Молекула, специфически связывающаяся с rsv



Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv
Молекула, специфически связывающаяся с rsv

 


Владельцы патента RU 2540020:

МЕДИММЬЮН ЛТД (GB)

Изобретение относится к области биотехнологии и иммунологии. Описаны антитела и их функциональные эквиваленты, способные специфически связываться с RSV. Также изобретение относится к нуклеотидным последовательностям, кодирующим указанное антитело, а также к клеткам, продуцирующим антитела, и к способам получения указанных антител. Изобретение может быть использовано в медицине. 6 н. и 17 з.п. ф-лы, 4 ил., 3 табл., 4 пр.

 

Изобретение относится к областям биологии и медицины.

Респираторный синцитиальный вирус (respiratory syncytial virus, RSV) представляет собой вирус простуды, принадлежащий к семейству парамиксовирусов. RSV вирулентен, легко передается и является наиболее распространенной причиной заболеваний нижних дыхательных путей у детей младше двух лет. За один сезон RSV инфицирует до 98% детей, посещающих детские сады. Госпитализация требуется 0,5-3,2% детей, инфицированных RSV. В США зарегистрировано примерно 90000 госпитализаций и 4500 смертей в год. Основными факторами риска госпитализации по причине RSV являются преждевременные роды, хроническое заболевание легких, врожденное заболевание сердца, сниженный иммунитет и возраст менее 6 недель у детей, не имеющих других заболеваний. Не существует эффективного лечения RSV-положительного бронхиолита, помимо поддерживающей терапии в виде адекватного питания и кислородной терапии. Эффективность противовирусных терапий, таких как рибавирин, в случае инфекции RSV показана не была. Для профилактики инфекции RSV зарегистрировано одно моноклональное антитело паливизумаб (также называемое Синагис). Паливизумаб представляет собой генетически сконструированное (гуманизированное) моноклональное антитело к слитому белку (белок F) RSV. Белок F RSV представляет собой мембранный белок вируса, отвечающий за слияние вириона с клеткой-хозяином после прикрепления. Кроме того, белок F способствует инфекции соседних клеток путем образования синцития. Считается, что его функция зависит от исходной олигомерной структуры белка. Однако паливизумаб не всегда оказывается эффективным. Таким образом, в области техники существует потребность в альтернативных и/или дополнительных антителах и терапиях против RSV.

Целью настоящего изобретения является разработка улучшенных антител против RSV или функциональных аналогов таких антител. Другой целью является разработка дополнительных антител против RSV, обеспечивающих синергический эффект в комбинации с существующими антителами, специфичными к RSV. Дальнейшей целью изобретения является разработка человеческих или гуманизированных антител или функциональных эквивалентов против белка F RSV, направленных против эпитопа, отличающегося от эпитопа, против которого направлены известные антитела, специфичные к RSV.

Таким образом, настоящее изобретение относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, способному специфически связываться с респираторным синцитиальным вирусом и содержащему:

- последовательность CDR1 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности KLSIH (SEQ ID NO: 4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GYEGEVDEIFYAQKFQH (SEQ ID NO: 8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LGVTVTEAGLGIDDY (SEQ ID NO: 12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности RASQIVSRNHLA (SEQ ID NO: 20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GASSRAT (SEQ ID NO: 24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LSSDSSI (SEQ ID NO: 28).

Настоящее изобретение относится к антителу, обозначенному "AM22", у которого последовательность тяжелой и легкой цепей представлены на фиг.2. В частности, последовательности областей CDR АМ22, определяющих антигенсвязывающие свойства АМ22, также представлены на фиг.2. Антитело АМ22 полностью человеческое, способно специфически связываться с RSV (фиг.3) и, таким образом, является предпочтительным для терапевтического и/или профилактического применения в отношении индивидов-людей.

Как указано выше, паливизумаб является единственным клинически используемым антителом против RSV. Паливизумаб представляет собой гуманизированное моноклональное антитело против эпитопа в антигенном сайте белка F RSV. Однако гуманизированные антитела все же содержат часть мышиного антитела, и хотя их иммуногенные свойства снижены по сравнению с мышиными антителами, тем не менее при введении человеку гуманизированных антител могут наблюдаться побочные эффекты. Авторам настоящего изобретения удалось получить и культивировать В-клетки человека, продуцирующие RSV-специфичные антитела, так что представленные RSV-специфичные антитела человека обладают сильно пониженной или вообще не обладают иммуногенной активностью из-за полностью человеческой последовательности. Как показано в примерах, антитела, представленные в изобретении, превосходят по своим характеристиками паливизумаб (фиг.1 и таблица 1). Авторы настоящего изобретения показали, что у хлопковых крыс (Sygmodon hispidus), получавших антитела по изобретению путем внутримышечной инъекции с последующей интраназальной нагрузкой RSV-X, наблюдался более низкий индекс патологии, чем у хлопковых крыс, получавших паливизумаб с последующей нагрузкой RSV-X (фиг.4С и таблица 2). Индекс патологии, используемый в настоящем документе, представляет собой сумму величин трех индивидуальных показателей повреждения легких. Эти три показателя представляют собой гипертрофию эпителия бронха и бронхиол, воспаление, вокруг бронхов и бронхиол (перибронхит/перибронхиолит) и воспаление в альвеолах (альвеолит). Кроме того, у хлопковых крыс, получавших внутримышечно антитела по изобретению с последующей нагрузкой RSV-X, наблюдался более низкий титр вируса, чем у хлопковых крыс, получавших паливизумаб с последующей нагрузкой RSV-X (фиг.4В). Титр вируса определяли с помощью теста TCID50 (доза, инфицирующая 50% клеточной культуры). Таким образом, по сравнению с паливизумабом, АМ22 является предпочтительным.

Помимо паливизумаба, известны еще несколько RSV-специфичных антител. В WO 2008/147196 описаны последовательности молекул, связывающих RSV, в частности антител D25, AM14, AM16 и AM23. Как подробно описано в примере 1 настоящей заявки, RSV-специфичное антитело AM22 было получено от того же донора, что и антитела D25, AM14, AM16 и AM23. Однако оказалось, что АМ22 распознает RSV более эффективно, чем все остальные антитела, полученные от того же донора. Значение IC50 для АМ22, равное 1,15 нг мл-1, ниже такового для паливизумаба, D25, AM14, AM16 или AM23. Следовательно, применение АМ22 для лечения и/или профилактики нарушения, связанного с RSV, является предпочтительным по сравнению с использованием других RSV-специфичных антител. Для достижения эффекта, сравнимого с эффектом других антител, необходимо меньшее количество АМ22. Следовательно, для лечения и/или профилактики нарушения, связанного с RSV, индивиду потребуется вводить меньшее количество АМ22. Альтернативно, при использовании того же количества АМ22, что и других антител, достигается более эффективное лечение и/или профилактика нарушения, связанного с RSV.

Далее, эпитоп, распознаваемый RSV-специфичным антителом по настоящему изобретению, отличается от эпитопов, распознаваемых ранее раскрытыми молекулами, связывающимися с RSV. АМ22, так же как и ранее описанные антитела (WO 2008/147196), способно связываться с белком F RSV (фиг.3А). Однако АМ22 не связывается с мономерным белком F RSV (фиг.3В, левая и правая панели). В отличие от АМ22, известные антитела паливизумаб и АМ16 (раскрытые в WO 2008/147196 и на фиг.3В) способны связываться с мономерной формой белка F. Следует отметить, что В-клетки линии АМ22, экспрессирующие антиген-специфический В-клеточный рецептор (BCR), не распознают рекомбинантную форму белка F (фиг.3С). Таким образом, эпитоп белка F для АМ22 отличается от эпитопов для паливизумаба, D25, AM23 и АМ16. При экспрессии белка F в векторе, содержащем мотив тримеризации "изолейциновой молнии" и 8 HIS-тагов (ILZ-8xHIS), АМ22 распознавало эту структуру, зависимую от тримерной конформации (фиг.3D). В то же время, АМ14 не распознавало ни мономерную форму белка F, ни белок ILZ-8xHIS. Таким образом, эпитоп, с которым связывается АМ22, отличается и от эпитопа, с которым связывается АМ14. Было также обнаружено, что АМ22 не нарушало связывания D25 или паливизумаба с клетками Hep2, инфицированными RSV. Таким образом, эпитоп белка F, с которым связывается АМ22, отличается от эпитопов, с которыми связываются D25, AM14, AM16, AM23 и паливизумаб. Следовательно, предпочтительно, комбинировать RSV-специфичные антитела или их функциональные эквиваленты по настоящему изобретению с уже известными RSV-специфичными антителами, такими как паливизумаб, D25, AM14, AM16 и AM23. При комбинировании антитела по настоящему изобретению с известным RSV-специфичным антителом в одной и той же схеме терапии распознаются два или более различных эпитопов RSV. В таком случае, возможно получить более сильный иммуногенный ответ на RSV. Далее, при комбинировании одного из известных RSV-специфичных антител с антителом АМ22 по изобретению можно добиться более высокой специфичности антител против RSV. При использовании такой комбинации, способной вызывать более сильный иммуногенный ответ и обладающей повышенной специфичностью к RSV, терапия и/или профилактика нарушения, связанного с RSV, будет более эффективной. Наконец, потребуется более низкая общая дозировка антител, поскольку АМ22 обладает повышенной способностью связываться с белком F по сравнению с паливизумабом, D25, AM14, AM16 и AM23, о чем свидетельствует его низкое значение IC50, равное примерно 1,15 нг/мл.

Таким образом, в одном варианте осуществления представлены антитело или его функциональный эквивалент по изобретению, чье значение IC50 составляет менее 1,25 нг/мл по данным теста нейтрализации in vitro, в котором клетки HEp-2 инфицируют вирусом RSV-A2. Предпочтительно, если значение IC50 для указанного антитела или функционального эквивалента составляет менее 1,2 нг/мл, предпочтительно, от 0,5 нг/мл до 1,2 нг/мл. Кроме того, предпочтительно, если значение IC50 для антитела или функционального эквивалента по изобретению ниже по меньшей мере в 120 раз, более предпочтительно, ниже по меньшей мере в 130 раз, чем значение IC50 для паливизумаба по данным теста нейтрализации in vitro, в котором клетки HEp-2 инфицируют вирусом RSV-A2. Предпочтительно, если значение IC50 для указанного антитела или функционального эквивалента составляет примерно 1,15 нг/мл. Таким образом, использование RSV-специфичного антитела или его функционального эквивалента по настоящему изобретению в комбинации с по меньшей мере одним доступным RSV-специфичным антителом приводит к более эффективному лечению и/или профилактике нарушения, связанного с RSV.

Функциональным эквивалентом антитела в настоящем документе называется функциональная часть, производное или аналог антитела. Функциональный эквивалент антитела, предпочтительно, представляет собой искусственное связывающее соединение, содержащее по меньшей мере одну последовательность CDR антитела.

Функциональной частью антитела называется часть, обладающая по меньшей мере одним таким же свойством, что и указанное антитело, качественно, но не обязательно количественно. Указанная функциональная часть способна связываться с тем же антигеном, что и указанное антитело, но не обязательно также сильно. Предпочтительно, если функциональная часть антитела содержит однодоменное антитело, одноцепочечное антитело, одноцепочечный вариабельный фрагмент (scFv), Fab-фрагмент или F(ab')2-фрагмент.

Функциональным производным антитела называется антитело, измененное так, что по меньшей мере одно свойство - предпочтительно, антигенсвязывающее свойство - полученного соединения практически не меняется качественно, но не обязательно количественно. Производное можно получить различными способами, например, путем замены консервативных аминокислот, при которой аминокислотный остаток заменяют на другой остаток со сходными свойствами (размер, гидрофобность и др.) таким образом, что функционирование в целом не претерпевает значительных изменений.

Специалист в области техники может получить различные аналоги антитела, например, с использованием библиотеки пептидов или фагового дисплея. Такой аналог обладает по меньшей мере одним таким же свойством, как и указанное антитело, качественно, не необязательно количественно.

Антитело по изобретению, предпочтительно, представляет собой антитело человека. При использовании антител человека для профилактики и лечения человека снижается вероятность побочных эффектов из-за иммунологической реакции у индивида-человека на последовательности, не являющиеся человеческими. В другом варианте осуществления антитело, функциональная часть, производное или аналог по изобретению представляет собой гуманизированное антитело. Гуманизированные антитела получают путем введения гипервариабельных доменов, не являющихся доменами человека, в антитела человека, что уменьшает иммуногенные свойства полученных антител по сравнению с антителами, которые являются полностью не человеческими. В другом предпочтительном варианте осуществления антитело или функциональная часть, производное или аналог по изобретению представляет собой химерное антитело. Таким образом, искомые последовательности, например, искомый сайт связывания, может быть введен в антитело или функциональный эквивалент по изобретению.

Специалисту в области техники хорошо известно, что тяжелая цепь антитела представляет собой большую из двух видов цепей, составляющих молекулу иммуноглобулина. Тяжелая цепь содержит константные домены, а также вариабельный домен, который участвует в связывании с антигеном. Легкая цепь антитела представляет собой меньшую из двух видов цепей, составляющих молекулу иммуноглобулина. Легкая цепь содержит константный домен и вариабельный домен. Вариабельный домен вместе с вариабельным доменом тяжелой цепи участвует в связывании с антигеном.

Области, определяющие комплементарность (CDR), представляют собой гипервариабельные области, присутствующие в вариабельных доменах тяжелых цепей и легких цепей. Области CDR тяжелой цепи и связанной с ней легкой цепи антитела вместе образуют сайт связывания антигена.

Поскольку в настоящем изобретении дано представление о том, что последовательности CDR, приведенные на фиг.2, определяют желаемые характеристики связывания, для специалиста не представляет трудности сконструировать варианты, содержащие по меньшей мере одну измененную последовательность CDR. Например, используется замена консервативных аминокислот. Также можно изменить по меньшей мере одну последовательность CDR, приведенную на фиг.2, для получения варианта антитела или его функционального эквивалента, по меньшей мере одно свойство которого будет отличаться от такового у АМ22. Предпочтительно, у полученного антитела или функционального эквивалента, содержащего последовательность CDR, которая по меньшей мере на 70% идентична последовательности CDR, приведенной на фиг.2 положительные характеристики связывания АМ22 отчасти сохраняются или даже улучшаются. Последовательность CDR, приведенную на фиг.2, предпочтительно, изменяют так, чтобы полученное антитело или функциональный эквивалент обладал по меньшей мере одним улучшенным свойством, например, повышенной стабильностью и/или сродством связывания по сравнению с АМ22. Предпочтительно, специфичность связывания сохраняется (качественно, не обязательно количественно). Таким образом, настоящее изобретение относится к вариантам антитела или их функциональным фрагментам, содержащим аминокислотную последовательность, которая по меньшей мере на 70% идентична последовательности CDR, приведенной на фиг.2. Из уровня техники известны различные способы изменения аминокислотной последовательности. Например, можно искусственно синтезировать последовательность тяжелой цепи или легкой цепи с желаемой последовательностью CDR. Предпочтительно, нуклеотидная последовательность, кодирующая последовательность CDR, содержит мутации, например, в результате случайного или сайт-специфического мутагенеза.

Для определения эффективности профилактических, терапевтических, диагностических и исследовательских способов, включающих использование антител к RSV по настоящему изобретению, предпочтительно, используют измерение константы сродства и специфичности связывания антигена и антитела. "Сродство связывания" в общем случае означает суммарную силу нековалентных взаимодействий между одним сайтом связывания молекулы (например, антителом) и его партнером (например, антигеном). Если не указано иначе, в настоящем документе "сродство связывания" означает внутреннее сродство связывания, относящееся к взаимодействию 1:1 членов пары связывания (например, антитела и антигена). Это сродство может быть в общем представлено константой равновесной диссоциации (Kd), которая равна отношению koff/kon (см., например, Chen, Y. et al., (1999) J. Mol Biol 293:865-881). Сродство можно измерить способами, известными из уровня техники, таких как, например, способ поверхностного плазмонного резонанса (SPR), с помощью инструмента BiaCore или IBIS-iSPR в IBIS Techonologies BV (Hengelo, the Netherlands) или жидкофазным способом, таким как Kinexa.

Согласно предпочтительным вариантам осуществления, антитела к RSV по изобретению обладают сродством связывания с эпитопом в составе белка F RSV, имеющем константы диссоциации (Kd) ниже 1×10-2 М, 1×10-3 М, 1×10-4 М, 1×10-5 М, 1×10-6 М, 1×10-7 М, 1×10-8 М, 1×10-9 М, 1×10-10 М, 1×10-11 М, 1×10-12 М, 1×10-13 М, 1×10-14 М или ниже 1×10-15 М. В одном варианте осуществления антитела к RSV имеют Kd ниже 10-7 М, ниже 5×10-8 М, ниже 10-8 М, ниже 5×10-9 М, ниже 10-9 М, ниже 5×10-10 М, ниже 10-10 М, ниже 5×10-11 М, ниже 10-11 М, ниже 5×10-12 М, ниже 10-12 М, ниже 5х10-13 М, ниже 10-13 М, ниже 5×10-14 М, ниже 10-14 М, ниже 5×10-15 М или ниже 10-15 М.

Настоящее изобретение также относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, содержащему:

- последовательность CDR1 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности KLSIH (SEQ ID NO:4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности RASQIVSRNHLA (SEQ ID NO:20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GASSRAT (SEQ ID NO:24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LSSDSSI (SEQ ID NO:28).

Предпочтительно, антитело или функциональный эквивалент по изобретению содержит последовательность CDR, которая по меньшей мере на 75%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90% идентична по меньшей мере одной из последовательностей CDR, приведенных на фиг.2. Наиболее предпочтительно, антитело или функциональный эквивалент по изобретению содержит последовательность CDR, которая по меньшей мере на 95% идентична по меньшей мере одной из последовательностей CDR, приведенных на фиг.2. В особенности предпочтительное антитело АМ22, описанное выше, содержит последовательности CDR, состоящие из последовательностей CDR, приведенных на фиг.2. Таким образом, в особенно предпочтительном варианте осуществления по изобретению представлено выделенное, синтетическое или рекомбинатное антитело или его функциональный фрагмент, способное специфически связываться с RSV и которое содержит:

- последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

В одном варианте осуществления изобретение относится к антителу или функциональному эквиваленту, содержащему последовательности тяжелой цепи CDR1 и CDR2 и последовательности легкой цепи CDR1 и CDR2, приведенные на фиг.2, или последовательности, которые по меньшей мере на 70%, предпочтительно, по меньшей мере на 75%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85% идентичны им. Кроме того, изобретение относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, содержащему последовательность тяжелой цепи CDR1, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности KLSIH (SEQ ID NO:4), последовательность CDR2 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GYEGEVDEIFYAQKFQH (SEQ ID NO:8), последовательность CDR1 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности RASQIVSRNHLA (SEQ ID NO:20), и последовательность CDR2 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности GASSRAT (SEQ ID NO:24). Предпочтительно, указанное антитело или функциональный эквивалент содержит последовательности CDR, которые по меньшей мере на 75%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90%, наиболее предпочтительно, по меньшей мере на 95% идентичны вышеуказанным последовательностям CDR тяжелых и легких цепей. Предпочтительно, указанное антитело или функциональный эквивалент также содержит последовательность CDR3 тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или последовательность CDR3 легкой цепи, содержащую последовательность, которая по меньшей мере на 70% идентична последовательности LSSDSSI (SEQ ID NO:28). Также изобретение относится к антителу или функциональному эквиваленту, содержащему вышеупомянутые последовательности CDR1, CDR2 и CDR3 тяжелой цепи, а также вышеупомянутые последовательности CDR1, CDR2 и CDR3 легкой цепи.

Необязательно, по меньшей мере одна из указанных последовательностей CDR человека может быть оптимизирована, предпочтительно, для повышения эффективности связывания или стабильности. Например, для этого можно использовать мутагенез с последующим предпочтительным анализом стабильности и/или эффективности связывания полученных соединений и выбором улучшенного антитела или функционального эквивалента.

Помимо оптимизирования последовательностей CDR, также может быть полезно оптимизировать по меньшей мере одну последовательность в по меньшей мере одной каркасной области. Это делается, как правило, для повышения эффективности связывания или стабильности. Например, последовательности каркасных областей оптимизируют путем мутирования молекулы нуклеиновой кислоты, кодирующей такую последовательность каркасных областей с последующим предпочтительным анализом свойств полученного антитела или функциональной части, что дает возможность получить улучшенные антитела или функциональные части. Таким образом, изобретение также относится к выделенным, синтетическим или рекомбинантным антителам или их функциональным частям, производным и/или аналогам, содержащим аминокислотную последовательность тяжелой цепи, которая по меньшей мере на 70% идентична последовательности тяжелой цепи, приведенной на фиг.2. Такая последовательность тяжелой цепи придает желаемые свойства связывания, как видно для антитела АМ22. Кроме того, аминокислотные последовательности легких цепей, которые по меньшей мере на 70% идентичны последовательностям легких цепей, приведенным на фиг.2, также придают желаемые свойства связывания, как видно для антитела АМ22. Таким образом, далее изобретение относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу по изобретению, последовательность тяжелой цепи которого содержит последовательность, которая по меньшей мере на 70% идентична последовательности QVQLVQSGAEVKKPGATVKVSCKISGHTLIKLSIHWVRQAPGKGLEWMGGYEGEVDEIFYAQKFQHRLTVIADTATDTVYMELGRLTSDDTAVYFCGTLGVTVTEAGLGIDDYWGQGTLVTVSS (SEQ ID NO:16), и/или последовательность легкой цепи которого по меньшей мере на 70% идентична последовательности EIVLTQSPGTLSLSPGERATLSCRASQIVSRNHLAWYQQKPGQAPRLLIFGASSRATGIPVRFSGSGSGTDFTLTINGLAPEDFAVYYCLSSDSSIFTFGPGTKVDFK (SEQ ID NO:32).

Выделенное, синтетическое или рекомбинантное антитело или его функциональная часть, производное и/или аналог по изобретению, предпочтительно, содержит последовательность тяжелой цепи и/или последовательность легкой цепи, которые по меньшей мере на 75%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90%, наиболее предпочтительно, по меньшей мере на 95% идентичны последовательности тяжелой цепи и/или последовательности легкой цепи, приведенным на фиг.2. Чем больше степень гомологии, тем ближе указанное антитело или функциональный эквивалент к антителу АМ22. Выделенное, синтетическое или рекомбинантное антитело или его функциональная часть, производное или аналог по изобретению, предпочтительно, содержит как тяжелую, так и легкую цепи, близкие к тяжелой и легкой цепи АМ22. Таким образом, далее представлено выделенное, синтетическое или рекомбинантное антитело или его функциональная часть, производное и/или аналог, содержащее последовательность тяжелой цепи и последовательность легкой цепи, которые по меньшей мере на 70%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90%, наиболее предпочтительно, по меньшей мере на 95% идентичны последовательности тяжелой цепи и последовательности легкой цепи, соответственно, представленным на фиг.2. В одном варианте осуществления представлено антитело или функциональный эквивалент, последовательность тяжелой цепи которого приведена на фиг.2 и последовательность легкой цепи которого приведена на фиг.2.

В одном варианте осуществления изобретение относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, содержащему последовательность тяжелой цепи, состоящую из последовательности тяжелой цепи, приведенной на фиг.2, и/или содержащему последовательность легкой цепи, состоящую из последовательности легкой цепи, приведенной на фиг.2. Альтернативно, специалисту в области техники хорошо известно, что возможно сконструировать укороченную последовательность тяжелой цепи или легкой цепи с аналогичным искомым свойством связывания. Предпочтительно, конструируют укороченную тяжелую цепь или легкую цепь, у которой укорочена константная область по сравнению с исходной тяжелой или легкой цепью. Предпочтительно, вариабельный домен сохраняется. Например, получают Fab-фрагмент или F(ab')2-фрагмент, или однодоменное антитело, или одноцепочечное антитело, или нанотело, или "unibody", или фрагмент scFv на основе последовательности тяжелой цепи или последовательности легкой цепи, приведенной на фиг.2. Таким образом, также представлена функциональная часть антитела, содержащая по меньшей мере функциональную часть последовательности, приведенной на фиг.2. Указанная функциональная часть имеет длину не менее 20 аминокислот и содержит по меньшей мере одну последовательность, выбираемую из группы, состоящей из последовательности, которая по меньшей мере на 70% идентична последовательности CDR1 тяжелой цепи, приведенной на фиг.2, последовательности, которая по меньшей мере на 70% идентична последовательности CDR2 тяжелой цепи, приведенной на фиг.2, последовательности, которая по меньшей мере на 70% идентична последовательности CDR3 тяжелой цепи, приведенной на фиг.2, последовательности, которая по меньшей мере на 70% идентична последовательности CDR1 легкой цепи, приведенной на фиг.2, последовательности, которая по меньшей мере на 70% идентична последовательности CDR2 легкой цепи, приведенной на фиг.2, последовательности, которая по меньшей мере на 70% идентична последовательности CDR3 легкой цепи, приведенной на фиг.2.

Как указано ранее, антитела и функциональные эквиваленты по настоящему изобретению распознают уникальный эпитоп тримера белка F RSV. Таким образом, представлены антитела и функциональные эквиваленты, специфически распознающие этот эпитоп. Антитела и их функциональные эквиваленты, специфически распознающие указанный уникальный эпитоп, предпочтительно, комбинируют с известными RSV-специфичными антителами, такими как паливизумаб, D25, АМ14, АМ16 и АМ23. При сочетании антитела или его функционального эквивалента по изобретению, специфически распознающего указанный уникальный эпитоп, с известным RSV-специфическим антителом, в ходе одной и той же терапии распознаются два или более различных эпитопов RSV. Это позволяет получить более сильный иммунный ответ на RSV и/или повышенную специфичность антител к RSV. Такая комбинация, приводящая к более сильному иммуногенному ответу и повышенной специфичности против RSV, позволяет достигнуть более эффективного лечения и/или профилактики нарушения, связанного с RSV.

Таким образом, изобретение относится к выделенному, синтетическому или рекомбинатному антителу или его функциональной части, производному и/или аналогу, способному специфически связываться с эпитопом, распознаваемым антителом, которое содержит:

- последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

В особенно предпочтительном варианте осуществления изобретение относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, способному специфически связываться с эпитопом, распознаваемым антителом АМ22, которое содержит:

- последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), и

- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и

- последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), и

- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), и

- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и

- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

В другом варианте осуществления изобретения рассматривают определенные модификации константной области (Fc), влияющие на эффекторную функцию. Например, увеличивают время полужизни в сыворотке белков, содержащих область Fc, путем повышения сродства связывания области Fc с FcRn. Термин "время полужизни антитела", употребляемый в настоящем документе, означает факмакокинетическое свойство антитела, измеряемое как среднее время выживаемости молекул антитела после введения. Время полужизни антитела может выражаться в виде времени, требуемого для выведения 50% известного количества иммуноглобулина из организма пациента (или другого млекопитающего) или из его определенного отдела, например, при измерении концентрации антител в сыворотке, т.е. время полужизни в кровотоке, или в других тканях. Время полужизни может варьировать от одного иммуноглобулина или класса иммуноглобулинов к другому. В целом, увеличение времени полужизни антитела приводит к увеличению среднего времени пребывания (mean residence time, MRT) в кровотоке для введенного антитела.

Увеличение времени полужизни позволяет уменьшить количество лекарственного средства, вводимого пациенту, а также понизить частоту введения. Для увеличения времени полужизни антитела по изобретению в сыворотке, можно ввести в антитело эпитоп, связывающийся с рецептором спасения (salvage receptor), как описано, например, в Патенте США № 5739277. Употребляемый в настоящем документе термин "эпитоп, связывающийся с рецептором спасения" означает эпитоп в области Fc молекулы IgG (например, IgG1, IgG2, IgG3 или IgG4), отвечающий за увеличения времени полужизни в сыворотке молекулы IgG. Альтернативно, антитела по изобретению с увеличенным временем полужизни можно получить с помощью модификации аминокислотных остатков, участвующих во взаимодействии Fc с рецептором FcRn (см., например, Патенты США №№ 6821505 и 7083784). Кроме того, время полужизни антител по изобретению можно увеличить путем конъюгирования с PEG или альбумином с помощью способов, широко применяемых в уровне техники. В некоторых вариантах осуществления время полужизни антител, содержащих варианты области Fc по изобретению, больше на примерно 5%, примерно 10%, примерно 15%, примерно 20%, примерно 25%, примерно 30%, примерно 35%, примерно 40%, примерно 45%, примерно 50%, примерно 60%, примерно 65%, примерно 70%, примерно 80%, примерно 85%, примерно 90%, примерно 95%, примерно 100%, примерно 125%, примерно 150% или более по сравнению с антителом, содержащим нативную область Fc. В некоторых вариантах осуществления время полужизни антител, содержащих варианты области Fc, больше примерно в 2 раза, примерно в 3 раза, примерно в 4 раза, примерно в 5 раз, примерно в 10 раз, примерно в 20 раз, примерно в 50 или более раз или в 2-10 раз, или в 5-25 раз, или в 15-50 раз по сравнению с антителом, содержащим нативную область Fc. Таким образом, изобретение относится к антителу, функциональной части, производному или аналогу по изобретению, содержащему эпитоп, связывающийся с рецептором спасения, и/или модифицированные остатки аминокислот, участвующие во взаимодействии Fc с рецептором FcRN, и/или аминокислотные остатки не природного происхождения. В другом предпочтительном варианте осуществления представлено антитело или функциональный эквивалент по изобретению, конъюгированное с PEG или альбумином.

В одном варианте осуществления настоящее изобретение относится к вариантам Fc по изобретению, где область Fc содержит модификацию (например, замену аминокислоты, вставку аминокислоты, делецию аминокислоты) в одном или более положениях, выбираемых из группы, состоящей из 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 247, 251, 252, 254, 255, 256, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 313, 316, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 339, 341, 343, 370, 373, 378, 392, 416, 419, 421, 440 и 443 согласно индексу EU, введенному в Kabat et al. (J Immunol. 1991; 147(5):1709-19). Область Fc необязательно содержит аминокислотные остатки не природного происхождения в дополнительных и/или альтернативных положениях, известных специалисту в области техники (см., например, 5624821; 6277375; 6737056; 7083784; 7317091; 7217797; 7276585; 7355008; 2002/0147311; 2004/0002587; 2005/0215768; 2007/0135620; 2007/0224188; 2008/0089892; WO 94/29351 и WO 99/58572).

В определенном варианте осуществления настоящее изобретение относится к антителу с вариантом Fc по изобретению, где область Fc содержит по меньшей мере одну аминокислоту не природного происхождения в одном или более положениях, выбираемых из группы, состоящей из 252, 254 и 256. В одном варианте осуществления аминокислоты не природного происхождения выбирают из группы, состоящей из 252Y, 254T и 256E.

Настоящее изобретение относится к антителам, специфичным к RSV, и их функциональным фрагментам с улучшенными свойствами по сравнению с антителами, известными из уровня техники. Авторам изобретения удалось получить антитела, специфичные к RSV, с наименьшим значением IC50, известным на сегодняшний день. Такие антитела обладают особенно высоким или сильным сродством к RSV и таким образом особенно полезны для противодействия и/или по меньшей мере частичного предотвращения инфекции RSV и/или неблагоприятных последствий инфекции RSV. Таким образом, в одном варианте осуществления представлено антитело со значением IC50 менее 1,25 нг/мл, предпочтительно, менее 1,2 нг/мл, более предпочтительно, менее 1,19 нг/мл, более предпочтительно, менее 1,18 нг/мл и, наиболее предпочтительно, от 1,1 до 1,17 нг/мл по данным теста нейтрализации in vitro, описанного в примерах (см. фигуру 1).

Изобретение, кроме того, относится к выделенной, синтетической или рекомбинантной нуклеотидной последовательности или ее функциональному эквиваленту, длина которого составляет по меньшей мере 15 нуклеотидов, предпочтительно, по меньшей мере 30 нуклеотидов, более предпочтительно, по меньшей мере 50 нуклеотидов, более предпочтительно, по меньшей мере 75 нуклеотидов, кодирующие по меньшей мере антигенсвязывающую часть антитела или функционального антитела по изобретению. Такую нуклеиновую кислоту, например, выделяют из В-клеток, способных продуцировать антитело по изобретению. В предпочтительном варианте осуществления представлена нуклеотидная последовательность, содержащая последовательность, которая по меньшей мере на 70% идентична по меньшей мере 15 нуклеотидам нуклеотидной последовательности, приведенной на фиг.2. Нуклеотидная последовательность по изобретению, предпочтительно, содержит последовательность, которая по меньшей мере на 75%, более предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90%, более предпочтительно, по меньшей мере на 95% идентична по меньшей мере 15 нуклеотидам нуклеотидной последовательности, приведенной на фиг.2. Предпочтительно, указанная нуклеотидная последовательность, приведенная на фиг.2, содержит по меньшей мере одну последовательность, кодирующую CDR.

В одном из предпочтительных вариантов осуществления изобретения представлена выделенная, синтетическая или рекомбинантная нуклеотидная последовательность, которая имеет длину по меньшей мере 15 нуклеотидов, или ее функциональный эквивалент, кодирующая по меньшей мере одну последовательность CDR антитела или функционального эквивалента по изобретению. Указанная нуклеотидная последовательность, предпочтительно, кодирует по меньшей мере одну последовательность CDR, которая по меньшей мере на 70% идентична области CDR антитела АМ22. Нуклеотидные последовательности, кодирующие области CDR АМ22, приведены на фиг.2. Кроме того, изобретение относится к выделенной, синтетической или рекомбинантной нуклеотидной последовательности или ее функциональному эквиваленту, содержащей последовательность, которая по меньшей мере на 70% идентична последовательности, выбираемой из группы, состоящей из aaattatccattcac (SEQ ID NO:3), ggttatgagggtgaggtcgatgagattttctacgcacagaagttccagcac (SEQ ID NO:7), ctaggtgtgacagtgactgaggctggactggggatcgatgactac (SEQ ID NO:11), agggccagtcagattgttagcaggaaccacttagcc (SEQ ID NO:19), ggtgcgtccagtcgggccact (SEQ ID NO:23) и ctgtcctctgattcctccata (SEQ ID NO:27).

Указанная нуклеотидная последовательность или функциональный эквивалент, предпочтительно, содержит последовательность, которая по меньшей мере на 75%, предпочтительно, по меньшей мере на 80%, более предпочтительно, по меньшей мере на 85%, более предпочтительно, по меньшей мере на 90% идентична любой из вышеупомянутых нуклеотидных последовательностей. Далее изобретение относится к нуклеотидной последовательности или ее функциональному эквиваленту, содержащей последовательность, которая по меньшей мере на 70% идентична по меньшей мере части нуклеотидной последовательности, приведенной на фиг.2, где указанная часть имеет длину по меньшей мере 15 нуклеотидов и кодирует по меньшей мере одну область CDR, приведенную на фиг.2.

Нуклеотидная последовательность или ее функциональный эквивалент по настоящему изобретению, предпочтительно, кодирует область, которая по меньшей мере на 70% идентична области CDR АМ22, тяжелой цепи АМ22 и/или легкой цепи АМ22. Таким образом, в одном варианте осуществления изобретение относится к выделенной, синтетической или рекомбинантной нуклеотидной последовательности или ее функциональному эквиваленту, содержащей последовательность, кодирующую аминокислотную последовательность, которая по меньшей мере на 70% идентична последовательности KLSIH (SEQ ID NO:4), и/или которая по меньшей мере на 70% идентична последовательности GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или которая по меньшей мере на 70% идентична последовательности LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или которая по меньшей мере на 70% идентична последовательности RASQIVSRNHLA (SEQ ID NO:20), и/или которая по меньшей мере на 70% идентична последовательности GASSRAT (SEQ ID NO:24), и/или которая по меньшей мере на 70% идентична последовательности LSSDSSI (SEQ ID NO:28), и/или которая по меньшей мере на 70% идентична последовательности QVQLVQSGAEVKKPGATVKVSCKISGHTLIKLSIHWVRQAPGKGLEWMGGYEGEVDEIFYAQKFQHRLTVIADTATDTVYMELGRLTSDDTAVYFCGTLGVTVTEAGLGIDDYWGQGTLVTVSS (SEQ ID NO:16) и/или которая по меньшей мере на 70% идентична последовательности EIVLTQSPGTLSLSPGERATLSCRASQIVSRNHLAWYQQKPGQAPRLLIFGASSRATGIPVRFSGSGSGTDFTLTINGLAPEDFAVYYCLSSDSSIFTFGPGTKVDFK (SEQ ID NO:32).

Как указано выше, антитело или функциональный эквивалент по изобретению способны распознавать уникальный эпитоп, присутствующий на тримерных белках F RSV. Таким образом, нуклеотидная последовательность по изобретению, предпочтительно, кодирует последовательность CDR, способную связываться с этим уникальным эпитопом. Также изобретение относится к выделенной, синтетической или рекомбинантной нуклеотидной последовательности или ее функциональному эквиваленту, кодирующей по меньшей мере одну последовательность CDR, способную специфически связываться с эпитопом, распознаваемым антителом, которое содержит:

- последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

Предпочтительно, указанная нуклеотидная последовательность кодирует целое антитело или функциональный эквивалент (например, содержащий тяжелую цепь или легкую цепь) по изобретению. Таким образом, ниже представлена выделенная, синтетическая или рекомбинантная нуклеотидная последовательность или ее функциональный эквивалент, кодирующая антитело или его функциональный эквивалент, способное специфически связываться с эпитопом, распознаваемым антителом, которое содержит:

- последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), и/или

- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), и/или

- последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), и/или

- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), и/или

- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и/или

- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

В одном из вариантов осуществления изобретения нуклеотидная последовательность или функциональный эквивалент кодирует антитело или его функциональную часть, производное и/или аналог, способное специфически связываться с эпитопом, распознаваемым антителом АМ22, которое содержит последовательность CDR1 тяжелой цепи, содержащую последовательность KLSIH (SEQ ID NO:4), последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH (SEQ ID NO:8), последовательность CDR3 тяжелой цепи, содержащую последовательность LGVTVTEAGLGIDDY (SEQ ID NO:12), последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA (SEQ ID NO:20), последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT (SEQ ID NO:24), и последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI (SEQ ID NO:28).

Нуклеотидная последовательность или функциональный эквивалент по изобретению, предпочтительно, кодирует антитело или его функциональный эквивалент с константой диссоциации (Kd), ниже 1×10-2 М, 1×10-3 М, 1×10-4 М, 1×10-5 М, 1×10-6 М, 1×10-7 М, 1×10-8 М, 1×10-9 М, 1×10-10 М, 1×10-11 М, 1×10-12 М, 1×10-13 М, 1×10-14 М или ниже 1×10-15 М.

Далее представлен вектор, содержащий нуклеотидную последовательность по изобретению. Такой вектор можно применять различными способами. Например, вектор по изобретению, содержащий терапевтически полезную нуклеотидную последовательность, пригоден для использования в профилактических или терапевтических целях. Введение такого вектора нуждающемуся индивиду приводит к экспрессии указанной профилактической или терапевтической нуклеотидной последовательности in vivo. Указанный вектор также можно применять для экспрессии in vitro искомой нуклеотидной последовательности, например, для (коммерческой) продукции антител или функциональных эквивалентов по изобретению. Способы конструирования вектора с нуклеотидной последовательностью по изобретению хорошо известны из уровня техники. Неограничивающие примеры векторов, пригодных для получения вектора по изобретению, включают ретровирусные и лентивирусные векторы.

Употребляемый в настоящем документе термин "% идентичности" означает процент остатков в аминокислотной последовательности-кандидате или нуклеотидной последовательности-кандидате, идентичных остаткам эталонной последовательности после выравнивания этих двух последовательностей и введения промежутков, если таковые необходимы, для достижения максимальной степени идентичности. Способы и компьютерные программы для выравнивания хорошо известны из уровня техники.

При употреблении в настоящем документе, молекула нуклеиновой кислоты или нуклеотидная последовательность, предпочтительно, содержит цепочку нуклеотидов, более предпочтительно, ДНК и/или РНК. В других вариантах осуществления молекула нуклеиновой кислоты или нуклеотидная последовательность по изобретению содержит другие типы нуклеотидных структур, такие как, например, спираль ДНК/РНК, пептидная нуклеиновая кислота (PNA), блокированная нуклеиновая кислота (locked nucleic acid, LNA) и/или рибозим. Указанные другие типы нуклеотидных структур называются функциональными эквивалентами нуклеотидной последовательности. Термин "функциональный эквивалент нуклеотидной последовательности" также включает цепочку, содержащую нуклеотиды не природного происхождения, модифицированные нуклеотиды и/или ненуклеотидные строительные элементы, обладающие теми же функциями, что и природные нуклеотиды.

Нуклеотидная последовательность или вектор по настоящему изобретению в особенности пригодны для конструирования антител или функциональных эквивалентов, специфичных к RSV. Это достигается, например, путем введения такой нуклеотидной последовательности или вектора в клетки таким образом, что клеточная система трансляции нуклеиновых кислот будет продуцировать закодированное антитело или функциональный эквивалент. В одном варианте осуществления нуклеотидная последовательность или вектор, кодирующая тяжелую и/или легкую цепь по изобретению, экспрессируется в так называемых продуцирующих клетках, таких как, например, линия клеток яичников китайского хомячка (CHO), NSO (миелома мыши) или 293(T), некоторые из которых адаптированы для коммерческого производства антител. Пролиферация указанных продуцирующих клеток приводит к получению продуцирующей клеточной линии, способной продуцировать антитела или их функциональные эквиваленты по настоящему изобретению. Предпочтительно, указанная продуцирующая клеточная линия пригодна для продуцирования антител для использования у человека. Таким образом, указанная продуцирующая клеточная линия, предпочтительно, не содержит патогенных агентов, таких как патогенные микроорганизмы. Наиболее предпочтительно, антитела или функциональные эквиваленты, состоящие из последовательностей человека, получают с использованием по меньшей мере одной нуклеотидной последовательности или вектора по изобретению.

Таким образом, изобретение также относится к клеточной линии, продуцирующей выделенное или рекомбинантное антитело, способной продуцировать антитело или его функциональную часть, производное и/или аналог по изобретению, а также к способу получения выделенного, синтетического или рекомбинантного антитела или его функциональной части, производного и/или аналога по изобретению, включающему получение клетки с нуклеотидной последовательностью или вектором по изобретению и трансляции указанной клеткой указанных нуклеотидной последовательности или вектора и, следовательно, продукции указанного антитела или его функциональной части, производного и/или аналога.

Клеткой, продуцирующей антитело, в настоящем документе называется клетка, способная продуцировать и/или секретировать антитело или его функциональный эквивалент, и/или способная превращаться в клетку, способную продуцировать и/или секретировать антитело или его функциональный эквивалент. Клетка, продуцирующая антитело, по изобретению представляет собой продуцирующую клетку, адаптированную для коммерческого производства антитела. Предпочтительно, если указанная продуцирующая клетка пригодна для продуцирования антител для использования у человека.

Способ по изобретению дополнительно, предпочтительно, включает стадию сбора, очистки и/или выделения указанного антитела, или его функциональной части, производного и/или аналога по изобретению. Полученные антитела или функциональные эквиваленты по изобретению, предпочтительно, используются для терапии человека, необязательно после дополнительных стадий очистки, выделения или обработки.

После представления улучшенных антител, специфичных к респираторному синцитиальному вирусу, или их функциональных эквивалентов по настоящему изобретению и кодирующих их нуклеотидных последовательностей и векторов, включая антитела человека или функциональные эквиваленты, стали доступны улучшенные профилактические и/или терапевтические применения. Антитело или функциональный эквивалент по изобретению противодействует RSV. Таким образом, антитело или функциональный эквивалент по изобретению в особенности пригодны для применения в качестве лекарственного или профилактического средства, необязательно в комбинации с по меньшей мере одним другим антителом, специфичным к RSV, известным из уровня техники. Предпочтительно, используются антитела или функциональные эквиваленты, состоящие из последовательностей человека или содержащие не более 5% последовательностей, не являющихся человеческими, для уменьшения вероятности побочных эффектов при лечении индивидов-людей. Таким образом, в настоящей заявке представлено выделенное, синтетическое или рекомбинантное антитело или его функциональная часть, производное и/или аналог, или нуклеотидная последовательность или ее функциональный эквивалент, или вектор, или клетка по настоящему изобретению, для применения в качестве лекарственного или профилактического средства. При введении нуклеиновой кислоты, или функционального эквивалента, или вектора по изобретению в результате их трансляции in situ получается антитело или функциональный эквивалент по изобретению. В особенно предпочтительном варианте осуществления указанное антитело содержит антитело АМ22 или его функциональный эквивалент. Указанное лекарственное или профилактическое средство, предпочтительно, используется для противодействия или по меньшей мере частичного предотвращения инфекции RSV. Таким образом, изобретение также относится к выделенному, синтетическому или рекомбинантному антителу или его функциональной части, производному и/или аналогу, или нуклеотидной последовательности или ее функциональному эквиваленту, или вектору, или клетке по настоящему изобретению для применения в качестве лекарственного и/или профилактического средства для по меньшей мере частичного лечения и/или профилактики нарушения, связанного с RSV. Лекарственное средство, содержащее АМ22 в комбинации с по меньшей мере одним другим RSV-специфичным агентом, предпочтительно, антителом, известным из уровня техники, особенно полезно, поскольку такая комбинация позволяет добиться более сильного иммуногенного ответа на RSV и/или большей специфичности антител к RSV. Таким образом, изобретение также относится к комбинации выделенного, синтетического или рекомбинантного антитела или его функциональной части, производного и/или аналога, или нуклеотидной последовательности, или ее функционального эквивалента, или вектора, или клетки по настоящему изобретению и другого отличного RSV-специфичного агента, предпочтительно, антитела или его функционального эквивалента, для применения в качестве лекарственного и/или профилактического средства. Комбинация по изобретению, предпочтительно, содержит АМ22 и антитело, выбираемое из группы, состоящей из паливизумаба, D25, АМ14, АМ16 и АМ23. Как указано ранее, такая комбинация в особенности полезна для по меньшей мере частичного лечения или профилактики нарушения, связанного с RSV. Таким образом, изобретение также относится к применению комбинации по изобретению для получения лекарственного и/или профилактического средства для по меньшей мере частичного лечения и/или профилактики нарушения, связанного с RSV. Таким образом, также изобретение относится к применению выделенного, синтетического или рекомбинантного антитела, или его функциональной части, производного и/или аналога, или нуклеотидной последовательности, или ее функционального эквивалента, или вектора, или клетки по настоящему изобретению для получения лекарственного и/или профилактического средства для по меньшей мере частичного лечения и/или профилактики нарушения, связанного с RSV, а также способ по меньшей мере частичного лечения или профилактики нарушения, связанного с RSV, где способ содержит введение нуждающемуся индивиду терапевтически эффективного количества выделенного, синтетического или рекомбинантного антитела, или его функциональной части, производного и/или аналога по изобретению. В одном предпочтительном варианте осуществления используется комбинация с по меньшей мере одним другим RSV-специфичным агентом, предпочтительно, другим антителом, специфичным к RSV. Предпочтительно, до лечения у указанного индивида диагностируют инфекцию RSV.

Указанное антитело, предпочтительно, содержит антитело АМ22 или его функциональную часть. Указанное по меньшей мере одно другое антитело, специфичное к RSV, предпочтительно, представляет собой паливизумаб, D25, АМ14, АМ16 или АМ23. Наиболее предпочтительно, использование комбинации АМ22 и D25.

С целью по меньшей мере частичного лечения или профилактики нарушения, связанного с респираторным синцитиальным вирусом, антитело или функциональный эквивалент по изобретению, предпочтительно, вводят индивиду перед началом инфекции. Альтернативно, антитело или функциональный эквивалент по изобретению вводят уже инфицированному индивиду. Указанное антитело или функциональный эквивалент, предпочтительно, вводят индивидам, для которых существует повышенный риск осложнений, таким как, например, госпитализированные индивиды или индивиды со сниженным иммунитетом. Повышенный риск инфекции RSV также характерен для пожилых людей. Антитела или функциональные эквиваленты по изобретению, предпочтительно, вводят путем одной или более инъекций. Интервалы дозировок антител или функциональных эквивалентов по изобретению для использования в терапевтических или профилактических целях, как описано в настоящем документе, установлены на основании исследований с использованием нарастающих доз в клинике в клинических исследованиях со строгими требованиями к протоколу. Обычно доза составляет от 0,1 до 10 мг на кг веса тела. Для профилактических или терапевтических целей антитела или функциональные эквиваленты по изобретению обычно комбинируют с фармацевтически приемлемым носителем, разбавителем и/или наполнителем. Примеры пригодных носителей включают, например, гемоцианин фиссуреллы (keyhole limoet haemocyanin, KLH), сывороточный альбумин (например, BSA или RSA) и овальбумин. В одном предпочтительном варианте осуществления указанный приемлемый носитель содержит раствор, например раствор соли.

Еще в одном варианте осуществления используется нуклеиновая кислота или вектор, кодирующие антитело или функциональный эквивалент по изобретению. Как описано выше, после введения такой нуклеиновой кислоты или вектора, антитела или функциональные эквиваленты продуцируются системами хозяина. Продуцируемые антитела или функциональные эквиваленты способны по меньшей мере частично предотвратить и/или противодействовать инфекции респираторным синцитиальным вирусом и/или неблагоприятным эффектам такой инфекции. Также дополнительно представлены нуклеотидная последовательность, или функциональный эквивалент, или вектор по изобретению для использования в качестве лекарственного, и/или профилактического средства. Изобретение также относится к использованию нуклеотидной последовательности, или функционального эквивалента, или вектора по изобретению для получения лекарственного, и/или профилактического средства для по меньшей мере частичных лечения и/или предотвращения нарушения, связанного с RSV.

Изобретение также относится к фармацевтической композиции, содержащей выделенное, синтетическое или рекомбинантное антитело, или его функциональную часть, производное и/или аналог, или нуклеотидную последовательность или ее функциональный эквивалент, или вектор, или клетку по изобретению и фармацевтически приемлемый носитель, разбавитель или наполнитель. Указанная фармацевтическая композиция, предпочтительно, пригодна для применения у людей. В одном предпочтительном варианте осуществления указанное антитело представляет собой АМ22. В другом предпочтительном варианте осуществления указанная нуклеиновая кислота кодирует АМ22 или его функциональный эквивалент. В одном варианте осуществления указанная фармацевтическая композиция дополнительно содержит по меньшей мере одно антитело, специфичное к RSV, предпочтительно, паливизумаб, D25, АМ14, АМ16 и/или АМ23.

Изобретение далее разъясняется в нижеследующих примерах. Эти примеры не ограничивают объем изобретения, но используются для пояснения изобретения.

Список цитируемой литературы

Краткое описание чертежей

Фиг.1. Высокая эффективность нейтрализации вируса RSV A2 на клетках Hep2 новым полностью человеческим моноклональным антителом АМ22 по сравнению с паливизумабом.

Фиг.2. Нуклеотидные и аминокислотные последовательности тяжелых и легких цепей АМ22.

Фиг.3. Моноклональные антитела человека к RSV распознают конформационные эпитопы на белке слияния (F) RSV. Данные ИФА и окраски FACS. (A) - связывание антител с клетками EL4, инфицированными вирусом везикулярного стоматита (VSV), псевдотипированного белком RSV F или RSV G. (В) - связывание антител к RSV F с планшетами для ИФА, покрытыми лизатами клеток HEp2, инфицированных RSV (левая панель), или с планшетами Ni-NTA HisSorp (Quiagen), покрытыми рекомбинантным белком F, помеченным HIS (правая панель). Связывание антител с белком F детектировали с помощью антитела для детекции IgG, конъюгированного с пероксидазой хрена (разведение 1:2500, производство Jackson). (С) - связывание рекомбинантного RSV F штамма Long, содержащего метку поли-HIS, с исходными клонами В-клеток, связывание с В-клетками детектировали с помощью антитела к пента-His. (D) - внутриклеточное связывание антител человека к RSV с клетками 293Т, трансфицированными конструкцией с рекомбинантым RSF V, содержащим тримеризационный домен (домен ILZ).

Фиг.4. Нагрузка RSV у хлопковых крыс, получавших иммуноглобулины человека в профилактических целях. (А) - выделение IgG1 человека из сыворотки на 1 и 5 день после внутримышечного введения указанных доз антител у хлопковых крыс. (В) - нагрузка RSV в легких хлопковых крыс, получавших указанные антитела за 24 часа до инфекции RSV-X. Нагрузку RSV определяли через 5 дней после инфекции культурой TCID50. Эксперименты повторяли дважды, группы воздействия состояли из 4-6 животных. У животных из тех же групп изучали патологию легких (С) - указана средняя патология легких для АМ22 и паливизумаба, см. также таблицу 2.

Примеры

Пример 1. Культура В-клеток, иммортализация и селекция

Способы

В-клетки были иммортализованы, и их культивировали, как описано выше (Scheeren FA, et al. (2005) Nat Immunol 6: 303-313; Diehl SA, et al. (2008) J Immunol 180: 4805-4815 и Kwakkenbos MJ, et al. (2009) Nat Med in press). Вкратце, В-клетки изолировали из периферической крови (Sanquin, Amsterdam, The Netherlands) путем сепарации в фиколле с микробусинами CD22 MACS (Miltenyi Biotech) и последующим сортингом клеток на CD19+CD3-CD27+IgM-IgA- (клетки памяти IgG) на FACSAria (Becton Dickinson). Использование этих тканей было одобрено комитетами медицинской этики института и основывалось на информированном согласии. После ретровирусной трансдукции В-клетки в концентрации 2×105 клеток/мл культивировали в IMDM, содержащей рекомбинантный мышиный IL-21 (25 нг/мл, R&D Systems), вместе с γ-облученными (50 Гр) фибробластами L-клеток мыши, стабильно экспрессирующими CD40L (клетки CD40L-L, 105 клеток/мл) в течение 36 часов. Ретровирусные конструкции BCL6 и BCL-xL, описанные ранее (Shvarts A. et al. (2002) Genes Dev 16: 681-686 и Jaleco AC et al. (1999) Blood 94: 2637-2646), клонировали в ретровирусный вектор LZRS, которым трансфицировали упаковочные клетки Phoenix, как описано выше, и добавляли к стимулированным В-клеткам (Shvarts A. et al. (2002) Genes Dev 16: 681-686 и Scheeren FA et al. (2005) Nat Immunol 6: 303-313). Трансдуцированные В-клетки культивировали в IMDM в присутствии рекомбинантного IL-21 и клеток CD40L-L в течение продолжительного времени. Поскольку В-клетки, трансдуцированные BLC6+Bcl-xL, секретируют относительно большое количество антител, проверяли, возможно ли селектировать антиген-специфичные В-клетки на основе секреции определенного антитела. В-клетки памяти от здорового донора, трансдуцированные BLC6+Bcl-xL, рассаживали по 100 клеток на лунку и наращивали в присутствии клеток CD40L-L и IL-21. Через 2 недели культивирования собирали супернатанты и скринировали на присутствие антител, нейтрализующих RSV, в эксперименте по микронейтрализации. Из 384 культур (100 клеток на лунку), 31 предотвращали инфекцию клеток HEp2 RSV A2. Помимо четырех микрокультур, из которых субклонировали D25, АМ14, АМ16 и АМ23 путем лимитирующего разведения, далее было получено антитело АМ22. Медианная величина полумаксимальной ингибирующей концетрации (IC50) АМ22 против вируса RSV-A2 составляет 1,15 нг/мл (фиг.1).

Для получения последовательностей тяжелой и легкой цепей иммуноглобулинового локуса АМ22 изолировали тотальную РНК с помощью набора RNeasy® mini kit (Qiagen), получали кДНК, проводили ПЦР и клонировали вариабельные области тяжелой и легкой цепей в вектор для клонирования pCR2.1 TA (Invitrogen). Чтобы исключить мутации, индуцированные обратной транскриптазой или ДНК-полимеразой, проводили несколько независимых экспериментов по клонированию. Для получения рекомбинантного mAb АМ22 клонировали вариабельные области тяжелой и легкой цепи АМ22 в одной и той же рамке считывания с константными областями IgG1 и каппа человека в вектор на основе pcDNA3.1 (Invitrogen) и временно трансфицировали клетки 293T. Рекомбинантные АМ22 очищали из культурального супернатанта с помощью белка А.

Результаты

Ранее получали четыре эффективных конформационно зависимых антитела к RSV, названных АМ14, АМ16, АМ23 и D25. Эти антитела были описаны в WO 2008/147196 и Kwakkenbos MJ et al. (2009) Nat Med, в печати. Антитела АМ22, полученные от того же донора, распознавали вирус RSV еще эффективнее по сравнению с другими антителами, о чем свидетельствует величина IC50 против вируса RSV-A2, равная 1,15 нг/мл (таблица 1 и фиг.1). Из аминокислотной последовательности цепей VH и VL АМ22 видно, что это антитело отличается от других антител (фиг.2).

Пример 2. Эксперименты по связыванию in vitro

Для дальнейшего определения антигенной специфичности антитела АМ22, были проведены эксперименты по связыванию in vitro, чтобы выяснить, распознает ли антитело белок RSV F или G, и в какой конформации.

Способы

(1) FACS-окрашивание белка RSV F или G

На клетках BHK, культивируемых в DMEM, содержащей 5% FSC, пенициллин/стрептомицин и 50 мкМ 2-меркаптоэтанола, готовили вирусный сток дикого типа и рекомбинантного вируса везикулярного стоматита (VSV), экспрессирующего белок RSV-G (VSV-G) или белок RSV-F (VSV-F) (эксперименты проводил M. Lukens в WKZ, Utrecht; вирусы VSV были любезно предоставлены J.S. Kahn и J.K Rose, Yale University School of Medicine). Инфекцию VSV проводили на клетках EL-4, культивируемых в модифицированной по Дульбекко среде Iscove (IMDM, Gibco, Invitrogen), содержащей 5% FCS, пенициллин/стрептомицин и 50 мкМ 2-меркаптоэтанола. Клетки EL-4, инфицированные вариантами вируса VSV, инкубировали с рекомбинантным антителом и затем окрашивали антителами мыши против антител PE человека (фиг.3А).

(2) ELISA на RSV

Планшеты покрывали лизатом инфицированных RSV клеток HEp-2 в PBS в течение 1 часа при 37°С или в течение ночи при 4°С и промывали промывочным буфером для ELISA (PBS, 0,5% Tween-20). Планшеты блокировали путем инкубации с 4% молоком на PBS перед добавлением антител к RSV или поликлональных козьих антител к RSV (Biodesign) в комбинации с антителами к IgG, конъюгированными с ферментом (разведение 1:2500 для антител к IgG, конъюгированных с HRP (Jackson)). Для проявления ELISA использовали TMB субстрат/стоп-раствор (Biosource) (фиг.3, левая панель). Помимо лизатов инфицированных RSV-A2 клеток HEp-2, планшеты Ni-NTA HisSorp (Qiagen) также покрывали белком F из RSV штамма Long, помеченным HIS (любезно предоставлен Frank Coenjaerts, UMCU, Utrecht на основе Ternette N. et al., (2007) Vaccine 25: 7271-7279) (фиг.3В, левая панель). Связывание антител с RSV F детектировали с помощью детектирующих антител к IgG, конъюгированных с пероксидазой хрена (разведение 1:2500, Jackson). В другой постановке FACS-анализа использовали исходные клоны В-клеток (фиг.3С). В-клетки инкубировали с рекомбинантным белком F, меченным HIS, и связывание с BCR детектировали с помощью антител к пента-HIS, меченных Alexa Fluor 647 (Quiagen).

(3) Тримеры RSV

Помимо рекомбинантного белка F, полученного из штамма Long RSV, получали тримеры RSV A2 F путем вставки открытой рамки считывания F в конструкцию, слитую с доменом-изолейциновой молнией, за которой следуют 8 повторов HIS (ILZ-8xHIS). Белковые конструкции временно экспрессировали в клетках 293Т и детектировали по протоколу внутриклеточной окраски с использованием набора Fix Perm (BD) (фиг.3D).

Результаты

Все антитела распознавали белок RSV-F, экспрессируемый рекомбинантным VSV (фиг.3А). Далее, за исключением АМ16, распознавание зависело от присутствия конформационных эпитопов на белке RSV-F, поскольку они не распознавали лизат инфицированных RSV клеток HEp-2 (фиг.2В, левая панель). Также в условиях прямого ELISA D25, АМ14, АМ22 и АМ23 не распознавали очищенный рекомбинантный белок RSV-F штамма Long с HIS-тагом (фиг.3В, левая панель). Однако при инкубировании исходных линий В-клеток, стабильно экспрессирующих BCR, с неочищенным культуральным супернатантом белка RSV-F с HIS-тагом, наблюдалось связывание АМ16, АМ23 и в меньшей степени D25 с клонами В-клеток (фиг.3С). Вероятно, белок в этом неочищенном культуральном супернатанте содержит фракцию F-тримеров RSV, связывающихся с BCR, но связывающихся с планшетами HisSorp только в мономерной форме. Однако не наблюдался захват белка RSV-F с BCR линий В-клеток АМ14 и АМ22 (фиг.3С). Таким образом, АМ14 и АМ22 связываются с другими эпитопами. Вероятно, в необработанном культуральном супернатанте линии клеток, продуцирующих белок F, присутствовал низкий процент гомотримеров или димеров белка F. Эти более нативные конформации белка F могут экспрессировать эпитопы, распознаваемые АМ23 и D25, которые теряются в денатурирующих условиях ELISA. Следует отметить, что при внутриклеточном окрашивании клеток 293Т, трансфицированных тримеризационной конструкцией RSV, содержащей последовательность ILZ-8xHIS, было обнаружено, что АМ22 распознавало RSV F (фиг.3D), в то время как АМ14 не распознавало эту белковую структуру. Таким образом, АМ22 является уникальным, поскольку оно распознает конформацию белка RSV-F, отсутствующую в денатурирующих условиях, и, следовательно, отсутствующую в мономерной форме белка. Связывание АМ22 с белком F обнаруживается только при условии вынужденного близкого нахождения молекул белка F RSV и образования ими тримеров, именно в этой конформации белок F находится на вирусных частицах, что объясняет высокую нейтрализующую эффективность АМ22.

Пример 3. Определение эффективности in vivo

Для определения эффективности in vivo моноклонального антитела АМ22 были проведены эксперименты на хлопковых крысах.

Способы

Здоровых хлопковых крыс в возрасте 7-9 недель (Sigmodon hispidus, Harlan Laboratories, Nederland) обезболивали изофлураном и вводили путем внутримышечной инъекции (i.m.) 0,1 мл очищенного антитела в дозировках 2,0 или 0,4 мг/кг для контрольного антитела, паливизумаба, АМ22, АМ23 и D25, а АМ14 вводили в дозировках 0,4 и 0,1 мг/кг. Через 24 часа животных обезболивали, забирали кровь для определения hIgG в сыворотке и нагружали закапыванием в нос 106 TCID50 RSV-X (100 мкл). Через пять дней животных умерщвляли и забирали легкие. Определяли титры вируса в легких, причем нижний порог детекции составлял 2,1 log10 TCID50 г-1. Все процедуры, включающие хлопковых крыс, были одобрены Комитетом по экспериментам на животных Нидерландского института вакцин.

Результаты

Панель антител к RSV, кроме АМ16, тестировали на хлопковых крысах. На животных профилактически воздействовали 2,0 или 0,4 мг/кг моноклональных антител перед интраназальным введением RSV-X, первичного изолята RSV A. Ввиду сравнительно низкой продукции антител, антитело АМ14 вводили в дозировке 0,4 и 0,1 мг/кг. Уровни IgG человека в сыворотке крови хлопковых крыс на 1 день (день инокуляции вирусом) и 5 день (день умерщвления животных) находились в одном и том же интервале для всех антител и соизмеримо снижались в зависимости от времени (фиг.4А).

Количество вируса RSV, выделяемого из легких умерщвленных животных, было заметно снижено у всех групп животных, получивших по 2,0 мг/кг иммуноглобулинов, по сравнению с контрольной группой (фиг.4В). У животных, получивших по 0,4 мг/кг паливизумаба и АМ23, наблюдалась значительная репликация вируса, а в группах АМ14 и D25 у 1 из 6 животных наблюдалась детектируемая репликация вируса. У животных, получивших АМ22, вирус не выделялся. Эти результаты показывают, что АМ22, специфически распознающие конформационные эпитопы на белке F RSV, обладают сильным нейтрализующим потенциалом in vivo.

Анализ патологии легких хлопковых крыс, нагруженных RSV

На 5 день после i.n. инфекции RSV у каждой хлопковой крысы удаляли левое легкое и фиксировали в формалине. Повреждения легких оценивали по шкале от 1 до 5 по трем индивидуальным показателям: 1) гипертрофия эпителия бронха и бронхиол, 2) воспаление вокруг бронха и бронхиол (перибронхиолит) и 3) воспаление в альвеолах (альвеолит). Среднюю сумму показателей всех животных в одной группе принимали за патологический индекс (максимальное значение 15) (фиг.4С, таблица 2). Патология легких после инфекции RSV была значительно ослаблена у групп животных, получивших высокие дозы иммуноглобулина (2 мг/кг) (таблица 3). Однако только в случае групп АМ14, АМ22 и АМ23 патология была значительно ослаблена при более низких концентрациях (0,4 мг/кг). Полное отсутствие патологии наблюдали у 3 из 5 животных, получавших АМ22 и АМ23 в дозировке 2 мг/кг, а при дозировке 0,4 мг/кг полное предохранение от инфекции наблюдали у 2 или 1 из 6 животных в группах АМ14 и АМ22, соответственно (таблица 3).

При комбинировании результатов примеров 1, 2 и 3 становится очевидным, что АМ22 обладает определенными преимуществами. АМ22 демонстрирует самое низкое значение IC50, что означает, что для достижения сходного профилактического или терапевтического эффекта необходимо меньшее количество АМ22 по сравнению с другими антителами. Эпитоп на белке F RSV, распознаваемый АМ22, отличается от эпитопов, распознаваемых другими антителами, что дает возможность использовать АМ22 в комбинации с одним из других антител для достижения более сильного иммуногенного ответа на RSV и повышенной специфичности антител к RSV. Наконец, воздействие АМ22 на хлопковых крыс приводило к практически полному подавлению репликации вируса и потенциально полному отсутствию патологии у этих хлопковых крыс.

Пример 4. Сродство АМ22 к белку F RSV

Для определения профилактической, терапевтической и диагностической ценности антитела, предпочтительно, определить константу сродства и специфичность связывания между белком F RSV и АМ22. Это не просто, поскольку требуется определить сродство антитела к олигомерной белковой структуре. Как правило, константы сродства определяют с помощью агентов, иммобилизованных на чипе. Однако антитела АМ14, АМ22, АМ23 и D25 не распознают белок F, иммобилизованный на чипе.

Способ

"Сродством связывания" обычно называют суммарную силу нековалентных взаимодействий между одним сайтом связывания молекулы (например, антитела) и ее партнером связывания (например, антигеном). Сродство молекулы Х к ее партнеру Y в общем случае может выражаться константой равновесной диссоциации (Kd), которая представляет собой отношение koff/kon. Сродство можно измерить с помощью способов, известных из уровня техники, таких как способ поверхностного плазмонного резонанса (SPR). Сродство (KD), скорость ассоциации (ka) и диссоциации (kd) будут измерены способом SPR с помощью прибора IBIS от IBIS Technologies BV (Hengelo, the Netherlands). Вкратце, антитела к RSV иммобилизуют, разводят очищенный белок F RSV (содержащий пента-HIS) и измеряют константы скорости и сродства путем инъекции по меньшей мере трех последовательных разведений белка.

Другой эксперимент на приборе IMIS-iSPR представляет собой иммобилизацию 1) антитела к пента-HIS, с которым связывается белок F-пента-HIS, или 2) прямую иммобилизацию белка F пента-HIS на чипе и дальнейшей инкубации с антителами AIMM для определения констант сродства.

Таблица 1
Эффективность нейтрализации RSV очищенными IgG
RSV A2*
Паливизумаб 152
D25 1,28
AM14 2,09
16 78,7
22 1,15
23 4,18

Значения IC50 (нг/мл) выбранных IgG против RSV определяли с помощью стандартного культурального анализа IC50 на клетках HEp2 с вирусом RSV A2.

Таблица 2
Кумулятивный патологический индекс у хлопковых крыс
антитело мг/кг патологический индекс (SEM) Р-значения
Паливизумаб 2,0 3,20(0,4) 0,0005
паливизумаб 0,4 5,40(0,8) <0,005
D25 2,0 3,40(0,4) 0,0005
D25 0,4 5,83(1,0) 0,05
AM14 0,4 4,20(0,8) 0,05
AM14 0,1 3,67(1,2) 0,05
AM22 2,0 2,75(0,8) 0,0005
AM22 0,4 4,00(0,9) <0,005
AM23 2,0 2,40(0,2) 0,0005
AM23 0,4 3,50(0,9) <0,005
контрольные IgG1 2,0 8,80(1,1) N.A.
контроль без инфекции N.A. 1,80(0,4) 0,0005

Кумулятивный патологический индекс легких у хлопковых крыс, получавших указанные антитела за 24 часа до инфекции RSV. Образцы легких, полученные через 5 дней после инфекции, оценивались патоморфологом в случайном порядке. Патологию легких оценивали по шкале от 0 до 5 для трех отдельных показателей: 1) гипертрофия эпителия бронха и бронхиол, 2) перибронхиолит и 3) альвеолит. Средний патологический индекс (максимальное значение 15) со стандартной ошибкой среднего (SEM) и статистическими отличиями от группы контрольных IgG1 вычисляли с помощью двустороннего теста Уилкоксона. Эксперименты повторяли дважды, группы воздействия состояли из 4-6 животных. N.A. - неприменимо.

Таблица 3
Предотвращение патологии у хлопковых крыс
антитело мг/кг значительное ослабление патологии без патологии
Паливизумаб 2 5/5 1/5
Паливизумаб 0,4 3/5 0/6
D25 2 5/5 0/5
D25 0,4 2/6 0/6
AM14 0,4 5/6 2/6
AM14 0,1 4/5 0/5
AM22 2 5/5 3/5
AM22 0,4 5/6 1/6
AM23 2 5/5 3/5
AM23 0,4 5/6 0/6

Количество животных со значительно ослабленной или отсутствующей легочной патологией на 5 день после инфекции RSV-X. Эксперименты повторяли дважды, группы воздействия состояли из 4-6 животных.

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> AIMM Therapeutics B.V.

Beaumont, Tim

Bakker, Adrianus Q

Yasuda, Etsuko

<120> МОЛЕКУЛА, СПЕЦИФИЧЕСКИ СВЯЗЫВАЮЩАЯСЯ С RSV

<130> P89282PC00

<140> PCT/NL2009/050599

<141> 2009-10-06

<160> 32

<170> PatentIn version 3.3

<210> 1

<211> 90

<212> ДНК

<213> Искусственная

<220>

<223> Fw1 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(90)

<400> 1

cag gtc cag ctg gta cag tct ggg gct gag gtg aag aag ccc ggg gcc 48

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

aca gtg aaa gtc tcc tgc aag att tcc gga cac acc ctc att 90

Thr Val Lys Val Ser Cys Lys Ile Ser Gly His Thr Leu Ile

20 25 30

<210> 2

<211> 30

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 2

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Thr Val Lys Val Ser Cys Lys Ile Ser Gly His Thr Leu Ile

20 25 30

<210> 3

<211> 15

<212> ДНК

<213> Искусственная

<220>

<223> CDR1 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(15)

<400> 3

aaa tta tcc att cac 15

Lys Leu Ser Ile His

1 5

<210> 4

<211> 5

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 4

Lys Leu Ser Ile His

1 5

<210> 5

<211> 42

<212> ДНК

<213> Искусственная

<220>

<223> Fw2 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(42)

<400> 5

tgg gtg cga cag gct cct gga aag ggg ctt gag tgg atg gga 42

Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Met Gly

1 5 10

<210> 6

<211> 14

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 6

Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Met Gly

1 5 10

<210> 7

<211> 51

<212> ДНК

<213> Искусственная

<220>

<223> CD2 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(51)

<400> 7

ggt tat gag ggt gag gtc gat gag att ttc tac gca cag aag ttc cag 48

Gly Tyr Glu Gly Glu Val Asp Glu Ile Phe Tyr Ala Gln Lys Phe Gln

1 5 10 15

cac 51

His

<210> 8

<211> 17

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 8

Gly Tyr Glu Gly Glu Val Asp Glu Ile Phe Tyr Ala Gln Lys Phe Gln

1 5 10 15

His

<210> 9

<211> 96

<212> ДНК

<213> Искусственная

<220>

<223> Fw3 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(96)

<400> 9

aga ctc acc gtg atc gcc gac aca gcg aca gac aca gtc tac atg gaa 48

Arg Leu Thr Val Ile Ala Asp Thr Ala Thr Asp Thr Val Tyr Met Glu

1 5 10 15

ctg ggc agg ctc acc tct gac gac acg gcc gtc tat ttc tgt gga aca 96

Leu Gly Arg Leu Thr Ser Asp Asp Thr Ala Val Tyr Phe Cys Gly Thr

20 25 30

<210> 10

<211> 32

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 10

Arg Leu Thr Val Ile Ala Asp Thr Ala Thr Asp Thr Val Tyr Met Glu

1 5 10 15

Leu Gly Arg Leu Thr Ser Asp Asp Thr Ala Val Tyr Phe Cys Gly Thr

20 25 30

<210> 11

<211> 45

<212> ДНК

<213> Искусственная

<220>

<223> CD3 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(45)

<400> 11

cta ggt gtg aca gtg act gag gct gga ctg ggg atc gat gac tac 45

Leu Gly Val Thr Val Thr Glu Ala Gly Leu Gly Ile Asp Asp Tyr

1 5 10 15

<210> 12

<211> 15

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 12

Leu Gly Val Thr Val Thr Glu Ala Gly Leu Gly Ile Asp Asp Tyr

1 5 10 15

<210> 13

<211> 33

<212> ДНК

<213> Искусственная

<220>

<223> Fw4 тяжелой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(33)

<400> 13

tgg ggc cag gga acc ctg gtc acc gtc tcc tca 33

Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser

1 5 10

<210> 14

<211> 11

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 14

Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser

1 5 10

<210> 15

<211> 372

<212> ДНК

<213> Искусственная

<220>

<223> Тяжелая цепь антитела к RSV

<220>

<221> CDS

<222> (1)..(372)

<400> 15

cag gtc cag ctg gta cag tct ggg gct gag gtg aag aag ccc ggg gcc 48

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

aca gtg aaa gtc tcc tgc aag att tcc gga cac acc ctc att aaa tta 96

Thr Val Lys Val Ser Cys Lys Ile Ser Gly His Thr Leu Ile Lys Leu

20 25 30

tcc att cac tgg gtg cga cag gct cct gga aag ggg ctt gag tgg atg 144

Ser Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Met

35 40 45

gga ggt tat gag ggt gag gtc gat gag att ttc tac gca cag aag ttc 192

Gly Gly Tyr Glu Gly Glu Val Asp Glu Ile Phe Tyr Ala Gln Lys Phe

50 55 60

cag cac aga ctc acc gtg atc gcc gac aca gcg aca gac aca gtc tac 240

Gln His Arg Leu Thr Val Ile Ala Asp Thr Ala Thr Asp Thr Val Tyr

65 70 75 80

atg gaa ctg ggc agg ctc acc tct gac gac acg gcc gtc tat ttc tgt 288

Met Glu Leu Gly Arg Leu Thr Ser Asp Asp Thr Ala Val Tyr Phe Cys

85 90 95

gga aca cta ggt gtg aca gtg act gag gct gga ctg ggg atc gat gac 336

Gly Thr Leu Gly Val Thr Val Thr Glu Ala Gly Leu Gly Ile Asp Asp

100 105 110

tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 372

Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser

115 120

<210> 16

<211> 124

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 16

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Thr Val Lys Val Ser Cys Lys Ile Ser Gly His Thr Leu Ile Lys Leu

20 25 30

Ser Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Met

35 40 45

Gly Gly Tyr Glu Gly Glu Val Asp Glu Ile Phe Tyr Ala Gln Lys Phe

50 55 60

Gln His Arg Leu Thr Val Ile Ala Asp Thr Ala Thr Asp Thr Val Tyr

65 70 75 80

Met Glu Leu Gly Arg Leu Thr Ser Asp Asp Thr Ala Val Tyr Phe Cys

85 90 95

Gly Thr Leu Gly Val Thr Val Thr Glu Ala Gly Leu Gly Ile Asp Asp

100 105 110

Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser

115 120

<210> 17

<211> 69

<212> ДНК

<213> Искусственная

<220>

<223> Fw1 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(69)

<400> 17

gaa att gtg ttg aca cag tct cca ggc acc ctg tct ttg tct cca gga 48

Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

gaa aga gcc acc ctc tcc tgc 69

Glu Arg Ala Thr Leu Ser Cys

20

<210> 18

<211> 23

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 18

Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys

20

<210> 19

<211> 36

<212> ДНК

<213> Искусственная

<220>

<223> CD1 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(36)

<400> 19

agg gcc agt cag att gtt agc agg aac cac tta gcc 36

Arg Ala Ser Gln Ile Val Ser Arg Asn His Leu Ala

1 5 10

<210> 20

<211> 12

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 20

Arg Ala Ser Gln Ile Val Ser Arg Asn His Leu Ala

1 5 10

<210> 21

<211> 45

<212> ДНК

<213> Искусственная

<220>

<223> Fw2 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(45)

<400> 21

tgg tac cag caa aaa cct ggc cag gct ccc agg ctc ctc atc ttt 45

Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Phe

1 5 10 15

<210> 22

<211> 15

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 22

Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Phe

1 5 10 15

<210> 23

<211> 21

<212> ДНК

<213> Искусственная

<220>

<223> CD2 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(21)

<400> 23

ggt gcg tcc agt cgg gcc act 21

Gly Ala Ser Ser Arg Ala Thr

1 5

<210> 24

<211> 7

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 24

Gly Ala Ser Ser Arg Ala Thr

1 5

<210> 25

<211> 96

<212> ДНК

<213> Искусственная

<220>

<223> Fw3 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(96)

<400> 25

ggc atc cca gtc cgg ttc agt ggc agt ggg tct ggg aca gac ttc act 48

Gly Ile Pro Val Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr

1 5 10 15

ctc acc atc aac gga ctg gcg cct gaa gat ttt gca gtt tac tac tgt 96

Leu Thr Ile Asn Gly Leu Ala Pro Glu Asp Phe Ala Val Tyr Tyr Cys

20 25 30

<210> 26

<211> 32

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 26

Gly Ile Pro Val Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr

1 5 10 15

Leu Thr Ile Asn Gly Leu Ala Pro Glu Asp Phe Ala Val Tyr Tyr Cys

20 25 30

<210> 27

<211> 21

<212> ДНК

<213> Искусственная

<220>

<223> CD3 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(21)

<400> 27

ctg tcc tct gat tcc tcc ata 21

Leu Ser Ser Asp Ser Ser Ile

1 5

<210> 28

<211> 7

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 28

Leu Ser Ser Asp Ser Ser Ile

1 5

<210> 29

<211> 36

<212> ДНК

<213> Искусственная

<220>

<223> Fw4 легкой цепи антитела к RSV

<220>

<221> CDS

<222> (1)..(36)

<400> 29

ttc aca ttc ggc cct ggg acc aag gtg gat ttc aaa 36

Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Phe Lys

1 5 10

<210> 30

<211> 12

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 30

Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Phe Lys

1 5 10

<210> 31

<211> 324

<212> ДНК

<213> Искусственная

<220>

<223> Легкая цепь антитела к RSV

<220>

<221> CDS

<222> (1)..(324)

<400> 31

gaa att gtg ttg aca cag tct cca ggc acc ctg tct ttg tct cca gga 48

Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

gaa aga gcc acc ctc tcc tgc agg gcc agt cag att gtt agc agg aac 96

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ile Val Ser Arg Asn

20 25 30

cac tta gcc tgg tac cag caa aaa cct ggc cag gct ccc agg ctc ctc 144

His Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45

atc ttt ggt gcg tcc agt cgg gcc act ggc atc cca gtc cgg ttc agt 192

Ile Phe Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Val Arg Phe Ser

50 55 60

ggc agt ggg tct ggg aca gac ttc act ctc acc atc aac gga ctg gcg 240

Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Gly Leu Ala

65 70 75 80

cct gaa gat ttt gca gtt tac tac tgt ctg tcc tct gat tcc tcc ata 288

Pro Glu Asp Phe Ala Val Tyr Tyr Cys Leu Ser Ser Asp Ser Ser Ile

85 90 95

ttc aca ttc ggc cct ggg acc aag gtg gat ttc aaa 324

Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Phe Lys

100 105

<210> 32

<211> 108

<212> БЕЛОК

<213> Искусственная

<220>

<223> Синтетическая конструкция

<400> 32

Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ile Val Ser Arg Asn

20 25 30

His Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45

Ile Phe Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Val Arg Phe Ser

50 55 60

Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Gly Leu Ala

65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys Leu Ser Ser Asp Ser Ser Ile

85 90 95

Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Phe Lys

100 105

1. Выделенное антитело или его функциональная часть, которое способно специфически связываться с белком F респираторного синцитиального вируса (RSV) и которое содержит:
- последовательность определяющей комплементарность области (CDR1) тяжелой цепи, содержащую последовательность KLSIH, и
- последовательность CDR2 тяжелой цепи, содержащую последовательность GYEGEVDEIFYAQKFQH, и
- последовательность CDR3 тяжелой цепи, содержащую последовательности LGVTVTEAGLGIDDY, и
- последовательность CDR1 легкой цепи, содержащую последовательность RASQIVSRNHLA, и
- последовательность CDR2 легкой цепи, содержащую последовательность GASSRAT, и
- последовательность CDR3 легкой цепи, содержащую последовательность LSSDSSI.

2. Антитело или его функциональный фрагмент по п.1, где антитело содержит:
последовательность тяжелой цепи, содержащую последовательность, которая по меньшей мере на 70%, по меньшей мере 75%, по меньшей мере на 80%, по меньшей мере на 85% идентична последовательности

и/или
последовательность легкой цепи, содержащую последовательность, которая по меньшей мере на 70%, по меньшей мере 75%, по меньшей мере на 80%, по меньшей мере на 85% идентична последовательности

где антитело или функциональный фрагмент сохраняют способность специфически связываться с белком F респираторного синцитиального вируса (RSV).

3. Антитело или его функциональная часть по п.1, где антитело содержит:
последовательность тяжелой цепи, содержащую последовательность

последовательность легкой цепи, содержащую последовательность

4. Антитело или его функциональная часть по п.1, где антитело содержит:
(а) последовательность тяжелой цепи, содержащую последовательность, которая по меньшей мере на 90% идентична последовательности

или
(b) последовательность легкой цепи, содержащую последовательность, которая по меньшей мере на 90% идентична последовательности

(с) последовательность тяжелой цепи, содержащую последовательность, которая по меньшей мере на 90% идентична последовательности

последовательность легкой цепи, содержащую последовательность, которая по меньшей мере на 90% идентична последовательности

(d) последовательность тяжелой цепи, содержащая последовательность

(е) последовательность легкой цепи, содержащая последовательность

5. Антитело или его функциональная часть по п.1, где антитело содержит:
(а) последовательность тяжелой цепи, содержащую последовательность, которая по меньшей мере на 95% идентична последовательности


или
(b) последовательность легкой цепи, содержащую последовательность, которая по меньшей мере на 95% идентична последовательности

(с) последовательность тяжелой цепи, содержащую последовательность, которая по меньшей мере на 95% идентична последовательности

последовательность легкой цепи, содержащую последовательность, которая по меньшей мере на 95% идентична последовательности

(d) последовательность тяжелой цепи, содержащая последовательность

(е) последовательность легкой цепи, содержащая последовательность

где антитело или функциональный фрагмент сохраняют способность специфически связываться с белком F респираторного синцитиального вируса (RSV).

6. Антитело или его функциональная часть по п.1, которое дополнительно содержит модификацию в константной области антитела (Fc), выбранную из:
- эпитопа, связывающегося с рецептором спасения, где эпитоп, связывающийся с рецептором спасения, содержит аминокислотные последовательности области Fc молекулы IgG, ответственные за повышение времени полувыведения в сыворотке молекулы IgG и/или;
- модифицированных аминокислотных остатков, идентифицированных как участвующие во взаимодействии между Fc и рецептором FcRN.

7. Антитело или его функциональная часть по п.1, содержащее область Fc, которая содержит модификацию в положении, выбранном из группы, состоящей из 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 247, 251, 252, 254, 255, 256, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 313, 316, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 339, 341, 343, 370, 373, 378, 392, 416, 419, 421, 440 и 443 согласно индексу EU по Кабат, где указанные модификации содержат аминокислотную замену, и/или вставку аминокислоты, и/или делецию аминокислоты.

8. Антитело или его функциональная часть по п.1, которое содержит область Fc, содержащую аминокислотную замену в аминокислотных остатках 252, 254 или 256 согласно индексу EU, введенному Kabat et al.

9. Антитело или его функциональная часть по п.8, в котором аминокислотная замена на аминокислотном остатке 252 является заменой на тирозин, замена на аминокислотном остатке 254 является заменой на треонин и аминокислотная замена на аминокислотном остатке 256 является заменой на глютаминовую кислоту.

10. Антитело или его функциональная часть по п.1, которое содержит область Fc, содержащую аминокислотные замены аминокислотных остатков 252, 254 и 256 согласно индексу EU, введенному Kabat et al., в котором аминокислотная замена на аминокислотном остатке 252 является заменой на тирозин, замена на аминокислотном остатке 254 является заменой на треонин и аминокислотная замена на аминокислотном остатке 256 является заменой на глютаминовую кислоту.

11. Антитело или его функциональная часть по любому из пп.1-10, которое представляет собой гуманизированное антитело.

12. Антитело или его функциональная часть по любому из пп.1-10, которое представляет собой антитело человека.

13. Антитело или его функциональная часть по любому из пп.1-10, где его функциональная часть представляет собой однодоменное антитело, одноцепочечное антитело, одноцепочечный вариабельный фрагмент (scFv), фрагмент Fab или фрагмент F(ab′)2.

14. Антитело или его функциональная часть по п.1, где антитело или его функциональная часть являются рекомбинантными.

15. Антитело или его функциональная часть по п.1, где антитело или его функциональная часть являются синтетическими.

16. Выделенная последовательность нуклеиновой кислоты, кодирующая антитело по п.1.

17. Последовательность нуклеиновой кислоты по п.16, содержащая последовательность, выбранную из группы, состоящей из

18. Последовательность нуклеиновой кислоты по п.16, где нуклеотидная последовательность тяжелой цепи содержит SEQ ID NO:15, и/или нуклеотидная последовательность легкой цепи содержит SEQ ID NO:31.

19. Применение антитела или его функциональной части по любому из пп.1-3 или 8-10 для получения лекарственного средства для лечения нарушения, связанного с RSV.

20. Применение антитела или его функциональной части по любому из пп.1-3 или 8-10 для получения профилактического средства для профилактики нарушения, связанного с RSV.

21. Фармацевтическая композиция для лечения или профилактики нарушения, связанного с RSV, содержащая:
- эффективное количество антитела или его функциональной части по любому из пп.1-3 или 8-10; и
- фармацевтически приемлемый носитель, разбавитель или наполнитель.

22. Способ получения антитела или его функциональной части, включающий культивирование клетки, содержащей последовательность нуклеиновой кислоты по любому из пп.16-18, в условиях, при которых экспрессируется последовательность нуклеиновой кислоты.

23. Способ по п.22, дополнительно включающий сбор, очистку и/или выделение указанного антитела или его функциональной части.



 

Похожие патенты:

Изобретение относится к области иммунологии и биотехнологии. Описаны гуманизированное антитело и его антигенсвязывающий фрагмент (Fab), которые селективно связывают человеческий ИФН-γ и содержат вариабельный участок тяжелой цепи (VH) и вариабельный участок легкой цепи (VL), где VH и VL имеют последовательности аминокислот соответственно SEQ ID NO:1 и 2, представленные в описании.

Настоящее изобретение относится к области биотехнологии, конкретно к антагонистам гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF), и может быть использовано в медицине.

Настоящее изобретение относится к области иммунологии. Предложены: антитело, связывающееся с интерлейкином-17 (ИЛ-17), характеризующееся 6 CDR из лёгкой и тяжёлой цепи, а также кодирующая нуклеиновая кислота и вектор для экспрессии указанного антитела.

Группа изобретений относится к медицине, а именно к офтальмологии, и может быть использована для лечения глазной болезни, ассоциированной со связанными с амилоидом-бета патологическими аномалиями/изменениями в тканях зрительной системы.

Настоящее изобретение относится к области иммунологии. Предложен полипептид, содержащий два связывающих фрагмента, представленных антителами, причем первый из них связывается с эпитопом СD3ε(эпсилон)-цепи человека и примата, не являющегося шимпанзе, в частности Callithrix jacchus, Saguinus oedipus и Saimirí sciureus, а второй - с EGFR, Her2/neu или IgE человека и/или примата, не являющегося шимпанзе, причем упомянутый эпитоп СD3ε включает аминокислотную последовательность Gln-Asp-Gly-Asn-Glu.

Настоящее изобретение относится к области биохимии. Предложено биспецифическое антитело, которое связывается как с фактором свертывания крови IX/активированным фактором свертывания крови IX, так и с фактором свертывания крови X, и функционально заменяет функцию фактора свертывания крови VIII.

Настоящее изобретение относится к области биохимии. Предложено биспецифическое антитело, которое связывается как с фактором свертывания крови IX/активированным фактором свертывания крови IX, так и с фактором свертывания крови X и функционально заменяет функцию фактора свертывания крови VIII.

Изобретение относится к области иммунологии и биотехнологии. Предложены варианты антагонистических антител, которые связываются с рецептором интерлейкина-7 (IL-7R).

Настоящее изобретение относится к биотехнологии и представляет собой фармацевтическую комбинацию для лечения ревматического заболевания, содержащую гуманизированное анти-CD4 антитело, способное к активации CD4+CD25+ регуляторных Т-клеток, и метотрексат.

Изобретение относится области иммунологии и биотехнологии. Предложено однодоменное антитело (VHH), способное связывать цитокин фактор некроза опухолей (ФНО, TNF) человека, фрагмент ДНК, кодирующий антитело по изобретению, способ получения антитела по изобретению, а также способ выявления и определения уровня содержания ФНО человека в биологическом образце.

Настоящее изобретение относится к вирусологии и предполагает использование однодоменных мини-антител для профилактики и терапии гриппа. Заявлено однодоменное мини-антитело, специфически связывающееся с определенным эпитопом гемагглютинина вируса гриппа типа A (H5N2) и подавляющее инфекцию вируса гриппа типа A (H5N2).
Изобретение относится к биотехнологии. Описывается штамм культивируемых гибридных клеток животного Mus musculus L.

Настоящее изобретение относится к области иммунологии и вирусологии и предполагает использование антител, представляющих собой тримеризованные однодоменные антитела, для профилактики и терапии бешенства.

Изобретение относится к области иммунологии и биотехнологии. Представлены выделенное, искусственное или рекомбинантное антитело или его функциональная часть, способные специфически связывать F-антиген респираторно-синцитиального вируса, которые включают: вариабельную последовательность тяжелой цепи, содержащую CDR1 NYIIN (SEQ ID NO:1), CDR2 GIIPVLGTVHYAPKFQG (SEQ ID NO:2), CDR3 ETALVVSTTYLPHYFDN (SEQ ID NO:3), и вариабельную последовательность легкой цепи, содержащую CDR1 QASQDIVNYLN (SEQ ID NO:4), CDR2 VASNLET (SEQ ID NO:5), CDR3 QQYDNLP (SEQ ID NO:6); а также нуклеотидная последовательность, кодирующая указанное антитело.

Изобретение относится к биохимии и представляет собой варианты гуманизированных антител и их фрагменты, которые связываются с белком Е2 вируса гепатита С. .
Изобретение относится к области иммунологии и может быть использовано для диагностики, профилактики и лечения ВИЧ-инфекции. .

Изобретение относится к выделенному вирусу растений, названному вирус томата торрадо (ToTV), и его компонентам, а также к способам получения устойчивых к ToTV растений. .

Изобретение относится к области органической химии, а именно к гетероциклическим соединениям общей формулы I или к их фармацевтически приемлемым солям, или сольватам, или их стереоизомерам, где R и R*, каждый независимо, представляет собой -CR1R2R3, C1-4алкиламино, бензиламино, C6-10ариламино, гетероС4-7циклоалкил, содержащий 1 гетероатом, выбранный из O; где R1 выбирают из C1-4алкила; фенила, необязательно замещенного 1, 2 или 3 заместителями, независимо выбранными из галогена, C1-4алкила, C1-4алкокси, трифторметокси или 2 заместителей у соседних атомов кольца, образующих 1,3-диоксолановую группу; бензила, необязательно замещенного галогеном или метокси; фенилсульфонилметила; C3-5гетероарила, содержащего от 1 до 2 гетероатомов, независимо выбранных из N и O; C3-5гетероарилметила, содержащего от 1 до 2 гетероатомов, выбранных из N и C3-6циклоалкила; R2 выбирают из водорода, гидроксила, ди-C1-4алкиламино, C1-4алкилкарбониламино, C1-4алкилоксикарбониламино, C1-4алкиламинокарбониламино, пиперидин-1-ила или имидазол-1-ила; R3 представляет собой водород или, альтернативно, R2 и R3 вместе образуют оксогруппу; или R1 и R3 вместе образуют циклопропил; при условии, что если один из R или R* представляет собой - CH(C6H5)N(CH3)2, тогда другой не может представлять собой - CH(C6H5)NHC(=O)OCH3; и если R и R* являются одинаковыми, тогда R1 отличен от фенила, когда R2 представляет собой гидроксил, ацетиламино, метоксикарбониламино или трет-бутоксикарбониламино, и R3 представляет собой водород; и R1 отличается от C1-4алкила, когда R2 представляет собой C1-4алкилоксикарбониламино, и R3 представляет собой водород.
Наверх