легко определена специалистом с обычной квалификацией в данной области, например, Скэтчардовским анализом (Scatchard, Ann. NY Acad. Sci. 5J.: 660, 1949), или с помощью коммерчески доступного биосенсорного инструмента. Относительно второй характеристики, антитела не дают существенную перекрестную реакцию с молекулой родственного полипептида, например, если они обнаруживают IL-21, но не другие известные полипептиды с использованием стандартного Вестерн-блот анализа или ловушечного - теста. Примеры известных родственных полипептидов включают в себя известные члены семейства IL-2, к которым принадлежит IL-21 (например, IL-2, IL-4, IL-7, IL-9 и IL-15).

[61] Моноклональные анти-IL-21 антитела могут быть получены с использованием антигенных эпитоп-несущих пептидов и полипептидов IL-21. Антитела данного изобретения связывают антигенные эпитоп-несущие пептиды и полипептиды, содержащие последовательность по меньшей мере из девяти, или от 15 до приблизительно 30 аминокислот, содержащихся в SEQ ID NO: 2, или другую аминокислотную последовательность, раскрытую здесь. Однако пептиды или полипептиды, содержащие более крупную часть аминокислотной последовательности, содержащей от 30 до 50 аминокислот, или любую длину, вплоть до полной аминокислотной последовательности, и в том числе полную аминокислотную последовательность полипептида, также применимы для индуцирования антител, которые связываются с IL-21. Желательно, чтобы аминокислотная последовательность эпитоп-несущего пептида являлась выбранной для обеспечения существенной растворимости в водных растворителях (т.е. последовательность включает в себя относительно гидрофильные остатки, тогда как гидрофобные остатки обычно устраняют). Кроме того, аминокислотные последовательности, содержащие остатки пролина, также могут быть желательны для крупномасштабного производства антител.

[62] Моноклональные анти-IL-21 антитела могут быть произведены способами, известными специалистам в данной области. Моноклональные антитела грызунов к специфическим антигенам могут быть получены известными способами (см., например, Kohler et al., Nature 256:495 (1975), Coligan et al. (eds.), Current Protocols in Immunology, Vol.1, pages 2.5.1-2.6.7 (John Wiley & Sons 1991) ["Coligan"], Picksley et al., "Production of monoclonal antibodies against proteins expressed in E. coli," in DNA Cloning 2: Expression Systems. 2nd Edition, Glover et al. (eds.), page 93 (Oxford University Press 1995)).

[63] Антитела изобретения могут быть получены любым способом, известным в данной области для синтеза антител, в частности химическим синтезом или предпочтительно способами рекомбинантной экспрессии. Рекомбинантная экспрессия антитела изобретения, или его фрагмента, производного или аналога, например тяжелой или легкой цепи антитела изобретения, требует конструирования экспрессирующего вектора, содержащего полинуклеотид, который кодирует антитело. После получения полинуклеотида данного изобретения, кодирующего молекулы антитела или тяжелой или легкой цепи антитела или его части (предпочтительно содержащей вариабельный домен тяжелой или легкой цепи), может быть получен вектор для продуцирования молекулы антитела путем технологии рекомбинантной ДНК с использованием способов, хорошо известных в данной области. Таким образом, способы получения белка путем экспрессии полинуклеотида, содержащего нуклеотидную последовательность, кодирующую антитело, описаны здесь. Способы, которые хорошо известны специалистам в данной области, могут быть использованы для конструирования экспрессирующих векторов, содержащих последовательности, кодирующие антитело, и подходящие сигналы контроля на уровне транскрипции и трансляции. Данные способы включают в себя, например, технологии рекомбинантных ДНК in vitro, способы синтеза и генетическую рекомбинанацию in vivo. Таким образом, изобретение обеспечивает реплицирующиеся векторы, содержащие нуклеотидную последовательность, кодирующую молекулу антитела изобретения или его тяжелой или легкой цепи, или вариабельный домен тяжелой или легкой цепи, функционально присоединенный к промотору. Такие векторы могут включать в себя нуклеотидную последовательность, кодирующую константную область молекулы антитела (см., например, публикация РСТ №WO 86/05807; публикация РСТ №WO 89/01036 и патент США №5122464), и вариабельный домен антитела может быть клонирован в такой вектор для экспрессии полной тяжелой или легкой цепи.

[64] Экспрессирующий вектор переносят в клетку-хозяина традиционными способами и затем трансфицированные клетки культивируют традиционными способами для получения антитела изобретения. Таким образом, изобретение включает в себя клетки-хозяина, содержащие полинуклеотид, кодирующий антитело изобретения, или его тяжелую или легкую цепь, функционально присоединенную к гетерологичному промотору. В предпочтительных вариантах для экспрессии двухцепочечных антител векторы, кодирующие как тяжелую, так и легкую цепи, могут быть коэкспрессированы в клетке-хозяина для экспрессии полной молекулы иммуноглобулина, как подробно описано ниже.

[65] Различные векторные системы для экспрессии в клетке-хозяина могут быть использованы для экспрессии молекул антител данного изобретения. Такие системы для экспрессии в клетке-хозяина представляют собой проводники, посредством которых представляющие интерес кодирующие последовательности могут быть произведены и впоследствии очищены, но также представляют собой клетки, которые могут, при трансформации или трансфицировании с помощью последовательностей, кодирующих подходящий нуклеотид, экспрессировать молекулу антитела изобретения in situ. Эти системы включают в себя, но не ограничиваются ими, системы микроорганизмов, таких как бактерии (например, Е. coli, В. subtilis), трансформированные с помощью рекомбинантной ДНК бактериофага, экспрессирующих векторов на основе плазмидной ДНК или космидной ДНК, содержащих последовательности, кодирующие антитело; дрожжи (например, Saccharomyces, Pichia), трансформированные с помощью рекомбинантных дрожжевых экспрессирующих векторов, содержащих последовательности, кодирующие антитело; клеточные системы насекомых, инфицированные с помощью рекомбинантных вирусных экспрессирующих векторов (например, бакуловирусов), содержащих последовательности, кодирующие антитело; систем растительных клеток, инфицированных с помощью рекомбинантных вирусных экспрессирующих векторов (например, вируса мозаики цветной капусты, CaMV; вируса табачной мозаики, TMV) или трансформированных с помощью рекомбинантных вирусных экспрессирующих векторов (например, Ti-плазмиды), содержащих последовательности, кодирующие антитело; или систем клеток млекопитающих (например, клеток COS, CHO, ВНК, 293, 3Т3), содержащих рекомбинантные экспрессионные конструкции, содержащие промоторы, полученные из генома клеток млекопитающих (например, металлотионеиновый промотор) или вирусов млекопитающих (например, MPSV, CMV, поздний аденовирусный промотор; промотор 7.5К вируса коровьей оспы). Предпочтительно бактериальные клетки, такие как Escherichia coli, и более предпочтительно эукариотические клетки, особенно для экспрессии полной рекомбинантной молекулы антитела используют для экспрессии рекомбинантной молекулы антитела. Например, клетки млекопитающих, такие как клетки яичников китайского хомячка (CHO), в сочетании с вектором, таким как основной промежуточный ранний генный промоторный элемент из цитомегаловируса человека, CMV энхансер или MPSV промотор, является эффективным для экспрессионной системы антител (Foecking et al., 1986, Gene 45: 101; Cockett et al., 1990, Bio/Technologv 8:2).

[66] В бактериальных системах, некоторое количество экспрессирующих векторов может быть успешно выбрано в зависимости от применения, предназначенного для экспрессируемой молекулы антитела. Например, в случае, когда должно быть получено большое количество такого белка, для создания фармацевтических композиций молекулы антитела, могут быть желательны векторы, которые направляют экспрессию высоких уровней продуктов слитого белка, который легко очищают. Такие векторы включают в себя, но не ограничиваются ими, экспрессирующий вектор pUR278 E.coli (Ruther et al., 1983, EMBO J.2: 1791), в котором последовательность, кодирующая антитело, может быть лигирована в отдельности в вектор внутрь рамки считывания с кодирующей областью lacZ таким образом, чтобы продуцировался слитый белок; векторы pFN (Inouye & Inouye, Nucleic Acids Res. 11:3101 -3109, 1985; Van Heeke & Schuster, J.Biol. Chem. 24:5503-5509, 1989); и т.п. Также могут быть применимы векторы pGEX для экспрессии чужеродных полипептидов в виде слитых белков с глутатион-S-трансферазой. В общем, такие слитые белки являются растворимыми и могут быть легко очищены из лизированных клеток путем адсорбции и связывания с матриксом глутатион-агарозных гранул с последующей элюцией в присутствии свободного глутатиона. Векторы pGEX конструируют для включения сайтов расщепления протеазами тромбина или фактора Ха, таким образом, чтобы продукт клонированного целевого гена мог быть высвобожден из молекулы GST.

[67] В системе насекомых, вирус ядерного полиэдроза Autographa califomica (AcNPV) используют в качестве вектора для экспрессии чужеродных генов. Вирус растет в клетках Spodoptera frugiperda. Последовательность, кодирующая антитело, может быть клонирована отдельно в несущественные области (например, полиэдриновый ген) вируса и помещена под контроль AcNPV промотора (например, полиэдринового промотора).

[68] В клетках-хозяина млекопитающих ряд экспрессионных систем на основе вирусов может быть использован. В случае, когда в качестве экспрессирующего вектора используют аденовирус, представляющая интерес последовательность, кодирующая антитело, может быть лигирована с аденовирусным комплексом, контролирующим транскрипцию/трансляцию, например поздним промотором и тройственной лидерной последовательностью. Данный химерный ген может быть затем встроен в аденовирусный геном путем in vitro или in vivo рекомбинации. Вставка в несущественную область вирусного генома (например, область Е1 или Е3) даст в результате рекомбинантный вирус, который жизнеспособен и способен экспрессировать в молекулу антитела в инфицированных хозяевах (например, см. Logan & Shenk, Proc. Natl. Acad. Sci. USA 81:355- 359, 1984). Специфические сигналы инициации могут также требоваться для эффективной трансляции встроенных последовательностей, кодирующих антитело. Данные сигналы включают в себя инициирующий кодон ATG и прилегающие последовательности. Кроме того, инициирующий кодон должен быть в фазе с рамкой считывания желаемой кодирующей последовательности для обеспечения трансляции полного инсерта. Данные экзогенные сигналы контроля трансляции и инициирующие кодоны могут быть из различных источников, как природных, так и синтетических. Эффективность экспрессии может быть повышена путем включения подходящих энхансерных элементов транскрипции, терминаторов транскрипции и т.д. (см. Bittneret et al., Methods in Enzvmol. 153:51-544, 1987).

[69] Кроме того, может быть выбрана линия клетки-хозяина, которая модулирует экспрессию встроенных последовательностей, или модифицирует и процессирует продукт гена определенным желаемым способом. Такие модификации (например, гликозилирование) и процессинг (например, расщепление) продуктов белка могут быть важными для функции белка. Различные клетки-хозяина имеют характерные и специфические механизмы для посттрансляционного процессинга и модификации белков и продуктов гена. Подходящие клеточные линии или системы клетки-хозяина могут быть выбраны для обеспечения правильной модификации и процессинга экспрессированного чужеродного белка. Для этой цели могут быть использованы эукариотические клетки-хозяина, которые обладают клеточным механизмом для правильного процессинга первичного транскрипта, гликозилирования и фосфорилирования продукта гена. Такие клетки-хозяина млекопитающих включают в себя, но не ограничиваются ими, СНО, VERO, ВНК, Hela, COS, MDCK, 293, 3T3, W138, и, в частности, клеточные линии рака молочной железы, такие как, например, ВТ483, Hs578T, HTB2, ВТ20 и T47D, и клеточные линии нормальной молочной железы, такие как, например, CRL7030 и Hs578Bst.

[70] Для длительного крупномасштабного производства рекомбинантных белков предпочтительна стабильная экспрессия. Например, могут быть сконструированы клеточные линии, которые стабильно экспрессируют молекулу антитела. Вместо использования экспрессирующих векторов, которые содержат вирусные точки начала репликации, клетки-хозяева могут быть трансформированы с использованием ДНК, контролируемой подходящими элементами контроля экспрессии (например, промоторными и энхансерными последовательностями, терминаторами транскрипции, сайтами полиаденилирования и др.), и с использованием селектируемого маркера. После введения чужеродной ДНК сконструированным клеткам может быть позволено расти в течение 1-2 дней в обогащенной среде, а затем перевести на селективную среду. Селектируемый маркер в рекомбинантной плазмиде придает устойчивость к селекции и позволяет клеткам стабильно интегрировать плазмиду внутрь их хромосом и расти с образованием очагов, которые, в свою очередь, могут быть клонированы и размножены в клеточных линиях. Данный способ может быть успешно применен для конструирования клеточных линий, которые экспрессируют молекулу антитела. Такие сконструированные клеточные линии могут быть особенно применимы в скрининге и оценке соединений, которые взаимодействуют прямо или косвенно с молекулой антитела.

[71] Может быть использован ряд селекционных систем, в том числе, но не ограничиваясь этим, гены тимидинкиназы вируса простого герпеса (Wigler et al., Cell Ц:223, 1977), гипоксантин-гуанин-фосфорибозилтрансферазы (Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA 48:202. 1992) и аденин-фосфорибозилтрансферазы (Lowy et al., Cell 22:817, 1980), которые могут быть применены в tk-, hgprt- или aprt-клетках соответственно. Также антиметаболитная устойчивость может быть использована в качестве основы для отбора следующих генов: dhfr, который сообщает устойчивость к метотрексату (Wigler et al., Proc. Natl. Acad. Sci. USA 77:357. 1980: O'Hare et al., Proc. Natl. Acad. Sci. USA 78: 1527. 1981); gpt, который придает устойчивость к микофенольной кислоте (Mulligan & Berg, Proc. Natl. Acad. Sci. USA 78:2072. 1981); neo, который придает устойчивость к аминогликозиду G-418 (Wu and Wu, Biotherapy 3:87-95. 1991; Tolstoshev, Ann. Rev. Pharmacol. Toxicol. 32:573-596, 1993; Mulligan, Science 260:926-932, 1993; and Morgan and Anderson, Ann. Rev. Biochem. 62: 191-217, 1993; TIB TECH 11 (5): 155-215). May, 1993; и hygro, который придает устойчивость к гигромицину (Santerre et al., Gene 30:147, 1984). Традиционные способы, известные в области технологий рекомбинантных ДНК, которые могут быть использованы, описаны в Ausubel et al. (eds.), 1993, Current Protocols in Molecular Biology, John Wiley & Sons, NY; Kriegler, 1990, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY; и в главах Chapters 12 и 13, Dracopoti et al. (eds), 1994, Current Protocols in Human Genetics, John Wiley & Sons, NY.; Colberre-Garapin et al., J. Mol. Biol. 150:1. 1981; которые включены здесь в качестве ссылки в их полном виде.

[72] Уровни экспрессии молекулы антитела могут быть повышены амплификацией вектора (в отношении обзора см., Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol.3. (Academic Press, New York, 1987)). В тех случаях, когда маркер в векторной системе, экспрессирующей антитело, является амплифицируемым, повышение уровня ингибитора, присутствующего в культуре клетки-хозяина, приведет к увеличению числа копий маркерного гена. Поскольку амплифицированная область является ассоциированной с геном антитела, то образование антитела также будет повышаться (Grouse et al., Mol. Cell. Biol. 2:257, 1983).

[73] Клетка-хозяин может быть котрансфицирована двумя экспрессирующими векторами данного изобретения, первым вектором, кодирующим полипептид, произведенный из тяжелой цепи, и вторым вектором, кодирующим полипептид, произведенный из легкой цепи. Данные два вектора могут содержать идентичные селективные маркеры, которые обеспечивают равную экспрессию полипептидов тяжелой и легкой цепи. Альтернативно, может быть применен единственный вектор, который кодирует полипептиды как тяжелой, так и легкой цепи. В таких случаях, легкая цепь должна быть помещена перед тяжелой цепью во избежание избытка токсичной тяжелой цепи (Proudfoot, Nature 322:52, 1986; Kohler, Proc. Natl. Acad. Sci. USA 77:2197, 1980). Кодирующие последовательности для тяжелой и легкой цепей могут содержать кДНК или геномную ДНК.

[74] После того как молекула антитела была рекомбинантно экспрессирована, она может быть очищена любым способом, известным в данной области для очистки молекулы иммуноглобулина, например, хроматографией (например, ионообменной, аффинной, в частности, в результате аффинности к специфическому антигену после хроматографии с протеином А и эксклюзионной колоночной хроматографии), центрифугированием, дифференциальной растворимостью или любым другим стандартным способом очистки белков.

[75] Для конкретных применений может быть желательно получение фрагментов анти-IL-21 антител. Такие фрагменты антитела могут быть получены, например, протеолитическим гидролизом антитела. Фрагменты антитела могут быть получены расщеплением пепсином или папаином целых антител традиционными способами. В качестве иллюстрации, фрагменты антитела могут быть произведены ферментативным расщеплением антител с помощью пепсина для обеспечения 5S-фрагмента, обозначенного F(ab')2. Данный фрагмент может быть дополнительно расщеплен с помощью тиол-редуцирующего агента для получения моновалентных 3,5S Fab'-фрагментов. Произвольно, реакция расщепления может быть выполнена с использованием блокирующей группы для сульфгидрильных групп, которые образуются в результате расщепления дисульфидных связей. В качестве альтернативы, ферментативное расщепление с использованием пепсина продуцирует непосредственно два моновалентных Fab-фрагмента и Fc-фрагмент. Эти способы описывают, например, Goldenberg, патент США №4331647, Nisonoff et al., Arch Biochem. Biophvs. 89:230, 1960; Porter, Biochem. J.73: 119, 1959; Edelman et al., in Methods in Enzymology Vol.1, страница 422 (Academic Press 1967), и Coligan на страницах 2.8.1-2.8.10 и 2.10.-2.10.4.

[76] Другие способы расщепления антител, такие как отделение тяжелых цепей с образованием моновалентных фрагментов легкой-тяжелой цепи, дополнительное расщепление фрагментов, или другие ферментативные, химические или генетические способы также могут быть применены, при условии, что фрагменты связываются с антигеном, который узнается интактным антителом.

[77] Например, Fv-фрагменты содержат ассоциацию тяжелых (VH) и легких (VL) цепей. Данная ассоциация может быть моновалентной, как описано Inbar et al., Proc. Nat'l Acad. Sci. USA 69:2659, 1972. Альтернативно, вариабельные цепи могут быть связаны межмолекулярной дисульфидной связью или поперечно сшиты химическими соединениями, такими как глутаральдегид (см., например, Sandhu, Crit. Rev. Biotech. 12:437, 1992).

[78] Fv-фрагменты могут содержать VH и VL цепи, которые соединены пептидным линкером. Данные одноцепочечные антигенсвязывающие белки (scFv) получают конструированием структурного гена, содержащего последовательности ДНК, кодирующие VH и VL домены, которые соединены олигонуклеотидом. Структурный ген встраивают в экспрессирующий вектор, который впоследствии встраивается в клетку-хозяин, такую как Е. coli. Рекомбинантные клетки-хозяина синтезируют единственную полипептидную цепь с линкерным пептидом, соединяющим два V-домена. Способы получения scFvs описаны, например, by Whitlow et al., Methods: A Companion to Methods in Enzymology 2:97 (1991) (см. также, Bird et al., Science 242:423, 1988, Ladner et al., патент США №4946778, Packetal. Bio/Technoloav 11:1271. 1993, и Sandhu, выше).

[79] Также возможно конструирование альтернативных каркасов применением коллекции мономерных белков для образования мономерного домена. Данные мономерные домены могут быть достаточно малыми для проникновения внутрь тканей. Мономерные домены могут быть природными или искусственными вариантами или их комбинацией. Мономерные домены могут образовывать мультимеры из двух или нескольких доменов. Мономерный домен связывает положение, аналогично эпитопам, описанным здесь, на молекуле-мишени. В некоторых случаях мультимер может быть образован из различных мономерных доменов (см., например, патентную заявку США 2004-0132028 и патентную заявку США 2006-0177831).

[80] Антитела данного изобретения включают в себя производные, которые модифицируют, т.е. ковалентным присоединением любого типа молекулы к антителу, так чтобы ковалентное присоединение не предохраняло антитело от связывания IL-21 или блокирования активации рецептора. Например, но без ограничения, производные антитела включают в себя антитела, которые были модифицированы, например, гликозилированием, ацетилированием, пэгилированием, фосфорилированием, амидированием, получение производных при помощи известных защитных/блокирующих групп, протеолитическим расщеплением, связыванием с клеточным лигандом или другим белком и т.д. Любая из многочисленных химических модификаций может быть выполнена известными способами, в том числе, но не ограничивается ими, химическое расщепление, ацетилирование, формилирование, метаболический синтез туникамицина и т.д. Кроме того, производное может содержать одну или несколько неклассических аминокислот.

[81] Анти-IL-21 антитело может быть конъюгировано с детектируемой меткой с образованием иммуноконъюгата анти-IL-21. Подходящие детектируемые метки включают в себя, например, радиоизотоп, флуоресцентную метку, хемилюминесцентную метку, ферментативную метку, биолюминесцентную метку или коллоидное золото. Способы создания и детектирования таких, меченных с целью обнаружения, иммуноконъюгатов хорошо известны любому обычному специалисту в данной области и описаны более детально ниже. Детектируемая метка может быть радиоизотопом, который обнаруживают авторадиографией. Изотопы, которые конкретно применимы для цели данного изобретения, представляют собой 3H, 125I, 131I, 35S и 14С.

[82] Иммуноконъюгаты анти-IL-21 также могут быть мечены с помощью флуоресцентного соединения. Присутствие флуоресцентно-меченного антитела определяют экспонированием иммуноконъюгата на свету подходящей длины волны и детектированием получаемой флуоресценции. Флуоресцентно-меченные соединения включают в себя флуоресцеин-изотиоционат, родамин, фикоэритрин, фикоцианин, аллофикоцианин, орто-фтальальдегид, красители Alexa, флуоресцентные наночастицы (например, Q-точки) и флуорескамин.

[83] Также возможно, что имммуноконъюгаты анти-IL-21 могут быть мечены с целью обнаружения путем пришивки компонента антитела к хемилюминесцентному соединению. Присутствие хемилюминесцентно-меченного имммуноконъюгата определяют детектированием наличия люминесценции, которая возникает во время протекания химической реакции. Примеры хемилюминесцентно-меченных соединений включают в себя люминол, изолюминол, акридиновый ароматический эфир, имидазол, акридиновую соль и оксалат-сложный эфир.

[84] Аналогично биолюминесцентное соединение может быть использовано для мечения иммуноконъюгатов анти-IL-21 данного изобретения. Биолюминесценция представляет собой тип хемилюминесценции, обнаруженной в биологических системах, в которой каталитический белок повышает эффективность реакции хемилюминесценции. Наличие биолюминесцентного белка определяют детектированием наличия люминесценции. Биолюминесцентные соединения, которые применимы для мечения, включают в себя люциферин, люциферазу и экворин.

[85] Альтернативно, имммуноконъюгаты анти-IL-21 могут быть мечены с целью обнаружения путем присоединения компонента анти-IL-21 антитела к ферменту. При инкубировании конъюгата анти-IL-21-фермент в присутствии подходящего субстрата молекула фермента взаимодействует с субстратом для образования химической молекулы, которая может быть обнаружена, например, спектрофотометрическими, флуорометрическими или визуальными средствами. Примеры ферментов, которые могут быть использованы для мечения с целью обнаружения полиспецифических иммуноконъюгатов, включают в себя β-галактозидазу, глюкозооксидазу, пероксидазу и щелочную фосфатазу.

[86] Специалисты в данной области техники узнают другие подходящие метки, которые могут быть использованы в соответствии с данным изобретением. Связывание маркерных молекул с анти-IL-21 антителами может быть выполнено с помощью традиционных способов, известных в данной области. Типичная методология в этой связи описана следующими: Kennedy et al., Clin. Chim. Acta 70:1, 1976; Schurs et al., Clin. Chim. Acta 81:1, 1977; Shih et al., Int'l J.Cancer 46:1101,1990: Stein et al., Cancer Res. 50:1330. 1990; и Coligan, выше.

[87] Кроме того, удобство и универсальность иммунохимического обнаружения могут быть усилены применением анти-IL-21 антител, которые были конъюгированы с авидином, стрептавидином и биотином (см., например, Wilchek et al. (eds.), "Avidin-Biotin Technology," Methods In Enzymology, Vol.184 (Academic Press 1990), и Bayer et al., "Immunochemical Applications of Avidin-Biotin Technology," in Methods In Molecular Biology, Vol.10, Manson (ed.), страницы 149-162 (The Humana Press, Inc. 1992).

[88] Способы выполнения иммунонологических анализов являются общепринятыми. См., например, Cook and Self, "Monoclonal Antibodies in Diagnostic Immunoassays," in Monoclonal Antibodies: Production. Engineering, and Clinical Application. Ritter and Ladyman (eds.), pages 180-208, (Cambridge University Press, 1995), Perry, "The Role of Monoclonal Antibodies in the Advancement of Immunoassay Technology", in Monoclonal Antibodies: Principles and Applications. Birch and Lennox (eds.), pages 107-120 (Wiley-Liss, Inc. 1995), and Diamandis, Immunoassay (Academic Press, Inc. 1996).

[89] Антитела или их фрагменты, имеющие повышенные периоды полураспада in vivo могут быть сконструированы способами, известными специалистам в данной области. Например, антитела или их фрагменты с повышенными периодами полураспада in vivo, могут быть сконструированы путем модификации (например, замещением, делецией или присоединением) аминокислотных остатков, идентифицированных в виде участвующих во взаимодействии между Fc-доменом и рецептором FcRn (см., например, международные публикации №№WO 97/34631 и WO 02/060919, которые включены здесь в качестве ссылки в их полном виде). Антитела, или их фрагменты с повышенными периодами полураспада in vivo могут быть сконструированы путем присоединения к указанным антителам или фрагментам антител молекул полимеров, таких как высокомолекулярный полиэтиленгликоль (PEG). PEG может быть присоединен к указанным антителам или фрагментам антител вместе с многофункциональным линкером или без многофункционального линкера, или путем сайт-специфической конъюгации PEG, например, к N-концу или С-концу указанных антител или фрагментов антител, или через эпсилон-аминогруппы, присутствующие на остатках лизина. Будут использовать образование линейных или разветвленных производных полимеров, которые приводят к минимальным потерям биологической активности. Степень конъюгации будут тщательно мониторировать SDS-PAGE и масс-спектрометрией для обеспечения правильной конъюгации молекул PEG с антителами. Непрореагировавший PEG может быть отделен от конъюгатов антитело-PEG, например, гель-хроматографией или ионообменной хроматографией.

Фармацевтические композиции

[90] Данное изобретение дополнительно включает в себя фармацевтические композиции, содержащие фармацевтически приемлемый носитель и полипептид или антитело, описанное здесь. Фармацевтическая композиция может включать в себя дополнительные терапевтические агенты, в том числе, но не ограничиваясь ими, цитотоксические агенты, цитотоксин, например, цитостатический или разрушающий агент, терапевтический агент или ион радиоактивного металла. Цитотоксин или цитотоксический агент включает в себя любой агент, который является вредным для клеток. Примеры включают в себя паклитаксол, цитохалазин В, грамицидин D, этидиум бромид, эметин, митомицин, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин, дигидроксиантрациндион, митоксантрон, митрамицин, актиномицин D, 1-дигидротестостерон, глюкокортикоиды, прокаин, тетракаин, лидокаин, пропранолол и пуромицин и их аналоги и или гомологи. Терапевтические агенты включают в себя, но не ограничиваются ими, антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацил с декарбазином), алкилирующие агенты (например, мехлоротамин, тио-ТЭПА хлорамбуцил, мелфалан, кармустин (BCNU) и ломустин (CCNU), циклофосфамид, бусульфан, дибром-маннитол, стрептозотоцин, митомицин С и, цис-дихлордиамин платина (II) (DDP) цисплатин), антрациклины (например, даунорубицин (ранее дауномицин) и доксорубицин), антибиотики (например, дактиномицин (ранее актиномицин), блеомицин, митрамицин и антрамицин (АМС)), и антимитотические агенты (например, винкристин и винбластин). Например, фармацевтическая композиция может содержать белок или полипептид, обладающие желаемой биологической активностью. Такие белки могут включать в себя, например, токсин, такой как абрин, рицин А, экзотоксин pseudomonas или дифтерийный токсин; белок, такой как фактор некроза опухолей, α-IFN, β-IFN, фактор роста нервов, тромбоцитарный фактор роста, тканевый активатор плазминогена, тромботический агент или анти-ангиогенный агент, например, ангиостатин или эндостатин; или модификаторы биологического ответа, такие как, например, лимфокины, интерлейкин - 1 (IL-1), интерлейкин - 2 (IL-2), интерлейкин - 6 (IL-6), гранулоцитарно-макрофагальный колониестимулирующий фактор (GM-CSF), гранулоцитарный колониестимулирующий фактор (G-CSF), антитела, сконструированные для противодействия модификаторами биологического ответа, другие антитела, другие слитые с Fc белки или другие факторы роста.

[91] Для терапевтических целей молекулы анти-IL-21 антитела и фармацевтически приемлемый носитель вводят пациенту в терапевтически эффективном количестве. Считается, что комбинацию терапевтической молекулы данного изобретения и фармацевтически приемлемого носителя вводят в "терапевтически эффективном количестве", если вводимое количество является физиологически значимым. Агент является физиологически значимым, если его присутствие приводит к обнаруживаемому изменению в физиологии пациента-реципиента. Например, применяемый для лечения воспаления является физиологически значимым, если его присутствие смягчает воспалительный ответ.

[92] Деградируемые полимерные микросферы были сконструированы для поддержания высоких системных уровней терапевтических белков. Микросферы получают из деградируемых полимеров, таких как поли(лактид-ко-гликолид) (PLG), полиангидриды, полиортоэфир), небиодеградируемых полимеров этилвинилацетата, в которых белки включены в полимер (Gombotz and Pettit, Bioconiugate Chem. 6:332, 1995; Ranade, "Role of Polymers in Drug Delivery", in Drug Delivery Systems, Ranade and Hollinger (eds.), pages 51-93 (CRC Press 1995); Roskos and Maskiewicz, "Degradable Controlled Release Systems Useful for Protein Delivery", in Protein Delivery: Physical Systems, Sanders and Hendren (eds.), pages 45-92 (Plenum Press 1997); Bartus et al., Science 281:1161. 1998; Putney and Burke, Nature Biotechnology 16:153. 1998; Putney, Curr. Opin. Chem. Biol. 2:548, 1998). Покрытые полиэтиленгликолем (ПЭГ) наносферы также могут представлять носители для внутривенного введения терапевтических белков (см., например, Gref et al., Pharm. Biotechnol. 10:167, 1997).

[93] Другие лекарственные формы могут быть разработаны специалистами в данной области, как показано, например, Ansel and Popovich, Pharmaceutical Dosage Forms and Drug Delivery Systems. 5th Edition (Lea & Febiger 1990), Gennaro (ed.), Remington's Pharmaceutical Sciences. 19th Edition (Mack Publishing Company 1995), и Ranade and Hollinger, Drug Delivery Systems (CRC Press 1996).

[94] Фармацевтические композиции могут быть поставлены в виде набора, содержащего контейнер, который содержит нейтрализующее анти-IL-21 антитело. Терапевтические полипептиды могут быть предоставлены в форме инъецируемого раствора однократной или многократных доз, или в виде стерильного порошка, который будет ресуспендирован перед введением. Альтернативно, такой набор может включать в себя диспергатор для порошка, жидкостной аэрозольный генератор или ингалятор для введения терапевтического полипептида. Такой набор дополнительно может содержать написанную информацию относительно указаний и применения фармацевтической композиции.

[95] Фармацевтическая композиция, содержащая анти-IL-21 антитела может быть приготовлена в жидкой форме, в аэрозольной или твердой форме. Жидкие формы иллюстрируют инъецируемыми растворами, аэрозолями, каплями, растворами для местного применения и суспензиями для перорального применения. Типичные твердые формы включают в себя капсулы, таблетки и формы с контролируемым высвобождением. Последнюю форму снабжают миниосмотическими насосами и имплантами (Bremer et al., Pharm. Biotechnol. 10:239,1997; Ranade, "Implants in Drug Delivery," in Drug Delivery Systems. Ranade and Hollinger (eds.), pages 95-123 (CRC Press 1995); Bremer et al., "Protein Delivery with Infusion Pumps", in Protein Delivery: Physical Systems. Sanders and Hendren (eds.), pages 239-254 (Plenum Press 1997); Yewey et al., "Delivery of Proteins from a Controlled Release Injectable Implant," in Protein Delivery: Physical Systems. Sanders and Hendren (eds.), pages 93-117 (Plenum Press 1997)). Другие твердые формы включают в себя кремы, пасты, другие топологические аппликации и т.п.

Терапевтическое применение анти-IL-21 антител

[96] IL-21 представляет собой, происходящий из CD4+T-клеток, цитокин, который является важным для наилучшего иммунитета, опосредованного CD8+Т-клетками, активности NK-клеток и наилучших гуморальных ответов, таких как образование антител и созревание В-клеток. Было показано, что IL-21 индуцирует ряд провоспалительных хемокинов и цитокинов, таких как IL-18, IL-15, IL-5, IL-6, IL-7A, IL-17F, TNFRII, sCD25, и RANTES. IL-21 также индуцирует острофазный ответ у «приматов кроме человека» и людей, при введении IV (пер., внутривенной) или SC (пер., подкожной) инъекцией (Dodds et al., Cancer Immunol Immunother 2008 Oct 17 [электронная публикация]). In vitro, стимулирует рост определенных популяций неопластических иммунных клеток, таких как клетки множественной миеломы и острой Т-клеточной лейкемии (Brenne et al., Blood 99(10):3756-62 (2002), diCarlo E, et al., Cancer Immunol Immunother 56(9): 1323-1324 (2007)). IL-21 также продуцируется клетками Ходжкина и Рид -Штернберга при лимфоме Ходжкина (Lamprecht et al., Blood 112(8):3339-47, 2008). Повышенная экспрессия рецептора IL-21 была показана в эпидермисе пациентов с системным склерозом (Distler et al., Arthritis & Rheumatism 52:865-864, 2004) и в синовиальных фибробластах при ревматоидном артрите (Jungel et al., Arthritis & Rheumatism 50:1468-1476. 2004). Кроме того, у мышей с аутоиммунным диабетом NOD повышалась экспрессия рецептора IL-21 (King et al., Cell 117:265-277. 2004). Было показано, что экспрессия IgG и IL-21 повышается в мышиной модели BXSB-Yaa, которая развивает аутоиммунное заболевание, подобное красной волчанке (Ozaki et al., J. Immunol. 173:5361-5371, 2004); экспрессия IL-21 является выше у мышей, предрасположенных к волчанке sanroque (Vinuesa et al., Nature 435:452, 2005); экспрессия IL-21 является выше в воспаленных по сравнению с невоспаленными тканями кишечника пациентов с болезнью Крона (Monteleone, et al., Gastroenterology 128:687-694, 2005). Также IL-21 является сверхпродуцированным в слизистой пациентов с целиакией (Finn et al. Gut. PMID: 17965065, 2007).

[97] Терапевтически эффективное количество анти-IL-21 антитела относится к количеству антитела, которое при введении субъекту является эффективным для предотвращения, задержки, снижения или ингибирования симптома или биологической активности, ассоциированной с болезнью или нарушением. Введение может состоять из единственной дозы или многократных доз и может быть предоставлено в комбинации с другими фармацевтическими композициями.

[98] Данное изобретение обеспечивает композиции и способы применения моноклональных анти-IL-21 антител при воспалительных и иммунных заболеваниях или состояниях, таких как псориаз, панкреатит, сахарный диабет I типа (IDDM), болезнь Грейвса, воспалительное заболевание кишечника (IBD), болезнь Крона, язвенный колит, синдром раздраженной толстой кишки, рассеянный склероз, ревматоидный артрит, реактивный артрит, энтеропатический артрит, спондилоартропатия, аутоиммунный миокардит, синдром Кавасаки, целиакия, увеит, болезнь Бехчета, болезнь коронарных артерий, хроническое обструктивное легочное заболевание (COPD), интерстициальное заболевание легких, воспалительное заболевание мышц (полимиозит, дерматомиозит), микроскопический полиангиит, аутоиммунная апластическая анемия, аутоиммунный тиреоидит, аутоиммунный гепатит, синдром Вегенера, дивертикулез, системная красная волчанка, анкилозирующий спондилит, склеродермия, системный склероз, псориатический артрит, остеоартрит, атопический дерматит, витилиго, реакция "трансплантат против хозяина" (GVHD), кожная Т-клеточная лимфома (CTCL), синдром Шегрена, гломерулонефрит, нефропатия IgA-типа, аутоиммунный нефрит, обыкновенная пузырчатка, миастения гравис, аутоиммунная потеря слуха, нейромиелит зрительного нерва, синдром Гудпасчера, криоглобулинемия, синдром Гийена - Барре, хроническая воспалительная демиелинизирующая полинейропатия (CIDP), аутоиммунная гемолитическая анемия, идиопатическая тромбоцитопеническая пурпура (ITP), отторжение трансплантата, высокосенсибилизированные пациенты с трансплантацией, антифосфолипидный синдром, аллергия и астма и другие аутоиммунные заболевания. Данное изобретение обеспечивает композиции и способы применения моноклональных антител анти-IL-21 в терапии конкретных раков клеток иммунной системы, таких как множественная миелома, острая Т-клеточная лейкемия или лимфома Ходжкина.

Контактный дераматит

[99] Аллергический контактный дерматит определяют в виде опосредованной Т-клетками иммунной реакции на антиген, который вступает в контакт с кожей. Предполагают, что CLA+Т-клеточная популяция участвует в инициации дерматита, поскольку аллергензависимые Т-клеточные ответы в значительной степени ограничены популяцией клеток CLA+(See Santamaria-Babi, et al., J. Exp. Med. 181:1935. (1995)). Последние данные обнаружили, что только Т-клетки памяти (CD45RO+) CD4+CLA+, а не CD8+Т-клетки памяти пролиферируют и продуцируют как цитокины 1 типа (IFN-γ), так и цитокины 2 типа (IL-5) в ответ на никель, стандартный аллерген контактной гиперчувствительности. Кроме того, после никель-специфической стимуляции число клеток, экспрессирующих CLA, в сочетании с CD4, CD45RO (памяти) или CD69 увеличивается и клетки экспрессируют хемокиновые рецепторы CXCR3, CCR4, CCR10, но не CCR6. См., Moed et al., Br. J. Dermatol. 51:32, (2004).

[100] На моделях животных было показано, что аллергический контактный дерматит является Т-клеточно-зависимым, и что аллерген-реактивные Т-клетки мигрируют к месту аппликации аллергена. См., в целом: Engeman, et al., J. Immunol. 164:5207. (2000); Ferguson & Kupper, J. Immunol. 150: 1 172, (1993); and Gorbachev & Fairchild, Crit. Rev. Immunol. 21:451 (2001).

[101] Введение антител против IL-21 в мышиные модели контактной гиперчувствительности используют для оценки клинического применения анти-IL-21 антител для улучшения симптомов и изменения развития болезни.

Атопический дерматит

[102] Атопический дерматит (AD) является хронически рецидивирующим воспалительным заболеванием кожи с резко увеличивающейся частотой заболевания за последние десятилетия. Клинически AD отличается сильно зудящими, часто экскориированными бляшками и папулами, которые обнаруживают хроническое рецидивирующее течение болезни. Диагноз AD чаще всего основан на значительных и незначительных клинических признаках. См., Hanifin J.M., Arch Dermatol 135: 1551 (1999). Гистопатология обнаруживает спонгиоз, гиперпаракератоз и фокальный паракератоз в острых очагах поражения, тогда как выраженная эпидермальная гиперплазия с гиперпаракератозом и паракератозом, акантозом/гипергранулезом и периваскулярной инфильтрацией дермы лимфоцитами и избыточные тучные клетки, являются признаками хронических поражений.

[103] Т-клетки играют центральную роль в инициации локальных иммунных ответов в тканях, и данные предполагают, что инфильтрирующие кожу Т-клетки, в частности, могут играть ключевую роль в инициации и поддержании разрегулированных иммунных ответов в коже. Приблизительно 90% инфильтрирующих Т-клеток в кожных воспалительных участках экспрессируют кожный лимфоцит-ассоциированный антиген, который связывает Е-селектин, индуцируемую молекулу адгезии на эндотелии (рассмотрено у Santamaria-Babi, et al., Eur. J. Dermatol. 14:13, (2004)). Было зафиксировано существенное повышение циркулирующих CLA+Т-клеток среди пациентов с AD по сравнению с контрольными индивидуумами (см. Teraki, et al., Br. J. Dermatol. 143: 373 (2000), в то время как другими было показано, что CLA+Т-клетки памяти пациентов с AD предпочтительно отзываются на экстракт аллергена по сравнению с популяцией CLA (см., Santamaria-Babi, L.F., et al., J. Exp. Med. 181: 1935. (1995)). У людей патогенез атопических заболеваний кожи был ассоциирован с повышением CLA+Т-клеток, которые экспрессируют повышенные уровни цитокинов Th-2-типа, подобные IL-5 и IL-13. См. Akdis et al., Eur. J. Immunol. 30: 3533 (2000); и Hamid et al., J. Allergy Clin. Immunol. 98: 225 (1996).

[104] Мыши NC/Nga самопроизвольно развивают AD-подобные очаги, которые во многих аспектах аналогичны AD человека, в том числе по течению болезни и признакам, гистопатологии и иммунопатологии при размещении в свободных от неспецифической микрофлоры (non-SPF) условиях, приблизительно в 6-8-недельном возрасте. Наоборот, мыши NC/Nga, содержащиеся в условиях SPF, не развивают очаги повреждения кожи. Однако появление спонтанных очагов на коже и почесывающее поведение могут быть синхронизированы у мышей NC/Nga при предоставлении условий SPF путем еженедельной внутрикожной инъекции неочищенного антигена пылевого клеща. См., Matsuoka et al., Allergy 58: 139 (2003). Таким образом, развитие AD в NC/Nga представляет собой применимую модель для оценки новых способов лечения AD.

[105] В дополнение к модели NC/Nga самопроизвольного AD, внутрикожная сенсибилизация мышей с использованием OVA также может быть использована в качестве модели для индуцирования антиген-зависимого эпидермального и дермального утолщения с использованием мононуклеарного инфильтрата в кожу сенсибилизированной мыши. Обычно это совпадает с повышенными уровнями в сыворотке тотальных и специфических IgE, однако никакой дисфункции кожного барьера или зуда обычно не происходит в этой модели. См., Spergel et al., J. Clin. Invest. 101:1614, (1998). Данный протокол может быть модифицирован с целью индуцирования дисрегуляции кожного барьера и зуда сенсибилизацией трансгенных мышей DO11.10 OVA TCR с помощью OVA. Повышенное число антиген-специфических Т-клеток, которые могли бы узнавать сенсибилизирующий антиген, может повышать уровень воспаления кожи до появления видимого почесывающего поведения и лихенификации/образования чешуек на коже.

[106] Введение анти-IL-21 антител мышиным моделям атопического дерматита применяют для оценки клинического применения анти-IL-21 антител для улучшения симптомов и изменения развития болезни.

Артрит

[107] Артрит, в том числе остеоартрит, ревматоидный артрит, артритические суставы в результате травмы и т.п., являются широко распространенными воспалительными состояниями, которые получили бы пользу от терапевтического применения противовоспалительных антител и связывающих полипептидов. Например, ревматоидный артрит (RA) представляет собой системное заболевание, которое затрагивает все тело и является одной из наиболее распространенных форм артрита. Ревматоидный артрит отличается воспалением мембраны, выстилающей сустав, которое вызывает боль, жесткость, тепло, покраснение и опухание. Воспалительные клетки высвобождают ферменты, которые могут расщеплять кость и хрящ. В результате ревматоидного артрита воспаленная выстилка сустава, синовиальный слой, может поражать и повреждать кость и сустав, что приводит к износу сустава и сильной боли среди прочих физиологических эффектов. Вовлеченный сустав может терять свою форму и правильное совмещение, что приводит к боли и потери подвижности.

Ревматоидный артрит

[108] Ревматоидный артрит (RA) представляет собой иммуноопосредованное заболевание, конкретно отличающееся воспалением и последующим повреждением ткани, приводящее к тяжелой нетрудоспособности и повышенной смертности. Различные цитокины продуцируются локально в ревматоидных суставах. Многочисленные исследования показали, что IL-1 и TNF-альфа, два прототипичных провоспалительных цитокина, играют важную роль в механизмах, вовлеченных в синовиальное воспаление и в прогрессирующее разрушение суставов. Действительно, введение ингибиторов TNF-аьфа и IL-1 пациентам с RA приводило к резкому улучшению биологических и клинических признаков воспаления и снижению эрозии кости и разрушению хрящей по радиологическим показателям. Однако, вопреки этим обнадеживающим результатам, существенный процент пациентов не реагирует на эти вещества, давая возможность предположить, что другие медиаторы также являются вовлеченными в патофизиологию артрита (Gabav. Expert. Opin, Biol. Ther. 2(2):135-149. 2002).

[109] Существует несколько известных в данной области экспериментальных моделей на животных для ревматоидного артрита. Например, в модели коллаген-индуцированного артрита (CIA) у мышей развивается хронический воспалительный артрит, который имеет близкое сходство с ревматоидным артритом человека. Поскольку CIA имеет общие сходные иммунологические и патологические свойства с RA, то это делает его идеальной моделью для скрининга потенциальных противовоспалительных соединений для человека. Модель CIA является хорошо известной моделью на мышах, которая, для проявления CIA, зависит как от иммунного ответа, так и от воспалительного ответа. Иммунный ответ содержит взаимодействие В-клеток и CD4+Т-клеток в ответ на коллаген, который подается в качестве антигена и приводит к образованию антител против коллагена. Фаза воспаления представляет собой результат тканевых ответов на медиаторы воспаления, как результат некоторых из этих антител, дающих перекрестную реакцию на мышиный нативный коллаген и активирующих путь активации комплемента. Преимущество использования модели СIА состоит в том, что основные механизмы патогенеза являются известными. Соответствующие Т-клеточные и В-клеточные эпитопы на коллагене II типа были идентифицированы и различные иммунологические (например, гиперчувствительность замедленного типа и антиколлагеновые антитела) и воспалительные (например, цитокины, хемокины и матрикс-деградирующие протеазы) параметры, относящиеся к иммуноопосредованному артриту, были определены и, таким образом, могут быть использованы для оценки эффективности тестируемой композиции в модели СIА (Wooley, Curr. Opin. Rheum. 3:407-20, 1999; Williams et al., Immunol. 89:9784-788, 1992; Myers et al., Life Sci. 61:1861-78, 1997; и Wang et al., Immunol. 92:8955-959. 1995).

[110] Введение анти-IL-21 антител данной мышиной модели CIA используют для оценки применения анти-IL-21 антител для улучшения симптомов и изменения течения болезни.

Воспалительное заболевание кишечника (IBD)

[111] В Соединенных Штатах приблизительно 500000 человек страдает от воспалительного заболевания кишечника (IBD), которое может поражать и ободочную кишку и прямую (язвенный колит), или обе, тонкий и толстый кишечник (болезнь Крона). Патогенез этих заболеваний неясен, но они заключаются в хроническом воспалении пораженных тканей. Язвенный колит (UC) представляет собой воспалительное заболевание толстой кишки, обычно называемой ободочной кишкой, отличающееся воспалением и изъязвлением слизистой оболочки или находящейся глубоко внутри выстилки ободочной кишки. Это воспаление вызывает частое опорожнение ободочной кишки, приводя к диарее. Симптомы включают в себя послабление стула и ассоциированный абдоминальный спазм, лихорадочное состояние и потерю веса. Хотя точная причина UC неизвестна, последнее исследование дает основание предположить, что естественная защитная реакция организма работает против белков тела, которые тело считает чужеродными ("аутоиммунная реакция"). Возможно потому, что они напоминают бактериальные белки в кишке, эти белки могут или спровоцировать, или стимулировать воспалительный процесс, который начинает разрушать выстилку ободочной кишки. Как только выстилка ободочной кишки разрушается, язва образует высвобождение слизи, гноя и крови. Болезнь обычно начинается в ректальной зоне и может, в конце концов, простираться через всю толстую кишку. Повторяющиеся случаи воспаления приводят к истончению стенки кишечника и прямой кишки на основе рубцовой ткани. Отмирание ткани ободочной кишки или сепсис может происходить вместе с тяжелой болезнью. Симптомы язвенного колита меняются в зависимости от тяжести, и их начало может быть постепенным или внезапным. Приступы могут быть спровоцированы многими факторами, в том числе респираторными инфекциями или стрессом.

[112] Хотя в настоящее время не существует никакого лечения для UC, способы лечения сфокусированы на подавлении нарушенного воспалительного процесса в выстилке ободочной кишки. Способы лечения, в том числе кортикостероидными иммунодепрессантами (например, азатиоприном, меркаптопурином и метотрексатом) и аминосалицилатами являются доступными для лечения болезни. Однако длительное применение иммунодепрессантов, таких как кортикостероиды и азатиоприн, может привести к серьезным побочным эффектам, в том числе истончению костей, катаракте, инфекционной болезни и воздействиям на печень и костный мозг. У пациентов, для которых существующая терапия не является успешной, альтернативой является хирургическая операция. Однако хирургическая операция заключается в удалении всей ободочной кишки и прямой кишки.

[113] Существует несколько экспериментальных моделей на животных, которые могут частично имитировать хронический язвенный колит. Наиболее широко используемая модель представляет собой модель колита, индуцированного 2,4,6-тринитробензолсульфокислотой/этиловый спирт (TNBS), которая включает в себя хроническое воспаление и изъязвление в ободочной кишке. При введении TNBS в ободочную кишку восприимчивых мышей путем интраректального капельного введения, TNBS индуцирует Т-клеточно-опосредуемый иммунный ответ в слизистой оболочке ободочной кишки, в этом случае приводя к тяжелому воспалению слизистой оболочки, отличающемуся массивной инфильтрацией Т-клеток и макрофагов на протяжении всей стенки толстой кишки. Кроме того, такая гистопатологическая картина сопровождается клинической картиной прогрессирующей потери веса (истощением), кровавой диареей, выпадением прямой кишки и утолщением стенки толстой кишки (Neurath et al., Intern. Rev. Immunol. 19:51-62, 2000). Адаптивный перенос наивных Т-клеток мышам с несовпадением по минорным локусам гистосовместимости или сингенным мышам с ослабленным иммунитетом приводит к развитию колита (Leach MW et al., 1996, Powrie F. et al., 1997), a также к повреждениям кожи, напоминающим псориаз (Schon MP et al., Nat. Med. 2: 183-8, 1997; Davenport CM et al., Int. Immunopharmacol. 5:653-72, 2002). Трансплантация всего лишь 0,2 миллиона CD4+CD25- Т-клеток от мышей BALB/C или B10.D2 в мышей с ослабленным иммунитетом С. В-17 SCID приводит к потере веса, положительному гемокульт-тесту кала и развитию повреждений кожи. Симптомы у данных мышей варьируют от колонии к колонии. Данная модель колита/псориаза имеет некоторые общие черты с болезнью Крона и псориазом человека и была широко использована для тестирования эффективности терапии данных заболеваний у людей.

[114] Другая экспериментальная модель колита использует декстран с сульфатом натрия (DSS), который индуцирует острый колит, проявляющийся кровавой диареей, потерей веса, укорачиванием ободочной кишки и изъязвлением слизистой с нейтрофильной инфильтрацией. DSS-индуцированный колит гистологически отличается инфильтрацией воспалительных клеток в собственную пластинку слизистой оболочки, с лимфоидной гиперплазией, фокальным (очаговым) поражением крипты и эпителиальным изъязвлением. Считается, что такие изменения развиваются из-за токсического эффекта DSS на эпителий и фагоцитоза клеток собственной пластинки слизистой оболочки и образования TNF-альфа и IFN-гамма. Несмотря на его обычное использование, несколько проблем относительно механизмов DSS об уместности по отношению к человеческому заболеванию остаются нерешенными. DSS рассматривают в качестве Т-клеточно-независимой модели, поскольку он обнаруживается у животных, дефицитных по Т-клеткам, таких как мыши SCID.

[115] Введение анти-IL-21 антител данным TNBS, DSS или CD4+Т-клеточным моделям переноса может быть использовано для оценки применения антагонистов IL-21 для улучшения симптомов болезни и изменения течения желудочно-кишечного заболевания. IL-21 может играть роль в воспалительном ответе при колите, нейтрализация активности IL-21 путем введения антагонистов IL-21 представляет собой потенциальный терапевтический подход при IBD.

Псориаз

[116] Псориаз является хроническим заболеванием кожи, которое поражает более чем семь миллионов американцев. Псориаз типа бляшек является наиболее широко распространенной формой, отличающейся воспаленными очажками кожи ("очаги"), покрытыми белыми серебристыми чешуйками. Псориаз может быть ограничен несколькими бляшками или затрагивать от умеренных до обширных участков кожи, выступающих чаще всего на коже головы, коленях, локтях и туловище. Хотя он является сильно заметным, псориаз не является заразной болезнью. Патогенез заболеваний заключается в активации Т-клеток, измененной презентации антигена и образовании цитокинов воспалительными дендритными клетками, и хроническом воспалении пораженных тканей. Анти-IL-21 антитела данного изобретения могли бы служить в качестве ценного терапевтического средства для уменьшения воспаления и патологических эффектов при псориазе, других воспалительных кожных заболеваниях, аллергических заболеваниях кожи и слизистых оболочек и родственных заболеваниях.

[117] Псориаз представляет собой опосредуемое Т-клетками воспалительное нарушение кожи, которое может вызывать значительный дискомфорт. Псориаз представляет собой заболевание, для которого не существует лечение и который поражает людей всех возрастов. Псориаз поражает приблизительно два процента населения Европы и Северной Америки. Хотя люди с псориазом легкой степени тяжести могут часто контролировать свое заболевание с помощью местнодействующих средств, более чем один миллион пациентов во всем мире нуждается в лечении ультрафиолетом или иммуносупрессивной терапией. К сожалению, неудобство и риск при облучении ультрафиолетом и токсичность многих методов лечения ограничивают их длительное применение. Кроме того, у пациентов обычно происходит повторение симптомов псориаза и в ряде случаев возобновление симптомов вскоре после прекращения иммуносупрессивной терапии. Анти-IL-21 антитела могут быть протестированы с помощью недавно разработанной модели псориаза на основе CD4+CD45RB модели переноса (Davenport et al., Internat. Immunopharmacol., 2:653-672, 2002).

[118] В дополнение к другим моделям заболеваний, описанным здесь, активность анти-IL-21 антител на воспаленной ткани, полученной из псориатических бляшек человека, может быть измерена in vivo с помощью мышиной модели тяжелой формы комбинированного иммунодефицита (SCID). Было разработано несколько мышиных моделей, в которых человеческие клетки или тканевый трансплантат имплантируют мышам с иммунодефицитом (все вместе называют модели ксенотрансплантатов); см., например, Cattan and Douglas, Leuk. Res. 8:513-22, 1994 и Flavell, Hematological Oncology. 14:67-82, 1996. В качестве in vivo модели ксенотрансплантата псориаза псориатическую ткань кожи человека имплантируют в мышиную модель SCID и впоследствии критически оценивают с подходящим антагонистом. Кроме того, другие экспериментальные модели псориаза на животных в данной области могут быть использованы для оценки антагонистов IL-21, такие как кожные трансплантаты псориатических тканей человека, имплантированные в мышиную модель AGR129 и критически оцененные с подходящим антагонистом (см., например, Boyman et al., J. Exp. Med. Онлайн публикация #20031482, 2004). Аналогично, ткани или клетки, полученные из очагов заболеваний колитом, IBD, IBS, артритом или других воспаленных очагов человека, могут быть использованы в модели SCID для оценки противовоспалительных свойств анти-IL-21 антител, описанных здесь.

[119] Эффективность лечения измеряют и статистически оценивают в виде возросшего противовоспалительного эффекта в рамках леченой популяции на протяжении периода времени с использованием способов, хорошо известных в данной области. Некоторые типичные способы включают в себя, без ограничения, например, измерение в модели псориаза толщины эпидермиса, числа воспалительных клеток в сосочковом слое дермы и степени выраженности паракератоза. Такие способы, известные в данной области, описаны здесь. См., например, Zeigler et al., Lab Invest 81:1253, 2001; Zollner et al., J. Clin. Invest. 109:671, 2002; Yamanaka et al., Microbiol. Immunol. 45:507, 2001; Raychaudhuri et al., Br. J. Dermatol. 144:931, 2001; Boehncke et al., Arch. Dermatol. Res. 291:104. 1999; Boehncke et al., J. Invest. Dermatol. Ц6:596, 2001; Nickoloff et al., Am. J. Pathol. 146:580, 1995; Boehncke et al., J. Cutan. Pathol. 24:1, 1997; Sugai et al., J. Dermatol. Sci. 11:85, 1998; и Villadsen et al., J. Clin. Invest. 112: 1571, 2003. Воспаление также может быть проконтролировано на протяжении периода времени с использованием хорошо известных методов, таких как проточная цитометрия (или ПЦР) для количественного определения числа воспалительных или поврежденных клеток, присутствующих в пробе, с помощью оценочного показателя (потеря веса, диарея, аноректальное кровотечение, длина ободочной кишки) для IBD, оценочная шкала заболевания по лапкам и оценочная шкала воспаления для модели СIА RA.

[120] Введение анти-IL-21 антител в данную мышиную модель псориаза используют для оценки применения анти-IL-21 антител для улучшения симптомов и изменения течения заболевания.

Системная красная волчанка

[121] Системная красная волчанка (SLE) представляет собой нарушение, опосредованное иммунным комплексом, отличающееся хроническим продуцированием IgG антител, направленных против универсальных аутоантигенов (например, анти-dsDNA). Эффекты SLE являются скорее системными, чем локализованными на специфическом органе, хотя в некоторых случаях могут приводить к гломерулонефриту (то есть волчаночному нефриту). Множественные хромосомные локусы были связаны с заболеванием и могут способствовать различным аспектам болезни, например, анти-dsDNA антитела и гломерулонефрит. Было показано, что CD4+Т-клетки активно участвуют в мышиных моделях SLE (Horwitz, Lupus 10:319-320, 2001; Yellin and Thienel, Curr. Rheumatol. Rep., 2:24-37, 2000). Роль CD8+Т-клеток не является четко установленной, но существуют данные предполагать, что "супрессорная" функция CD8+Т-клеток нарушается у пациентов с волчанкой (Filaci et al., J. Immunol. 166:6452-6457. 2001; Sakane et al., J. Immunol., 137:3809-3813, 1986).

[122] Было убедительно показано, что IL-21 индуцирует дифференцировку наивных В-клеток человека в антителосекретирующие плазматические клетки (Ozaki et al., J. Immunol. 173:5361, 2004; Ettinger et al., J. Immunol. 175:7867-79, 2005; Ettinger et al., J. Immunol. 178:2872-82, 2007; Kuchen et al., J. Immunol. 179:5886-96, 2007). Ozaki et al., (J. Immunol. 173:5361, 2004) также показали, что экспрессия IL-21 повышена у предрасположенных к волчанке мышей BXSB-Xaa, модели для SLE, в возрасте, при котором прежде всего становятся очевидны начальные характерные признаки аутоиммунных процессов. Лечение данных мышей BXSB-Kao с помощью мышиного антагониста IL-21 частично ингибирует различные параметры заболевания, в том числе гломерулонефрит (Bubier et al., Ann N Y Acad. Sci. 1110:590-601. 2007). Было показано, что тот же самый антагонист IL-21 является эффективным в другой доклинической модели заболевания SLE, мыши MRL/lpr (Herber et al., J. Immunol. 178: 3822-3830, 2007). Кроме того, поскольку IL-21 лимитирует развитие клеток Treg, то введение анти-IL-21 антител могло бы обеспечить более надежную супрессорную функцию Т-клеток у пациентов с волчанкой, у которых эта функция нарушена (Lamprecht et al., Blood. 112 (8):3339-47. 2008).

[123] Данные, полученные от 24 пациентов с SLE и 15 здоровых контролей, показали, что 1) экспрессия мРНК IL-21 является повышенной в CD4+Т-клетках пациентов с волчанкой по сравнению с контролями, 2) уровни IL-21 являются существенно повышенными в сыворотках пациентов с активными по сравнению с неактивными SLE или контролями, что установлено с использованием коммерческого набора IL-21 kit (Invitrogen, Carlsbad, CA), 3) IL-21 повышает пролиферацию CD4+Т-клеток и CD 19+В-клеток у пациентов и контролей в зависимости от дозы, 4) IL-21 повышает индуцированную анти-CD40 дифференцировку плазматических клеток у нормальных контролей и пациентов с SLE, и 5) повышенные уровни IL-21 могут вносить вклад в пролиферацию аутореактивных CD4+Т-клеток и дифференцировку плазматических клеток у SLE (Rus, V., ACR Presentation #1760. 2008 American College of Rheumatology meeting, October 24-29, 2008).

[124] Анти-IL-21 антитела могут быть введены в сочетании с другими агентами, уже находящимися в применении при аутоиммунитете, в том числе иммуномодуляторами, такими как IFNγ, NOVANTRONE®, ENBREL®, BETAFERON®, REM1CADE®, LEUKINE® и PROLEUKIN®. Анти-IL-21 антитела могут быть введены в сочетании с другими агентами, уже применяемыми в терапии рака множественной миеломы, лимфомы Ходжкина или острого Т-клеточного лейкоза, такими как THALOMID® или со стероидами, такими как дексаметазон или преднизон. Установление оптимального уровня дозы и схемы применения анти-IL-21 антител делают различными способами, в том числе изучением фармакокинетики и фармакодинамики анти-IL-21 антител; определением эффективных доз на животных моделях и оценкой токсичности анти-IL-21 антител. Прямые фармакокинетические измерения проводят на приматах и затем клинические испытания могут быть использованы для прогнозирования теоретических доз у пациентов, у которых анти-IL-21 антитела в плазме достигают уровней, которые являются достаточной величины и длительности для достижения биологического ответа у пациентов.

Отторжение трансплантата

[125] Реципиенты трансплантированных твердых органов могут развивать острое или хроническое отторжение аллотрансплантата, обусловленное несоответствием гистосовместимости. Образование антител, направленных против молекул HLA (аллоантител) у данных пациентов происходит вследствие презентации чужеродного антигена Т-клеткам. Аллоантитела могут опосредовать повреждение ткани в трансплантате путем образования иммунных комплексов, фиксации комплемента и антителозависимой клеточной цитотоксичности, управляемой связанными аллоантителами. Путь активации комплемента также высвобождает локальные факторы, которые активируют эндотелиальные клетки и вызывают васкулопатию в трансплантате. C4d-продукт комплемента является ранним маркером и при остром и при хроническом отторжении трансплантата и может быть обнаружен в доклинических случаях до явных патологических изменений (Racusen and Haas, Clin. J. Am. Soc. Nephrol. 1:415-420. 2006; Moll and Pascual, Am. J. Transplantation 5:2611-2618. 2005; Tinkam and Chandraker, Clin J. Am. Soc. Nephrol. 1:404-414, 2006). У пациентов проводят скрининг на анти-HLA аллоантитела (панелированное антитело) до трансплантации. Пациенты могут быть высокосенсибилизированными вследствие предшествующего отторжения аллотрансплантата, переливаний крови или многоплодных беременностей. Наличие аллоантител у высокосенсибилизированных пациентов с трансплантацией усложняет уход за ними, так как могут быть необходимы усиленные иммуносупрессивные способы лечения и шанс острого отторжения является высоким (Baid et al., Curr. Opin. Immunol. 13:577-581, 2001). В некоторых случаях используют агенты, нацеленные на В-клетки (микофенольную кислоту или ритуксимаб), хотя данная терапевтическая стратегия прямо не нацелена на антителосекретирующие плазматические клетки. Также применяют плазмоферез для снижения циркулирующего иммуноглобулина. Во всех случаях, реципиентов с трансплантатом лечат с помощью иммуносупрессивных агентов, нацеленных на Т-клетки для снижения риска отторжения, и реципиенты могут быть медленно "отлучены" от этих режимов, поскольку установлена толерантность к трансплантату (Seyfort-Margolis and Turka, J. Clin. Invest. 118(8):2684-2685. 2008; Taylor et al., Crit. Rev. Oncol. Hematol. 56:23-46, 2005; Amante and Ejercito, Transplant. Proc. 40:2274-2280, 2008).

[126] Развитие плазматических клеток, секретирующих антитела, требует когнатной помощи от CD4 Т-клеток в дополнение к специализированному микроокружению, которое поддерживает выживание плазматических клеток (Tarlington et al., Curr. Opin. Immunol. 20:162-169, 2008). Секреция цитокинов активированными Т-клетками является необходимой для дифференцировки и выживания плазматических клеток и, как известно, затрагивает природу образования антител и изотип Ig. Существуют модели для мониторинга Т-клеточно-зависимых антительных ответов в мышиных линиях и "приматах кроме человека". Эти методы хорошо понятны специалистам в данной области. Кинетика и амплитуда первичных или вторичных антительных ответов против модельных пептидных антигенов, таких как овальбумин, столбнячный токсоид, овечьи эритроциты, или модифицированный тринитрофенилом гемоцианин лимфы улитки мониторируют с использованием анализов, которые обнаруживают тотальные или антигенспецифические антитела, в том числе субтипов IgG, IgM, IgE или IgA в сыворотке леченных животных. В некоторых моделях созревание аффинности антител также может быть проконтролировано. Данные модели могут быть использованы для тестирования эффектов лекарственных средств, которые изменяют В-клеточную помощь Т-клетками и которые блокируют цитокины, которые считаются важными для дифференцировки и выживания плазматических клеток.

[127] Изучение отторжения аллотрансплантата проводят на многих видах животных. Например, модель почечного трансплантата на яванских макаках может представлять эффекты хронического отторжения почечного аллотрансплантата, опосредованного аллоантителами у людей. Толерогенные для аллотрансплантата режимы выполняют в некоторых случаях перед трансплантацией. Присутствие донор-специфических аллоантител мониторируют проточным цитометрическим анализом сыворотки реципиента с несовпадающими лейкоцитами периферической крови и отложения C4d-компонента комплемента обнаруживают в биопсиях почечного аллотрансплантата (Smith et al., Am. J. Transplant. 6:1790-1798, 2006; Smith et al., Am. J. Transplant. 8:1-11, 2008). Острые и хронические модели трансплантации могут быть проведены на мышиных видах специалистами в данной области.

[128] Введение анти-IL-21 антител в модель Т-клеточно-зависимого антительного ответа или в модель отторжения аллотрансплантата используют для оценки клинического применения анти-IL-21 антител для снижения ответов аллоантител и улучшения симптомов отторжения аллотрансплантата, или в виде части схемы лечения перед трансплантацией или толерогенного режима для реципиентов с трансплантатом, в том числе высокосенсибилизированных пациентов с трансплантацией.

[129] Изобретение далее иллюстрируют следующими неограничивающими примерами.

ПРИМЕРЫ

Пример 1. Получение белков и антител IL-21

1А. Иммунизации и гибридомы

[130] Белок IL-21 получали, как описано в патенте США №7250274, включенного здесь полностью. Растворимые рецепторные белки IL-21 получали, как описано в патентной заявке США 2007-0122413 и патенте США №6777539, обе включены здесь полностью. Моноклональные антитела против IL-21 получали в мышах дикого типа, генерирующих мышиные антитела, и в трансгенных мышах, генерирующих полностью человеческие антитела (Medarex, Princeton, NJ). Мышей иммунизировали белком IL-21 человека. Вкратце, исходно мышей иммунизировали подкожной инъекцией 30 мкг очищенного рекомбинантного IL-21 (полученного в E.coli в ZymoGenetics), конъюгированного с BSA (Imject Pharmalink Immunogen Kit, Pierce), и вводили в сочетании с CpG (олигонуклеотидом лиганда мышиного TLR9 и GM-CSF (гранулоцитарно-макрофагальный колониестимулирующий фактор, R&D, Minneapolis, MN) и адъювантом Emulsigen® - Р (MVP Laboratories, INC, Omaha, NE) в соответствии с инструкцией производителя. После начальной иммунизации каждая из мышей получала по три дополнительных 30 мкг IL-21 в адъюванте Emulsigen® - P с использованием подкожного способа введения с недельными интервалами. Через семь дней после четвертой иммунизации у мышей отбирали кровь через ретроорбитальное сплетение и отделяли сыворотку крови для анализа способности сыворотки связываться с IL-21.

[131] Собирали и объединяли спленоциты двух мышей BALB/c с высоким титром или трансгенных мышей и сливали с клетками мышиной миеломы Р3-Х63-Ag8:653 с использованием PEG 1450 в одну процедуру слияния (соотношение при слиянии 2:1, спленоцитов к миеломным клеткам", Antibodies: A Laboratory Manual", E.Harlow and D.Lane, Cold Spring Harbor Press). После 9 дней роста после слияния идентифицировали пулы гибридом, продуцирующих специфическое антитело, прямым способом проведения ELISA и ловушечным ELISA с использованием рекомбинантного белка IL-21, немеченого и меченого человеческого IgG Fc, в виде мишени для специфического антитела. Положительные пулы гибридом анализировали дополнительно на их способность блокировать связывание лиганда с рецептором, которое измеряют в виде уровня фосфорилирования STAT3 после лиганд-рецепторного взаимодействия ("реакция нейтрализации фосфорилирования STAT3") очищенного рекомбинантного белка IL-21 в клетках BaF3, экспрессирующих последовательность рецептора IL-21. Моноклональные антитела, очищенные от среды для культуры тканей, отличались их способностью блокировать лиганд-рецепторное взаимодействие ("реакция нейтрализации фосфорилирования STAT3") очищенного рекомбинантного белка IL-21 в клетках BaF3, экспрессирующих последовательности рецептора. "Нейтрализацию" моноклональных антител идентифицировали таким образом.

[132] Пулы гибридом, дающие положительные результаты в "реакции нейтрализации фосфорилирования STAT3" и форматах ELISA, клонировали по меньшей мере два раза методом серийных разведений. В данных анализах пробы титровали с использованием стандартного разведения с низкой плотностью (менее чем одна клетка на лунку), чтобы увидеть, какой клон будет сохранять наивысшее показание оптической плотности OD. С использованием результатов, как реакции нейтрализации, так и анализов титрования, два специфических клона из каждой исходной маточной лунки отбирали для дополнительных анализов. Клоны подвергают дополнительному раунду клонирования для обеспечения гомогенности культуры и подвергают скринингу с использованием прямого способа проведения ELISA. После одного дополнительного анализа методом титрования отбирали два конечных клона IL-21. Гибридомные клоны культивировали в среде для выращивания, содержащей 90% модифицированной среды Iscove's Modified Dulbecco's (пер., среда Дульбекко, модифицированная по способу Исков) с 2 мМ L-глутамина, 100 мкг/мл пенициллина и 100 мкг/мл стрептомицина сульфата и 10% Fetal Clone I Serum (Hyclone Laboratories). Клоны размножали высевом культур при 2×105 клеток/мл и поддержанием между 1×105 и 5×105 клеток/мл при 37°С и 5-6% CO2. Клетки адаптировали к бессывороточным условиям при последовательных переносах. Клетки замораживают в 90% сыворотке, 10% DMSO и хранят в газовой фазе аппарата с замораживанием погружением в жидкий азот.

[133] Очищенные моноклональные антитела, продуцируемые гибридомными клонами, характеризовали различными способами, в том числе сортировкой (binning) (т.е. определением, могло ли каждое антитело ингибировать связывание любого другого антитела), эпитопным картированием с использованием пептидов, относительной аффинностью и нейтрализацией.

[134] Способы получения гетерологичных антител из трансгенных мышей известны, смотри, например, Lonberg, Nat. Biotech. 23(9): 1117-25. 2005; Tomizuka et al., PNAS 97(2):722-727. 2000; и патент США №5625126.

[135] Нижеуказанные гибридомы, продуцирующие мышиные моноклональные антитела (mAb), направленные против IL-21 человека, были депонированы в Американской коллекции типовых культур, Manassas, VA. клон 338.5.4 АТСС No. (PTA-8317), клон 338.11.5 АТСС No. (PTA-8314), клон 338.14.3 АТСС No. (PTA-8313), клон 338.15.5 АТСС No. (PTA-8315), клон 338.17.3 АТСС No. (PTA-8316), клон 338.24.5 АТСС No. (PTA-8430), клон 338.25.6 АТСС No. (PTA-8431), клон 338.39.5 АТСС No. (PTA-8432), клон 338.29.2 АТСС No. (PTA-8433), клон 338.28.6 АТСС No. (PTA-8434).

[136] Нижеуказанные гибридомы, продуцирующие человеческие моноклональные антитела, направленные против IL-21 человека, были депонированы в Американской коллекции типовых культур, Manassas, VA. Таблица 1 обеспечивает полные аминокислотные последовательности вариабельной тяжелой (VH) и вариабельной легкой (VL) цепей антител. Также включенными являются последовательности для CDRI, CDR2 и CDR3 областей VH и VL для каждого антитела. Соответствующие нуклеотидные последовательности указывают в списке последовательностей.

Включенной в банк, но не в таблицу 1, является гибридома, обозначенная 366.345.6.11, АТСС No. PTA-8788.

1В: Экспрессия клона 362.78.1.44 генов тяжелой и легкой цепи иммуноглобулина в клеточной линии млекопитающих для получения 362.78-СНО

[137] Человеческое моноклональное антитело против IL-21 человека (произведенное из гибридомного клона 362.78.1.44) экспрессировали в клетках СНО с использованием двух экспрессионных кассет. VH-цепь сливали с модифицированной константной областью IgG1 человека. Модифицированный IgG1, IgG1.1, содержал пять аминокислотных замен для снижения эффекторных функций. Тяжелую цепь антитела человека против IL-21 человека соединяли с селектируемым маркером дигидрофолатредуктазой (DHFR) с последовательностью сайта внутренней посадки рибосом (IRES). Экспрессию тяжелой цепи антитела человека против IL-21 человека и селектируемого маркера DHFR направляли конститутивным синтетическим промотором, состоящим из слияния цитомегаловирусного (CMV) энхансера и энхансера/промотора миелопролиферативного вируса саркомы (MPSV). Сигнал полиаденилирования обезьяньего вируса 40 (SV40) использовали для терминации транскрипции на конце селектируемого маркера DHFR. VL-цепь сливали с константной областью каппа-цепи иммуноглобулина человека. Легкую цепь антитела человека против IL-21 человека связывали с селективным маркером устойчивости к пуромицину (puroR) с последовательностью IRES. Экспрессию легкой цепи человека против IL-21 человека и селектируемого маркера puroR направляли конститутивным синтетическим промотором, состоящим из слияния CMV энхансера человека и энхансера/промотора MPSV. Сигнал полиаденилирования SV40 использовали для терминации транскрипции на конце селектируемого маркера. Экспрессионные кассеты тяжелой и легкой цепи человека против IL-21 человека котрансфицировали в клетки-хозяина СНО DXB-11. Селекцию на пуромицине сопровождали селекцией на меторексате для получения высокой, стабильной экспрессии человеческого моноклонального антитела против IL-21 человека. Экспрессированный в СНО вариант mAb IL-21 клона 362.78.1.44 будет называться в последующих примерах в виде "362.78-СНО."

Пример 2. Моноклональные антитела анти-IL-21 связывают белки и пептиды IL-21 человека

2А. Связывание и нейтрализация пептидов

[138] Способность связывающих и нейтрализующих моноклональных антител против IL-21 человека связываться с IL-21 человека, мутантным белком IL-21 человека и с синтетическими пептидами, произведенными из IL-21 человека, демонстрировали в прямом формате анализа ELISA.

[139] Использовали следующие пептиды:

[140] пептид #1 ((SEQ ID NO:3) pyroGlu GQDRHMIRMRQLIDIVDQLKC;

[141] пептид #2 ((SEQ ID NO: 4) NDLVPEFLPAPEDVETNC,

[142] пептид #3 ((SEQ ID NO: 5) NVSIKKLKRKPPSTNAGRRQKHRLTC,

[143] пептид #4 ((SEQ ID NO:6) CDSYEKKPPKEFLERFKSLLQKMIHQHLS и

[144] Рекомбинантный IL-21 человека (SEQ ID NO: 2), синтетические пептиды, произведенные из последовательности IL-21 человека, и рекомбинантный мутантный IL-21 человека (SEQ ID NO: 7) по отдельности иммобилизовали на поверхности 96-луночных полистирольных планшетов для ELISA в объеме 100 мкл/лунку в концентрации 1 мкг/мл в покрывающем буфере (0,1 М Na2CO3, pH 9,6). Планшеты инкубировали в течение ночи при 4°С, после чего несвязавшийся белок отсасывали и планшеты промывали дважды с использованием 300 мкл/лунку буфера для промывки (PBS-Tween, определенным в виде 0,137М NaCl, 0,0022M KCl, 0,0067M Na2HPO4, 0,0020 M KH2PO4, 0,05% об./масс. полисорбат 20, pH 7,2). Лунки блокировали с помощью 200 мкл /лунку блокирующего буфера (PBS-Tween плюс 1% мас./об. бычьего сывороточного альбумина (BSA)) в течение 1 часа, после чего планшеты промывали дважды промывочным буфером. Разведения антител готовили в 5% эмбриональной бычьей сыворотке (FBS)/среде Дульбекко, модифицированной по способу Исков (IMDM) и доводили до 1 мкг/мл. Затем сдвоенные пробы каждого разведения антитела переносили в планшеты для анализа, 100 мкл/лунку, для связывания белков анти-IL-21 человека. После 1 часа инкубации при температуре окружающей среды материал из лунок отсасывали, и планшеты промывали дважды, как описано выше. Затем меченое пероксидазой хрена (HRP) Fc-специфическое козье антитело против мышиных IgG, или Fc-специфическое козье антитело против крысиных IgG, или Fc-специфическое козье антитело против человеческого IgG (Jackson ImmunoResearch Laboratories, West Grove, PA) в разведении 1:5000 с 5% средой FBS/IMDM добавляли в каждую лунку, 100 мкл/лунку, и планшеты инкубировали при температуре окружающей среды в течение 1 часа. После удаления несвязанного антитела, конъюгированного с HRP, планшеты промывали пять раз, 100 мкл/лунку тетраметилбензидина (ТМВ) (BioFX Laboratories, Owings Mills, MD) добавляли в каждую лунку и планшеты инкубировали в течение 3 минут при температуре окружающей среды. Развитие окраски останавливали добавлением 100 мкл/лунку реактива 450 nm ТМВ Stop Reagent (BioFX Laboratories, Owings Mills, MD) и просчитывали значения поглощения содержимого лунок на приборе Molecular Devices Spectra MAX 340 при 450 нм.

2В. Измерение аффинности связывания моноклонального антитела против IL-21 человека 362.78-СНО с IL-21 человека и IL-21 яванских макак методом поверхностного плазменного резонанса (Biacore)

[145] анти-IL-21 моноклональное антитело 362.78-СНО оценивали на его аффинность связывания с рекомбинантным IL-21 человека и рекомбинантным IL-21 обезьян с использованием поверхностного плазмонного резонанса.

[146] Определение аффинности. Кинетическе константы скорости и равновесные константы диссоциации измеряли для взаимодействия моноклонального антитела против IL-21 человека 362.78-СНО с IL-21 человека и IL-21 обезьяны путем поверхностного плазмонного резонанса. Константа скорости ассоциации (ka(M-1s-1)) представляет собой значение, которое отражает скорость образования комплекса антиген-антитело. Константа скорости диссоциации (kd(s-1)) представляет собой значение, которое отражает стабильность данного комплекса. Путем деления константы скорости диссоциации на константу скорости ассоциации (kd/ka) получают равновесную константу диссоциации (KD(М)). Это значение описывает аффинность связывания взаимодействия. Антитела со сходной KD могут иметь сильно отличающиеся константы скорости ассоциации и диссоциации. Следовательно, измерение как ka, так и kd антител помогает более однозначно описать аффинность взаимодействия антитела с антигеном.

[147] Материалы и методы. Изучение кинетик связывания и аффинности выполняли на системе Biacore T100™ (GE Healthcare, Piscataway, NJ). Методы для Biacore T100™ программировали с использованием программного обеспечения BIACORE Т100™ Control Software, v 1.1.1. Для данных экспериментов антитело 362.78-СНО или фиксировали на сенсорном чипе СМ4 с использованием Fc-гамма специфического козьего антитела против человеческих IgG (Jackson immunoResearch, West Grove, PA), или антитело 362.78-СНО минимально биотинилировали с использованием Sulfo-NHS-LC-Biotin, соотношение масс 1:100 (Pierce, Rockford, IL) в буфере PBS pH 7,4, затем фиксировали на чипе со стрептавидином (SA). Все эксперименты по связыванию выполняли при 25°С в буфере 10 мМ HEPES, 300 мМ NaCl, 5 мМ CaCl2, 0,05% Surfactant Р20 (Biacore), 1 мг/мл бычьего сывороточного альбумина, pH 8,0.

[148] Для данных экспериментов с Fc-гамма специфическим козьим антителом против человеческих IgG, захватывающее антитело разбавляли до концентрации 50 мкг/мл в 10 мМ ацетате натрия pH 5,0, и затем ковалентно иммобилизовали на всех четырех проточных кюветах сенсорного чипа СМ4 с использованием химии сшивания амином (EDC:NHS). После иммобилизации антитела оставшиеся активные сайты на проточной кювете блокировали с помощью 1 М этаноламина. Получали плотность захватывающего антитела приблизительно 3500 RU. анти-IL-21 антитело 362.78-СНО было фиксировано на проточной кювете 2, 3 и 4 чипа СМ4 в трех различных плотностях (изменяющихся от 25 до 150 RU). Захват антитела 362.78-СНО на иммобилизованной поверхности выполняли на скорости потока 10 мкл/мин. Система Biacore измеряет массу белка, связанного с поверхностью сенсорного чипа, и таким образом, захват тест-антитела проверяли для каждого цикла. Серийные разведения рекомбинантного человеческого IL-21 или рекомбинантного обезьяньего IL-21 (ZymoGenetics) готовили от 40 нМ до 0,003 нМ (серийные разведения 1:5). Серийные разведения инъецировали на поверхность и позволяли специфически связываться с антителом 362.78-СНО, захваченным на сенсорном чипе. Двойные инъекции каждой концентрации антигена IL-21 выполняли при времени ассоциации или 6,5 или 7 минут и времени диссоциации или 10, 15, или 60 минут. Изучение кинетики связывания выполняли со скоростью потока 50 мкл/мин. Между циклами проточные кюветы промывали 20 мМ соляной кислотой для регенерации поверхности. Данная стадия промывки удаляла как захваченное тест-антитело, так и любой связанный антиген из поверхности иммобилизованного антитела. Затем антитело 362.78-СНО опять захватывали в следующем цикле.

[149] Для экспериментов с минимально биотинилированным 362.78-СНО, биотинилированное антитело захватывали (пер., фиксировали) на проточной кювете 2, 3, и 4 чипа SA в трех различных плотностях (изменяющихся от 150 до 1200 RU). Захват биотинилированного антитела 362.78-СНО поверхностью выполняли на скорости потока 10 мкл/мин. Серийные разведения рекомбинантного человеческого IL-21 или рекомбинантного обезьяньего IL-21 (ZymoGenetics) готовили или от 50 нМ до 0,001 нМ (серийные разведения 1:4) или от 40 нМ до 0,003 нМ (серийные разведения 1:5). Данные серийные разведения инъецировали на поверхность и позволяли специфически связываться с антителом 362.78-СНО, захваченным на сенсорном чипе. Двойные инъекции каждой концентрации антигена IL-21 выполняли при времени ассоциации или 6,5 или 7 минут и времени диссоциации или 10, 15 или 60 минут. Изучение кинетики связывания выполняли со скоростью потока 50 мкл/мин. Между циклами проточные кюветы промывали 20 мМ соляной кислоты для регенерации поверхности. Данная стадия промывки удаляла любой связанный антиген с поверхности иммобилизованного антитела. Цикл промывки не удалял биотинилированное антитело 362.78-СНО с поверхности сенсора и антитело впоследствии было доступно для связывания следующей пробы антигена.

[150] Данные собирали с использованием программного обеспечения BIACORE Т100™ Evaluation software (версия 1.1.1). Данные обрабатывали вычитанием референсной проточной ячейки и контрольных инъекций. Стабильность базовой линии оценивали для уверенности, что стадия регенерации обеспечивала прочную поверхность для связывания на протяжении всей последовательности инъекций. Идентичные кривые инъекций проверяли в отношении воспроизводимости. На основе связывания моновалентного IL-21 с бивалентным антителом определяли модель связывания 1:1, которая является подходящей. Кривые связывания за вычетом референсных трех проточных кювет (FC2-1, FC3-1, FC4-1) в целом соответствовали модели связывания 1:1 с множественными Rmax и с набором RI по отношению к нулю. Данные хорошо соответствуют модели связывания 1: 1 с хорошим согласованием между экспериментальными и теоретическими кривыми связывания. Хи-квадрат (chi2) и средние квадратические ошибки, связанные с выравниваем, были низкими. Отклонений в остатках не существовало.

[151] Результаты. Для взаимодействия 362.78-СНО с IL-21 человека, данные собирали из четырех отдельных экспериментов, ka нескольких экспериментов находились в пределах от ЗЕ+07 до 5+07 (M-1s-1), тогда как kd находились в пределах от ЗЕ-06 до ЗЕ-05 (s-1). Вычисленные KD находились в пределах от 0.9Е-13 до 8Е-13 (М).

[152] Для взаимодействия 362.78-СНО с IL-21 обезьяны данные собирали из трех отдельных экспериментов, ka для каждого эксперимента составляла ЗЕ+07 (M-1s-1), тогда как kd находились в пределах от 2Е-04 до 5Е-04 (s-1). Вычисленные KD находились в пределах от 0,9Е-11 до 2Е-11 (М).

Пример 3. Эксперименты по кросс-реактивности между видами

[153] Определение способности антител против IL-21 человека давать перекрестную реакцию и связывать IL-21 мышей или яванских макак IL-21 или синтетические пептиды, произведенные из IL-21 человека

[154] Изучение кросс-реактивности между видами может быть важным для демонстрации специфичности для терапевтических стратегий развития антагонистов. Для определения, могут ли описанные здесь связывающие и нейтрализующие формы против IL-21 человека давать перекрестную реакцию и связываться с мышиным или обезьяним IL-21 (и таким образом уравнивать яванскую макаку или мышь в качестве пригодных видов для тестирования), было необходимо продемонстрировать конкурентное связывание антител с рекомбинантным IL-21 человеческим, мышиным и яванской макаки в различных форматах анализа. Один из способов тестирования связывания моноклональных антител представляет собой их поведение в иммуноблот-анализах (Вестерн-блот). Рекомбинантный человеческий IL-21 (SEQ ID NO:2), рекомбинантный мышиный IL-21 (SEQ ID NO:11), рекомбинантный обезьяний IL-21 (SEQ ID NO:9), синтетические пептиды, произведенные из последовательности IL-21 человека: пептид #1 pyr30-K50 (Seq ID 3), пептид #2 N54-C71 (SEQ ID NO:4), пептид #3 N97-C122 (SeqID N0:5), пептид #4 C125-S153 (SEQ ID NO:6), конъюгированные с овальбумином, или иррелевантный контрольный цитокин, рекомбинантный человеческий IFN-λ (ZymoGenetics) подвергали гель-электрофорезу в полиакриламидном геле с додецилсульфатом натрия (SDS-PAGE) с использованием 4-12% BisTris полиакриламдных гелей (Invitrogen, Inc.) и переносили на нитроцеллюлозные мембраны с помощью стандартных способов и буфера, содержащего 25 мМ Tris, 186 мМ глицин и 40% метанол.

[155] Для Вестерн-блотов неспецифические сайты на мембранах блокировали буфером, содержащим 20 мМ Tris, рН 7,4, 0,5 мМ EDTA, 0,5% IGEPAL CA-630, 150 мМ NaCl, 0,25% желатин и 1% блокирующий буфер казеинового гидролизата (Western Blocking Reagent, Roche Diagnostics, Inc., Basel Switerzerland) (блокирующий буфер). Затем мембраны инкубировали в течение 2 часов при комнатной температуре с очищенным моноклональным антителом (10 нг/мл или 100 нг/мл) в блокирующем буфере с последующей инкубацией в течение 2 часов с конъюгированным с пероксидазой хрена ослиным антителом против человеческого IgG (Jackson Laboratories, Bar Harbor, ME). Мембраны промывали 5 раз с помощью Tris/EDTA/IGEPAL/NaCI/блокирующего буфера с желатином, не имеющего казеиновый гидролизат, и проявляли с помощью раствора SUPERSIGNAL™ DuraWest Luminol/Enhancer/ Peroxidase Solution (Pierce, Rockford, IL) для детектирования хемилюминесценции. Блоты проявляли с использованием стандартных способов на основе рентгеновской пленки.

Пример 4. Оценка способности антител против IL-21 человека к кросс-реактивности и связыванию γс-семейства цитокинов IL-2, IL-4, IL-7, IL-9, IL-15 человека

[156] Другим важным свойством специфического антитела является способность антитела связываться с белком-мишенью (белками-мишенями) и противодействовать связыванию с белком-мишенью (белками-мишенями), но не связывать родственные белки (не являющиеся мишенями) в значительной степени. Способность антител против IL-21 человека связываться с родственными цитокинами тестировали в формате Вестерн-блот. Получали пробы всех членов γс-семейства цитокинов и разгоняли в SDS-PAGE и переносили на нитроцеллюлозные мембраны для блоттинга. Рекомбинантный человеческий IL-2 (202-IL/CF), человеческий IL-4 (204-IL/CF), человеческий IL-7 (207-IL/CF), человеческий IL-9 (209-IL/CF), человеческий IL-15 (247-IL/CF) - все получали от R&D Systems, Minneapolis MN), человеческий IL-21 (ZymoGenetics) и человеческий IFN-λ (патенты США №№6927040; 7252969) использовали для оценки специфичности антител. Все из протестированных антител не показали заметное связывание выше фона с γс-семейством цитокинов, за исключением человеческого IL-21, у которого наблюдали четкое связывание, согласующееся с предшествующими Вестерн-блотами с использованием данных антител (см. Пример 3).

Пример 5. Изучение конкурентной эпитоп-специфической сортировки (биннинга эпитопов)

[157] Эксперименты по эпитоп-специфической сортировке (binning) выполняли для определения, какие анти-IL-21 моноклональные антитела способны связываться одновременно с человеческим IL-21. Ресуспендировали как человеческие, так и мышиные антитела. Моноклональные антитела анти-IL-21, которые конкурируют за один и тот же, или перекрывающийся, сайт связывания (эпитоп) на антигене, не обладают способностью связываться одновременно и функционально объединяют в одно семейство или ″bin эпитопов″ (хранилище, бункер эпитопов). Анти-IL-21 моноклональные антитела, которые не конкурируют за один и тот же сайт связывания на антигене, обладают способностью связываться одновременно, и группируют в отдельные семейства, или "bins эпитопов". Эксперименты выполняли с использованием системы BIACORE T100™. Эксперименты по binning (сортировке эпитопов, сортинг, epitope-specific sorting, эпитоп-специфическая сортировка) выполняли с растворимым человеческим IL-21 (ZymoGenetics) в качестве антигена.

[158] Исследование эпитоп-специфической сортировки (epitope binning) выполняли на системе BIACORE T100™ (GE Healthcare, Piscataway, NJ). Методы программировали с использованием программного обеспечения BIACORE T100™ Control Software, v 1.1.1. Индивидуальные моноклональные антитела анти-IL-21 ковалентно иммобилизовали к раздельным проточным ячейкам сенсорного чипа BIACORE CM4. Затем IL-21 антиген инъецировали и давали специфически связываться с моноклональным антителом, иммобилизованным на сенсорном чипе. Система BIACORE измеряет массу белка, связанного с поверхностью сенсорного чипа, и, таким образом, иммобилизацию первичного антитела анализируемой пары и специфическое связывание IL-21 антигена с первичным антителом проверяли для каждого тест-цикла. После связывания IL-21 антигена инъецировали анти-IL-21 моноклональное антитело и давали связаться. Если вторичное анти-IL-21 моноклональное антитело было способно связывать антиген одновременно с первичным моноклональным антителом, то детектировали увеличение массы на поверхности чипа, или связывание. Однако если вторичное анти-IL-21 моноклональное антитело не было способно связывать антиген одновременно с первичным моноклональным антителом, то дополнительной массы, или связывания, не обнаруживали. Каждое анти-IL-21 моноклональное антитело, проанализированное против самого себя, использовали в качестве негативного контроля для установления уровня фонового сигнала (отсутствие связывания).

[159] Серии экспериментов выполняли для анализа связывающих свойств очищенных моноклональных антител анти-IL-21, полученных из гибридомных слияний селезенок мышей, иммунных к человеческому IL-21. Первое анти-IL-21 моноклональное антитело анализируемой пары иммобилизовали ковалентно с использованием EDC:NHS до плотности приблизительно 1000 RU (пер., единиц резонанса). IL-21 антиген разбавляли до 100 нМ и позволяли растекаться по поверхности иммобилизованного антитела. Затем вторичное антитело анализируемой пары разбавляли до 5 мкг/мл (приблизительно 32,2 нМ) и позволяли связываться с захваченным IL-21 антигеном. Субпопуляцию анти-IL-21 моноклональных антител анализировали в качестве первичного антитела в сочетании с полной панелью вторичных анти-IL-21 моноклональных антител. Эксперименты по связыванию выполняли со скоростью потока 30 мкл/мин при 25°С. Буфер для этих исследований состоял из 10 мМ Hepes, 0,3 М NaCg, 0,05% surfactant P20, 5 мМ CaCl2, 1 мг/мл бычьего сывороточного альбумина, рН 8,0. Между циклами антитело на чипе регенерировали с помощью 20 мМ соляной кислотой. Данные собирали с помощью BIACORE Т100™ Evaluation software (version 1.1.1), затем перегружали в EXCEL ™ для дополнительной обработки данных.

[160] Получали характеристики очищенных моноклональных антител анти-IL-21 и определяли в семейства эпитопов (epitope bins). Сигнал (RU, единица резонанса), представленный BIACORE, прямо коррелировал с массой на поверхности сенсорного чипа. После установления уровня фонового сигнала (RU), связанного с негативным контролем (то же самое анти-IL-21 моноклональное антитело использовали и для первичного, и для вторичного антитела), результаты сортировки (binning results) представляли как в виде положительного, так и в виде отрицательного связывания. Положительное связывание указывает на то, что два различных анти-IL-21 моноклональных антитела способны связывать антиген одновременно. Отрицательное связывание указывает на то, что два различных анти-IL-21 моноклональных антитела не способны связывать антиген одновременно. Разница между значениями положительного и отрицательного ответа в данном эксперименте была существенной и обеспечивала однозначное распределение моноклональных анти-IL-21 антител на шесть отдельных семейств, или семейство эпитопов (epitope bins). Первое семейство эпитопов (epitope bin) было представлено анти-IL-21 моноклональными антителами, например, от клонов 338.5.4; 362.78.1 и 362.597.3. Второе семейство эпитопов (epitope bin) было представлено анти-IL-21 моноклональными антителами, например, от клонов 338.14.3; 362.75.1.1 и 366.328.10. Было обнаружено, что дополнительное третье семейство (third bin) перекрывает связывающие эпитопы антител bin #1 и bin #2. Третье семейство (third bin) было представлено моноклональным антителом, например, от клона 366.552.11. Антитела, которые нейтрализуют IL-21, обнаружены в каждом из этих трех семейств (bins).

[161] Идентифицировали три дополнительных семейства эпитопов (epitope bins). Каждое из этих семейств (bins) было представлено моноклональным антителом, например, от гибридомных клонов 366.345.6.11 (bin #4), 338.28.6 (bin#5) и 338.39.5 (bin#6). Антитела, идентифицированные в этих трех семействах (bins), не нейтрализуют биологическую активность человеческого IL-21.

Пример 6. Изучение конкуренции растворимого рецептора

[162] Эксперименты по конкуренции выполняли для определения, какие моноклональные антитела против IL-21 человека обладают способностью связывания IL-21 одновременно с растворимым рецептором IL-21. Моноклональные антитела против IL-21 человека, которые конкурируют с растворимым рецептором за один и тот же, или перекрывающийся, связывающий сайт (эпитоп) на антигене не обладают способностью связываться одновременно. Моноклональные анти-IL-21 антитела, которые не конкурируют с растворимым рецептором за один и тот же связывающий сайт на антигене, являются не способными связываться одновременно. Эксперименты по конкуренции выполняли с растворимым, рекомбинантным человеческим IL-21 в виде антигена. IL-21 антигену позволяли связать моноклональное антитело до конкуренции с растворимым рецептором IL-21. Два варианта растворимого рецептора IL-21 (оба произведены ZymoGenetics) использовали для анализа моноклонального антитела в данных исследованиях: Первый вариант рецептора состоит из гомодимерного рецептора (IL-21 R-Рс), состоящего из внеклеточного домена рецептора IL-21, слитого с Fc молекулой, произведенной из человеческого иммуноглобулина. Вторая растворимая форма рецептора представляла собой гетеродимерный рецептор (IL-21 R/γc-Fc), состоящий из одной субъединицы, содержащей внеклеточный домен рецептора IL-21, слитого с Fc молекулой, произведенной из человеческого иммуноглобулина, и второй субъединицы, содержащей внеклеточный домен общей γ-цепи, слитой с Fc молекулой, произведенной из человеческого иммуноглобулина, как описано в совместном патенте США №6777539, включенном сюда в качестве ссылки в его полном виде.

[163] Исследования конкуренции выполняли на системе BIACORE Т100™ (GE Healthcare, Piscataway, NJ). Методы программировали с использованием программного обеспечения BIACORE Т100™ Control Software, v 1.1.1. Индивидуальные анти-IL-21 моноклональные антитела иммобилизовали ковалентно к отдельным проточным ячейкам сенсорного чипа BIACORE CM4. Затем инъецировали IL-21 антиген (SEQ ID NO: 2), давали специфически связаться с моноклональным антителом, иммобилизованным на сенсорном чипе. Система Biacore измеряет массу белка, связанного с поверхностью сенсорного чипа, и таким образом, иммобилизацию первого антитела и специфическое связывание IL-21 антигена с первым антителом проверяли для каждого тест-цикла. После связывания IL-21 антигена инъецировали растворимый рецептор и давали им связаться. Если растворимый рецептор был способен связывать антиген одновременно с первым моноклональным антителом, то на поверхности чипа обнаруживали увеличение массы, или связывание. Однако если растворимый рецептор не был способен связывать антиген одновременно с первым моноклональным антителом, никакой дополнительной массы, или связывания, не обнаруживали. Каждое моноклональное анти-IL-21, проанализированное против самого себя, использовали в качестве отрицательного контроля для определения уровня фонового сигнала (отсутствие связывания). В качестве положительного контроля каждое анти-IL-21 моноклональное антитело анализировали против анти-IL-21 антитела из другого семейства эпитопов (epitope bin) для определения уровня положительного сигнала (связывания).

[164] Серии экспериментов выполняли для анализа связывающих свойств 5 очищенных моноклональных анти-IL-21 антител (от гибридомных клонов 362.78.1, 366.75.1.1, 366.328.10, 366.552.11.31 и 366.345.6.11), которые связывают человеческий IL-21. Первое моноклональное анти-IL-21 антитело анализируемой пары ковалентно иммобилизовали с помощью смеси 0,4 М EDC [N-этил-N'-(3-диэтиламинопропил)карбодиимида] и 0,1 М NHS (N-гидроксисукцинимида) до плотности приблизительно 1000 RU. После иммобилизации антитела активные сайты на проточной ячейке блокировали с помощью 1 М этаноламина. IL-21 антиген разбавляли до 100 нМ и позволяли растекаться по поверхности иммобилизованного антитела. Затем растворимый рецептор разбавляли до 10 мкг/мл и позволяли связаться с захваченным IL-21 антигеном. Эксперименты по связыванию выполняли со скоростью потока 30 мкл/мин при 25°С. Буфер для данных исследований состоял из 10 мМ Hepes, 0,3 М NaCl, 0,05% surfactant P20, 5 мМ CaCl2, 1 мг/мл бычьего сывороточного альбумина, рН 8,0. Между циклами проточную ячейку промывали с помощью 20 мМ соляной кислоты для регенерации поверхности. Данная стадия промывки удаляла IL-21 антиген и любой связанный растворимый рецептор из поверхности иммобилизованного антитела и обеспечивала последующее связывание следующей тест-пробы. Данные собирали с помощью программного обеспечения BIACORE Т 100™ Evaluation software (version 1.1.1).

[165] Очищенные моноклональные анти-IL-21 антитела отличались по их способности конкурировать с человеческим растворимым рецептором IL-21 за связывание с IL-21 антигеном. Сигнал (RU, единицы ответа), представленный BIACORE, прямо коррелировал с массой на поверхности сенсорного чипа. После установления уровня фонового сигнала (RU), связанного с отрицательными контролями (то же самое анти-IL-21 моноклональное антитело использовали как в качестве первичного, так и в качестве вторичного антитела), результаты конкуренции представляли как в виде положительного, так и в виде отрицательного связывания. Положительное связывание указывает на то, что анти-IL-21 моноклональное антитело и растворимый рецептор IL-21 способны связывать антиген одновременно. Отрицательное связывание указывает на то, что анти-IL-21 моноклональное антитело и растворимый рецептор IL-21 не способны связывать антиген одновременно. Разница между значениями положительного и отрицательного ответа в данном эксперименте была существенной и обеспечивала однозначное определение конкуренции между анти-IL-21 моноклональными антителами и растворимым рецептором IL-21.

[166] Моноклональные антитела от гибридомных клонов 362.78.1 и 366.552.11.31 конкурировали с обоими вариантами растворимого рецептора IL-21 (гомодимерным IL-21 r-fc и гетеродимерным IL-21 R/γc-Fc) за связывание с человеческим IL-21 антигеном. Моноклональные антитела от гибридомных клонов 366.328.10 и 366.345.6.11 не конкурировали ни с одним из вариантов растворимого рецептора за связывание с антигеном. Моноклональное антитело от гибридомного клона 362.75.1.1 показали частичную конкуренцию за связывание с обеими формами растворимого рецептора. Данные исследования выполняли с IL-21 антигеном, предварительно связанным с моноклональным антителом. Было показано, что три из этих антител (362.78.1, 366.328.10, 366.552.11.31) нейтрализуют человеческий IL-21, тогда как моноклональные антитела от гибридомных клонов 362.75.1.1 и 366.345.6.11 в зависимости от анализа являются очень слабыми или не нейтрализующими биологическую активность человеческого IL-21.

Пример 7. STAT3 анализ биологической активности IL-21 Baf/hulL-21 R

[167] Нижеследующий анализ биологической активности фосфорилированного STAT3 использовали в качестве первичного скрининга для измерения нейтрализующих титров анти-IL-21 в мышиной сыворотке, а также относительных уровней нейтрализации IL-21 гибридомными супернатантами и очищенными анти-IL-21 антителами. Активность IL-21 определяли измерением уровня фосфорилирования STAT3 (белок STAT3 является передатчиком сигнала и активатором транскрипции 3) после лиганд-рецепторного взаимодействия в клетках BaO/KZ134/hulL-21 R (см., Spolski and Leonard, Annu Rev Immunol. Nov 8: 2007). Относительную нейтрализующую активность определяли на основе снижения уровней фосфорилированного STAT3 с использованием ЕС50 концентрации (ЕС50 - концентрация препарата, приводящего к 50% подавлению действия фермента) IL-21 и титрования антагониста.

[168] Клетки BaO/KZ134/hulL-21 R промывали два раза средой для анализа (RPMI 1640 с 5% эмбриональной бычьей сыворотки, 1 х Glutamax, 1% пируватом натрия и 2 мкМ β-меркаптоэтанола; все от Invitrogen, Carlsbad, CA) перед высевом при 40000 клеток/лунку в 96-луночные, круглодонные планшеты для культуры тканей (Becton Dickinson, Franklin Lakes, NJ). Клетки помещали в термостат для культуры тканей при 37°С на время подготовки растворов для анализа. Для определения ЕС50 и ЕС90 концентрация IL-21 в данном анализе готовили серийные разведения рекомбинантного человеческого IL-21 в среде для анализа и высевали в отдельный 96-луночный планшет с U-образным дном. Альтернативно, для анализа нейтрализации IL-21 EC50 концентрацию IL-21 (определенную равной 33 пМ) проинкубировали с серийными разведениями иммунизированной IL-21 мышиной сыворотки, истощенной средой для гибридом, очищенным растворимым человеческим IL-21 R/γc-Fc или очищенными моноклональными анти-IL-21 антителами. Затем как планшеты с клетками, так и планшеты с растворами инкубировали во влажной камере для культуры тканей для уравновешивания в течение 30 минут при 37°С и 5% CO2. Через 30 минут взаимодействие инициировали переносом растворов IL-21 в планшеты для клеток и инкубированием в течение 10 минут при 37°С и 5% CO2.

[169] После 10 минут инкубирования реакции останавливали, помещая планшеты на баню со льдом и добавляя 125 мкл ледяного буфера Cell Wash Buffer (BIO-PLEX Cell Lysis Kit, BIO-RAD Laboratories, Hercules, CA) в каждую лунку. Затем клетки осаждали центрифугированием при 1500 об/мин при 4°С в течение 5 минут и среду отсасывали. Для лизиса клеток в каждую лунку добавляли 50 мкл/лунку лизирующего буфера (приготовленного в соответствии с инструкциями фирмы-производителя, BIO-RAD Labs). Затем клеточные лизаты пипетировали вверх и вниз пять раз, все время на бане со льдом, и перемешивали на качающейся платформе для микропланшет в течение 20 минут при 600 об/мин при 4°С. Затем планшеты центрифугировали при 3000 об/мин при 4°С в течение 20 минут. Супернатанты собирали и переносили в новый планшет для микротитрования и смешивали 1:1 с буфером для анализа Assay Buffer (BIO-RAD) для хранения при -20°С.

[170] Гранулы для захвата Capture beads (BIO-PLEX Phospho-SТАТ3 Assay, BIO-RAD Laboratories) разбавляли и вносили в 96-луночный планшет с фильтрами (Millipore Corporation, Ireland) в соответствии с рекомендациями производителя. Планшеты промывали два раза буфером для отмывки Wash Buffer (BIO-RAD) и 50 мкл смеси клеточного лизата вносили в каждую лунку. Затем каждый планшет заворачивали в алюминиевую фольгу и встряхивали в течение ночи при комнатной температуре при 300 об/мин. На следующий день планшет помещали в вакуумный аппарат для микротитрования и промывали два раза буфером для промывки Wash Buffer. После добавления 25 мкл/лунку детектирующего антитела (BIO-RAD) закрытые фольгой планшеты инкубировали при комнатной температуре в течение 30 минут со встряхиванием при 300 об/мин. Планшет подвергали фильтрации и промывали два раза буфером для промывки. Добавляли стрептавидин-РЕ (BIO-RAD; 50 мкл/лунку) и закрытые фольгой планшеты инкубировали при комнатной температуре в течение 15 минут со встряхиванием при 300 об/мин. Планшет подвергали фильтрации и промывали два раза и ресуспендировали в 125 мкл/лунку буфера для ресуспендирования гранул Bead Resuspension Buffer (BIO-RAD). Затем уровень фосфорилированного STAT3 анализировали с помощью ридера для матриц (BIO-PLEX, BIO-RAD Laboratories) в соответствии с инструкциями производителя. Данные анализировали с помощью аналитического программного обеспечения (BIO-PLEX MANAGER 3.0, BIO-RAD Laboratories). Повышение уровня фосфорилированного фактора транскрипции STAT3, присутствующего в лизатах, свидетельствовало о взаимодействии IL-21 рецептора с лигандом. Для анализа нейтрализации, снижение уровня фосфорилированного фактора транскрипции STAT3, присутствующего в лизатах, свидетельствовало о нейтрализации взаимодействия IL-21 рецептора с лигандом. Значения IC50 (концентрация антагониста, которая дает 50-процентное ингибирование активности лиганда) вычисляли с помощью программного обеспечения GraphPad Prism®4 software (GraphPad Software, Inc., San Diego CA) и выражали в виде молярных концентраций для каждого реагента в анализе нейтрализации.

[171] Человеческий IL-21 индуцировал фосфорилирование STAT3 в зависимости от дозы при установленной ЕС50 концентрации, которая составляет приблизительно 33 пМ. Таблица 7 суммирует значения IC50 для положительного контроля (человеческий растворимый слитый белок IL-21 R/γc-Fc) и для элементов, нейтрализующих IL-21, описанных здесь. Эти данные указывают на то, что IL-21 нейтрализующее антитело было активным и было равным положительному контролю или лучше, чем положительный контроль при снижении фосфорилирования STAT3, индуцированного IL-21.

Таблица 7
Значения IC50 в анализе фосфорилирования STAT3
IC50 (пМ) Эксперимент #1 IC50 (пМ) Эксперимент #2 IC50 (пМ) Эксперимент #3*
растворимый hIL-21 R/γc-Fc 25 102 140,2
Клон#mAbIL-21:
362.75.1 Нет нейтрализации
362.78.1 14 60
362.78.1.44 41 66,7
362.78-CHO (A2162F) 42,0
366.328.10.63 210
366.552.11.31 59
366.617.7 69
366.345.6.11 Низкая

* Эксперимент 3 проводили с использованием 96 пМ IL-21

Пример 8. STAT-люциферазный анализ биологической активности IL-21 Baf3/huIL-21 R

[172] Данный 24-часовой анализ измеряет активность STAT-люциферазы, индуцированной IL-21 в трансфицированных клетках Baf3/KZ134/huIL-21 R. Трансфицированные клетки Baβ/KZ134/huIL-21 R промывали два раза средой для анализа (средой RPMI 1640 без фенола красного с 5% эмбриональной бычьей сывороткой, 1 × Glutamax, 1% пируватом натрия и 2 мкМ β-меркаптоэтанола; все от Invitrogen, Carlsbad, СА) перед высевом при 40000 клеток/лунку в 96-луночный, плоскодонный непрозрачный белый культуральный планшет (Corning/Costar, Lowell, MA). Затем клетки помещали в термостат для культуры тканей на время приготовления растворов для анализа. В отдельном планшете смешивали человеческий IL-21 или со средой, или с рядом антагонистов IL-21 (или моноклональных антител, или растворимого рецептора IL-21 человека/γc-Fc). После смешивания данный планшет также помещали во влажную камеру термостата для культуры тканей при 37°С. Через 30 минут растворы для анализа вносили в планшет для клеток и перемешивали. Затем данный планшет помещали обратно в термостат на 24 часа. Через 24 часа клетки вынимали из термостата и давали охладиться до комнатной температуры. Затем каждую лунку разбавляли 1:1 объемом 100 мкл люциферазного реагента Steady-Glo Luciferase reagent (Promega, Madison, Wl) и тщательно смешивали. Планшеты накрывали и встряхивали при комнатной температуре в течение 10 минут и измеряли относительные люциферазные единицы (RLU) на люминометре.

[173] Для определения ЕС50 и ЕС90 концентраций IL-21 в данном анализе анализировали серийные разведения рекомбинантного человеческого IL-21 в диапазоне от 0 до 100 нг/мл. ЕС90 концентрацию IL-21, ~15 нг/мл (961 пМ), использовали в последующих экспериментах нейтрализации. В данных экспериментах клон 362.78.1 (и его субклон 362.78.1.44 и, экспрессированный в СНО, вариант 362.78-СНО; см. пример 1) и клон 362.328.10.63 показали максимальную анти-IL-21 активность, с IC50 концентрациями в диапазоне 300-850 пМ, тогда как значения IC50 для растворимого контроля рецептора IL-21 человека/γc-Fc находились в диапазоне от 650-1830 пМ. Относительные активности нейтрализующих элементов, описанных здесь, суммируют в таблице 8.

Таблица 8
Значения IC50 в 24-часовом STAT-люциферазном анализе
IC50 (пМ) Эксперимент #1 IC50 (пМ) Эксперимент #2 IC50 (пМ) Эксперимент #3*
Растворимый hIL-21R/γc-Fc 650-850 1830 140,2
Клон#mAbIL-21:
362.75.1 Нет нейтрализации
362.78.1 400 775 760
362.78.1.44 850
362.78-CHO (A2162F) 533
366.328.10.63 300-500
366.552.11.31 2400
366.617.7 6360
366.345.6.11 3184

Пример 9. Перекрестная реакция с IL-21 активностью яванских макак, мышей или крыс

[174] Изучение видовой перекрестной реакции (в особенности перекрестной реакции для "приматов кроме человека") является важным для завершения, до момента доклинических фармакологических/токсикологических исследований при создании терапевтического антагониста. Для определения могут ли формы, нейтрализующие анти-IL-21 человека, описанные здесь, давать перекрестную реакцию и нейтрализовать активность, индуцированную обезьяньим IL-21, мышиным IL-21 или крысиным IL-21 (и, таким образом, признать или яванских макак, мышей и/или крыс в качестве жизнеспособных видов для анализа), сначала необходимо было продемонстрировать биологическую активность рекомбинантного обезьяньего, мышиного или крысиного IL-21. Методы анализов STAT-люциферазной активности в отношении IL-21, описанные в примере 8, применяли для определения значений ЕС50 и ЕС90 для рекомбинантного IL-21 человека, обезьяньего IL-21, мышиного IL-21 и крысиного IL-21 (все произведены в ZymoGenetics). Результаты показывают, что уровни STAT-люциферазной активности, индуцированные человеческим, обезьяньим и мышиным IL-21 в данном анализе значительно различаются. Определяли значения ЕС90, используемые в последующих экспериментах, которые являются следующими: 961 пМ для IL-21 человека; 102 пМ для IL-21 яванских макак; 6,41 нМ для мышиного IL-21 и 1,08 нМ для крысиного IL-21. Растворимый рецептор IL-21 (hIL-21 R/γc-Fc) нейтрализовал эффекты обезьяньего, мышиного и крысиного IL-21.

[175] IL-21. Добавление очищенных моноклональных антител против IL-21 человека, показанное в таблице 9, в различной степени нейтрализовало обезьяний IL-21, но не нейтрализовало мышиный или крысиный IL-21 (примечание, только 362.78-CHO и 366.552.11 анализировали против крысиного IL-21). Значения IC50 для нейтрализации обезьяньего IL-21 нейтрализующими формами, описанными здесь, находилось в диапазоне от ~ 100 пМ до 431 пМ и суммированы в таблице 9. Должно быть отмечено, что лучшие нейтрализующие антитела IL-21 человека - все были способны эффективно нейтрализовать обезьяний IL-21, но не мышиный IL-21, или крысиный IL-21. Кроме того, анализировали продуцируемое СНО-клеткой IL-21 mAb (362.78-CHO) в отдельном эксперименте с использованием 800 пМ концентрации IL-21 яванской макаки.

Пример 10. Оценка потенциальной перекрестной реакции к IL-4 в анализе, основанном на клеточной системе

[176] При разработке терапевтического цитокинового антагониста важно знать, будет ли данный антагонист давать перекрестную реакцию со структурно родственными цитокинами и нейтрализовать структурно родственные цитокины. Анализ пролиферации первичных В-клеток разрабатывали для анализа форм, нейтрализующих IL-21, описанных здесь, в отношении перекрестной реакции и нейтрализации человеческого IL-4.

[177] Выделение первичных В-клеток. Для получения первичных В-клеток 200 мл периферической крови отбирали у здоровых людей- добровольцев (ZymoGenetics). Кровь разбавляли до 400 мл буфером PBS (пер., забуференный фосфатом физиологический раствор) комнатной температуры и делали 35-мл аликвоты в 50-мл конических пробирках. Подслаивали четырнадцать миллилитров фиколл-гипака Ficoll/Hypaque (Pharmacia, Uppsala, Sweden) комнатной температуры и пробирки центрифугировали в течение 20 минут при 2000 об/мин. Слой РВМС (пер., мононуклеарных клеток периферической крови человека) на границе раздела отсасывали и промывали два раза буфером MACS (PBS, HEPES 20 мМ и 1% BSA; Invitrogen, Carlsbad, СА). Клетки подсчитывали и В-клетки выделяли посредством негативного отбора с использованием набора для выделения В-клеток Isolation Kit от Miltenyi Biotec (Auburn, CA), следуя протоколу, представленному производителем. Небольшую пробу очищенных В-клеток анализировали на чистоту FACS-анализом и обнаружили, что во всех экспериментах CD19+В-клетки являются >97% чистоты.

[178] Анализ пролиферации. В-клетки пролиферируют в ответ на совместное культивирование IL-4 с иммобилизованным анти-lgM. Для определения потенциальной перекрестной реакции к IL-4 и нейтрализации IL-4 моноклональными антителами (mAbs) анти-IL-21, предварительно выделенные В-клетки сначала высевали при 40 000-50000 клеток/лунку в 96-луночный планшет для культуры тканей с U-образным дном (Becton Dickinson, Franklin Lakes, NJ), который был предварительно покрыт с использованием 1,0 мкг/мл анти-lgM (Southern Biotech, Birmingham, AL). Затем клетки обрабатывали с помощью 10 нг/мл рекомбинантного IL-4 человека (R&D Systems; Minneapolis, MN) и титрованные серии IL-21 антагониста (анализируемые антитела или контроли). Затем клетки инкубировали в течение 3 дней при 37°С и 5% CO2 во влажной камере термостата для культуры тканей. Через три дня клетки облучали с помощью 1 мкКи/лунку [3Н]-тимидина (Amersham Biosciences, Piscataway, NJ). Через 16 часов клетки собирали на стекло-волокнистых фильтрах и производили количественный анализ [3H]-включения с использованием бета-счетчика (Topcount NXT, Packard). Ни одно из трех проанализированных моноклональных анти-IL-21 антител (362.78.1, 366.328.10.6 и 366.552.11.31) не показало какую бы то ни было нейтрализацию пролиферации, индуцированную IL-4, вплоть до 250-кратного молярного избытка.

Пример 11.

11А. Оценка потенциальной перекрестной реакции к IL-2 и IL-15 в анализе, основанном на клеточной системе

[179] При разработке терапевтического цитокинового антагониста важно знать, будет ли данный антагонист давать перекрестную реакцию со структурно родственными цитокинами и нейтрализовать структурно родственные цитокины. Мышиная Т-клеточная линия, CTLL-2, может быть индуцирована к пролиферации в ответ на IL-2 или IL-15 человека. Таким образом, данный анализ выбран для анализа форм, нейтрализующих IL-21, описанных здесь, в перекрестной реакции к IL-2 и IL-15 человека и нейтрализации IL-2 и IL-15 человека.

[180] Клетки CTLL-2 промывали три раза в среде для биологического анализа пролиферации (RPM1 1640, 2×Glutamax, 10% FBS, 2 x NaPyr (пер., пируват натрия), 1×β-меркаптоэтанол и 20 мМ Hepes; Invitrogen, Carlsbad, CA), и высевали при 50000 клеток на лунку в 96-луночные круглодонные планшеты для культуры тканей (Becton Dickinson, Franklin Falls, NJ). К этим клеткам добавляли предопределенную дозу ЕС90 или IL-2 (3,0 нг/мл) или IL-15 (0,5 нг/мл) в сочетании с серийным разведением форм, нейтрализующих IL-21. Соотношение цитокина к антителу изменялось от 250-кратного молярного избытка до соотношения 1:1. Анти-IL-2 или анти-IL-15 нейтрализующие антитела (оба от R&D Systems, Minneapolis, MN) использовали в виде положительных контролей. Затем клетки инкубировали в течение 24 часов при 37°С и 5% CO2 во влажной камере термостата для культуры тканей. Через 24 часа клетки облучали с помощью 1 мкКи/лунку [3H]-тимидина (Amersham Biosciences, Piscataway, NJ). Через 16 часов клетки собирали на стекло-волокнистых фильтрах и производили количественный анализ количества [3H]-включения с использованием бета-счетчика (Topcount NXT, Packard).

[181] Результаты. Ни одно из трех проанализированных моноклональных анти-IL-21 антител (362.78.1, 366.328.10.6 и 366.552.11.31) не показало какую бы то ни было нейтрализацию пролиферации, индуцированную IL-2 или IL-15.

11В. Подтверждение с помощью поверхностного плазменного резонанса (Biacore) того, что IL-21 mAb 362.78-СНО не связывает цитокины IL-2. IL-4, IL-7, IL-9 или IL-15, родственные IL-21 человека.

[182] анти-IL-21 mAb 362.78-СНО оценивали посредством поверхностного плазмонного резонанса в отношении потенциальной перекрестной реактивности (кросс-реактивности) с человеческим IL-2, человеческим IL-4, человеческим IL-7, человеческим IL-9 и человеческим IL-15.

[183] Материалы и методы. Эксперименты выполняли для анализа перекрестной реактивности анти-IL-21 моноклонального антитела 362.78-СНО с человеческим IL-2, человеческим IL-4, человеческим IL-7, человеческим IL-9 и человеческим IL-15. Изучение связывания выполняли на BIACORE Т100™ (GE Healthcare, Piscataway, NJ). Методы программировали с использованием программного обеспечения BIACORE T100™ Control Software, v 2.0. Fc-гамма специфическое козье антитело против человеческих IgG (Jackson ImmunoResearch, West Grove, PA) ковалентно иммобилизовали на проточных ячейках 1 и 2 сенсорного чипа СМ4 с использованием химии сшивания амином (EDC:NHS). Затем очищенное анти-IL-21 моноклональное антитело 362.78-СНО наносили на проточную ячейку сенсорного чипа 2 при плотности приблизительно 240 RU. Проточную ячейку 1 использовали в качестве ссылочной поверхности.

[184] IL-2, IL-4, IL-7, IL-9 и IL-15 (все куплены у R&D Systems, Minneapolis, MN) вносили инъецированием на поверхность захваченного антитела (проточная ячейка 2) и ссылочной проточной ячейки (проточная ячейка 1) в концентрациях 100, 20 и 4 нМ. В качестве положительного контроля для данной серии экспериментов IL-21 (изготовленный ZymoGenetics) также вносили инъецированием в тех же самых концентрациях. Изучение связывания выполняли со скоростью потока 25 мкл/мин, времени ассоциации 2 минуты и времени диссоциации 3 минуты. Все эксперименты по связыванию выполняли при 25°С в буфере: 10 мМ HEPES, 300 мМ NaCl, 5 мМ CaCl2, 0,05% Surfactant P20 (Biacore), 1 мг/мл бычьего сывороточного альбумина, рН 8,0. Между циклами проточную ячейку промывали с использованием 20 мМ соляной кислоты для регенерации поверхности. Данная стадия промывки удаляла как захваченное антитело 362.78-СНО, так и любой связанный антиген с поверхности чипа. Данные собирали с использованием программного обеспечения BIACORE T100™ Evaluation software (версия 2.0). Данные обрабатывали путем вычитания инъекций ссылочной проточной ячейки и контрольной. Стабильность базовой линии оценивали для уверенности, что стадия регенерации обеспечивала соответствующую поверхность для связывания на протяжении всей последовательности инъекций.

[185] Результаты. Не наблюдали связывание IL-2, IL-4, IL-7, IL-9 или IL-15 с антителом 362.78-СНО. Наоборот, положительный контроль IL-21 демонстрировал зависимое от дозы связывание, которое согласовывалось с предыдущими исследованиями.

[186] Данное отсутствие перекрестной реактивности впоследствии объяснили исследованием картирования эпитопов клона 362.78 (см. пример 17). Аминокислотные остатки, расположенные рядом с D-спиралью IL-21, которые, как показано, связываются клоном 362.78 (EKKPPKEFLERFKSLL; SEQ ID NO: 2 от остатка 129 до 144)), не являются наиболее консервативными среди родственных цитокинов человека, содержащих гамма-цепь, также ни среди IL-21 мыши, как показано в таблице 10.

Таблица 10
IL21_человека - TCPSCDSYEKK-PPKEFLERFKSLLQKMIHQHLSSTHGSEDS
IL21_мыши - KCPSCDSYEKR-TPKEFLERLKWLLQKMIHQHLS
IL15_человека - CKECEELEEK-NIKEFLQSFVHIVQMFINTS
IL2_человека - TTFMCEYADET-ATIVEFLNRWITFCQSIISTLT
IL4_человека - GLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
IL7_человека - SLEENKSLKEQKK-LNDLCFLKRLLQEIKTCWNKILMGTKEH
IL9_человека - CEQPCNQTTAG-NALTFLKSLLEIFQKEKMRGMRGKI

[187] IL-21 человека показан в виде SEQ ID NO: 2; IL-21 мыши показан в виде SEQ ID NO: 11; IL-15 человека показан в виде SEQ ID NO: 92; IL-2 человека показан в виде SEQ ID NO: 93; IL-4 человека показан в виде SEQ ID NO: 94; IL-7 человека показан в виде SEQ ID NO: 95; IL-9 человека показан в виде SEQ ID NO: 96.

Пример 12. Анализы В-клеточной пролиферации

Анализы первичных В-клеток

[188] Для дальнейшего анализа активности форм, нейтрализующих IL-21, разрабатывали два анализа первичных В-клеток. Анализ В-клеточной пролиферации использовали для демонстрации нейтрализации пролиферации, индуцированной IL-21, в течение 4 дней, и анализ дифференцировки В-клеток в течение 8 дней показал нейтрализацию дифференцировки в плазматические клетки, индуцированную IL-21. Данные эксперименты показали нейтрализацию IL-21 в длительных биологически значимых анализах.

[189] Выделение первичных В-клеток человека. Для получения первичных В-клеток 200 мл периферической крови отбирали у здоровых людей-добровольцев (ZymoGenetics). Кровь разбавляли с помощью 200 мл буфера PBS комнатной температуры и делали 35-мл аликвоты в 50-мл конических пробирках. Подслаивали четырнадцать миллилитров фиколл-гипака Ficoll/Hypaque (Pharmacia, Uppsala, Sweden) комнатной температуры и пробирки центрифугировали в течение 20 минут при 2000 об/мин. Слой РВМС (мононуклеарных клеток периферической крови человека) на границе раздела отсасывали и промывали два раза буфером MACS (PBS, HEPES 20 мМ и 1% BSA; Invitrogen, Carlsbad, CA). Клетки подсчитывали и В-клетки выделяли посредством негативного отбора с использованием набора для выделения В-клеток Isolation Kit от Miltenyi Biotec (Auburn, CA), следуя протоколу, представленному производителем. Небольшую пробу очищенных В-клеток анализировали на чистоту FACS-анализом и обнаружили, что во всех экспериментах В-клетки являются >97% чистоты.

[190] Анализ пролиферации. В-клетки пролиферируют в ответ на совместное культивирование с анти-CD40 и IL-21. Для определения нейтрализующей активности моноклональных антител анти-IL-21, В-клетки высевали при 40000-50000 клеток/лунку в обработанный 96-луночный планшет для культуры тканей с U-образным дном (Becton Dickinson, Franklin Lakes, NJ). Затем клетки обрабатывали с помощью 0,1 мкг/мл анти-CD40 (козье поликлональное антитело против человеческого CD40; R&D Systems, Minneapolis, MN), 50 нг/мл (3,21 нМ) рекомбинантного IL-21 (ZymoGenetics, A 1207F) и титрования антагонистом IL-21 (анализируемые mAbs или контроли). Затем планшеты с клетками инкубировали в течение 3 дней при 37°С и 5% СО2 во влажной камере термостата для культуры тканей. Через три дня клетки облучали с помощью 1 мкКи/лунку [3H]-тимидина (Amersham Biosciences, Piscataway, NJ). Затем через 16 часов клетки собирали на стекло-волокнистых фильтрах и производили количественный анализ [3Н]-включения с использованием бета-счетчика (Topcount NXT, Packard). Кривые IC50, измеряющие эффективную нейтрализацию пролиферации, индуцированную IL-21 просчитывали и выражали в виде молярной концентрации. Значения IC50 для лучше всего нейтрализующих mAbs, описанных здесь, находились в диапазоне от 0,71 нМ до 6,55 нМ и суммированы в таблице 11.

Таблица 11
Нейтрализация IL-21 в анализе В-клеточной пролиферации
Антагонист IL-21 IC50 (нМ)
Растворимый hIL-21R/γc-Fc 3,5
362.75.1 Отсутствие нейтрализации
362.78.1 1.17
366.328.10 0,71
366.552.11 4,75
366.617.7 6,55

[191] Анализ В-клеточной дифференцировки. Дифференцировка наивных В-клеток в антителопродуцирующие плазматические клетки в значительной степени облегчается in vitro при сочетании IL-21 с анти-CD40 и IL-4 (Ettinger et al., J Immunol. 175:7867-79, 2005; Ettinger et al, J Immunol. 178:2872-82, 2007; Kuchen et al. J Immunol. 179:5886-96. 2007). Для демонстрации активности в анализе, более длительном, чем данные два анализа скрининга на основе Baf3, описанные в примерах 7 и 8, использовали нейтрализующие формы, описанные здесь, для нейтрализации IL-21 и ингибирования дифференциации плазматических клеток человека. Для выполнения этого первичные В-клетки человека высевали при 150000 клеток/лунку в обработанный 96-луночный плоскодонный планшет для культуры тканей (Becton Dickinson, Franklin Lakes, NJ). Затем клетки обрабатывали с помощью 0,1 мкг/мл анти-CD40 (козье поликлональное антитело против человеческого CD40; R&D Systems, Minneapolis, MN), 10 нг/мл рекомбинантного человеческого IL-4 (R&D Systems) и 25 нг/мл (1,6 нМ) рекомбинантного человеческого IL-21 (ZymoGenetics). Затем добавляли антагонисты IL-21 (анализируемые mAbs или контроли) и клетки инкубировали при 37°С и 5% CO2 в течение восьми дней во влажной камере термостата. В конце восьми дней кондиционированные среды собирали (для титров антител), и клетки осаждали для последующих проточных цитометрических анализов.

[192] Анализ В-клеток с помощью проточной цитометрии: Клетки ресуспендировали в буфере для FACS человека (HBSS, 20 мМ HEPES, 1% BSA (все из Invitrogen) и 2% человеческие сывороточные антитела Human Ab Serum (Gemini Bio-Products, Woodland, CA)) в течение пяти минут для блокирования Fc-рецепторов. Затем клетки центрифугировали (5 минут при 1200 об/мин) и отсасывали. Красители готовили разведением антител 1:100 в буфере для FACS человека и дозировали по 100 мкл на пробу. Смесь с одним красителем (для настройки компенсационных настроек цитометра) и несколькими красителями готовили с использованием нижеследующих антител: анти-CD 138-FITC, анти-lgD-PE, анти-CD38-РЕ-Су5.5 и анти-CD 19-АРС. Плазматические клетки определяли как крупные (оцененные прямым светорассеянием) клетки CD19+, IgD10, CD38+ и CD138+. Процентное содержание плазматических клеток относительно общего содержания В-клеток использовали для определения эффективности нейтрализующих форм, описанных здесь.

[193] Результаты: При комбинировании IL-21 с IL-4 и анти-CD40, приблизительно 50% живых, крупных В-клеток на 8 день представляли собой CD138+ плазматические клетки IgDlow. В отсутствие IL-21 пропорция плазматических клеток составляла ~ 8% крупных клеток В-клеток. Добавление различных антагонистов IL-21 к культурам, содержащим IL-21, снижало пропорцию плазматических клеток в зависимости от дозы. Клон 362.78.1 представлял собой наиболее эффективный нейтрализатор и почти полностью нейтрализовал активность IL-21 при соотношениях антагонист:лиганд 10:1 и 2,5:1. Другие проанализированные антитела, клоны 366.328.10.63 и 366.552.11.31 были почти такими же эффективными при нейтрализации дифференциации, стимулированной IL-21. Эти данные суммированы в таблице 12.

Таблица 12
Ингибирование дифференциации плазматических клеток человека путем нейтрализации моноклональными анти-hlL-21 антителами
Соотношение антагонист:лиганд
10:1 2,5:1 0,6:1 0,16:1
Антагонист IL-21 % плазматических клеток CD138+IgDlow
362.78.1 13,7 15,5 34,1 42,8
366.328.10.63 15,4 20,2 41,4 52,1
366.552.11.31* 15,4 26,4 44,8 50,3
Рецептор IL-21 23,4 41,7 54,.2 66,7
* Примечание, что фактические соотношения антагонист:лиганд для клона 366.552.11.31 составляли 14.4, 3.6, 0,9 и 0,22:1

Пример 13. Мышиная модель РТН (пер., гиперчувствительности замедленного типа)

[194] DTH ответы являются классическими иммунными ответами, которые инициируются CD4+Т-клетками и опосредуются Т-клетками, нейтрофилами и макрофагами. DTH ответ является хорошим индикатором CD4+Т-клеточно-опосредованного ответа. Мышей иммунизируют подкожно с помощью яичного белка овальбумина (OVA) в одном из двух адъювантов, полном адъюванте Фрейнда (CFA; Sigma) или Ribi (Sigma; известным также под названием адъювант MPL+TDM+CWS) (пер., состоящий из монофосфориллипида А (MPL), димиколята трегалозы (TDM) и скелета клеточной стенки (CWS)). Данная фаза называется фаза сенсибилизации (дни 0-6). Измерения уха производят через семь дней. Затем мышей инъецировали в ухо контрольным PBS (левое ухо) или OVA (правое ухо). Эта фаза называется фазой провокации (дни 7-8). Иммунные ответы, генерированные на OVA, индуцируют воспаление уха, что приводит к увеличению толщины уха в течение 24 часов, уха, обработанного OVA, но не уха, обработанного PBS. Толщину измеряют с помощью калиперов.

[195] Мышей C57BL/6 (n=8/группу) иммунизируют в спину с помощью 100 мкг яичного овальбумина (OVA), эмульгированного в CFA в общем объеме 200 мкл. При использовании Ribi вместо CFA, добавляют 0,5 мг/мл овальбумина в один флакон RIBI и сильно перемешивают в течение 2 минут для образования эмульсии, которую используют для инъецирования мышей. Через семь дней после иммунизации мышей инъецируют с помощью 10 мкл PBS в левое ухо (контроль) с помощью 10 мкл OVA в PBS в левое ухо в объеме 10 мкл. Толщину уха всех мышей измеряют до инъецирования мыши в ухо (0 измерение). Толщину уха измеряют через 24 часа после провокации. Вычисляют разницу толщины уха между 0 измерением и 24-часовым измерением она отражает воспаление уха. Группы мышей инъецируют с помощью PBS или анти-IL-21 антитела различной концентрации внутрибрюшинно или с дней 0-6 (фаза сенсибилизации), или с дней 7-8 (фаза провокации). Инъецирование на 7 и 8 день предоставляют за 2 часа до измерения толщины уха в 0 и 24 часовые моменты времени. В конце 24-часового периода, после измерения толщины уха, уши отрезали и помещали в формалин для гистологических анализов.

Пример 14. Мышиная модель рассеянного склероза

[196] Для анализа оказывает ли анти-IL-21 какие бы то ни было эффекты на рассеянный склероз, анализировали способность анти-IL-21 антител ингибировать экспериментальный аутоиммунный энцефаломиелит (EAE-MS), мышиная модель MS. Использовали хорошо изученную Т-клеточно-зависимую иммунизацию пептидом миелинового олигодендроцитарного гликопротеина (MOG) (35-55) использовали в мышиной модели C57BL/6. Эксперимент проводят для определения того, что анти-IL-21 антитело могло бы задерживать и/или ингибировать шкалу заболевания ЕАЕ или путем ингибирования опосредованной DC (пер., дендритной клеткой) презентации антиген, или путем усиления CD8 Т-клеточных ответов. Отсутствие эффективных CD8 Т-клеточных ответов в данной модели обостряет ЕАЕ (Malipiero et. al., Eur. J. Immunol. 27:3151-3160, 1997). Позднее проявление заболевания в модели ЕАЕ в зависимости от дозы позволяет предположить, что применение анти-IL-21 антитела может быть полезным при MS.

[197] ЕАЕ представляет собой мышиную модель MS. В одной такой модели мышей C57BL/6 иммунизируют с помощью 100 мкг пептида MOG (MOG 35-55) или 100 мкг рекомбинантного белка MOG, эмульгированного в адъюванте CFA. Два миллилитра 0,5 мг/мл препарата MOG 35-55 в PBS добавляли во флакон с CFA и энергично встряхивали на вортексе для превращения в эмульсию раствора или получения в соотношении 1:1 рекомбинантного MOG в CFA. Спины мышей сбривают и инъецируют подкожно 100 мкг MOG/CFA в спины мышей. Показания массы мышей берут за два дня до и каждый день после иммунизации. Затем мышей на 2 день инъецируют внутривенно (i.v.) с помощью 200 мкл коклюшного токсина (РТ), конечная концентрация 200 нг/мышь. Мышей ежедневно подвергают мониторированию на клинические показатели. Группы мышей инъецируют внутрибрюшинно (i.p.) с помощью 200 мкл PBS, 100 мкг BSA, 10 мкг - 200 мкг анти-IL-21 антитела в объеме 200 мкл с дней 0-20, или 3 х в неделю в течение 3 недель. Массы мышей, клинические показатели и частоту возникновения заболевания оценивают и изображают графически.

Пример 15. Анти-mIL-21 антитело снижает заболеваемость и прогрессирование в мышиной модели адаптивного Т-клеточного переноса колита и псориаза

[198] Адаптивный перенос наивных Т-клеток мышам с несовпадением по минорным локусам гистосовместимости или сингенным мышам с ослабленным иммунитетом приводит к развитию колита (Leach MW et al., 1996, Powrie F. et al., 1997), a также поражениям кожи, похожим на псориаз (Schon MP et al., Nat Med. 2: 183-8, 1997; Davenport CM et al., Int. Immunopharmacol. 5:653-72, 2002). Трансплантация только лишь 0,2 миллиона CD4+CD25-Т-клеток от мышей BALB/C или B10.D2 мышам с ослабленным иммунитетом С. В-17 SCID приводит к потере веса, положительному гемокульт-тесту и развитию поражений кожи. Симптомы у данных мышей отличаются от колонии к колонии.

[199] Данная модель колита/псориаза, которая имеет некоторые сходства с болезнью Крона и псориазом человека, была активно использована для анализа эффективности терапии для данных заболеваний у людей. Для данного эксперимента мышей (8 самок мышей доноров B10.D2; 50 самок реципиентов С. В-17 SCID) получали от Jackson Laboratories или Charles River Laboratories соответственно. Собирали селезенки 8 мышей В10. D2. CD4+CD25- Т-клетки выделяли из объединенных селезенок с использованием общепринятой методологии, известной в данной области. Чистоту Т-клеточной популяции оценивали проточной цитометрией.

[200] Наивные мыши С. В-17 SCID получали 5×105 CD4+CD25-T-клеток (выделенных из селезенок мышей B10.D2) путем внутривенной инъекции на день 0. Всех мышей взвешивали, по меньшей мере, пять раз в неделю и внимательно наблюдали за потерей веса, которая может быть связана с колитом. Кроме того, клинический показатель колита [консистенция кала и кровь в кале] оценивали, по меньшей мере, один день в неделю. Мышей также подвергали тщательному мониторированию, по меньшей мере, пять дней в неделю и определяли показатели симптомов псориаза (выпадение волос, почесывание, алопеция и т.д.).

[201] Крысиное антитело против мышиного IL-21 (mIL-21), контрольное антитело, крысиный изотип, или наполнитель (PBS) вводили группам мышей, начиная в день 0. Способы лечения производили в виде внутрибрюшинных инъекций, два раза в неделю, с помощью антитела, вводимого при 0,2 или 0,8 мг на мышь на дозу. Способы лечения также могли быть произведены с помощью аналогичного режима дозирования или другого способа введения. В группах анти-IL-21 антитела находилось 9-10 мышей на группу, 6-7 мышей на группу в группах изотипического контрольного антитела и 10 мышей на группу в группе PBS. Данный режим дозирования называют "профилактической дозировкой".

[202] В отдельном эксперименте группы мышей, получившие дозы тех же самых антител, и дозы, описанные выше (10 мышей на группу), начинали свои способы лечения на 12 день после переноса клеток, который является приблизительно днем, на который у мышей начиналось появление признаков псориаза и/или колита. Данные режимы дозирования называют "терапевтической дозировкой".

[203] В конце исследования (45 день) ткани ободочной кишки представляли на гистологическое подтверждение колита и сыворотку на анализ уровней цитокинов и хемокинов.

[204] Результаты профилактической дозировки. Мыши, получающие анти-IL-21 антитело как в дозах 0,2 мг, так и 0,8 мг, отличались существенным (по меньшей мере р<0,05 или ниже) сокращением снижения массы тела и существенным сокращением псориатической кожи и симптома колита на протяжении всего периода эксперимента по сравнению с мышами, которым вводили PBS или 0,2 мг изотипное контрольное моноклональное антитело. В конце исследования (45 день) мыши, леченные с помощью любой дозы антитела mIL-21, имели приблизительно 100% их начальной массы тела, тогда как мыши, леченные PBS, обнаруживали потерю в среднем 16% их начальной массы тела, и мыши, леченные с помощью изотипичнеского контрольного антитела, имели 10-15% потерю их начальной массы тела. На 45 день мыши, леченные с помощью любой дозы антитела mIL-21, имели приблизительно в 6,5-7 раз более низкие средние клинические показатели колита и приблизительно в 5-7 раз более низкие средние показатели псориатической кожи. Только у 20% мышей, леченных с помощью 0,2 мг анти-IL-21 антитела, развивался псориаз, который был слабым, тогда как ни у одной из мышей, леченных с помощью дозы 0,8 мг, не развивались никакие симптомы псориатической кожи. С другой стороны, у 100% мышей, леченных PBS, развивался псориаз, вместе с приблизительно 50% данных мышей, развивающих тяжелые симптомы. В конце исследования было также существенное сокращение гистологических индексов колита (оцененных по шкале для флегмоны кишечника, очагов и структуры) у мышей, леченных анти-IL-21 антителом, по сравнению с мышами, леченными с помощью PBS и 0,2 мг изотипичного контрольного антитела.

[205] Мыши, леченные с помощью анти-IL-21 антитела, имели значительно более низкие уровни сывороточных IL-6, RANTES (пер. RANTES - хемокин, экспрессируемый и секретируемый Т-клетками при активации), TNF-α, - MIP-I β по сравнению с леченными PBS, дополнительно обеспечивающих противовоспалительную роль анти-IL-21 антитела.

[206] Результаты терапевтической дозировки. Мыши, получающие анти-IL-21 антитело как в дозах 0,2 мг, так и 0,8 мг, начиная с 12 дня после переносов Т-клеток, отличались сокращениями потери массы тела и существенными сокращениями симптомов колита на протяжении периода эксперимента по сравнению с мышами, которым вводили изотипичное контрольное моноклональное антитело. На 45 день мыши, леченные с помощью любой дозы антитела mIL-21, имели приблизительно в 3,5-4 раза более низкие средние клинические показатели колита по сравнению с мышами, леченными с помощью изотипичного контрольного моноклонального антитела. Мыши, леченные дозой 0,8 мг анти-IL-21 антитела, имели более низкие клинические показатели псориаза, чем мыши, леченные с помощью изотипичного контрольного антитела или PBS.

[207] Вывод. Взятые вместе данные результаты указывают на то, что введение in vivo анти-IL-21 антитела было эффективным в сокращении появления и тяжести колита и псориаза в мышиной модели Т-клеточного переноса, и позволяют предположить, что анти-IL-21 антитела могут быть эффективны при лечении воспалительного заболевания кишечника и/или псориаза у людей.

Пример 16. Мышиная модель контактной гиперчувствительности

[208] Контактная гиперчувствительность может быть индуцирована у мышей с помощью различных контактных аллергенов, в том числе динитрофторбензола (DNFB) и оксазолона. Мышей сенсибилизируют местно с помощью аллергена в переносчике из ацетона и оливкового масла и затем иммунизируют аллергеном в ухо в оливковом масле в чистом виде. Изменение толщины уха является мерой иммунного ответа на антиген. анти-IL-21 антитела вводят или в фазу сенсибилизации (дни 0-5), или во время фазы провокации (дни 5-6). Ингибирование толщины уха антагонистами IL-21 указывает на роль IL-21 в индуцировании контактной гиперчувствительности.

[209] Мышам С57 В1/6 окрашивают спину с помощью 0,5% DNFB в смеси ацетон: оливковое масло (4:1) или смесью ацетон-оливковое масло в чистом виде в 0 день. На 5 день толщину уха мышей измеряют с помощью калиперов и мышей заражают в уши оливковым маслом в чистом виде (контроль) или 0,25% DNFB в оливковом масле нанесением капель раствора 25 µI на ухо. Изменение толщины уха измеряют на 6 день и воспаление вычисляют в виде разности толщин уха между 5 днем и 6 днем. Группам мышей инъецировали внутрибрюшинно (i.p.) PBS или 10-100 мкг анти-IL-21 антител или в дни 0-5, или в дни 5-6.

[210] Ингибирование толщины уха анти-1b21 антителами показывает, что анти-IL-21 антитела могут быть применимы для ингибирования контактной гиперчувствительности.

Пример 17. Картирование эпитопов А. Эксперимент водородно-дейтериевого обмена (НРх)

[211] С целью идентификации эпитопных областей IL-21, которые распознаются нейтрализующими анти-IL-21 mAbs 362.78.1.44, 362.597.3, 366.328.10, 366.552.11 и растворимым hIL-21 R/γc-Fc, использовали метод водородно-дейтериевого обмена (HDx) на основе иммуноаффинности с последующим масс-спектрометрическим анализом. В частности, очищенные mAbs иммобилизовали на гранулах CNBr-активированной сефарозы и переводили в дейтериевый буфер. Денатурированный IL-21 связывался с иммуноаффинными гранулами при инкубации и гранулы промывали дейтерированным буфером для удаления несвязанных белков. Затем комплекс антиген-антитело подвергали воздействию раствора PBS для инициации обратного взаимодействия с водородом амида на несвязанных в областях IL-21. Затем водородно-дейтериевый обмен гасили и IL-21 элюировали в буфере с низким рН, IL-21 затем подвергали протеолитическому разрушению иммобилизованным пепсином. Затем создавали масс-спектрометрические пептидные карты масс-спектрометрией на MALDI-TOF и сравнивали с пептидными масс-спектрометрическими картами контрольной пробы, произведенными при свободном состоянии IL-21, который обменивали обратно к водороду амида из дейтерированного IL-21 путем разбавления раствором PBS. Фиг.3 показывает расширенные масс-спектры продуктов протеолитического разрушения пепсином пептидов IL-21 как в свободном состоянии (фиг.3А и 3С), так и связанного с антителом IL-21 (фиг.3В и 3D). Как указано на фиг.3А, перекрывающийся пептидный изотоп относили к соответствующим пептидам EKKPPKEF (SEQ ID NO: 2 от остатка 129 до 136) (масса/заряд, m/z, 1002.5619 Да) и LERFKSLL (SEQ ID NO: 2 от остатка 137 до 144) (m/z, 1005.6091 Да) IL-21 в свободном состоянии с теоретическими пептидными массами с точностью определения массы 10 ppm (частей на миллион, ч./млн). Наблюдали небольшое количество остаточного дейтерированного пептида в районе m/z, 1002.5619 Да, обусловленное неполным обменом на водород амида.

[212] Фиг.3В представляет собой спектр того же диапазона масс фиг.3А, показывающая две перекрывающиеся зоны пептидных изотопов, имеющих моноизотопные ионы при 1014.49 m/z и 1015.00 m/z. Так как два пептидных иона были сгруппированы в кластеры вокруг того же самого диапазона масс, то было трудно установить идентичность каждого пептида между двумя ионами. Однако данные тандемной масс-спектрометрии пептидных ионов фиг.3А и В показали, что они имели идентичные картины фрагментации пептида (данные не показаны). Хотя существовал незначительный процент недейтерированного пептида, обнаруженного в пробе, полученной из комплекса антиген-антитело, большинство пептидных ионов удерживало дейтерий и смещалось в область более высоких масс в силу ограниченной доступности растворителя к областям связывания антитело/антиген, указывая на то, что сайт связывания mAb, вероятно, содержит область EKKPPKEFLERFKSLL (SEQ ID NO: 2 от остатка 129 до 144).

[213] Другой пептид, продукт протеолитического разрушения пепсином как IL-21 в свободном состоянии, так и в комплексе антиген-антитело наблюдали как показано на фиг.3С и D и его идентифицировали в виде KSLLQKMIHQHLSSRTHGSEDS (SEQ ID NO: 2 от остатка 141 до 162) (m/z, 2519.2451) на основе теоретической массы продукта протеолитического разрушения пепсином пептидного фрагмента IL-21. Как показано на фиг.3D, сравнение сдвига массы данного пептида из 22-х аминокислотных остатков (Δмасс=9,0 Да) со сдвигом массы двух данных upstream-остатков (фиг.2 В, EKKPPKEF (SEQ ID NO: 2 от остатка 129 до 136) и LERFKSLL (SEQ ID NO: 2 от остатка 137-144), данная область только незначительно защищалась после связывания mAb, указывая на то, что только часть данного пептида может быть вовлечена в связывание с mAb. В действительности данная пептидная последовательность представляет собой С-концевой хвост, и он содержит четыре аминокислотных остатка, перекрывающихся с пептидом (LERFKSLL (SEQ ID NO: 2 от остатка 137 до 144), которые, по-видимому, являются существенно защищенными mAb. На основе данных масс-спектрометрических измерений удерживания дейтерированного производного авторы изобретения установили этот эпитоп IL-21 для связывания mAb EKKPPKEFLERFKSLL (SEQ ID NO: 2 от остатка 129 до 144) и upstream-последовательность KSLLQKMIHQHLSSRTHGSEDS (SEQ ID NO: 2 от остатка 141 до 162).

В. Эксперимент защиты лизина от мечения

[214] С помощью HDx анализа определяли эпитопную область IL-21, связывающую mAb, и заметили, что пять лизиновых остатков (из суммарных 12 лизиновых остатков в IL-21) находятся в установленной области связывающего эпитопа. Поскольку наиболее вероятно, что лизиновые остатки присутствуют в областях белка, доступных для растворителя, обусловленных их свойством заряда, лизин, по-видимому, является идеальным вариантом для избирательной химической модификации для параллельного определения области эпитопа антигена. Идея после стратегии химической модификации состоит в том, что защита лизина в антигене от модификации в присутствии антитела или в отсутствие антитела находится в связи с его связывающим эпитопом (Scholten et al., J. Amer. Soc. Mass Spectr. 17: 983-994, 2006). Таким образом, для дальнейшего получения характеристик эпитопной области и для определения лизиновых остатков, вовлеченных в связывание mAb, выполняли избирательное ацетилирование лизиновых остатков как в аффинно-связанных, так и в свободных состояниях IL-21. Сайт модификации/защиты от модификации лизина определяли анализами картирования полной массы и пептида с помощью MALDI-TOF и масс-спектрометрии с ионизацией распылением в электрическом поле (ESI).

[215] Scholten et al. (Scholten et al., J. Amer. Soc. Mass Spectr. 17: 983-994, 2006) исследовали молярное соотношение между реагентом для ацетилирования (NHS-ацетатом) и антигеном для полного ацетилирования лизиновых остатков, доступных для растворителя, и обнаружили, что мечение было эффективным при 250-кратном молярном избытке реагента при 3-минутной реакции. Для определения связывающего эпитопа те же самые условия реакции применяли как для свободного состояния IL-21, так и для аффинно-связанного IL-21 с несколькими нейтрализующими IL-21 mAbs, а также гетеродимерного рецепторного белка IL-21 (IL-21 R/γc-Fc). При данном условии реакции мечения различная доступность для растворителя лизиновых остатков IL-21 в чистом виде и аффинно-связанного IL-21 вызвала распределение ацетилирования лизина (степень заполнения ацетилом) на молекуле IL-21. Число защищенных лизиновых остатков на аффинно-связанном IL-21 было сравнимо с IL-21 в чистом виде на основе наиболее интенсивного иона. Спектральное выравнивание на основе наиболее интенсивных ионов отчетливо показало, что число лизиновых ацетилирований на антигенах, выделенных из различных иммунных комплексов, является различным. Было очевидным, что реагент для мечения лизина был менее доступен в аффинно-связанном IL-21. Следовательно, ацетилирование снижалось путем связывания антигена с антителом.

[216] Лизины, защищенные ацетилированием, которые могут быть вовлечены в связывание mAb, были дополнительно зондированы расщеплением протеазами и с последующим анализом картирования пептидных масс с помощью жидкостного хромато-масс-спектрометра. Поскольку ковалентно модифицированные лизиновые остатки являются устойчивыми к расщеплению трипсином, то использовали протеолитический фермент пепсин для создания пептидов, в большей степени обнаруживаемых масс-спектрометрией, для более детального изучения модификации лизинов. Модификацию индивидуальных пептидов исследовали с помощью ионообменной хроматографии одного пептида. Как показано на фиг.4, выбранные ионообменные хроматограммы получали как из контрольных (IL-21 в чистом виде), так и тест-проб (аффинно-связанных молекул IL-21) для определения ацетилированных и неацетилированных остатков лизина. Фиг.4А представляет собой выбранную ионообменную хроматограмму полученного в результате протеолиза пептида, элюированного на 56,22 мин при данных хроматографических условиях, и моноизотопная масса пептида составляла около 662,9 Да, который, по-видимому, находится в трехзарядном состоянии (Δm=0,3 Да), как указано во вставленном масс-спектре. Производили идентификацию данного пептида в трехзарядном состоянии в виде содержащего ацетилированный лизин пептидного фрагмента, образованного в результате расщепления пепсином, TCPSCDSYEKK.PPKEF (SEQ ID NO: 2 от остатка 119 до 136) (m/z, 1986 Да), принимая во внимание, что масса неацетилированного пептида составляет 1860 Да (m/z). Разница масс (ацетилированный пептид / неацетилированный пептид) составляла 126 Да, указывая на то, что все три остатка лизина в данном пептиде были ацетилированы в свободном состоянии IL-21. Однако выбранная ионообменная хроматограмма аффинно-связанного IL-21 не показала следов пептида (фиг.4В), указывая на то, что три остатка лизина были полностью защищены путем связывания IL-21 с антителом.

[217] Было обнаружено, что дополнительный пептид после разрушения пепсином (KSLLQKMI (SEQ ID NO: 2 от остатка 141 до 148) является защищенным после связывания IL-21 mAb (фигура 4С и 4D). Моноизотопный ион пептида был около 509 Да (m/z) в виде двухзарядного иона (Δm=0,5 Da) и разница масс (ацетилированный пептид / неацетилированный пептид) составляла 42 Да, указывая на то, что только один из двух остатков лизина в данном пептиде был защищен. Более ранние эксперименты H/D обмена указывали на то, что находящийся слева лизин (upstream) С-концевого хвоста пептидной последовательности, KSLLQKMIHQHLSSRTHGSEDS (SEQ ID NO: 2 от остатка 141 до 162), был, вероятнее всего, защищен связыванием антитела. Таким образом, наиболее вероятным является то, что К113, а не К119 вовлечен в связывание антитела.

[218] Четыре лизиновых остатка (К102, К103, К106 и КПЗ) были защищены от ацетилирования связыванием с клонами 362.78.1.44 и 362.597.3, и лизиновые остатки были расположены в предполагаемой эпитопной области, связывающей mAb IL-21, как показано в анализе HDx. В совокупности, анализ защиты от ацетилирования обеспечивал вовлечение специфических лизиновых остатков во взаимодействие антиген-антитело и дополнительно подтверждал эпитопную последовательность, предполагаемую из анализа HDx.

17С. Сравнение аминокислотных последовательностей IL-21 различных видов

[219] Для лучшего понимания перекрестной реактивности между видами, результаты в примерах 3 и 9, в свете установленных эпитопов на IL-21, связанном mAbs IL-21 (пример 17А и В), получали аминокислотные последовательности и сравнивали IL-21 со многими видами крест-накрест (таблица 13). Полная человеческая последовательность была более чем на 96% идентичной последовательностям яванских макак и макак-резус, тогда как только на 61-65% идентичной последовательностям IL-21 грызунов. А именно, прерывистый эпитоп, связанный клонами 362.78.1.44 и 362.597.3, как описано в примере 17 (показанный в таблице 13), является идентичным IL-21 человека, яванских макак и макак-резус, тогда как крысиная IL-21 последовательность отличается от человеческого IL-21 в пределах 6 остатков в данных областях, и мышиная IL-21 последовательность отличается 7 остатками.

[220] Таблица 13
Выравнивание аминокислотной последовательности IL-21 для IL-21 человека, яванских макак, макак-резус, крысы и мыши.
Ни IL-21 MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLV
CynolL-21 MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLD
RhesuslL-21 MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLD
RatIL-21 MERTLVCLILIFLGTVAHKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLD
MulL-21 MERTLVCLWIFLGTVAHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLD
Hu PEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPP
Cyno PEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSP
Rh PEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSP
Rat PELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLP
Mu PELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLP
Hu STNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Cyno STGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Rh STGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Rat AKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
Mu ARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

[221] IL-21 человека показан в виде SEQ ID NO:2; IL-21; мышиный показан в виде SEQ ID NO: 11; IL-21 яванских макак показан в виде SEQ ID NO:9; IL-21 макак-резус показан в виде SEQ ID NO:9; IL-21 крысы показан в виде SEQ ID NO: 97.

[222] Прерывистый эпитоп, установленный для двух высоко родственных анти-hIL-21 mAbs 362.78.1 и 362.597.3 подчеркнут выше.

Пример 18. Антиидиотипические моноклональные антитела к 362.78-СНО для применения в доклинических и клинических иммунологических анализах.

[223] Антиидиотипические mAbs производили специфическими к 362.78-СНО для применения в доклинических и клинических иммуноанализах, так что потенциальные ответы на анти-36278-СНО антитело у индивидуумов, леченных с помощью данного терапевтического анти-IL-21 mAb, могут быть конкретно измерены.

[224] Для установления различий между иммуногеном (362.78-СНО), который сам по себе является антителом, и антиидиотипическими антителами в данном примере, иммуноген будут обозначать в виде Ab1, и антиидиотипическое антитело будут обозначать в виде Ab2. Антиидиотипическое антитело должно ингибировать (нейтрализовать) связывание Ab1 со своим антигеном (IL-21). Однако, это должно быть отмечено, что в данном способе будут произведены анти-Abl антитела, которые не являются антиидиотипическими. По определению, данные антитела будут связывающими анти-362.78-СНО, не нейтрализующими антителами и также могут быть применимы в доклинических и клинических иммуноанализах.

[225] Способ. Для иммунизации мышей с помощью 362.78-СНО, пять мышей BALB/c от 6 до 8 недельного возраста (Charles River Laboratories, Wilmington, MA) иммунизировали с помощью 362.78-СНО. Исходно мышей иммунизировали подкожной инъекцией с помощью ~50 мкг очищенного 362.78-СНО (Lot# A2125F) в сочетании с адъювантом Emulsigen® - Р (MVP Laboratories INC, Omaha, NE) согласно инструкциям производителя. После исходной иммунизации каждая из мышей получала дополнительные 50 мкг 362.78-СНО в адъюванте Emulsigen® - Р с использованием подкожного способа введения каждые две недели в течение шестинедельного периода. Через семь дней у мышей третьей и четвертой иммунизации забирали кровь через ретроорбитальное сплетение и сыворотку отделяли от крови для анализа способности сыворотки связываться с 362.78-СНО.

[226] Отбор животных со слиянием с помощью как ловушечного варианта анализа, так анализа нейтрализации.

[227] Ловушечный вариант анализа. Способность мышиных анти-362.78-СНО (Ab2, антиидиотипических) антител в антисыворотке связываться с 362.78-СНО (Ab1, продуцированному в клетках СНО, lot # E10569) оценивали с помощью ловушечного вариант ELISA. В данном анализе лунки 96-луночных полистирольных планшетов для ELISA сначала покрывали с использованием 100 мкл/лунку Fc-специфического козьего антитела против IgG человека (Jackson ImmunoResearch Laboratories, West Grove, PA) в концентрации 1 мкг/мл в покрывающем буфере (0,1 М Na2CO3, рН 9,6). Планшеты инкубировали в течение ночи при 4°С, после чего несвязанное антитело отсасывали и планшеты промывали дважды с использованием 300 мкл/лунку буфера для промывки (PBS-Tween, установленного как 0.137М NaCI, 0.0022M KCl, 0.0067М Na2HPO4, 0,0020M KH2PO4, 0,05% об./мас. полисорбат 20 (Tween 20), рН 7,2). Лунки блокировали 200 мкл/лунку блокирующего буфера (PBS-Tween плюс 1% масс./об. бычьего сывороточного альбумина (BSA) в течение 60 минут при комнатной температуре (RT), отсасывали и планшеты промывали дважды 300 мкл/лунку PBS-Tween. Планшеты инкубировали с 362.78-СНО (Ab1, ZGI, продуцированном в клетках СНО, lot # E10569) в концентрации 1 мг/мл (в 1% BSA в PBS-Tween). Через 1 часа инкубации при RT, содержимое лунок планшетов отсасывали и планшеты промывали дважды как описано выше. Готовили серийные 10-кратные разведения (в 1% BSA в PBS-Tween) антисыворотки (Ab2), начиная с исходного разведения от 1:1000 и кончая 1:1000000. Затем двойные пробы каждого разведения переносили в планшет для анализа, 100 мкл/лунку. Нормальная мышиная сыворотка служила в виде отрицательного контроля. После 1 часа инкубации при RT содержимое лунок планшетов отсасывали и планшеты дважды промывали, как описано выше. Затем Fc-специфическое козье антитело против мышиного IgG, конъюгированное с HRP (пероксидазой хрена) (Jackson ImmunoResearch Laboratories), при разведении 1:5000 добавляли в лунки, 100 мкл/лунку. После 1 часа инкубации при RT несвязанное детектирующее антитело отсасывали из лунок и планшеты дважды промывали. После отсасывания 100 мкл/лунку тетраметилбензидина (ТМВ) (BioFX Laboratories, Owings Mills, MD) добавляли в каждую лунку и планшеты инкубировали в течение 1 минуты при RT. Развитие окраски останавливали добавлением 100 мкл/лунку стоп-реагента (BioFX Laboratories, Owings Mills, MD) и значения поглощения содержимого лунок прочитывали на приборе Molecular Devices Spectra MAX 340 при 450 нм.

[228] Реакция нейтрализации. Способность мышиных анти-362.78-СНО антиидиотипических антител (Ab2) в антисыворотке ингибировать (нейтрализовать) связывающую активность 362.78-СНО (Ab1) оценивали с помощью реакции нейтрализации на планшетах. В этом анализе лунки 96-луночных полистирольных планшетов для ELISA сначала покрывали с использованием 100 мкл/лунку лиганда IL-21 человека (lot # A 1207F) в концентрации 1 мкг/мл в покрывающем буфере (0,1 М Na2CO3, рН 9,6). Планшеты инкубировали в течение ночи при 4°С, после чего несвязанный лиганд отсасывали и планшеты промывали дважды с использованием 300 мкл/лунку буфера для промывки (PBS-Tween, установленного как 0,137М NaCl, 0.0022М KCl, 0,0067М Na2HPO4, 0,0020М KH2PO4, 0,05% об./мас. полисорбат 20 (Tween 20), рН 7,2). Лунки блокировали 200 мкл/лунку блокирующего буфера (PBS-Tween плюс 1% мас./об. бычьего сывороточного альбумина (BSA) в течение 1 часа, после чего планшеты промывали два раза буфером для промывки. Готовили серийные 10-кратные разведения (в 1% BSA в PBS-Tween) антисыворотки (Ab2), начиная с исходного разведения от 1:100 и кончая 1:1000000. Нормальная мышиная сыворотка служила в качестве отрицательного контроля. Затем двойные пробы каждого разведения переносили в 96-луночный планшет для разведения, 100 мкл/лунку. Ab1 добавляли в виде 2 × раствора, 100 мкл/лунку. После 45 минут инкубации при RT 100 мкл/лунку переносили в планшет для анализа после отсасывания блокирующего буфера. После 1 часа инкубации при RT содержимое лунок отсасывали и планшеты дважды промывали, как описано выше. Затем Fc-специфическое козье антитело против IgG человека, меченное пероксидазой хрена, конъюгированное с HRP (пероксидазой хрена) (Jackson ImmunoResearch Laboratories, West Grove, PA) в разведении 1:5000 добавляли в каждую лунку, 100 мкл/лунку, и планшеты инкубировали при RT в течение 1 часа. После удаления несвязанного детектирующего антитела планшеты дважды промывали, 100 мкл/лунку тетраметилбензидина (ТМВ) (BioFX Laboratories, Owings Mills, MD) добавляли в каждую лунку и планшеты инкубировали в течение 2 минут при RT. Развитие окраски останавливали добавлением 100 мкл/лунку стоп-реагента (BioFX Laboratories, Owings Mills, MD) и значения поглощения содержимого лунок прочитывали на приборе Molecular Devices Spectra MAX 340 при 450 нм.

[229] Слияние. Двух мышей с наивысшими нейтрализующими титрами анти-362.78-СНО иммунизировали во время окончания с помощью приблизительно 50 мкг 362.78-СНО (Ab1) в PBS без адъюванта посредством подкожной инъекции. Через четыре дня собирали селезенку и лимфатические узлы данной мыши. Электрослияние выполняли с использованием традиционных методов, известных в данной области для слияния лимфоцитов с мышиными миеломными клетками Р3-Х63-Ag8.653 (Американская коллекция типовых культур, CRL 1580) при соотношении 1:1 лимфоцит:миелома с помощью прибора Cyto-pulse CEEF-50 (Cyto Pulse Sciences Inc., Glen Burnie, MD). Смесь для слияния распределяли в 96-луночные плоскодонные планшеты. Лунки планшетов для слияния заполняли три раза 70% заменой гибридомной питательной среды (IMDM с 1 х L-глутамином (100х), 1 × пенициллин-стрептомицином (100х), все Gibco Invitrogen, Carlsbad, CA, 10% сывороткой Fetalclonel, не инактивированной прогреванием (HyClone, Logan, UT), с 10% фактором для клонирования гибридом Hybridoma Cloning Factor (BM Condimed HI Roche Diagnostic, Indianapolis, IN), 1 × добавка HAT (50 ×, Gibco Invitrogen). (пер., содержимое) лунок оценивали через десять дней после нанесения на планшеты слияния.

[230] Отбор основных (master) лунок. Проводили скрининг 96-луночных планшетов для слияния на присутствие мышиных анти-362.78-СНО идиотипических антител с помощью ловушечного варианта ELISA, как описано выше, за исключением того, что гибридомные супернатанты анализировали неразбавленными из культуральных планшетов. Гибридомные клетки положительных лунок успешно наращивали в 24-луночных культуральных планшетах. При достижении плотности культур в 24-луночных планшетах приблизительно 4-6×105 клеток/мл супернатант (приблизительно 1,5 мл) собирали из каждой лунки в отдельности и хранили, и клетки из каждой лунки криоконсервировали. Среда для замораживания состояла из 90% сыворотки Fetalclone 1 и 10% DMSO. Каждый из 24-луночных супернатантов анализировали повторно, как в ловушечном варианте ELISA, так и в нейтрализующем варианте ELISA в планшетах, описанном выше. Результаты показали, что после экспансии все супернатанты основных лунок сохраняли свою способность узнавать 362.78-СНО антитело (Ab1) в растворе. Семь из супернатантов основных лунок сохраняли свою способность нейтрализовать связывание Ab1 с человеческим IL-21-лигандом.

[231] Клонирование. Клетки из 5 основных лунок выбирали в соответствии с их нейтрализующей активностью и клонировали в ростовой среде для гибридом, снабженной 1×НТ (100х, Gibco Invitrogen) для выделения клонированной гибридомы, продуцирующей представляющее интерес нейтрализующее mAb. Клетки клонировали в 96-луночных культуральных планшетах для микротитрования с использованием традиционного подхода разведения низкой плотности (менее чем 1 клетка на лунку) и моноклональность оценивали микроскопическим исследованием (содержимого) лунок для одного очага роста перед анализом. Через шесть дней после высева в планшеты все планшеты подвергали скринингу нейтрализующим ELISA на ингибирующие анти-362.78-СНО антиидиотипические антитела. Гибридомные клетки из положительных лунок успешно размножали в 24-луночных планшетах.

[232] Отбор клонов первого раунда. Супернатанты из приблизительно 6 лунок каждой клонированной гибридомной линии, которые были положительными к специфическому mAb и происходили из лунок только из одной колонии для роста гибридомы, собирали из каждого набора клонирования и проводили повторный скрининг при различных разведениях в нейтрализующем ELISA для идентификации лучшего клона, продуцирующего нейтрализующее mAb. При плотности лучшего клона 24-луночных культур приблизительно 4-6×105 клеток/мл, супернатант собирали по отдельности и хранили содержимое каждой лунки и клетки из каждой лунки при тщательной криоконсервации.

[233] Выводы. Производили мышиные моноклональные антитела (Аb2) реактивные против рекомбинантно экспрессированного 362.78-СНО антитела (Ab1), и антитела проявляли нейтрализующую активность, способную блокировать связывание 362.78-СНО антитело с IL-21 человека. Данные антитела могут быть применимы в виде реагентов в доклинических и клинических иммунологических анализах.

Пример 19. Связывание нативного внутриклеточного IL-21 человека и IL-21 яванских макак (но не мышиного или крысиного IL-21) (моноклональным антителом) IL-21 mAb 362.78.1.44

[234] Нейтрализующие анти-1b-21 моноклональные антитела, описанные здесь, производили из трансгенных мышей, экспрессирующих гены иммуноглобулина человека, и иммунизированных рекомбинантным человеческим IL-21 (см. пример 1). Важно было подтвердить, что IL-21 mAb клон 362.78.1.44 может связывать и нейтрализовать нативный IL-21 человека помимо рекомбинантной формы IL-21. Кроме того, для поддержки доклинических токсикологических исследований полезно понять связывающую способность IL-21 mAb клона 362.78.1.44 с нативным IL-21 различных видов. Для данного анализа один из подходов представляет собой мечение IL-21 mAb клона 362.78.1.44 с флуоресцентным красителем и использование меченного антитела для обнаружения внутриклеточного IL-21 в активированных Т-клетках проточной цитометрией. В данном исследовании свежевыделенные лейкоциты периферической крови человека и яванской макаки, а также спленоциты крысы и мыши активировали in vitro с помощью РМА (пер., форбол-12-миристат-1-3-ацетат (ФМА)) и иономицина в течение 24 часов для стимуляции образования IL-21. Клетки собирали, фиксировали, пермеабилизовали и окрашивали на предмет обнаружения экспрессии CD3 или CD4 (для определения популяций хелперных Т-клеток), и IL-21 с помощью IL-21 mAb клона 362.78.1.44, меченного ALEXA FLUOR-647 (AF-647), и сравнивали с интенсивностью окраски, индуцированной изотипически сходным контрольным антителом. Положительный сигнал в данном анализе, выше сигнала, наблюдаемого для изотипического контрольного mAb, демонстрирует специфическое связывание IL-21 mAb клона 362.78.1.44 с эндогенным IL-21 тестируемых видов, хотя оно не является индикатором нейтрализующей активности IL-21. Дополнительные исследования необходимы для демонстрации нейтрализации IL-21 видов, которая дает положительный результат в отношении связывания IL-21 с mAb против человеческого IL-21 клон 362.78.1.44 (см. пример 20).

[235] Выделение РВМС человека (пер., мононуклеарных клеток периферической крови человека): 100 мл периферической крови отбирали у здоровых людей добровольцев (ZymoGenetics) в гепариновые вакуумные пробирки Вакутайнер (Vacutaine) с зелеными крышками (Becton Dickinson, San Jose, CA). Кровь разбавляли с помощью 100 мл PBS комнатной температуры и 35 мл аликвоты распределяли в 50 мл конические пробирки. Подслаивали 14 мл фикола Ficoll/Paque PLUS (Pharmacia, Uppsala, Sweden) комнатной температуры и пробирки центрифугировали в течение 20 минут при 2000 об/мин. Извлекали слой РВМС на границе раздела фаз и промывали два раза средой для анализа (RPMI 1640, снабженную пенициллин/стрептомицином, 10% эмбриональной бычьей сывороткой, пируватом натрия, 2 мкМ β-меркаптоэтанола, все от Invitrogen, Carlsbad, CA). Жизнеспособные клетки подсчитывали в трипановом синем с помощью традиционных методов.

[236] Выделение РВМС яванских макак: 40 мл периферической крови отбирали в гепариновые вакуумные пробирки Вакутайнер (Vacutaine) с зелеными крышками (BD Biosciences) у яванских макак, содержащихся в университете Вашингтона в Сиэтле. Кровь разбавляли с помощью 40 мл PBS комнатной температуры и 35 мл аликвоты распределяли в 50 мл конические пробирки. Подслаивали четырнадцать мл фиколла Ficoll/Paque PLUS (Pharmacia, Uppsala, Sweden) комнатной температуры и пробирки центрифугировали в течение 20 минут при 2000 об/мин. Извлекали слой РВМС на границе раздела фаз и промывали два раза средой для анализа (RPMI 1640, снабженную пенициллин/стрептомицином, 10% эмбриональной бычьей сывороткой, пируватом натрия, 2 мкМ β-меркаптоэтанола, все от Invitrogen, Carlsbad, CA). Жизнеспособные клетки подсчитывали в трипановом синем с помощью традиционных методов.

[237] Выделение мышиных и крысиных спленоцитов. Как крысиные, так и мышиные спленоциты готовили в соответствии с нижеприведенным протоколом. Свежевзятую селезенку осторожно разрушали до суспензии однородных клеток с помощью концов двух покрытых инеем предметных стекол. Затем клетки пропускали через нейлоновый фильтр с отверстиями 70 мкм для удаления комков. Эритроциты лизировали путем ресуспендирования осадка клеток в 2 мл лизирующего буфера АСК в течение 10 при комнатной температуре. Данное взаимодействие останавливали добавлением среды для анализа, затем клетки центрифугировали (1200 об/мин в течение 5 минут), ресуспендировали и пропускали через нейлон с другими с отверстиями для удаления дебриса. Жизнеспособные клетки подсчитывали в трипановом синем с помощью традиционных методов.

[238] Активация клеток в течение ночи с помощью РМА и иономицина. Клетки всех видов ресуспендировали при 2,0×106 клеток на мл. Затем один мл клеток высевали с добавлением или без добавления 20 нг/мл РМА и 200 нг/мл иономицина в 24-луночный планшет и инкубировали при 37°С в течение 20 часов во влажной камере термостата для культуры тканей с 5% CO2. Через 20 часов в каждую лунку добавляли 1,0 мкл GolgiPlug (BD Pharmingen) и клетки инкубировали в течение дополнительных четырех часов.

[239] Сбор клеток и окрашивание поверхности. После 24 часов инкубации, описанной выше, клетки собирали, промывали холодным буфером FACS и высевали при 2,0×105-5,0×105 клеток на лунку в 96-луночный планшет для культуры тканей (Becton Dickinson and Co., Franklin Lakes, NJ). Затем клетки, в случае необходимости, окрашивали с помощью 1 мкг/мл одного или нескольких нижеуказанных антител: антимышиное CD4-РЕ, антикрысиное CD3-PE, антикрысиное В220-РЕ, или анти-обезьянье CD4-PE, или против человеческого CD4-PE в течение 20 минут на бане со льдом. Затем клетки промывали два раза в PBS в препарате для фиксации.

[240] Фиксация и пермеабилизация клеток. Для фиксации клеток каждый осадок клеток ресуспендировали в 200 мкл 2% параформальдегида и инкубировали при комнатной температуре в течение 5 минут. Затем клетки центрифугировали (5 минут при 1200 об/мин) и супернатанты отсасывали и клетки ресуспендировали в буфере для пермеабилизации [PBS, снабженным 0,1% сапонином (Calbiochem) и 0,5% BSA (Sigma)] в течение 10 минут при комнатной температуре.

[241] Внутриклеточное окрашивание. После фиксации и пермеабилизации клетки окрашивали с помощью ~1 мкг/мл одного из нижеуказанных меченых антител: антимышиного IL-21-AF647, против человеческого IL-21 клон 362.78.1.44-AF647 (оба произведены ZymoGenetics) или антителом сравнения против человеческого IL-21-AF647 от BD Pharmingen. Затем клетки инкубировали при комнатной температуре в темноте в течение 40 минут. Через 40 минут клетки промывали дважды буфером FACS (HBSS (пер., сбалансированным солевым раствором Хэнкса), снабженным 1% BSA, 2% сывороткой АВ человека и 0,05% HEPES).

[242] Получение и анализ данных. По завершению окрашивания и промывки клетки ресуспендировали в 400 мкл буфера FACS и данные получали с помощью прогона через FACS Calibur (BD Pharmingen) с программным обеспечением CellQuest software. Данные анализировали с помощью программного обеспечения FCS Express data analysis software (De Novo Software, Los Angeles, CA).

[243] Результаты. Обнаружение человеческого IL-21 в клетках человеческих Т-клетках, индуцированных РМА+иономицин: Тогда как только 0,015% CD3+Т-клеток положительно окрашивалось с использованием изотипического контроля, приблизительно 9% CD4+Т-клеток положительно окрашивалось на IL-21 с использованием IL-21 mAb клона 362.78.1.44, меченного с помощью AF-647. Эту же фракцию IL-21+-клеток обнаруживали с помощью коммерчески доступного IL-21 mAb от eBiosciences. Это показывает, что IL-21 mAb может связывать IL-21, эндогенно произведенный в CD4+Т-клетках человека.

[244] Обнаружение IL-21 яванских макак в мононуклеарных клетках периферической крови, индуцированных РМА+иономицин: Приблизительно 3,6% обезьяньих CD3+Т-клеток положительно окрашивали на IL-21 с использованием IL-21 mAb клона 362.78.1.44, меченного с помощью AF-647, по сравнению с 0,1% положительных с использованием изотипического контроля. Это число является выше, чем число, обнаруженное с помощью коммерчески доступного mAb против человеческого IL-21 от eBiosciences. Данное расхождение может быть обусловлено более слабой аффинностью связывания антитела eBiosciences в отношении обезьяньего IL-21. Эти результаты показывают, что клон 362.78.1.44 mAb против человеческого IL-21 может связывать IL-21, эндогенно произведенный в CD4+Т-клетках яванских макак.

[245] Обнаружение мышиного IL-21 в спленоцитах, индуцированных РМА+иономицин: С использованием в качестве положительного контроля крысиного анти-мышиного IL-21 моноклонального антитела, произведенного ZymoGenetics, приблизительно 13,5% активированных мышиных CD4+Т-клеток были положительными на IL-21. Однако как было предсказано из Вестерн-блот и нейтрализующих активность анализов, показывающими, что mAb против IL-21 человека клон 362.78.1.44 не связывают или нейтрализуют мышиный IL-21 (см. примеры 3 и 9), mAb против IL-21 человека клон 362.78.1.44, меченное с помощью AF647, не обнаруживало любые IL-21-положительные клетки. Это дополнительно демонстрирует, что mAb против IL-21 человека клон 362.78.1.44 не связывается с мышиным IL-21.

[246] Обнаружение крысиного IL-21 в спленоцитах, индуцированных РМА + иономицин. Спленоциты крысы активировали в течение ночи в присутствии РМА и индомицина. Данные условия активации были достаточными для образования IL-21-положительных Т-клеток человека, обезьяньих и мышиных Т-клеток. В данном эксперименте, ни антимышиное-IL-21 mAb, ни mAb против IL-21 человека клон 362.78.1.44, не обнаруживали какие бы то ни было клетки, которые были положительными на IL-21. Однако поскольку в данном эксперименте не было положительного контроля, данный отрицательный результат не окончательно исключал возможность того, что mAb против IL-21 человека клон 362.78.1.44 может связываться с крысиным IL-21. Однако эти данные, рассматриваемые наряду с отсутствием нейтрализации биологической активности крысиного IL-21 при помощи mAb против IL-21 человека клон 362.78.1.44, в других анализах (см. пример 9), убедительно доказывают, что данное mAb, вероятно, не связывает крысиный IL-21.

[247] Вывод. Описанное здесь mAb IL-21 клон 362.78.1.44, несомненно, связывается с нативными формами белка IL-21 человека и яванских макак, но не с мышиным или крысиным IL-21.

Таблица 14
Виды Изотипический контроль mAb против IL-21 человека (клон 78) Положительный контроль к анти-IL-21
Человек 0,015% CD3+Т-клеток, положительно окрашенных с контрольными hIgG4-AF647 9% CD3+Т-клеток были IL-21+ 10% CD3+Т-клеток были IL-21+(eBiosciences aIL-21 mAb*)
Яванская макака 0,1% CD3+Т-клеток, положительно окрашенных с контрольными hIgG4-AF647 3,6% CD3+Т-клеток были IL-21+ 0,2% CD3+Т-клеток были IL-21+*
Мышь Никакой изотипический контроль не использовали Ничто не обнаружено 13,5% CD4+Т-клеток были IL-21+
Крыса Никакой изотипический контроль не использовали Ничто не обнаружено Нет в наличии
*(данное mAb может не прочно связываться с обезьяньим IL-21)

Пример 20. Связывание нативного IL-21 человека и нейтрализация биологической активности нативного IL-21 человека клоном 362.78.1.44

[248] Нейтрализующие моноклональные антитела анти-IL-21 (IL-21 mAb, описанные здесь, производили в трансгенных мышах, экспрессирующих гены иммуноглобулина человека и иммунизированных с помощью рекомбинантного IL-21 человека (см. пример 1). Было важно подтвердить, что mAb IL-21 клон 362.78.1.44 может связывать и нейтрализовать нативный IL-21 человека в дополнение к рекомбинантной форме IL-21. Для демонстрации нейтрализации нативного IL-21 использовали ранее описанный анализ на основе клеток Baf3/IL-21 R pSTAT (см. пример 7) и пробы кондиционированной среды от активированных CD4+Т-клеток использовали в качестве источника нативного IL-21. В данном эксперименте пробы кондиционированной Т-клетками среды предварительно инкубировали с различными количествами mAb IL-21 клон 362.78.1.44 и затем измеряли индуцированный IL-21 уровень фосфорилирования STAT3 (pSTAT3) в трансфектантах Baf3/hIL-21R. Нейтрализацию нативного IL-21 демонстрировали с помощью проб кондиционированной Т-клетками среды от четырех отдельных здоровых людей доноров.

[249] Выделение РВМС человека и создание проб кондиционированной Т-клетками среды: 100 мл периферической крови у четырех здоровых людей добровольцев (ZymoGenetics) отбирали в гепариновые вакуумные пробирки Вакутайнер (Vacutaine) с зелеными крышками (Becton Dickinson, San Jose, CA). Затем кровь разбавляли с помощью 100 мл PBS комнатной температуры и распределяли на 35-мл аликвоты в 50-мл конические пробирки. Подслаивали 14 мл фиколла Ficoll/Paque PLUS (Pharmacia, Uppsala, Sweden) комнатной температуры и пробирки центрифугировали в течение 20 минут при 2000 об/мин. Извлекали слой РВМС на границе раздела фаз и промывали два раза средой для анализа (RPMI 1640, снабженную пенициллин/стрептомицином, 10% эмбриональной бычьей сывороткой, пируватом натрия, 2 мкМ β-меркаптоэтанола, все от Invitrogen, Carlsbad, CA). Жизнеспособные клетки подсчитывали в трипановом синем с помощью традиционных методов. Т-клетки отбирали посредством негативного отбора с помощью набора для отбора CD4+Т-клеток человека Human CD4+Т Cell Selection Kit от Miltenyi Biotec (Auburn, CA), следуя протоколу, полученному от производителя. С помощью традиционного метода иммунофенотипирования впоследствии определили проточной цитометрией, что CD4+Т-клетки являются >95% чистоты. Затем Т-клетки инкубировали в течение трех дней при 5×10е5 клеток на лунку в 24-луночном планшете, предварительно покрытом с использованием 5,0 мкг/мл анти-CD3 антитела в среде для скоса Th1, содержащей 5,0 мкг/мл анти-IFNγ, 1,0 мкг/мл анти-CD28 (все от Becton Dickinson) и 10 нг/мл рекомбинантного IL-12 (R&D Systems, Minneapolis, MN). Через три дня клетки промывали, пересевали в среду, содержащую 25 нг/мл РМА и 500 нг/мл иономицина и инкубировали в течение пяти часов при 37°С. Через пять часов пробы кондиционированной среды собирали и замораживали и хранили при -80°С до дня эксперимента.

[250] Для определения приблизительной концентрации IL-21 в пробах кондиционированной Т-клетками среды готовили серийные разведения 1:4 и анализировали индукцию фосфорилирования STAT3 в трансфектантах Baf3/hIL-21 R. Следуя 10-минутному протоколу анализа биологической активности pSTAT3, изложенному в примере 7, относительную концентрацию IL-21 в каждой пробе кондиционированной среды определяли сравнением уровня pSTAT3 с уровнем, полученным при титровании рекомбинантным IL-21. С использованием этих данных определенная концентрация IL-21 в каждой из четырех проб кондиционированной среды находилась между 5,0 и 10,0 нг/мл.

[251] Для демонстрации нейтрализации фософрилирования STAT3, индуцированного нативным IL-21, 1:10 разведения (конечные концентрации IL-21 между 0,5 и 1,0 нг/мл) четырех проб кондиционированной Т-клетками среды проинкубировали в течение 30 при 37°С с 1:4 серийными разведениями IL-21 mAb клона 362.78.1.44. Концентрация клона 362.78.1.44 находилась в диапазоне от 0,4 до 400 нг/мл. Через 30 минут пробы кондиционированной среды + IL-21 mAb переносили в планшет для клеток Baf3/hIL-21 R и инкубировали в течение дополнительных 10 минут при 37°С. Через 10 минут взаимодействия останавливали с помощью холодного буфера для промывки, клетки лизировали и измеряли количество pSTAT3 с помощью метода, описанного в примере 7.

[252] Во всех четырех пробах кондиционированной среды клон 362.78.1.44 IL-21 mAb эффективно нейтрализовал активность IL-21 (данные суммированы в таблице 15). Представленные данные четко демонстрируют эффективное связывание с нативным IL-21 человека и нейтрализацию нативного IL-21 человека клоном 362.78.1.44.

[253] Таблица 15
Нейтрализация нативного IL-21 клоном 362.78.1.44 IL-21 mAb
Индукция pSTAT3 (раз выше фона)
IL-21 mAb Концентрация, (нг/мл) Донор 1 Донор 2 Донор 3 Донор 4
0,4 69,49 56,32 61,11 62,73
1,6 70,84 61,73 68,24 65,41
6,25 70,76 10,46 7,51 60,65
25 2,16 1,62 1,70 2,49
100 168 1,43 1,51 1,49
400 1,59 1,30 1,14 1,51

Пример 21.

21А. Пилотное исследование токсичности с помощью IL-21 mAb 362.78-СНО у яванских макак

[254] Эпитопная специфичность IL-21 mAb 362.78-СНО является общей для людей, макак резус и яванских макак (см. примеры 17 и 17b), таким образом, переносимость и токсичность IL-21 mAb анализировали на яванских макаках, подходящих для данного анализа вида для испытания на безопасность.

[255] Яванских макак лечили с помощью одной инъекции IL-21 mAb 362.78-СНО и проводили мониторинг клинических признаков с 4 по 8 неделю после лечения. IL-21 mAb доставляли подкожной или внутривенной инъекцией в дозах 5 или 100 мг/кг. Никаких клинических признаков не наблюдали. Никаких значимых изменений массы тела или коагуляции не наблюдали. Никаких изменений в биохимическом анализе крови или общем анализе. крови, связанных с токсичностью лекарственного средства, не наблюдали. Однократное лечение с помощью IL-21 mAb 362.78-CHO при 5 или 100 мг/кг хорошо переносилось всеми животными.

[256] Вскрытие трупа выполняли у животных при высокой дозе (100 мг/кг). Никаких существенных анатомических изменений не наблюдали. Гистопатологический анализ животных при высокой дозе показал минимальную лимфоидную гиперплазию в лимфоидной ткани. Иммуногистохимический анализ лимфоидных тканей показал умеренное увеличение размера фолликул и в типах клеток, ассоциированных с фолликулами. Данные изменения могли бы иметь отношение к фармакологической активности IL-21 mAb 362.78-CHO, поскольку известно, что IL-21 прямо затрагивать развитие и выход В-клеток из лимфоидных фолликул и поддерживать переключение классов, созревание аффинности и развитие плазматических клеток.

[257] Фармакокинетическое поведение и биологическую доступность IL-21 mAb 362.78-CHO мониторировали в исследовании при однократной дозе на яванских макаках. Восемь самцов яванских макак лечили с помощью IL-21 mAb 362.78-CHO. Троих лечили подкожной инъекцией 5 мг/кг и троих лечили внутривенной инъекцией 5 мг/кг. Двоих лечили внутривенной инъекцией 100 мг/кг. Пробы сыворотки брали для анализа уровней IL-21 mAb 362.78-CHO на протяжении четырех недель после введения для группы 100 мг/кг и протяжении восьми недель после введения для двух групп 5 мг/кг. Анализ без компартментализации фармакокинетических профилей показал, что воздействие возрастало пропорционально от дозы при внутривенном введении 5 или 100 мг/кг IL-21 mAb. Биологическая доступность IL-21 mAb 362.78-CHO составляла приблизительно 50% после подкожного введения. Вычисленный конечный полупериод для IL-21 mAb составлял 10-14 дней. Вычисленный конечный полупериод для IL-21 mAb *инсерт: 362.78-CHO у яванских макак составлял 10-14 дней.

21В. Пилотное фармакологическое исследование 362.78-CHO у яванских макак

[258] Эпитопная специфичность IL-21 mAb 362.78-CHO является общей для людей, макак резус и яванских макак (см. примеры 17 и 17b), таким образом, in vivo фармакологию IL-21 mAb анализировали у яванских макак, в подходящих видах для фармакодинамической оценки.

[259] Яванских макак лечили с помощью однократной инъекции IL-21 mAb 362.78-CHO и мониторировали клинические показатели в течение 4-8 недель после лечения. Доставку IL-21 mAb 362.78- СНО производили подкожной и внутривенной инъекцией в дозах 5 или 100 мг/кг. У всех животных проводили мониторинг изменений в составе лейкоцитов периферической крови проточной цитометрией. Никаких связанных с лечением изменений в концентрации моноцитов и В-клеток, и никаких изменений в Т-клеточных субпопуляциях CD4 и CD8, ни в соотношении клеток CD4 к CD8 не наблюдали. Снижение концентрации NK-клеток наблюдали после введения IL-21 mAb 362.78-CHO. Во всех группах лечения NK-клетки периферической крови были повышены на 24 ч после лечения по отношению к фоновым значениям. У пяти из восьми животных уровни NK-клеток оставались на 60% ниже фонового значения в течение последних двух недель. Подтверждающее исследование с использованием подходящих контролей для управления стрессом и другими источниками нестабильности концентрации NK-клеток периферической крови будут необходимы для подтверждения данного наблюдения.

Пример 22. Анти-mIL-21 антитело снижает заболеваемость и прогрессирование коллаген-индуцированного артрита (CIA) в мышиной модели

Мышиная модель коллаген-индуцированного артрита (CIA).

[260] Существует несколько моделей животных ревматоидного артрита, известных в данной области. Например, в модели коллаген-индуцированного артрита (CIA) мыши развивают хронический воспалительный артрит, который очень напоминает человеческий ревматоидный артрит. Поскольку CIA имеет общие сходные иммунологические и патологические свойства с RA, то это делает его идеальной моделью для скрининга потенциальных противовоспалительных соединений для человека. Модель CIA представляет собой известную модель на мышах, возникновение которого зависит как от иммунного ответа, так и от воспалительного ответа. Иммунный ответ включает в себя взаимодействие В-клеток и CD4+Т-клеток в ответ на коллаген, который дается в качестве антигена, и приводит к образованию антиколлагеновых антител. Воспалительная фаза является результатом тканевых ответов на медиаторы воспаления, в результате некоторые из этих антител дают перекрестную реакцию с мышиным нативным коллагеном и активируют путь комплемента. Преимущество использования модели CIA состоит в том, что основные механизмы патогенеза являются известными. Были идентифицированы релевантные Т-клеточные и В-клеточные эпитопы на коллагене II и были определены различные иммунологические (например, гиперчувствительность замедленного типа и антиколлагеновое антитело) и воспалительные (например, цитокины хемокины и матрикс-деградирующие ферменты) параметры, относящиеся к иммуноопосредованному артриту, и, таким образом, могут быть использованы для оценки эффективности тестируемого соединения в модели CIA (Wooley, Curr. Qpin. Rheum. 3:407-20, 1999; Williams et al., Immunol. 89:9784-788, 1992; Myers et al., Life Sci. 61: 1861-78, 1997; и Wang et al., Immunol. 92:8955-959, 1995). Потенциальная эффективность крысиного антимышиного mAb к IL-21, произведенного ZymoGenetics, была проанализирована в модели CIA, как описано ниже.

[261] Самцов мышей DBA/1J (Jackson Labs) десятинедельного возраста использовали для терапевтического приема лекарственного средства (т.е. поскольку мыши заболели установленным заболеванием). На день 21 всем животным давали внутрикожную инъекцию в хвост 100 микролитров 1 мг/мл коллагена типа II цыплят в полном адъюванте Фрейнда (приготовленного Chondrex, Redmond, WA), и через три недели, на 0 день, им давали одну и ту же инъекцию, кроме того, что приготовлена в неполном адъюванте Фрейнда. анти-IL-21 антитело или носитель (PBS) вводили в виде внутрибрюшинной инъекции через день, в общей сложности 6 доз, как только у мышей развивалось установленное заболевание. Мыши (n=7 на лечение) получали или 0,15 мг анти-IL-21 антител на животное на дозу, или носитель контроль, PBS (Life Technologies, Rockville, MD). Животные начинали показывать симптомы артрита после второй инъекции коллагеном, вместе с большинством животных, развивающими воспаление в течение 1-2 недель. Распространение заболевания оценивали в каждой лапке с помощью калипера для измерения толщины лапки и присвоением клинического показателя (0-3) для каждой лапки (см. ниже).

[262] Мониторинг заболевания.

[263] Животные могут начинать проявлять признаки воспаления лапок вскоре после второй инъекции коллагена, и некоторые животные могут даже начинать проявлять признаки воспаления пальцев перед второй инъекцией коллагена. Большинство животных развивает артрит в течение 1-2 недель бустер-инъекции, но для некоторых может потребоваться более продолжительный период времени. Частота заболевания в данной модели обычно составляет 90-100%, и обычно 0-5 не ответивших на лечение (определенных после 6 недель наблюдения), увиденных в эксперименте с использованием 60 животных. Поскольку данное исследование только индуцировало мышей с установленным заболеванием, то мышей, которые не развивали артрит, не использовали. Примечательно, что, как только начинается воспаление, может случиться общее транзиторное появление различных слабо выраженных воспалений лапок или пальцев. По этой причине не считается, что животное имеет установленное заболевание, прежде чем не разовьется выраженное, устойчивое опухание лапок.

[264] Всех животных наблюдали ежедневно для оценки статуса заболевания в их лапках, которое делали путем присвоения качественного клинического показателя для каждой из лапок. Каждый день у каждого животного оценивали по шкале клинических симптомов 4 лапки в соответствии с их состоянием клинического заболевания. Для определения клинического показателя лапка может считаться как имеющая 3 зоны, пальцы, собственно лапку (кость или лапку), и лучезапястный или голеностопный сустав. Распространение и тяжесть воспаления, относящегося к данным зонам, принимали во внимание, в том числе: наблюдение каждого пальца в отношении опухания; задранные когти или покраснение пальцев; принятие во внимание любого проявления отека или покраснения в любой из лапок; принятие во внимание любой потери четкой анатомической демаркации сухожилий или костей; оценка запястья или лодыжки в отношении любого отека или покраснения; и принятие во внимание распространяется ли воспаление проксимально вверх по ноге. Шкала оценки лапок 1, 2 или 3, во-первых, базировалась на общем впечатлении тяжести, и во-вторых, на том, сколько зон было вовлечено. Шкала, используемая для оценки клинических показателей, показана ниже.

[265] Клинический показатель:

[266] 0 = норма

[267] 0,5 = Вовлечены один или несколько пальцев, но только пальцы воспалены

[268] 1 = среднее воспаление, вовлекающее лапку (1 зону), и может включать палец или пальцы

[269] 2 = умеренное воспаление в лапке и может включать некоторые из пальцев и/или запястье/лодыжка (2 зоны)

[270] 3 = тяжелое воспаление в лапке, запястье/лодыжка и некоторые или все пальцы (3 зоны)

[271] Установленному заболеванию давали определение в виде качественной оценочной шкалы воспаления лапок, с ранжированием 1 или несколько, которое сохранялось в течение двух дней подряд. Как только установленное заболевание появлялось, дату записывали и обозначали как первый день животного с "установленным заболеванием".

[272] Мыши, получающие анти-mIL-21 антитело отличались уменьшением опухания лапок в течение всего периода эксперимента и имели приблизительно на 25% более низкое среднее значение показателя артрита по сравнению с мышами, получающими PBS. Данные результаты указывают на то, что анти-IL-21 антитело уменьшало опухание лапок и прогрессирование заболевания, связанного с данной моделью артрита и позволяют предположить, что анти-IL-21 антитело может быть эффективным при лечении артрита у человека.

Пример 23. Экспрессия IL-21 R в пробах псориатической кожи человека

[273] Экспрессия IL-21 R обычно ограничивается клетками гематопоэтического происхождения. Однако при установлении воспалительного заболевания экспрессия IL-21 R на негематопоэтических клетках может обеспечить прямые стимулы для типов клеток, которые опосредуют функциональные изменения в пораженных тканях. При псориазе рост кератиноцитов разрегулирован, вместе с эпидермальной гиперплазией с псориатической сыпью, аберрантной терминальной (пер., конечной) дифференцировкой и неполным развитием рогового слоя. IL-21, продуцируемый инфильтрирующими в псориатическую кожу Т-клетками Th1 и Th17, может активировать функциональные изменения в кератиноцитах, в том числе пролиферацию клеток, образование хемокинов и измененную дифференциацию. По этой причине исследовали IL-21 R на кератиноцитах в очагах псориатической кожи.

[274] Методы. Иммуногистохимический анализ 18 проб кожи, взятых методом биопсии от 4 нормальных людей доноров и 9 пациентов с псориазом, выполняли с помощью мышиного IgG1 антитела против человеческого IL-21 R, произведенного в ZymoGenetics. Для пациентов с псориазом субпопуляция (5) обеспечивала пробы как пораженной, так и непораженной кожи. Высокую степень эпидермальной гиперплазии отмечали в гистопатологическом исследовании пораженной кожи всех доноров. Иммунореактивность (окрашивание) IL-21 R на специфических типах клеток оценивали на основе частоты положительных клеток и интенсивности окрашивания.

[275] Результаты. В нормальной коже и непораженной коже пациентов с псориазом, окрашивание на IL-21 R было положительным на случайных внутриэпидермальных мононкулеарных клетках (MNC), рассеянных макрофагах и фибробластоподобных клетках. Положительное окрашивание на IL-21 R присутствовало на большом числе MNC во всех пробах пораженной кожи пациентов с псориазом. Пробы, окрашенные с использованием контрольного антитела мышиного изотипа, были отрицательными. Минимальное окрашивание или отсутствие окрашивания на IL-21 R присутствовало на эпидермальных кератиноцитах нормальной кожи. В пробах непораженной кожи, взятых методом биопсии, пациентов наблюдали слабое окрашивание в эпидермальных кератиноцитах в 4 пробах, и умеренное окрашивание наблюдали в шиповатом слое в пятой пробе. Окрашивание от среднего до сильного существовало в фокальных областях кератиноцитов в 8 пробах из 9 пациентов с псориазом.

[276] Вывод. В псориатических поражениях кожи экспрессия IL-21 R не ограничивается инфильтрирующими лейкоцитами, но является также позитивной (up-regulated) на эпидермальных кератиноцитах. Наличие повышенного окрашивания на IL-21 R на эпидермальных кератиноцитах в непораженной коже пациентов с псориазом по сравнению с нормальными контролями позволяет предположить, что даже в незатронутой коже кератиноциты могут отзываться аберрантно на активацию IL-21. В присутствии воспаления отмечали повышенное содержание IL-21 R на инфильтрирующих MNC и в гиперпластическом эпидермальном слое. Таким образом, лечение псориаза с помощью антитела, блокирующего IL-21, может ингибировать воспаление путем блокирования сигналов IL-21 как в воспалительные клетки, так и эпидермальные кератиноциты.

1. Выделенное антитело против IL-21 человека, содержащее вариабельную область тяжелой цепи, содержащей SEQ ID NO: 31, 33 и 35, и вариабельную область легкой цепи, содержащей SEQ ID NO: 39, 41 и 43.

2. Антитело по п.1, в котором тяжелая цепь включает аминокислотные остатки 20-145 SEQ ID NO: 29 или последовательность, имеющую по крайней мере 80% идентичность к этому, и в которых легкая цепь включает аминокислотные остатки 21-126 SEQ ID NO: 37, или последовательность, имеющую идентичность, по крайней мере на 80%.

3. Выделенное антитело против IL-21 человека, содержащее вариабельную область тяжелой цепи, содержащей SEQ ID NO: 47, 49 и 51, и вариабельную область легкой цепи, содержащей SEQ ID NO: 55, 57 и 59.

4. Антитело по п.3, в котором тяжелая цепь включает аминокислотные остатки 20-145 SEQ ID NO: 45 или последовательность, имеющую по крайней мере 80% идентичность к этому, и в которых легкая цепь включает аминокислотные остатки 21-126 SEQ ID NO: 53, или последовательность, имеющую идентичность, по крайней мере на 80%.

5. Антитело по п.1 или 2, где Fc-часть указанного антитела имеет пониженную эффекторную функцию.

6. Антитело по п.3 или 4, где Fc-часть указанного антитела имеет пониженную эффекторную функцию.

7. Антитело по п.1, где Fc-часть указанного антитела выбрана из группы, состоящей из IgG1, IgG2 и IgG4.

8. Антитело по п.1 или 2 для использования при лечении ревматоидного артрита, для лечения воспалительного заболевания кишечника (IBD), где воспалительное заболевание кишечника выбрано из группы, состоящей из болезни Крона, язвенного колита и синдрома раздраженной толстой кишки.

9. Антитело по п.1 или 2 для использования при лечении ревматоидного артрита.

10. Антитело по п.1 или 2 для использования при лечении рассеянного склероза.

11. Антитело по п.1 или 2 для использования при лечении сахарного диабета I типа (IDDM).

12. Антитело по п.1 или 2 для использования при лечении синдрома Шегрена.

13. Антитело по п.1 или 2 для использования при лечении аутоиммунного заболевания, выбранного из группы, состоящей из панкреатита, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, анкилозирующего спондилоартрита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции "трансплантат против хозяина" (GVHD), кожной Т-клеточной лимфомы (CTCL), гломерулонефрита, нефропатии IgA-типа, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома, аутоиммунного увеита и астмы.

14. Антитело по п.1 или 2 для использования при лечении системной красной волчанки (SLE) или псориаза.

15. Антитело по п.1 или 2 для использования при лечении заболеваний, опосредованных фолликулярными Т-клетками-хелперами, или заболеваний, опосредованных В-клетками, выбранных из группы, состоящей из системной красной волчанки, аутоиммунной потери слуха, болезни Грейвса, обыкновенной пузырчатки, миастении гравис, нейромиелита зрительного нерва, синдрома Гудпасчера, аутоиммунного нефрита, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии и идиопатической тромбоцитопенической пурпуры (ITP).

16. Антитело по п.3 или 4, где Fc-часть указанного антитела выбрана из группы, состоящей из IgG1, IgG2 и IgG4.

17. Антитело по п.3 или 4 для использования при лечении ревматоидного артрита, для лечения воспалительного заболевания кишечника (IBD), где воспалительное заболевание кишечника выбрано из группы, состоящей из болезни Крона, язвенного колита и синдрома раздраженной толстой кишки.

18. Антитело по п.3 или 4 для использования при лечении ревматоидного артрита.

19. Антитело по п.3 или 4 для использования при лечении рассеянного склероза.

20. Антитело по п.3 или 4 для использования при лечении сахарного диабета I типа (IDDM).

21. Антитело по п.3 или 4 для использования при лечении синдрома Шегрена.

22. Антитело по п.3 или 4 для использования при лечении аутоиммунного заболевания, выбранного из группы, состоящей из панкреатита, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, анкилозирующего спондилоартрита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции "трансплантат против хозяина" (GVHD), кожной Т-клеточной лимфомы (CTCL), гломерулонефрита, нефропатии IgA-типа, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома, аутоиммунного увеита и астмы.

23. Антитело по п.3 или 4 для использования при лечении системной красной волчанки (SLE) или псориаза.

24. Антитело по п.3 или 4 для использования при лечении заболеваний, опосредованных фолликулярными Т-клетками-хелперами, или заболеваний, опосредованных В-клетками, выбранных из группы, состоящей из системной красной волчанки, аутоиммунной потери слуха, болезни Грейвса, обыкновенной пузырчатки, миастении гравис, нейромиелита зрительного нерва, синдрома Гудпасчера, аутоиммунного нефрита, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии и идиопатической тромбоцитопенической пурпуры (ITP).

25. Гибридома, которая продуцирует антитело, содержащее вариабельную область тяжелой цепи, содержащей SEQ ID NO: 31, 33 и 35, и вариабельную область легкой цепи, содержащей SEQ ID NO: 39, 41 и 43, и которая депонирована в коллекции культур «American Type Culture Collection», имеющая номер «АТСС Patent Deposit Designation РТА-8790».

26. Анти-IL-21 антитело, продуцируемое гибридомой по п.25.

27. Гибридома, которая продуцирует антитело, содержащее вариабельную область тяжелой цепи, содержащей SEQ ID NO: 47, 49 и 51, и вариабельную область легкой цепи, содержащей SEQ ID NO: 55, 57 и 59, и которая депонирована в коллекции культур «American Type Culture Collection», имеющая номер «АТСС Patent Deposit Designation РТА-8786».

28. Анти-IL-21 антитело, продуцируемое гибридомой по п.27.

29. Антитело по п.26, где Fc-часть указанного антитела имеет пониженную эффекторную функцию.

30. Антитело по п.26, где Fc-часть указанного антитела выбрана из группы, состоящей из IgG1, IgG2 и IgG4.

31. Антитело по п.26 для использования при лечении воспалительного заболевания кишечника (IBD), где воспалительное заболевание кишечника выбрано из группы, состоящей из болезни Крона, язвенного колита и синдрома раздраженной толстой кишки.

32. Антитело по п.26 для использования при лечении ревматоидного артрита.

33. Антитело по п.26 для использования при лечении рассеянного склероза.

34. Антитело по п.26 для использования при лечении сахарного диабета I типа (IDDM).

35. Антитело по п.26 для использования при лечении синдрома Шегрена.

36. Антитело по п.26 для использования при лечении аутоиммунного заболевания, выбранного из группы, состоящей из панкреатита, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, анкилозирующего спондилоартрита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции "трансплантат против хозяина" (GVHD), кожной Т-клеточной лимфомы (CTCL), гломерулонефрита, нефропатии IgA-типа, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома, аутоиммунного увеита и астмы.

37. Антитело по п.26 для применения при лечении системной красной волчанки (SLE) или псориаза.

38. Антитело по п.26 для использования при лечении заболеваний, опосредованных фолликулярными Т-клетками-хелперами, или заболеваний, опосредованных В-клетками, выбранных из группы, состоящей из системной красной волчанки, аутоиммунной потери слуха, болезни Грейвса, обыкновенной пузырчатки, миастении гравис, нейромиелита зрительного нерва, синдрома Гудпасчера, аутоиммунного нефрита, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии и идиопатической тромбоцитопенической пурпуры (ITP).

39. Антитело по п.28, где Fc-часть указанного антитела имеет пониженную эффекторную функцию.

40. Антитело по п.28, где Fc-часть указанного антитела выбрана из группы, состоящей из IgG1, IgG2 и IgG4.

41. Антитело по п.28 для использования при лечении ревматоидного артрита, для лечения воспалительного заболевания кишечника (IBD), где воспалительное заболевание кишечника выбрано из группы, состоящей из болезни Крона, язвенного колита и синдрома раздраженной толстой кишки.

42. Антитело по п.28 для использования при лечении ревматоидного артрита.

43. Антитело по п.28 для использования при лечении рассеянного склероза.

44. Антитело по п.28 для использования при лечении сахарного диабета I типа (IDDM).

45. Антитело по п.28 для использования при лечении синдрома Шегрена.

46. Антитело по п.28 для использования при лечении аутоиммунного заболевания, выбранного из группы, состоящей из панкреатита, воспалительного заболевания мышц (полимиозита, дерматомиозита), микроскопического полиангиита, аутоиммунной апластической анемии, аутоиммунного тиреоидита, аутоиммунного гепатита, синдрома Вегенера, дивертикулеза, анкилозирующего спондилоартрита, склеродермии, системного склероза, псориатического артрита, остеоартрита, атопического дерматита, витилиго, реакции "трансплантат против хозяина" (GVHD), кожной Т-клеточной лимфомы (CTCL), гломерулонефрита, нефропатии IgA-типа, высокосенсибилизированных пациентов с трансплантацией, антифосфолипидного синдрома, аутоиммунного увеита и астмы.

47. Антитело по п.28 для использования при лечении системной красной волчанки (SLE) или псориаза.

48. Антитело по п.28 для использования при лечении заболеваний, опосредованных фолликулярными Т-клетками-хелперами, или заболеваний, опосредованных В-клетками, выбранных из группы, состоящей из системной красной волчанки, аутоиммунной потери слуха, болезни Грейвса, обыкновенной пузырчатки, миастении гравис, нейромиелита зрительного нерва, синдрома Гудпасчера, аутоиммунного нефрита, криоглобулинемии, синдрома Гийена - Барре, хронической воспалительной демиелинизирующей полинейропатии (CIDP), аутоиммунной гемолитической анемии и идиопатической тромбоцитопенической пурпуры (ITP).



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к способу синтеза целевого белка с пониженным ксилозилированием, пониженным фукозилированием или их комбинацией.
Настоящее изобретение относится к области иммунологии. Предложены вариабельные домены тяжелых (VH) и легких (VL) цепей мышиного антитела против фактора некроза опухоли альфа (ФНО-α) человека, а также антигенсвязывающий фрагмент Fab, которые селективно связываются с ФНО-α человека и нейтрализуют его.

Изобретение относится к области биохимии, в частности к молекуле нуклеиновой кислоты, которая является циклическим или линейным вектором, пригодным для экспрессии, по меньшей мере, одного целевого полипептида в клетках млекопитающих, включающая (а) по меньшей мере, одну экспрессирующую кассету (POI) для экспрессии целевого полипептида; (б) экспрессирующую кассету (MSM), включающую ген селективного маркера млекопитающих; (в) экспрессирующую кассету (MASM), включающую амплифицированный ген селективного маркера млекопитающих; причем экспрессирующая кассета (POI) фланкирована в направлении 5′ кассетой экспрессии (MASM), кассета экспрессии (MSM) локализована в направлении 3′ от кассеты экспрессии (POI) и в которой кассеты экспрессии (MASM), (POI) и (MSM) расположены в той же ориентации от 5′ к 3′.

Изобретение относится к области биотехнологии и иммунологии. Представлены: способ ингибирования роста опухолевых клеток у индивидуума и способ усиления иммунного ответа у индивидуума, включающие введение индивидууму моноклонального антитела против PD-1 и моноклонального антитела против CTLA-4 10D1.

Изобретение относится к иммунологии. .

Изобретение относится к области биотехнологии, конкретно к экспрессионным конструкциям, и может быть использовано для экспрессии иммуноглобулина. .

Изобретение относится к биотехнологии и может быть использовано для получения моноклональных антител (МКА) к V антигену Yersinia pestis. .

Изобретение относится к биотехнологии и может быть использовано для получения моноклональных антител (МКА) к V антигену Yersinia pestis. .

Изобретение относится к биотехнологии и биофармакологии и предоставляет штаммы гибридных культивируемых клеток животных Mus musculus Sp2/0-BC/rhPC-4F10, Sp2/0-BC/rhPC-1C6, Sp2/0-BC/rhPC-3H6, - продуценты моноклональных антител, специфичных к протеину С человека.

Изобретение относится к модифицированным аденилатциклазным токсинам Bordetella, которые являются дефектными в отношении связывания CD11b/CD18, и к их применению в приготовлении фармацевтической композиции для лечения коклюша и/или для защиты против инфекции Bordetella.

Изобретение относится к области ветеринарии и касается способа диагностики инфекции, вызываемой Lawsonia intracellularis. .

Изобретение относится к области генной инженерии и клонирования. .

Изобретение относится к антителу, специфически связывающемуся с вариантом PRO87299. .
Изобретение относится к области медицины и касается терапевтического средства для лечения заболеваний, родственных детским хроническим артритным заболеваниям, например, собственно детских хронических артритных заболеваний, болезни Стилла и им подобных, включающее в качестве активного ингредиента антагонист рецептора интерлейкина-6 IL-6, гуманимзированное антитело РМ-1.
Настоящее изобретение относится к области иммунологии. Предложены вариабельные домены тяжелых (VH) и легких (VL) цепей мышиного антитела против фактора некроза опухоли альфа (ФНО-α) человека, а также антигенсвязывающий фрагмент Fab, которые селективно связываются с ФНО-α человека и нейтрализуют его.
Наверх