Конъюгированные молекулы фактора viii

Изобретение относится к области биотехнологии, конкретно к получению молекулы Фактора VIII с укороченным В-доменом и ковалентно конъюгированной с гидрофильным полимером, имеющей измененное время полужизни в кровотоке, и может быть использовано в медицине для лечения гемофилии. Получают молекулу предшественника Фактора VIII с укороченным В-доменом, где В-домен соответствует аминокислотам 741-761 из SEQ ID NO 2. При этом указанная молекула ковалентно конъюгирована с ПЭГ или полисахаридом размером 10-80 кДа посредством О-связанного олигосахарида по сериновому остатку в укороченном В-домене, который соответствует аминокислоте 750 в SEQ ID NO 2. Изобретение позволяет увеличить время полужизни Фактора VIII в кровотоке. 5 н. и 3 з.п. ф-лы, 8 ил., 4 табл., 7 пр.

 

Область техники

[0001] Настоящее изобретение относится к конъюгированным молекулам Фактора свертывания VIII. В частности, настоящее изобретение относится к конъюгированным молекулам Фактора свертывания VIII, имеющим измененное время полужизни в кровотоке.

Предшествующий уровень техники

[0002] Гемофилия А - это наследственная болезнь кровотечений, причиной которой является дефицит Фактора свертывания VIII (FVIII) или нарушение его активности. Клинические проявления затрагивают непервичный гемостаз - формирование кровяного сгустка протекает нормально, но сгусток нестабилен из-за того, что не происходит вторичное образование тромбина. Это заболевание лечат путем внутривенной инъекции Фактора свертывания FVIII, который либо выделяют из крови, либо получают рекомбинантным способом.

[0003] Современные рекомендации по лечению расходятся с традиционными способами лечения по возникновению жалобы и направлены на профилактику. Время полужизни в кровотоке эндогенного FVIII составляет 12-14 часов, и, таким образом, профилактическую терапию следует осуществлять несколько раз в неделю, чтобы у пациента фактически отсутствовали симптомы заболевания. Внутривенное введение для многих пациентов, особенно для детей и лиц молодого возраста, связано со значительными неудобствами и/или болью. Таким образом, в данной области техники существует необходимость в новых образцах Фактора VIII с активностью Фактора VIII, которые предпочтительно гомогенны по структуре, предпочтительно безопасны и предпочтительно имеют значительно увеличенное время полужизни в кровотоке, для того чтобы уменьшить число введений в неделю Фактора VIII. Кроме того, в данной области техники существует необходимость в сравнительно простых способах получения и производства таких молекул.

[0004] В данной области техники известно ПЭГилирование Фактора VIII, применяемое для увеличения времени его полужизни в кровотоке. Тем не менее получение безопасного продукта, обладающего гомогенной структурой, а также существенно улучшенным временем полужизни в кровотоке, является затруднительным. Имеющиеся способы получения конъюгированных молекул Фактора VIII являются часто трудоемкими и/или приводят к низкому выходу и/или получаемые продукты не гомогенны по структуре. В WO 2008011633 было предложено применение искусственным образом полученных сайтов О-сцепленного гликозилирования для получения терапевтических белков с длительным временем полужизни в кровотоке терапевтических белков, однако в этой заявке не были раскрыты конъюгированные молекулы Фактора VIII.

Сущность изобретения

[0005] В первом аспекте настоящее изобретение относится к молекуле Фактора VIII с укороченным В-доменом, имеющей измененное время полужизни в кровотоке, причем указанная молекула ковалентно конъюгирована с гидрофильным полимером за счет О-связанного олигосахарида в укороченном В-домене, где активация Фактора VIII приводит к удалению ковалентно связанной боковой группы.

[0006] В других аспектах настоящее изобретение относится, кроме того, к способам получения таких молекул, к применению таких молекул и к фармацевтическим композициям, включающим такие молекулы.

[0007] Таким образом, предлагается конъюгированная молекула Фактора VIII с измененным временем полужизни в кровотоке, где конъюгированная боковая группа (например, гидрофильный полимер) удаляется в ходе активации. Молекулы по изобретению предпочтительно имеют гомогенную структуру - по меньшей мере, с точки зрения положения гидрофильного полимера в укороченном В-домене - и предпочтительно имеют благоприятный профиль безопасности. Кроме того, здесь также представлены простые способы получения таких молекул. Предпочтительно, чтобы активированные молекулы Фактора VIII по изобретению были сходны с эндогенным активированным Фактором VIII.

Подробное описание изобретения

Определения:

[0008] Молекулы Фактора VIII: FVIII/Фактор VIII - это высокомолекулярный сложный гликопротеин, который изначально синтезируется гепатоцитами. FVIII состоит из 2351 аминокислот, включая сигнальный пептид, и содержит несколько отчетливо различимых доменов, определяемых гомологией. Имеется три А-домена, уникальный В-домен и два С-домена. Порядок доменов можно представить как NH2-A1-A2-B-A3-C1-C2-COOH. FVIII циркулирует в плазме в виде двух цепей, разделенных по границе В-А3. Цепи соединены связями, опосредованными ионами двухвалентного металла. Цепь А1-А2-В называют тяжелой цепью (НС), а А3-С1-С2 - легкой цепью (LC).

[0009] Эндогенные молекулы Фактора VIII циркулируют in vivo в виде пула молекул с В-доменами различного размера. По всей вероятности, in vivo происходит постепенное энзиматическое отщепление В-домена, что приводит к формированию пула молекул с В-доменами различного размера. Принято считать, что расщепление по положению 740, в ходе которого удаляется последний фрагмент В-домена, происходит в связи с тромбиновой активации. Однако нельзя исключить, что вариант Фактора VIII, в котором, например, был поврежден сайт расщепления в положении 740, может быть активным.

[0010] В данном тексте термин "Фактор VIII", или "FVIII", относится к человеческому плазменному гликопротеину, который является участником внутреннего пути свертывания и необходим для свертывания крови. "Нативный FVIII" является полноразмерной молекулой человеческого FVIII, показанной в SEQ ID NO 1 (аминокислоты 1-2332). В-домен включает аминокислоты 741-1648 в SEQ ID N01.

[ООН] SEQ ID N01:

ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSWYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTWITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDWRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPS PGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLMGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVENTVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPGKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESNHAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKWFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDN1MVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPWNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

[0012] Молекулы Фактора VIII по настоящему изобретению - это молекулы Фактора FVIII с укороченным В-доменом, где оставшиеся домены соответствуют последовательности, представленной аминокислотами 1-740 и 1649-2332 в SEQ ID NO 1. Следовательно, молекулы по изобретению являются рекомбинантными молекулами, полученными в трансформированных клетках хозяина, предпочтительно в клетках млекопитающих. Тем не менее оставшиеся домены (т.е. три А-домена и два С-домена) могут незначительно различаться, например примерно на 1%, 2%, 3%, 4% или 5% от аминокислотной последовательности, представленной в SEQ ID NO 1 (аминокислоты 1-740 и 1649-2332). В частности, возможно введение аминокислотных модификаций (замен, делеций и т.п.) в остальные домены, например, с целью изменения связывающей способности Фактора VIII по отношению к различным компонентам, таким как, например, фактор vW, LPR, различные рецепторы, другие Факторы свертывания, клеточные поверхности и т.п. Кроме того, молекулы Фактора VIII по изобретению могут включать другие посттрансляционные модификации - например, в укороченном В-домене и/или в одном или более из остальных доменов молекул. Эти другие посттрансляционные модификации могут быть в форме различных молекул, конъюгированных с молекулой Фактора VIII по изобретению, таких как, например, полимерные соединения, пептидные соединения, соединения-производные жирных кислот и т.п.

[0013] Все молекулы Фактора VIII по настоящему изобретению - независимо от того, модифицированы они вне В-домена или нет, содержат ли иную посттрансляционную модификацию или нет - обладают активностью Фактора VIII (что подразумевает способность участвовать в каскаде реакций свертывания, причем их действие в функциональном отношении сходно или идентично FVIII), индуцируют образование FXa за счет взаимодействия с FIXa на активированных тромбоцитах и способствуют образованию кровяного сгустка. Эту активность можно оценивать in vitro способами, хорошо известными в данной области техники, такими как, например, анализ свертывания, анализ эндогенного потенциала тромбина и т.п. Молекулы Фактора VIII по настоящему изобретению имеют активность FVIII, составляющую по меньшей мере около 10%, по меньшей мере 20%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 80%, по меньшей мере 90% и 100% или даже более 100% от активности нативного человеческого FVIII.

[0014] В-домен: В-домен Фактора VIII охватывает аминокислоты 741-1648 в SEQ ID NO 1. В-домен расщепляется по нескольким различным сайтам, что приводит к высокой гетерогенности циркулирующих в плазме молекул FVIII. Конкретная функция высоко гликозилированного В-домена не известна. Известно, что этот домен не существенен для активности FVIII в каскаде реакций свертывания. Это предположение о вероятном отсутствии функции подтверждается тем фактом, что FVIII с делецией/с укороченным В-доменом, оказывается, обладает in vivo свойствами, идентичными тем, которые наблюдаются для полноразмерного нативного FVIII. С другой стороны, имеются свидетельства тому, что В-домен может уменьшать связывание белка с клеточной мембраной, по меньшей мере, в условиях отсутствия сыворотки.

[0015] Молекула Фактора VIII с укороченным В-доменом/с делецией В-домена: Эндогенный полноразмерный FVIII синтезируется в виде одноцепочечной молекулы-предшественника. Перед секрецией молекула-предшественник расщепляется на тяжелую цепь и легкую цепь. Для получения рекомбинантного FVIII с делецией В-домена можно применить две различные стратегии. Либо синтезируют отдельно тяжелую цепь без В-домена и легкую цепь в виде двух различных полипептидных цепей (двухцепочечная стратегия), либо FVIII или FVIII с делецией В-домена синтезируют в виде единственной полипептидной цепи-предшественника (одноцепочечная стратегия), которая расщепляется на тяжелую и легкую цепи таким же образом, как и полноразмерный предшественник FVIII.

[0016] В полипептиде-предшественнике FVIII с делецией В-домена участки тяжелой и легкой цепи обычно разделены линкером. Чтобы минимизировать риск введения иммуногенных эпитопов в FVIII с делецией В-домена, последовательность линкера предпочтительно получают из В-домена FVIII. Линкер должен включать сайт узнавания для протеазы, которая расщепляет полипептид-предшественник FVIII с делецией В-домена на тяжелую и легкую цепь. В В-домене полноразмерного FVIII данный сайт узнавания составляют аминокислоты 1644-1648. Тромбиновый сайт, приводящий к удалению линкера при активации FVIII с делецией В-домена, расположен в тяжелой цепи. Таким образом, маловероятно, чтобы размер и аминокислотная последовательность линкера влияли на его удаление из остальной молекулы FVIII при активации тромбином. При производстве FVIII удобно осуществлять делецию В-домена. Тем не менее можно включать фрагменты В-домена в линкер без снижения продуктивности. Негативный эффект В-домена на продуктивность не связывают с каким-либо конкретным размером В-домена или конкретной его последовательностью.

[0017] Укороченный В-домен может содержать несколько сайтов O-гликозилирования. Тем не менее в предпочтительном воплощении молекула включает только один, как вариант два, три или четыре O-связанных олигосахарида в укороченном В-домене.

[0018] В предпочтительном воплощении укороченный В-домен включает только один сайт потенциального O-гликозилирования и гидрофильный полимер ковалентно конъюгирован по этому сайту O-гликозилирования.

[0019] O-связанные олигосахариды в молекулах по изобретению с укороченным В-доменом могут быть присоединены по сайтам O-гликозилирования, которые были искусственно получены рекомбинантным способом и/или за счет выведения на поверхность молекулы "скрытых" сайтов O-гликозилирования путем укорочения В-домена. В обоих случаях подобные молекулы можно создавать путем разработки аминокислотной последовательности Фактора VIII с укороченным В-доменом и последующего проведения in silico анализа данной аминокислотной последовательности, с помощью которого можно предсказать вероятность образования сайтов O-гликозилирования в укороченном В-домене. Молекулы со сравнительно высокой вероятностью присутствия таких сайтов гликозилирования можно синтезировать в подходящих клетках хозяина, с последующим анализом паттерна гликозилирования, а затем произвести отбор молекул с O-сцепленным гликозилированием в укороченном В-домене. Подходящие клетки хозяина для получения рекомбинантного белка Фактора VIII предпочтительно должны происходить от млекопитающих для того, чтобы можно было гарантировать гликозилирование молекулы. При осуществлении на практике настоящего изобретения эти клетки являются клетками млекопитающих, более предпочтительно - устойчивой клеточной линией, включая, без ограничения, линии клеток СНО (например, АТСС CCL 61), COS-1 (например, АТСС CRL 1650), фибробласты почки сирийского хомячка (ВНК) и НЕК293 (например, АТСС CRL 1573; Graham et al., J. Gen. Virol. 36:59-72, 1977). Предпочтительной линией клеток ВНК является клеточная линия tk-ts13 ВНК (Waechter and Baserga, Proc.Natl.Acad.Sci.USA 79:1106-1110, 1982), здесь и далее обозначенная как клетки ВНК 570. Линия клеток ВНК 570 доступна в Американской коллекции типовых культур (АТСС), 12301 Parklawn Dr., Rockville, MD 20852, с регистрационным номером в базе данных АТСС (accession number) CRL 10314. Линия клеток tk-ts13 ВНК доступна также в АТСС под регистрационным номером CRL 1632. Предпочтительной линией клеток СНО является линия клеток СНО К1, доступная в АТСС под регистрационным номером СС161, а также клеточные линии CHO-DXB11 и CHO-DG44.

[0020] Другие приемлемые клеточные линии включают, без ограничения, Rat Нер I (гепатома крысы; АТСС CRL 1600), Rat Hep II (гепатома крысы; АТСС CRL 1548), ТСМК (АТСС CCL 139), легкое человека (АТСС НВ 8065), NCTC 1469 (АТСС CCL 9.1); клетки DUKX (линия клеток СНО) (Uriaub and Chasin, Proc. Natl. Acad. Sci. USA 77:4216-4220, 1980) (клетки DUKX, обозначаемые также как клетки DXB11), а также DG44 (линия клеток СНО) (Cell, 33: 405, 1983; Somatic Cell and Molecular Genetics 12: 555, 1986). Можно применять также клетки ЗТЗ, клетки Namalwa, клетки миеломы и слияния миелом с другими клетками. В некоторых воплощениях такими клетками могут быть мутантные или рекомбинантные клетки, такие как, например, клетки, которые экспрессируют в количественном и качественной отношении иной спектр энзимов, катализирующих посттрансляционную модификацию белков (например, энзимов гликозилирования, таких как гликозилтрансферазы и/или гликозидазы, или ферментов процессинга, например пропептидов), чем тот тип клеток, от которого они произошли. Особенно предпочтительны клетки DUKX (линия клеток СНО).

[0021] На данный момент предпочтительны клетки НЕК293, COS, клетки яичника китайского хомячка (СНО), фибробласты почки сирийского хомячка (ВНК) и клетки миеломы, особенно клетки яичника китайского хомячка (СНО).

[0022] Таким образом, авторы настоящего изобретения показали, что существует возможность активировать "скрытые" сайты O-гликозилирования в В-домене Фактора VIII путем укорочения В-домена. Чтобы не привязываться к конкретной теории, это явление можно объяснить третичной структурой молекулы в укороченном В-домене, где происходят изменения. Таким образом, "скрытые" сайты O-гликозилирования становятся "доступными" для гликозилирования в укороченном В-домене. Одним из преимуществ такого подхода является обеспечение приемлемого профиля безопасности рекомбинантных молекул с точки зрения, например, аллергенности. Другим его преимуществом является то, что этот подход предоставляет более простой путь получения вариантов с укороченным В-доменом, содержащих O-связанные олигосахариды в В-домене, благодаря изначальному присутствию сайтов гликозилирования в В-домене, поскольку ранее было показано, что создавать искусственные сайты O-гликозилирования в рекомбинантных белках трудно.

[0023] Длина В-домена в молекуле FVIII дикого типа (wt) составляет около 907 аминокислот. Длина укороченного В-домена в молекулах по настоящему изобретению может варьироваться от примерно 10 аминокислот до примерно 700 остатков, например около 12-500 аминокислот, 12-400 аминокислот, 12-300 аминокислот, 12-200 аминокислот, 15-100 аминокислот, 15-75 аминокислот, 15-50 аминокислот, 15-45 аминокислот, 20-45 аминокислот, 20-40 аминокислот или 20-30 аминокислот. Укороченный В-домен может включать фрагменты тяжелой цепи и/или короткой цепи и/или искусственно введенной последовательности, которая не присутствует в молекуле wt FVIII. Термины "с укороченным В-доменом" или "с делецией В-домена" в данном описании можно употреблять равнозначно.

[0024] Измененное время полужизни в кровотоке: Молекулы по настоящему изобретению имеют измененное время полужизни в кровотоке0 по сравнению с молекулой Фактора VIII дикого типа, предпочтительно увеличенное время полужизни в кровотоке. Время полужизни в кровотоке предпочтительно увеличено по меньшей мере на 10%, предпочтительно по меньшей мере на 15%, предпочтительно по меньшей мере на 20%, предпочтительно по меньшей мере на 25%, предпочтительно по меньшей мере на 30%, предпочтительно по меньшей мере на 35%, предпочтительно по меньшей мере на 40%, предпочтительно по меньшей мере на 45%, предпочтительно по меньшей мере на 50%, предпочтительно по меньшей мере на 55%, предпочтительно по меньшей мере на 60%, предпочтительно по меньшей мере на 65%, предпочтительно по меньшей мере на 70%, предпочтительно по меньшей мере на 75%, предпочтительно по меньшей мере на 80%, предпочтительно по меньшей мере на 85%, предпочтительно по меньшей мере на 90%, предпочтительно по меньшей мере на 95%, предпочтительно по меньшей мере на 100%, более предпочтительно по меньшей мере на 125%; более предпочтительно по меньшей мере на 150%, более предпочтительно по меньшей мере на 175%, более предпочтительно по меньшей мере на 200% и более предпочтительно по меньшей мере на 250% или 300%. И еще более предпочтительно, чтобы такие молекулы имели время полужизни в кровотоке, которое увеличено по меньшей мере на 400%, 500%, 600% или даже на 700% по отношению ко времени полужизни в кровотоке FVIII дикого типа.

[0025] Гидрофильный полимер: Модифицирующая группа/гидрофильный полимер по настоящему изобретению предпочтительно не должны быть природными. В одном примере "не встречающейся в природе модифицирующей группой" является полимерная модифицирующая группа, в которой по меньшей мере один полимерный фрагмент не является природным. В другом примере не встречающейся в природе модифицирующей группой является модифицированный углевод. Местоположение функционализации посредством модифицирующей группы выбирают таким образом, чтобы не происходило предотвращение энзиматического присоединения "модифицированного сахара" к полипептиду. Понятие "модифицированный сахар" относится также к любому остатку-миметику гликозила, который может быть функционализирован с помощью модифицирующей группы и который является субстратом для природного или модифицированного энзима, например для гликозилтрансферазы.

[0026] Полимерная модифицирующая группа, присоединяемая к полипептиду, может изменять свойства такого полипептида, например его биодоступность, биологическую активность или время полужизни в организме. Типичные полимеры по изобретению включают водорастворимые полимеры, которые могут быть линейными или разветвленными, могут содержать одну или более независимо выбранных полимерных частиц, таких как полиалкиленгликоль и его производные. Полимерная модифицирующая группа по изобретению может включать водорастворимый полимер, например полиэтиленгликоль - ПЭГ (PEG) - и его производные (m-PEG), полипропиленгликоль и его производные (PPG, m-PPG) и т.п.

[0027] Термин "водорастворимый" относится к молекулам, которые в некоторой степени растворимы в воде и их растворимость можно детектировать. Способы детектирования и/или оценки растворимости в воде хорошо известны в данной области техники. Приведенные в примерах водорастворимые полимеры по изобретению включают пептиды, сахариды, полиэфиры, полиамины, поликарбоновые кислоты и т.п. Пептиды могут иметь смешанные последовательности, а могут быть составлены из единственной аминокислоты - например полилизина. Примером полисахарида является полисиаловая кислота. В качестве примера полиэфира представлен полиэтиленгликоль, например m-PEG. Полиэтиленимин является примером полиамина, а полиакриловая кислота - примером поликарбоновой кислоты.

[0028] Полимерным скелетом водорастворимого полимера по изобретению может быть полиэтиленгликоль (т.е. ПЭГ). Термин "ПЭГ в связи с настоящим изобретением включает полиэтиленгликоль в любой из его форм, включая алкокси-ПЭГ, бифункциональный ПЭГ, многофункциональный (multiarmed) ПЭГ, вилообразный (forked) ПЭГ, разветвленный ПЭГ, ПЭГ с боковыми заместителями (pendent) (т.е. ПЭГ или родственные ему полимеры, содержащие одну или более функциональных групп, присоединенных к полимерному скелету), или же ПЭГ, содержащий внутри себя деградируемые связи.

[0029] Полимерный скелет может быть линейным или разветвленным. Разветвленные полимерные скелеты в общем виде известны в данной области техники. Как правило, разветвленный полимер содержит центральную сердцевинную структуру (central branch core moiety) и множество линейных полимерных цепей, присоединенных к центральной сердцевинной структуре. ПЭГ обычно применяется в его разветвленных формах, которые можно получить путем добавления оксида этилена к различным полиолам, таким как глицерин, пентаэритрит и сорбит. Центральную структуру можно также получить из некоторых аминокислот, таких как лизин или цистеин. В одном примере разветвленный полиэтиленгликоль можно представить общей формулой вида R(-ПЭГ-ОН)m, где R представляет собой ядро полимера, например глицерин или пентаэритрит, a m - число ветвей. Многофункциональные (multiarmed) молекулы ПЭГ, например, те, что описаны в патенте США №5932462, включенном в настоящее описание полностью посредством ссылки, также можно применять в качестве полимерного скелета.

[0030] На Фиг.8 показан пример разветвленного полимера ПЭГ, применяемый в воплощениях данного изобретения, обозначенный здесь как "SA-глицерин-ПЭГ." На Фиг.8А показан пример компонента SA-глицерин-ПЭГ полимеров CMP-SA-глицерин-ПЭГ или SA-глицерин-ПЭГ, присоединенного к гликану или к аминокислоте полипептида. На Фиг.8 В показан фрагмент SA-глицерин-ПЭГ, присоединенный гликану или полипептиду через остаток галактозы (Gal). На Фиг.8С показан фрагмент SA-глицерин-ПЭГ, присоединенный к гликану или полипептиду через остаток Gal-GalNAc. На Фиг.8D показан фрагмент SA-глицерин-ПЭГ, присоединенный к аминокислоте полипептида через группу Gal-GalNAc. В различных воплощениях АА - это треонин или серин. В одном примере воплощения АА превращается в сайт O-сцепленного гликозилирования путем делеции В-домена полипептида FVIII. Обсуждение в нижеследующем абзаце [0032], касающееся молекулярного веса этого полимера, в общем случае применимо к разветвленному ПЭГ, показанному на Фиг.8. На Фиг.8 индекс "n" может быть любым целым числом, которое соответствует линейному (или же разветвленному) полимеру m-PEG желаемого молекулярного веса, что обсуждено в абзаце [0032]. В различных воплощениях "n" выбирают таким образом, чтобы линейный фрагмент m-PEG составлял примерно от 20 кДа до 40 кДа, например, около 20 кДа, около 30 кДа или около 40 кДа. Целые числа, соответствующие этим молекулярным весам m-PEG, составляют от примерно 400 (например, около 455) до примерно 900 (например, около 910). Соответственно, "n" выбирают таким образом, чтобы получить разветвленный ПЭГ с молекулярным весом примерно от 40 кДа до 80 кДа, например, около 40 кДа, около 50 кДа, около 60 кДа, около 70 кДа или около 80 кДа.

[0031] Многие другие полимеры также можно применять в данном изобретении. Особенно применимы в данном изобретении полимерные скелеты, которые имеют непептидную природу и являются водорастворимыми. Примеры подходящих полимеров включают, без ограничения, другие полиалкиленгликоли, например полипропиленгликоль ("PPG"), сополимеры этиленгликоля и пропиленгликоля и им подобные, полиоксиэтилированный полиол, полиолефиновый спирт, поливинилпирролидон, полигидроксипропилметакриламид, поли([альфа]-гидроксикислота), поливиниловый спирт, полифосфазен, полиоксазолин, поли(М-акрилоилморфолин), такие как описанные в патенте США №5629384, который включен в настоящее описание полностью посредством ссылки, а также их сополимеры, терполимеры и их смеси.

[0032] Несмотря на то что молекулярный вес каждой цепи полимерного скелета может варьироваться, обычно он находится в пределах примерно от 100 Да до 160000 Да, например, приблизительно от 5000 Да до 100000 Да. Более конкретно, размер каждого конъюгированного гидрофильного полимера по настоящему изобретению может варьироваться примерно от 500 Да до 80000 Да, как, например, примерно от 1000 Да до 80000 Да; примерно от 2000 Да до 70000 Да; примерно от 5000 до 70000 Да; примерно от 5000 до 60000 Да; примерно от 10000 до 70000 Да; примерно от 20000 до 60000 Да; примерно от 30000 до 60000 Да; примерно от 30000 до 50000 Да; или примерно от 30000 до 40000 Да. Следует понимать, что эти размеры представляют собой скорее оценку, чем точные значения. В предпочтительном воплощении молекулы по изобретению конъюгированы с гетерогенной популяцией гидрофильных полимеров, таких как, например, ПЭГ размером, например, 10000, 40000 или 80000 Да ± примерно 5000, примерно 4000, примерно 3000, примерно 2000 или примерно 1000 Да.

[0033] O-связанный олигосахарид: Как N-гликаны, так и O-гликаны присоединяются к белкам клетками, продуцирующими данный белок. Клеточный аппарат N-гликозилирования распознает и гликозилирует сигнальные последовательности N-гликозилирования (мотивы N-X-S/T) в аминокислотной цепи, когда насцентный белок перемещается из рибосомы в эндоплазматический ретикулум (Kiely et al. 1976; Glabe et al. 1980).

[0034] Аналогично O-гликаны присоединяются по специфическим сайтам O-гликозилирования в аминокислотной цепи, но мотивы, запускающие O-гликозилирование, гораздо более гетерогенны, чем сигналы N-гликозилирования, и мы до сих пор не способны адекватным образом предсказывать сайты O-гликозилирования в аминокислотной последовательности (Julenius et al. 2004). Поэтому создание искусственных сайтов O-гликозилирования связано в некоторой мере с неопределенностью. Принято считать, что нативная молекула FVIII не содержит сайтов O-гликозилирования, и, таким образом, опытный специалист предположил бы, что следует создать по меньшей мере один искусственный сайт O-гликозилирования и вставить его в В-домен в связи с осуществлением на практике настоящего изобретения.

[0035] O-связанный олигосахарид в укороченном В-домене Фактора VIII можно, таким образом, присоединить к природной последовательности O-сцепленного гликозилирования или к последовательности O-сцепленного гликозилирования, которая была искусственно создана рекомбинантным способом.

[0036] В предпочтительном воплощении настоящего изобретения O-связанный олигосахарид присоединен к природной последовательности O-сцепленного гликозилирования, которая не подвержена гликозилированию в молекуле Фактора VIII дикого типа, но становится доступной для O-гликозилирования вследствие укорочения В-домена. Пример такой последовательности приведен в Примерах и в SEQ ID NO 2 (укороченный В-домен соответствует аминокислотам 742-763). Возможно, что "скрытый" сайт O-гликозилирования в SEQ ID NO 2 также будет гликозилирован, даже если укорочение В-домена произойдет где-то в другом месте, т.е. если укороченный В-домен будет несколько короче (например, на 1, 2, 3, 4 или 5 аминокислот короче, чем SEQ ID NO 2) или длиннее (например, на 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45 или 50 аминокислот) по сравнению с SEQ ID NO 2. Такой подход, связанный с активацией "скрытого" сайта O-гликозилирования путем укорочения В-домена, а не с созданием искусственного сайта O-гликозилирования, имеет преимущество в том, что создается молекула с благоприятным профилем безопасности (т.е. со сниженной аллергенностью и т.д.). Могут быть аналогично активированы и другие сайты O-гликозилирования в В-домене Фактора VIII при укорочении молекул различным образом.

[0037] Глико-ПЭГилирование O-связанного олигосахарида: Биосинтез O-гликанов можно модифицировать и прерывать добавлением остатков сиаловой кислоты на сравнительно ранних этапах биосинтеза. Определенные энзимы - сиалилтрансферазы - способны воздействовать на GalNAca-Ser/Thr или же на подтипы структур (core subtypes) O-гликанов ранней стадии биосинтеза, после воздействия энзима Core 1 GalT. Термин «Т-антиген» (Т antigen) связан с присутствием дисахарида Galp1-3GalNAca-Ser7Thr. При синтезе таких структур возникает конкуренция между гликозилтрансферазами за один и тот же субстрат, и, таким образом, уровни экспрессии гликозилтрансфераз и их субклеточное распределение в аппарате Гольджи определяют структурный выход в биосинтезе O-гликанов и их разнообразие. Как показано на Фиг.1, глико-ПЭГилированию подвержен только дисахарид Galp1-3GalNAcα-Ser/Thr.

[0038] Тем не менее доступное количество этой структуры можно существенно увеличить путем обработки белка сиалидазой или ферментом Corel GalT, или же их комбинацией. Результатом процесса глико-ПЭГилирования является присоединение сиаловой кислоты-ПЭГ к нативной структуре за счет образования α3-связи с дисахаридом Galp1-3GalNAcα-Ser/Thr белка-мишени (Фиг.1).

[0039] Другие гидрофильные полимеры также можно присоединять к O-связанным олигосахаридам. Основным требованием для энзиматического конъюгирования других гидрофильных полимеров с FVIII посредством O-гликана является возможность их присоединения к производному глицил-сиаловой кислоты за счет свободной аминогруппы, что раскрыто в WO 03031464. Для достижения этой цели существует большое разнообразие химических способов конъюгирования, известных специалистам в данной области техники. Примеры активированного биосовместимого полимера включают оксиды полиалкилена, такие как, без ограничения, полимеры полиэтиленгликоль (ПЭГ) и 2-(метакрилоилокси)этил фосфорилхолин (mРС) (как описано в WO 03062290), декстраны, коломиновые кислоты (colominic acids) или другие полимеры углеводной природы, полимеры аминокислот или специфических пептидных последовательностей, производные биотина, поливиниловый спирт (PVA), поликарбоксилаты, поливинилпирролидон, полиэтилен-со-ангидрид малеиновой кислоты, полистирол-со-ангидрид малеиновой кислоты, полиозазолин, поли(акрилоилморфолин), гепарин, альбумин, целлюлозы, гидролизаты хитозана, крахмалы, например гидроксиэтилен-крахмалы и гидроксипропил-крахмалы, гликоген, агарозы и их производные, гуаровая смола, пуллулан, инулин, ксантановая смола, каррагинан, пектин, гидролизаты альгиновой кислоты, другие полимеры и любые их эквиваленты.

[0040] Фармацевтическая композиция: В данном описании подразумевается, что термин «фармацевтическая композиция» предпочтительно охватывает композиции, включающие молекулы Фактора VIII по настоящему изобретению, подходящие для парентерального введения, такие как, например, готовые к использованию стерильные водные композиции или сухие стерильные композиции, которые можно растворять, например, в воде или водном буфере. Композиции по изобретению могут включать различные фармацевтически приемлемые эксципиенты, стабилизаторы и т.д.

[0041] Дополнительные ингредиенты в таких композициях могут включать увлажняющие вещества, эмульгаторы, антиоксиданты, объемообразующие агенты, агенты, регулирующие тоничность, хелатирующие агенты, ионы металлов, маслянистые растворители, белки (например, человеческий сывороточный альбумин, желатин или белки) и цвиттер-ион (например, аминокислоту, такую как бетаин, таурин, аргинин, глицин, лизин и гистидин). Подобные дополнительные ингредиенты, разумеется, не должны оказывать негативный эффект на общую стабильность препарата по настоящему изобретению. Парентеральное введение можно осуществлять путем подкожной, внутримышечной, внутрибрюшинной или внутривенной инъекции с помощью шприца, возможно шприца-ручки. В другом варианте парентеральное введение можно проводить с помощью инфузионного насоса. Другим вариантом является композиция, которая может представлять собой раствор или суспензию для введения соединения FVIII в форме назального или пульмонального спрэя. В качестве еще одного варианта фармацевтические композиции, содержащие соединение FVIII по изобретению, могут быть также приспособлены для чрескожного введения, например, путем инъекции без применения иглы или в форме накладки, возможно накладки для ионтофореза, или же для трансмукозального, например трансбуккального введения.

[0042] Таким образом, в первом аспекте настоящее изобретение относится к молекуле Фактора VIII с укороченным В-доменом, имеющей измененное время полужизни в кровотоке, причем указанная молекула ковалентно конъюгирована с гидрофильным полимером посредством O-связанного олигосахарида в укороченном В-домене, при этом активация Фактора VIII (активация молекулы) приводит к удалению ковалентно конъюгированного полимера.

[0043] Согласно одному воплощению гидрофильным полимером является ПЭГ. Размер полимера ПЭГ может варьироваться примерно от 10000 до 160000 Да; например, от 10000 до 80000 Да, например, около 10000; 15000; 20000; 25000; 30000; 35000; 40000; 45000; 50000; 55000; 60000; 65000, 70000; 75000; или 80000 Да. Предпочтительно, чтобы O-связанный олигосахарид был присоединен по сайту O-гликозилирования, который был получен путем укорочения В-домена, а не путем вставки искусственного сайта O-гликозилирования, не присутствующего в молекуле wt FVIII.

[0044] Согласно особенно предпочтительному варианту осуществления, молекула по настоящему изобретению включает аминокислотную последовательность, представленную в SEQ ID NO 2. Такие молекулы имеют уникальную особенность в том, что активированная молекула FVIII идентична нативной активной молекуле FVIII. Эта особенность, по-видимому, дает более удачные характеристики в испытаниях на безопасность.

[0045] Настоящее изобретение относится также к фармацевтическим композициям, включающим молекулы по настоящему изобретению.

[0046] Настоящее изобретение, кроме того, относится к способу получения молекулы по настоящему изобретению, причем указанный способ включает конъюгацию молекулы Фактора VIII с укороченным В-доменом с гидрофильным полимером, таким как, например, группа ПЭГ, посредством O-связанного олигосахарида в укороченном В-домене. Следовательно, настоящее изобретение также относится к молекулам, которые получены или которые можно получить таким способом.

[0047] В другом аспекте настоящее изобретение относится к способу лечения гемофилии, включающему введение пациенту, нуждающемуся в лечении, терапевтически эффективного количества молекул по изобретению.

[0048] В данном описании термин "лечение" относится к лекарственной терапии любого человека или животного, которые в этом лечении нуждаются. Предполагается, что указанный пациент прошел медицинский осмотр врачом-терапевтом, который поставил предварительный или окончательный диагноз, который указывал бы на то, что применение вышеупомянутого специального лечения будет благотворным для здоровья указанного пациента-человека или животного. Время проведения и цель указанной терапии может варьироваться от одного пациента к другому в соответствии с состоянием его здоровья. Таким образом, указанная терапия может быть профилактической, смягчающей, симптоматической и/или лечебной.

[0049] В еще одном аспекте настоящее изобретение относится к применению молекулы по изобретению в качестве лекарства, а также к применению молекулы по изобретению для изготовления лекарства для лечения гемофилии.

[0050] В последнем аспекте настоящее изобретение относится к способу разработки молекулы Фактора VIII с укороченным В-доменом по настоящему изобретению, который включает (i) укорочение В-домена и, возможно, проведение анализа аминокислотной последовательности этой укороченной молекулы Фактора VIII для выявления потенциальных сайтов О-сцепленного гликозилирования, (ii) синтез молекул в подходящих клетках хозяина и (iii) отбор молекул, содержащих O-связанные гликаны в укороченном В-домене.

Краткое описание графических материалов

[0051] На рисунках размер конъюгированных групп в некоторых случаях обозначен как "К", и здесь имеется в виду, что это эквивалент кДа (килодальтон).

[0052] Фиг.1: Схематическое изображение процесса глико-ПЭГилирования O-связанных олигосахаридов. Данная схема не представляет исчерпывающий перечень возможных путей, приводящих к продуктам, получаемых в примерах.

[0053] Фиг.2: Ионообменная хроматография реакционной смеси на смоле Source 15Q (А). Денатурирующий электрофорез в полиакриламидном геле (SDS-PAGE) с молекулярными маркерами (слева) собранной фракции (В).

[0054] Фиг.3: Очистка продукта с блокированными группами на смоле Superdex 200 в ходе эксклюзионной хроматографии.

[0055] Фиг.4: Свертывающая активность O-глико-ПЭГилированного rFVIII при использовании различных реагентов аРТТ. (А) - соотношение между свертывающей активностью и хромогенной активностью. (В) - удельная свертывающая активность.

[0056] Фиг.5: In vivo эффекты соединения 40К-ПЭГ-[O]-N8 (время до наступления окклюзии) у мышей FVIII КО.

[0057] Фиг.6: Блок-схема, отображающая стадии способа, задействованные при получении глико-ПЭГилированного Фактора FVIII по изобретению.

[0058] Фиг.7: Схематическое представление молекулы Фактора VIII по настоящему изобретению, полученной в Примерах.

ПРИМЕРЫ

Пример 1

Получение рекомбинантного O-гликозилированного Фактора VIII с укороченным В-доменом

[0059] Пример аминокислотной последовательности молекулы Фактор VIII с делецией В-домена дан в SEQ ID NO 2. Этот полипептид можно также обозначить как "N8". Эта молекула включает 21-аминокислотную последовательность линкера (SFSQNSRHPSQNPPVLKRHQR - подчеркнутое S - это остаток серина с O-гликаном, который ПЭГилирован в Примере 2).

[0060] Молекулы Фактора VIII по настоящему изобретению могут быть обозначены в Примерах различным образом - но все упоминания молекул Фактора VIII относятся к молекулам Фактора VIII по изобретению или в других случаях к молекулам Фактора VIII в процессе превращения в молекулы Фактора VIII по изобретению.

[0061] SEQ ID NO 2:

ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSWYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTWITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDWRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGA QTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKWFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPWNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Линия клеток и способ культивирования:

[0062] С помощью кДНК Фактора VIII была разработана плазмида для экспрессии в клетках млекопитающих, кодирующая Фактор VIII с делецией В-домена (BDD), имеющий аминокислотную последовательность, представленную в SEQ ID NO 2. Эта плазмида кодирует тяжелую цепь Фактора VIII, включающую аминокислоты 1-740 полноразмерного человеческого Фактора VIII, и легкую цепь Фактора VIII, включающую аминокислоты 1649-2332 полноразмерного человеческого Фактора VIII. Последовательности тяжелой и легкой цепей соединены 21-аминокислотным линкером с последовательностью аминокислот 741-750 и 1638-1648 полноразмерного человеческого Фактора VIII. Клетки яичника китайского хомячка (СНО) трасфецировали плазмидой, кодирующей Фактор VIII BDD, и производили отбор с помощью дигидрофолатредуктазной системы, что в конечном счете приводило к клональной суспензии клеток-продуцентов, культивируемых в среде, свободной от животных компонентов.

[0063] Первой стадией способа является посев виала клеток из виала рабочего банка клеток в среду для выращивания определенного химического состава, свободную от животных компонентов. После оттаивания клетки сначала инкубировали в матрасе (T-flask). Через один иди два дня после оттаивания клетки перемещали в колбу шейкера и объем культуры увеличивали путем последовательных разведений, так чтобы выдерживать плотность клеток в пределах 0.2-3.0×106 клеток/мл. Следующей стадией является перемещение культуры из колбы шейкера в засевные биореакторы. На этой стадии объем культуры еще возрастал перед конечным переносом в продукционный биореактор. На всех стадиях увеличения объема инокулята применяли ту же среду определенного химического состава, свободную от животных компонентов. После переноса в продукционный биореактор в среду добавляли компоненты, которые повышают концентрацию продукта. В продукционном биореакторе клетки культивировали в циклическом периодическом процессе, где время цикла составляет три дня. При сборе выращенных клеток 80-90% культурального объема перемещали в резервуар для сбора клеток. Оставшуюся культуральную жидкость затем разбавляли свежей средой так, чтобы получить исходную плотность клеток, и затем начинали новый период культивирования.

[0064] Порцию собранного материала осветляли путем центрифугирования и фильтрации и перемещали его в резервуар для хранения перед началом процесса очистки. К собранному материалу, не содержащему клетки, добавляли буфер в резервуар для хранения для стабилизации рН.

[0065] По окончании производственного цикла клетки собирали и замораживали, для того чтобы получить банк клеток по окончании производства. Этот банк клеток тестировали на микоплазму, стерильность и загрязненность вирусами.

Очистка:

[0066] Для выделения Фактора VIII с делецией В-домена из культуральной клеточной среды применяли четырехстадийный способ очистки, включающий стадию концентрирования на колонке Capto MMC, стадию иммуноаффинной (immunoabsorbent) хроматографии, стадию анионообменной хроматографии и, наконец, стадию гель-фильтрации. Как правило, применяли следующий способ: 11 литров стерильной фильтрованной среды наносили с помощью насоса на колонку (1.6×12 см) Capto MMC (GE Healthcare, Швеция), уравновешенную в буфере А: 20 мМ имидазол, 10 мМ СаСl2, 50 мМ NaCl, 0.02% Tween 80, рН=7.5, при скорости потока 15 мл/мин. Колонку промывали с помощью 75 мл буфера А с последующей промывкой с помощью 75 мл буфера А, содержащего 1.5 М NaCl. Белок элюировали с помощью 20 мМ имидазола, 10 мМ CaCl2, 0.02% Tween 80, 2.5 М NaCl, 8 М этиленгликоля, рН=7.5, при скорости потока 1 мл/мин. Собирали фракции по 8 мл и анализировали их на активность Фактора VIII (КоА-тест). Объединяли фракции, содержащие фактор VIII, и, как правило, получали суммарный объем порядка 50 мл.

[0067] Были разработаны моноклональные антитела к Фактору VIII (Kjaike Eur J Biochem 234 773). В ходе картирования эпитопов (результаты не приведены) было обнаружено, что эти антитела (F25) распознают дальний С-концевой участок последовательности тяжелой цепи от аминокислотного остатка 725 до 740. Антитела F25 были иммобилизованы на NHS-активированной смоле Sepharose 4 FF (GE Healthcare, Bio-Sciences AB, Упсала, Швеция) при плотности, составляющей 2.4 мг на мл геля, по существу, как описано производителем. Собранный в предыдущей стадии пул разбавляли в 10 раз с помощью 20 мМ имидазола, 10 мМ CaCl2, 0.02% Tween 80, pH=7.3 и наносили на колонку с F25 Sepharose (1.6×9.5 см), уравновешенную с помощью 20 мМ имидазола, 10 мМ CaCl2, 150 мМ NaCl, 0.02% Tween 80, 1 М глицерина, pH=7.3, при скорости потока 0.5 мл/мин. Колонку промывали уравновешивающим буфером до тех пор, пока сигнал в УФ-области не становился постоянным, а затем с помощью 20 мМ имидазола, 10 мМ CaCl2, 0.65 М NaCl, pH=7.3 до тех пор, пока сигнал в УФ-области снова не становился постоянным. Фактор VIII элюировали с помощью 20 мМ имидазола, 10 мМ CaCl2, 0.02% Tween 80, 2.5 М NaCl, 50% этиленгликоля, pH=7.3 при скорости потока 1 мл/мин. Собирали фракции по 1 мл и анализировали их на активность Фактора VIII (КоА-тест). Объединяли фракции, содержащие Фактор VIII, и, как правило, получали суммарный объем порядка 25 мл.

[0068] Готовили буфер А: 20 мМ имидазол, 10 мМ CaCl2, 0.02% Tween 80, 1 М глицерин, pH=7.3 и буфер В: 20 мМ имидазол, 10 мМ СаСl2, 0.02% Tween 80, 1 М глицерин, 1 М NaCl, pH=7.3 для стадии ионного обмена. Уравновешивали колонку (1×10 см) Macro-Prep 25Q Support (Bio-Rad Laboratories, Геркулес, Калифорния, США) с помощью 85% буфера А/15% буфера В при скорости потока 2 мл/мин. Пул, собранный в предыдущей стадии, разбавляли в 10 раз буфером А и наносили на колонку с помощью насоса при скорости потока 2 мл/мин. Колонку промывали с помощью 85% буфера А/15% буфера В при скорости потока 2 мл/мин и элюировали Фактор VIII в режиме линейного градиента от 15% буфера В до 70% буфера В объемом 120 мл при скорости потока 2 мл/мин. Собирали фракции по 2 мл и анализировали их на активность Фактора VIII (КоА-тест). Объединяли фракции, содержащие Фактор VIII, и, как правило, получали суммарный объем около 36 мл.

[0069] Пул, полученный на предыдущей стадии, наносили на колонку (2.6×60 см) Superdex 200 prep grade (GE Healthcare, Bio-Sciences AB, Упсала, Швеция), уравновешивали и элюировали при скорости 1 мл/мин с помощью 20 мМ имидазола, 10 мМ СаСl2, 0.02% Tween 80, 1 М глицерина, 150 мМ NaCl, pH=7.3. Собирали фракции по 3 мл и анализировали их на активность Фактора VIII (КоА-тест). Объединяли фракции, содержащие Фактор VIII, и, как правило, получали суммарный объем около 57 мл. Пул, содержащий Фактор VIII, хранили при - 80°С.

[0070] С помощью указанного выше четырехстадийного способа очистки был получен общий выход примерно 15%, который оценивали по активности КоА, а также в ходе El-ISA.

[0071] Линия клеток, используемая для получения N8, является рекомбинантной линией клеток яичника китайского хомячка (СНО), стабильно трасфецированных плазмидой экспрессии #814 F8-500 в pTSV7, состоящей из вектора экспрессии pTSV7 со вставкой, содержащей кДНК, кодирующую белок F8-500. Подразумевается, что "N8" в данном описании относится к белку, имеющему аминокислотную последовательность, приведенную в SEQ ID NO 2. Начиная с N-конца белок F8-500 (N8) состоит из сигнального пептида FVIII (аминокислоты с -19 по -1), за которым следует тяжелая цепь FVIII без В-домена (аминокислоты 1-740), 21-аминокислотный линкер (SFSQNSRHPSQNPPVLKRHQR) и легкая цепь FVIII (аминокислоты 1649-2332 человеческого FVIII дикого типа). Последовательность 21-аминокислотного линкера получена из В-домена FVIII и состоит из аминокислот 741-750 и 1638-1648 полноразмерного FVIII.

[0072] Клетки СНО трансфецировали с помощью 814 F8-500 в pTSV7 и производили отбор с помощью дигидрофолатредуктазной системы, что в конечном счете давало клональную суспензию клеток-продуцентов, культивируемых в свободной от животных компонентов среде для выращивания. Производственный цикл начинали с оттаивания виала банка рабочих клеток и наращивания количества клеток с последующим их переносом в продукционный биореактор. Такую же среду определенного химического состава, свободную от животных компонентов, применяли на всех стадиях увеличения объема инокулята. После переноса в продукционный биореактор в среду добавляли компоненты, которые повышают концентрацию продукта. В продукционном биореакторе клетки культивировали в циклическом периодическом процессе с продолжительностью цикла, равной трем дням. При сборе полученного материала 80-90% объема культуры переносили в резервуар для сбора выращенных клеток. Оставшуюся культуральную жидкость затем разбавляли свежей средой, так чтобы получить исходную плотность клеток, и затем начинали новый период культивирования. Собранную порцию материала осветляли в ходе центрифугирования и фильтрации и переносили в резервуар для хранения до начала процесса очистки. К собранному материалу, не содержащему клетки, добавляли буфер в резервуар для хранения с целью стабилизации рН.

Пример 2

ПЭГилирование рекомбинантного Фактора VIII с укороченным и О-гликозилированным В-доменом:

[0073] Молекулы рекомбинантного Фактора VIII, полученные в Примере 1, конъюгировали с полиэтиленгликолем (ПЭГ) по следующему способу:

[0074] Для того чтобы глико-ПЭГилирование молекул рекомбинантного Фактора VIII, полученных в Примере 1, было эффективным, предпочтительно, чтобы концентрация FVIII была >5 мг/мл. Поскольку FVIII в обычных условиях не растворим при такой концентрации, провели скрининг выбранных буферных композиций (см. некоторые из этих результатов в Табл. 1).

[0075] На основании этих данных было обнаружено, что подходящим реакционным буфером является буфер, содержащий 50 мМ MES, 50 мМ CaCl2, 150 мМ NaCl, 20% глицерин, рН 6.0.

[0076]

Таблица 1
Оценка влияния условий реакции на растворимость и агрегацию FVIII
Состав реакционного буфера Преципитат % Агрегата
10 мМ гистидин, 260 мМ глицин, 1% сахароза, 10 мМ CaCl2 ДА n.d. (не определено)
50 мМ HEPES, 10 мМ СаСl2, 150 мМ NaCl, рН 7; ДА n.d.
50 мМ MES, 10 мМ CaCl2, 150 мМ NaCl, рН 6.0 ДА n.d.
50 мМ MES, 50 мМ CaCl2, 150 мМ NaCl, рН 6.0 НЕТ 8
50 мМ MES, 50 мМ СаСl2, 150 мМ NaCl, 10% глицерин, рН 6.0 НЕТ 5
50 мМ MES, 50 мМ СаСl2, 150 мМ NaCl, 20% глицерин, рН 6.0 НЕТ 1.0-1.7

[0077] Рекомбинантный FVIII, очищенный, как описано выше, концентрировали в реакционном буфере либо путем ионного обмена на колонке 50 HQ с применением стадии элюирования, либо на фильтре Sartorius Vivaspin (PES) с отсечкой 10 кДа или на фильтре Amicon 10 кДа MWCO PES до концентрации 6-10 мг/мл. Глико-ПЭГилирование FVIII инициировали путем смешивания Фактора VIII (BDD) (конечная концентрация ~4.7 мг/мл) с сиалидазой (A. urifaciens) (159 МЕ/мл), СМР-8SА-глицерин-ПЭГ-40 кДа (5 моль-экв.) и МВР-ST3Gal1 (540 ME) в реакционном буфере (50 мМ MES, 50 мМ CaCl2, 150 мМ NaCl, 20% глицерин, 0.5 мМ антипаин, рН 6.0). Реакционную смесь инкубировали при 32°С до достижения степени конверсии ~20-30% от общего.

[0078] После инкубации образец разбавляли буфером А (25 мМ Tris, 5 мМ CaCl2, 20 мМ NaCl, 20% глицерин, рН 7.5) и наносили на колонку Source 15Q (1 см id (внутренний диаметр) ×6 см, 4.7 мл, 1 мл/мин, 280 нм). Связавшийся материал промывали буфером А и элюировали в режиме ступенчатого градиента буфером В (25 мМ Tris, 5 мМ CaCl2, 1 М NaCl, 20% глицерин, рН 7.5). Глико-ПЭГилированный Фактор VIII-(O)-SА-глицерин-ПЭГ-40 кДа элюировался с колонки при ~25% буфера В. На Фиг.2 показана ионообменная хроматография реакционной смеси на колонке Source 15Q.

[0079] Для того чтобы блокировать свободные остатки галактозы, которые появляются на поверхности N-гликанов при обработке сиалидазой, суммарную фракцию Фактора VIII-SА-глицерин-ПЭГ-40 кДа (конечная концентрация 1.0 мг/мл) смешивали с CMP-SA (2000 моль-экв.) и MBP-SBD-ST3Gal3 (400 МЕ/мл) в реакционном буфере 50 мМ MES, 20 мМ СаСl2, 150 мМ NaCl, 10 мМ MnCl2, 20% глицерин, рН 6.0 и инкубировали при 32°С в течение 11 часов.

[0080] Полученный глико-ПЭГилированный Фактор VIII-SA-глицерин-ПЭГ-40 кДа с блокированными группами отделяли от CMP-SA и ST3Gal3 с помощью гель-фильтрации на колонке Superdex 200 (10 см id×300 мм; 280 нм), уравновешенной с помощью 50 мМ MES, 50 мМ CaCl2, 150 мМ NaCl, 10% глицерина, рН 6.0; при скорости 0.25 мл/мин. Продукт - Фактор VIII-SA-глицерин-ПЭГ-40 кДа - элюировался через 38 мин. На Фиг.3 показана очистка продукта с блокированными группами в ходе эксклюзионной хроматографии с помощью Superdex 200. Фракцию, соответствующую пику, собирали, разделяли на аликвоты и подвергали последующему анализу.

[0081] Целью процедуры блокирования является уменьшение клиренса in vivo конъюгированной молекулы Фактора VIII.

Пример 3

Активность O-гликан-ПЭГилированного rFVIII в хромогенном анализе активности FVIII:

[0082] Активность O-глико-ПЭГилированного rFVIII, полученного в Примере 2, оценивали в ходе хромогенного анализа FVIII с помощью реагентов Coatest SP (Chromogenix) следующим образом: образцы rFVIII и калибратор (7-ой международный стандарт FVIII от NIBSC) разводили в буфере Coatest для анализа (50 мМ Tris, 150 мМ NaCl, 1% BSA, pH 7.3, с консервантом). По пятьдесят мкл образцов, стандартов и отрицательного контроля (буфер) наносили на 96-луночные планшеты для микротитрования (Nunc) в дублях. Смешивали реагент "Фактор IXa/Фактор X", фосфолипидный реагент и CaCl2 из набора Coatest SP в соотношении 5:1:3 (об.:об.:об.) и добавляли в лунки по 75 мкл полученной смеси. После инкубации в течение 15 мин при комнатной температуре добавляли 50 мкл смеси "субстрат Фактора Ха S-2765/ингибитора тромбина 1-2581" и проводили реакцию в течение 10 мин при комнатной температуре, после чего добавляли по 25 мкл 1 М лимонной кислоты, pH 3. Измеряли абсорбцию при 415 нм на ридере планшетов для микротитрования Spectramax (Molecular Devices), с длиной волны сравнения 620 нм. Значение для отрицательного контроля вычитали из значений для всех образцов и строили калибровочную кривую в виде линейной регрессии значений абсорбции, нанесенных против концентрации FVIII. Удельную активность вычисляли путем деления активности образцов на концентрацию белка, определенную с помощью эксклюзионной HPLC путем вычисления площади пика легкой цепи на хроматограмме HPLC, т.е. фрагмент ПЭГ не был включен в расчет. Данные в Табл. 2 показывают, что удельная хромогенная активность сохранялась для O-глико-ПЭГилированных соединений rFVIII, и это означает, что активность Фактора VIII сохранялась в ПЭГилированных вариантах.

Соединение rFVIII Удельная хромогенная активность (МЕ/мг)
rFVIII 11819±727 (5)
10 кДа-ПЭГ-[O]-rFVIII Около 8331 (1)
40 кДа-ПЭГ-[O]-rFVIII 9760±886 (8)
80 кДа-ПЭГ-[O]-rFVIII 12129±2643 (3)

Данные представляют средние и стандартные отклонения нескольких независимых определений (их число указано в скобках).

Пример 4

Активность O-гликан-ПЭГилированного rFVIII в анализе свертывающей активности FVIII

[0084] Активность O-глико-ПЭГилированного rFVIII оценивали далее в анализе свертывающей активности FVIII. Образцы rFVIII разводили в HBS/BSA (20 мМ HEPES, 150 мМ NaCl, pH 7.4 с 1% BSA) до концентрации примерно 10 Е/мл с последующим 10-кратным разведением в плазме без FVIII, содержащей VWF (Dade Behring). Образцы и стандарт калиброванной плазмы (HemosIL Calibration Plasma, Instrumentation Laboratory) последовательно разводили в HBS/BSA до четырех (образцы) или шести (калибратор) различных концентраций. Время свертывания измеряли на приборе ACL9000 (Instrumentation laboratory) с применением однофакторной программы, где образцы/стандарты смешивали с равными объемами лишенной FVIII плазмы, содержащей VWF (Dade Behring), ионами кальция и реагентами аРТТ и определяли время свертывания. В качестве реагентов использовали следующие: Synthasil (HemosIL, Instrumentation Laboratory), Actin FS (Активированный реагент PTT, Dade Behring), Stago (STA® PTT-A, Stago) и dAPPTin (DAPPTIN®TC, Technoclone). Активности образцов вычисляли по графику зависимости в полулогарифмических координатах времени свертывания от концентрации калибратора.

[0085] Свертывающая активность (Фиг.4) соединений O-глико-ПЭГилированного rFVIII (контроль, 10, 40 и 80 кДа ПЭГ соответственно) уменьшалась в различной степени, в зависимости от размера молекулы ПЭГ и применяемых реагентов аРТТ. Применение Synthasil или dAPPTin в качестве реагентов аРТТ приводило к постепенному снижению свертывающей активности с размером ПЭГ. С реагентом аРТТ (Stago) наблюдалась на 50% более низкая удельная свертывающая активность для всех трех оцениваемых О-глико-ПЭГилированных соединений N8. Если в качестве реагента аРТТ применяли Actin FS, удельная свертывающая активность держалась на уровне примерно 10000 МЕ/мг. Эти данные указывают на то, что на ход анализа аРТТ влияет присутствие фрагмента ПЭГ, однако при использовании конкретных реагентов аРТТ, например, Actin FS, удельная свертывающая активность rFVIII не нарушалась при O-глико-ПЭГилировании.

Пример 5:

Влияние O-сцепленного ПЭГилирования rFVIII на активность кофактора и на скорость активации FVIII

[0086] Внедрение активированного FVIII в комплекс FIXa-FVIIIa повышает каталитическую эффективность FIXa-катализируемой активации FX на пять порядков по величине (van Dieijen et al. (1981) J Biol Chem 256:3433), и характеристика сборки комплекса FIXa-FVIIIa и кинетики активации FX является чувствительным методом измерения функциональной связности молекул FVIIIa. Активность кофактора тромбин-активированного rFVIII или ПЭГ-rFVIII характеризовали путем определения кинетических параметров FIXa-катализируемой активации FX в присутствии фосфолипидов и тромбин-активируемого rFVIII или ПЭГ-rFVIII. Применяя анализ активности FVIIIa (анализ активности FIXa-кофактора), осуществляли обратное титрование FIXa и FVIIIa против фиксированной концентрации (0.1 нМ) rFVIIIa или FIXa соответственно для получения величины кажущегося сродства FIXa к rFVIIIa (К1/2FIXa) и функциональной концентрации FVIIIa. Были получены константа Михаэлиса (km) и скорость каталитической реакции (kcat) активации FX с помощью титрования FX против фиксированной концентрации комплекса FIXa-FVIIIa.

[0087] Определения активности FIXa-кофактора проводили следующим образом. Тромбин-активированные варианты rFVIII и ПЭГ-rFVIII готовили непосредственно перед каждым анализом путем инкубации rFVIII (обычно 0.7 нМ, 1 Е/мл) с 5 нМ человеческого α-тромбина в течение ровно 30 секунд при 37°С. После этого количественно определяли скорость активации FX путем переноса части пробы из описанной выше реакции активации в приготовленную смесь FIXa, фосфолипидных везикул (Phospholipid TGT, Rossix [Мельндаль, Швеция]), гирудина, Pefabloc Xa и CaCl2; активацию FX инициировали путем добавления FX и проводили реакцию в течение 30 секунд или 60 секунд при 37°С. Активацию останавливали разбавлением реакции активации FX охлажденным на льду буфером, содержащим EDTA. С помощью специфического хромогенного субстрата Fxa проводили количественное определение концентрации Fxa, путем считывания абсорбции при 405 нм на ридере для ELISA. Для переведения единиц абсорбции в концентрацию FXa использовали стандартную кривую, полученную с помощью очищенного Fxa. Для переведения скорости активации FX в концентрацию rFVIIIa использовали скорость каталитической реакции комплексов FIXa-rFVIIIa, собранных из активированных вариантов rFVIII или ПЭГ-rFVIII.

[0088] Скорость тромбин-катализируемой активации rFVIII измеряли путем подсчета начального (с 0 по 3 мин) образования rFVIIIa в смеси, содержащей 0.7 нм rFVIII или ПЭГ-rFVIII и 0.13 нм человеческого α-тромбина. Образование FVIIIa было линейным по времени. Скорость активации FVIIIa выражали в молях rFVIIIa, образовавшихся за минуту на количество молей rFVIII, присутствующего изначально (v/[rFVIII]0).

[0089] O-сцепленное глико-ПЭГилирование rFVIII не влияло на скорость тромбин-катализируемой активации rFVIII или на km или kcat FIXa-катализируемой активации FX в присутствии активированного rFVIII (см. Табл. 3). Более того, O-сцепленное глико-ПЭГилирование не влияло на кажущуюся Kd взаимодействия rFVIIIa-FIXa (К1/2FIXa).

[0090] На Фиг.4 показана свертывающая активность O-глико-ПЭГилированного rFVIII, определенная с помощью различных реагентов аРТТ.

Данные приведены в виде соотношения между свертывающей активностью и хромогенной активностью (А) или в виде удельной свертывающей активности (В). Показаны значения средних и стандартных отклонений трех независимых экспериментов.

[0091]

Таблица 3
Скорость активации rFVIII и кинетические константы активации FX под действием FIXa
Скорость Активация FX
Молекула FVIII активации FVIII К1/2FIXa Km kcat
10-3×мин-1 нМ нМ С-1
rFVIII 10.4±1.9 0.88±0.46 7.9±1.7 4.5±1.9
40К-ПЭГ-[O]-rFVIII 9.9±3.8 0.42±0.02 6.4±0.8 4.7±0.2
80К-ПЭГ-[O]-rFVIII 9.8±3.4 1.11±0.12 8.2±0.6 3.7±0.4

Данные представляют средние и стандартные отклонения 3-6 измерений.

Пример 6

Фармакокинетика глико-ПЭГилированного FVIII с делецией В-домена (BDD) в нокаутированных по FVIII мышах (FVIII КО) и нокаутированных по vWF мышах (vWF КО)

[0092] Была изучена кинетика глико-ПЭГилированного BDD-FVIII с различным размером ПЭГ после внутривенного введения 280 МЕ/кг мышам FVIII КО.

[0093] Были изучены следующие соединения: BDD-FVIII, BDD-FVIII - 10К ПЭГ (O-гликан, 0129-0000-1005), BDD-FVIII - 40К ПЭГ (O-гликан, 0129-0000-1003), BDD-FVIII-2×40K ПЭГ (О- и М-гликан 0129-0000-1008-1А), BDD-FVIII - 80К ПЭГ (N-гликан, 0129-0000-1012, O-гликан 0129-0000-1009).

Схема экспериментов на животных:

[0094] Мышей, нокаутированных по гену Фактора VIII (FVIII КО), разводили в компании Taconic M&B. Данная линия получена удалением 16 экзона у мышей C57BI/6. Опыты проводили на смеси самцов и самок (ок. 1:1) с приблизительным весом 25 г, в возрастном диапазоне 19-26 недель. Полное обратное скрещивание мышей не проводилось. В этой линии мышей не детектировался FVIII.

[0095] Мышам проводили однократные внутривенные инъекции в хвостовую вену 280 МЕ/кг перечисленных выше соединений. Если инъекция происходила рядом с веной, эту мышь заменяли другой мышью. После введения дозы получали образцы крови из глазного синуса начиная с момента «перед дозированием» и вплоть до 64 часов после дозирования с помощью непокрытых стеклянных капилляров. От каждой мыши брали по три образца, и в каждый момент времени собирали по 2, 3 или 4 образца. Кровь стабилизировали в цитрате натрия (9:1) и разводили в буфере FVIII СОА SP (1:4), после чего центрифугировали 5 мин при 4000 g. Плазму, полученную из разбавленной крови, замораживали на сухом льду и хранили при -80°С перед количественным определением (анализ хромогенной активности FVIII и/или анализ антигена FVIII).

Количественный анализ плазмы

[0096] Хромогенную активность FVIII определяли с помощью реагентов из набора Coatest SP (Chromogenix). По 50 мкл разведенных образцов плазмы и калибраторов (калибровочная плазма ILS) в буфере Coatest SP, а также отрицательного контроля (чистый буфер) наносили на 96-луночные планшеты для микротитрования (Nunc) в дублях. Смешивали реагент "Фактор IXa/Фактор X", фосфолипидный реагент и CaCl2 из набора Coatest SP в соотношении 5:1:3 (об.:об.:об.) и добавляли в лунки по 75 мкл этой смеси. Через 15 мин инкубации при комнатной температуре добавляли 50 мкл смеси "субстрат Фактора Ха S-2765/ингибитор тромбина 1-2581" и проводили реакцию в течение 10 мин при комнатной температуре, после чего добавляли 25 мкл 2% лимонной кислоты. Измеряли абсорбцию при 405 нм на ридере планшетов для микротитрования Spectramax (Molecular Devices). Активность FVIII в образцах плазмы рассчитывали по калибровочной кривой, полученной с помощью разведения калиброванного международного стандарта плазмы (ILS).

[0097] Анализ антигена FVIII проводили с помощью коммерчески доступного набора ELISA Asserachrom VIII:CAg (Diagnostica Stago), с применением двух моноклональных антител, направленных к легкой цепи человеческого FVIII. Калибраторы (разведения соединений) или образцы плазмы, разбавленные по меньшей мере в 50 раз в буфере для разведении Coatest SP, имеющегося в наборе, наносили на планшет с предварительно покрытыми лунками и проводили ELISA согласно инструкциям производителя. Величины, использованные в отчете о результатах фармакокинетического исследования, получены по стандартной кривой, построенной с помощью самих соединений.

Оценка фармакокинетических параметров:

[0098] Фармакокинетический анализ данных проводили некомпартментными способами (NCA), с применением ILS в качестве калибратора (данные основаны на хромогенной активности), с помощью самих соединений в качестве калибратора (данные основаны на ELISA). По этим данных оценивали следующие параметры: Сmax (максимальная концентрация; соответствует забору крови в первый момент времени после внутривенного введения), Тmax (время максимальной концентрации; соответствует первому моменту времени после внутривенного введения это забор пробы), AUC0-∞ (площадь под кривой от времени t=0 до бесконечности), Т1/2 (конечный период полувыведения), CL (клиренс) и Vss (объем распределения в стабильном состоянии). Все расчеты были сделаны с помощью WinNonlin Pro, версия 4.1.

[0099] После внутривенной инъекции 280 МЕ/кг BDD-FVIII, BDD-FVIII-10 кДа ПЭГ, BDD-FVIII - 40 кДа ПЭГ, ВDD-FVIII-2×40 кДа ПЭГ и ВDD-FVIII-60 кДа ПЭГ мышам FVIII КО время полужизни возрастало с увеличением размера ПЭГ в интервале от 7.8 ч (BDD-FVIII) до 15-16 ч (Табл. 4), что соответствует двукратному увеличению. Аналогично, снижался клиренс (CL), а среднее время удерживания (MRT) возрастало с увеличением размера ПЭГ (Табл. 4).

[0100]

Таблица 4
Оценка фармакокинетических параметров FVIII, глико-ПЭГилированного с помощью ПЭГ различного размера, после внутривенного введения мышам FVIII КО на основании данных по хромогенной активности (BDD:с делецией В-домена)
Соединение Доза (МЕ/кг) Т1/2, (ч) CL (мл/ч/кг) MRT(4) Пролонгация (кратность)
BDD-FVIII 280 6.7-9.3 8.1-10 9.9-11 1
BDD-FVIII 10 кДа ПЭГ (O-гликан) 280 10 8.5 16 1.3
BDD-FVIII-2×40 кДа ПЭГ 280 13 5.8 19 1.9-2.1
BDD-FVIII 40 кДф ПЭГ (O-гликан) 280 15-16 3.6-3.8 20-22 1.7
BDD-FVIII 80 кДа ПЭГ (O-гликан) 280 15 6.4 21 1.9

Вывод:

[0101] Глико-ПЭГилирование BDD-FVIII увеличивало Т1/2 в 1.3-2.1 раза по сравнению с BDD-FVIII после внутривенного введения 280 МЕ/кг мышам FVIII КО. Увеличение Т1/2 наблюдалось по мере увеличения размера ПЭГ-группы, в интервале от 10 кДа до 80кДа ПЭГ.

Пример 7

[0102] Пролонгированный гемостатический эффект 40K-ПЭГ-[O]-N8, по сравнению с Advate, в модели FеСl3-индуцированного повреждения у мышей с гемофилией А.

[0103] Исследовали продолжительность действия 40К-ПЭГ-[O]-N8, по сравнению с рекомбинантным FVIII (Advate) в модели FeСl3-индуцированного повреждения у мышей с гемофилией A (F8-KO).

[0104] Мышей анестезировали и помещали на грелку-матрац (37°С) для поддержания температуры тела. Освобождали сонную артерию и помещали вокруг нее датчик потока (0.5 PSB Nanoprobe), который измеряет кровоток по ультразвуку. Индуцировали повреждение (химическое окисление, опосредованное ионами железа) путем аппликации фильтровальной бумаги (2×5 мм), свежесмоченной в 10% растворе FeCl3 вокруг высвобожденной сонной артерии. Фильтровальную бумагу удаляли через 3 мин. Затем артерию промывали три раза с помощью 0.9% NaCl и, наконец, применяли Surgilube (акустический соединитель) для вытеснения воздуха из датчика потока, чтобы обеспечить оптимальное измерение тока крови. Кровоток (мл/мин) записывали в течение 25 мин после удаления фильтровальной бумаги, пропитанной FeCl3, и определяли время окклюзии путем измерения времени (в мин) от удаления фильтровальной бумаги, пропитанной FeCl3, до тех пор, пока кровоток не становился равным 0 мл/мин. Если окклюзия не происходила по истечении 25 мин, время окклюзии все равно считали равным 25 мин, даже если окклюзия не происходила в течение всего наблюдаемого периода. Мышам F8-KO (n=6-10) вводили Advate (280 Е/кг), 40К-ПЭГ-[O]-М8 (280 Е/кг) или растворитель. Повреждение, индуцируемое FeCl3, осуществляли через 5 мин (немедленное действие) или через 24, 48, 60 и 72 часа после дозирования. Кровоток (мл/мин) записывали в течение 25 мин после удаления FeCl3, после чего определяли время окклюзии.

[0105] Закупорка не происходила у мышей F8-KO, которым вводили раствор, в то время как окклюзия произошла у всех мышей, которым вводили 40 кДа-ПЭГ-[O]-М8 или Advate, через 5 мин после введения дозы (немедленное действие) со средним временем окклюзии 4.3+0.4 мин и 5.2±0.7 мин соответственно. У мышей F8-KO, которым вводили 40 кДа-ПЭГ-[O]-М8, среднее время окклюзии возрастало до 13.8±3.4 мин через 72 часа после введения дозы. В отличие от этого у мышей F8-KO, которым вводили Advate, время окклюзии составило 13.0±3.4 мин и 15.9+2.9 мин через 24 и 48 часов соответственно. Важно подчеркнуть, что окклюзия не наблюдалась через 60 и 72 часа после введения Advate. Окклюзия происходила у всех мышей, которым вводили 40 кДа-ПЭГ-[O]-М8, через 24 часа после введения дозы, в то время как окклюзия наблюдалась только у 67% мышей, которым вводили Advate. Через 72 часа окклюзия все еще наблюдалась у 63% мышей, которым вводили 40 кДа-ПЭГ-[O]-N8, в то время как окклюзия не наблюдалась через 60 и 72 часа после введения Advate.

Длительный эффект 40 кДа-ПЭГ-[O]-N8 у мышей F8-KO.

[0106] Осуществляли FеCl3-индуцируемое повреждение через 5 мин (немедленное действие), 24, 48, 60 и 72 часов после введения дозы 280 МЕ/кг 40 кДа-ПЭГ-[O]-N8, 280 МЕ/кг Advate или растворителя. Кровоток (мл/мин) записывали в течение 25 мин после удаления FeCl3, после чего определяли время до наступления окклюзии. Через 60 и 72 часа после дозирования не происходила окклюзия у мышей, которым вводили Advate. Показаны средние и SEM 6-10 мышей на группу. Значения времени до окклюзии между различными группами сравнивали с помощью теста Краскела-Уоллиса, включая критерий Данна (Dunn's post test).*:p<0.05; **:р<0.01.

[0107] В заключение, 40 кДа-ПЭГ-[O]-N8 обладает существенно более длительным гемостатическим эффектом, по сравнению с Advate, в модели FeCl3-индуцируемого повреждения на мышах F8-KO.

1. Молекула предшественника Фактора VIII с укороченным В-доменом, имеющая увеличенное время полужизни в кровотоке, где В-домен соответствует аминокислотам 741-761 из SEQ ID NO 2, причем указанная молекула ковалентно конъюгирована с полиэтиленгликолем (ПЭГ) или полисахаридом размером 10-80 кДа посредством О-связанного олигосахарида по сериновому остатку в укороченном В-домене, который соответствует аминокислоте 750 в SEQ ID NO 2.

2. Молекула предшественника Фактора VIII с укороченным В-доменом, имеющая увеличенное время полужизни в кровотоке, имеющая аминокислотную последовательность, представленную в SEQ ID NO 2, причем указанная молекула ковалентно конъюгирована с полиэтиленгликолем (ПЭГ) или полисахаридом размером 10-80 кДа посредством О-связанного олигосахарида по сериновому остатку в положении 750 в SEQ ID NO 2.

3. Молекула по любому из пп. 1-2, где размер ПЭГ или полисахарида составляет около 40000 Да.

4. Фармацевтическая композиция для лечения гемофилии, включающая молекулу по любому из пп. 1-3 в терапевтически эффективном количестве и фармацевтически приемлемый эксципиент.

5. Способ получения молекулы согласно любому из пп. 1-3, включающий
(а) трансфекцию подходящей клетки-хозяина вектором, кодирующим белковую молекулу по любому из пп. 1-3,
(б) культивирование клетки-хозяина со стадии (а) в условиях, пригодных для экспрессии Фактора VIII в клетке-хозяине,
(в) сбор Фактора VIII из культуры клетки-хозяина согласно стадии (б), и
(г) ковалентную конъюгацию молекулы предшественника Фактора VIII с полиэтиленгликолем (ПЭГ) или полисахаридом размером 10-80 кДа посредством О-связанного олигосахарида по сериновому остатку в укороченном В-домене, который соответствует аминокислоте 750 в SEQ ID NO 2.

6. Применение молекулы по любому из пп. 1-3 в качестве лекарства для лечения гемофилии.

7. Применение по п. 6 для лечения гемофилии путем подкожного введения.

8. Применение по п. 6 для лечения гемофилии путем внутривенного введения.



 

Похожие патенты:

Изобретение относится к биотехнологии, а именно к способу очистки полипептида, содержащего Сн2/Сн3-область. Способ включает связывание полипептида с белком А и элюирование полипептида с градиентом pH, начинающимся с 5,0 или менее, с использованием элюирующего буфера, причем элюирующий буфер включает буфер с высоким pH и буфер с низким pH, а градиент pH образуется в результате регулирования процентного содержания каждого pH-буфера в элюирующем буфере.

Изобретение относится к биохимии. Обеспечиваются способы получения белков растительного происхождения или супраструктур белков.

Изобретение относится к области получения и выделения однодоменных молекул (SDAB). Описан способ выделения или очистки SDAB молекулы, которая представляет собой трехвалентную молекулу нанотела ATN-103, направленную на TNFα и HAS, из смеси, содержащей указанную SDAB молекулу и одно или более загрязняющих веществ.
Изобретение относится к области биотехнологии и может быть использовано для получения антимикробных белков и пептидов насекомого. Способ получения комплекса антимикробных пептидов насекомого предусматривает инфицирование жирового тела насекомого на стадии личинки бактериями Micrococcus luteus А270 и Escherichia coli D31 с последующим извлечением жирового тела насекомого на стадии личинки.

Изобретение относится к области биотехнологии, конкретно к слитым белкам, содержащим вариант родостомина, и может быть использовано в медицине. Получают полипептид, селективный в отношении интегрина αvβ3, состоящий из аминокислотной последовательности SEQ ID NO:1, конъюгированной на N-конце посредством линкерной аминокислотной последовательности, содержащей комбинацию аминокислот глицина и серина, с вариантом человеческого сывороточного альбумина (HSA) с SEQ ID NO:4.

Изобретение относится к биотехнологии и может быть использовано для получения протективных антигенов на основе секретируемых белоксодержащих соединений Staphylococcus aureus.

Изобретение относится к области биохимии, в частности к cконструированному гибридному инсектицидному белку, обладающему активностью против европейского кукурузного мотылька, а также к выделенной молекуле нуклеиновой кислоты, его кодирующей.

Настоящее изобретение относится к области иммунологии. Предложены варианты антител против NR10 человека или яванского макака, в том числе гуманизированные.

Группа изобретений относится к биотехнологии. Рекомбинантная плазмидная ДНК pPA-OPRF-ETA размером 8007 пар оснований кодирует синтез рекомбинантного белка OprF-ETA Pseudomonas aeruginosa.

Изобретение относится к области биоинженерии, молекулярной биологии и биотехнологии. Предложена дрожжевая клетка, предназначенная для детекции взаимодействия между белками и их доменами, котрансформированная двумя плазмидами, модифицированными для экспрессии в клетках дрожжей двух белков, где нуклеотидная последовательность, кодирующая первый белок, клонирована в одну плазмиду, а нуклеотидная последовательность, кодирующая второй белок, - в другую плазмиду, где нуклеотидные последовательности, кодирующие белки, слиты с нуклеотидными последовательностями, кодирующими активационный и ДНК-связывающий домены белка GAL4, при этом нуклеотидные последовательности, кодирующие исследуемые белки, отделены от нуклеотидных последовательностей, кодирующих активационный или ДНК-связывающий домен белка GAL4, при помощи нуклеотидной последовательности, кодирующей пептид, представляющий собой последовательность GluLeuGluAlaAlaAlaLysGluAlaAlaAlaLysGluAlaAlaAlaLysGluAlaAlaAla, который экспрессируется в виде белкового мостика между исследуемым белком и доменами белка GAL4.

Изобретение относится к области биотехнологии, конкретно к конъюгату варианта эксендина с молекулой ПЭГ, и может быть использовано в медицине. Указанный конъюгат включает эксендин с аминокислотной последовательностью SEQ ID NO: 4 и одну молекулу ПЭГ с молекулярным весом от 21 кДа до 29 кДа, конъюгированную с остатком цистеина в эксендине.

Изобретение относится к области биохимии. Предложен ПЭГ-модифицированный эксендин или аналог эксендина, содержащий одно или более ПЭГ-производных (варианты).

Изобретение относится к области биотехнологии, конкретно к получению пептидного производного - миметика ЭПО, имеющего формулу (I): и его фармацевтических солей, где R1, R5 выбраны из циклических пептидов, имеющих последовательности SEQ ID NO:5, 6, 7 и 8; n1, n2 представляют собой целые числа, независимо выбранные из 0-10; R2, R4 выбраны из -СО или -CH2; R3 выбран из О, S, CH2, N(CH2)n3NHR6, NCO(CH2)n4NHR6, CHOCONH(CH2)n5NHR6, CHSCON(CH2)n5NHR6 или CHNHCON(CH2)n5NHR6; где n3 представляет собой целое число, выбранное из 1-10, n4 представляет собой целое число, выбранное из 2-10, n5 представляет собой целое число, выбранное из 2-10, R6 выбран из Н или производных метоксиполиэтиленгликоля.

Изобретение относится к области технологий изготовления биологических препаратов и может быть использовано в фармацевтической промышленности. .

Изобретение относится к области биотехнологии, в частности к способу направленной доставки ДНК в опухолевые и стволовые клетки, экспрессирующие рецептор CXCR4. .

Изобретение относится к области биотехнологии, в частности к способу получения трехмерных матриц для тканеподобных структур из клеток животного происхождения. .
Изобретение относится к области химии полимеров, биохимии и медицины, а именно к способу получения глюкозочувствительных полимерных гидрогелей, применяемых в качестве носителей для контролируемого выделения инсулина.

Изобретение относится к медицине, в частности, к гематологии. .

Изобретение относится к таким областям как биохимия, биофизика, медицинская диагностика и может быть использовано в качестве модели клеточной мембраны при исследовании механизма действия лекарственных мембранопротекторных препаратов, а также для создания активных элементов биосенсорных устройств.

Изобретение относится к биотехнологии. Предложен способ печати биологических лигандов, представляющих собой олигосахариды, и/или полисахариды, и/или пептиды, и/или гликопептиды, и/или биотин.

Изобретение относится к области биотехнологии, конкретно к получению молекулы Фактора VIII с укороченным В-доменом и ковалентно конъюгированной с гидрофильным полимером, имеющей измененное время полужизни в кровотоке, и может быть использовано в медицине для лечения гемофилии. Получают молекулу предшественника Фактора VIII с укороченным В-доменом, где В-домен соответствует аминокислотам 741-761 из SEQ ID NO 2. При этом указанная молекула ковалентно конъюгирована с ПЭГ или полисахаридом размером 10-80 кДа посредством О-связанного олигосахарида по сериновому остатку в укороченном В-домене, который соответствует аминокислоте 750 в SEQ ID NO 2. Изобретение позволяет увеличить время полужизни Фактора VIII в кровотоке. 5 н. и 3 з.п. ф-лы, 8 ил., 4 табл., 7 пр.

Наверх