Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения



Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения
Полипептиды, содержащие fc-участок, которые демонстрируют повышенную эффекторную функцию благодаря изменениям степени фукозилирования, и способы их применения

 


Владельцы патента RU 2583298:

МАКРОДЖЕНИКС, ИНК. (US)

Изобретение относится к области биотехнологии и иммунологии. Описан способ ослабления посттрансляционного фукозилирования молекулы, содержащей модифицированный Fc-участок. Способ предусматривает модификацию Fc-участка, экспрессию молекулы-кандидата, оценку соотношения гликозилирования олигосохаридов с высоким содержанием маннозы к гликозилированию комплексных олигосахаридов и идентификацию молекулы-кондидата как подходящей при соотношении больше чем 0,2. Предложенное изобретение может быть использовано в медицине. 14 з.п.ф-лы, 95 ил., 35 табл., 7 пр.

 

1. Перекрестная ссылка на родственные заявки

Данная заявка заявляет приоритет по заявке на патент США с серийным № 61/249510 (поданной 7 октября 2009 г.), которая включена в данный документ ссылкой в ее полном объеме. Данная заявка дополнительно включена ссылкой в ее полном объеме в заявки на патенты США с серийными №№ 11/952568 (поданную 7 декабря 2007 г.) и 60/869254 (поданную 6 декабря 2006 г.).

2. ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Данное изобретение относится к полипептидам, содержащим Fc-участок, которые демонстрируют повышенную эффекторную функцию, благодаря изменениям степени фукозилирования, и к способам применения таких полипептидов для лечения или предотвращения раковых опухолей и других заболеваний. Содержащие Fc-участок полипептиды по данному изобретения представляют предпочтительно иммуноглобулины (например, антитела), в которых Fc-участок содержит по меньшей мере одну аминокислотную замену по отношению к соответствующей аминокислотной последовательности дикого типа Fc-участка, и которая является достаточной для ослабления пост-трансляционного фукозилирования и опосредует повышенное связывание с активирующим Fc-рецептором и уменьшенное связывание с ингибиторующим Fc-рецептором.

Способы настоящего изобретения особенно полезны в профилактике, лечении или улучшении одного или нескольких симптомов, связанных с заболеванием, нарушением или инфекцией, где повышенная эффективность эффекторной функции клеток (например, ADCC), опосредованной FcγR, является желательной, например, при раке, инфекционном заболевании. Способы настоящего изобретения представляют также применение в повышении терапевтической эффективности терапевтических антител, действие которых опосредовано ADCC. С другой стороны, способы настоящего изобретения особенно полезны в профилактике, лечении или улучшении одного или нескольких симптомов, связанных с заболеванием или нарушением, в которых сниженная эффективность эффекторной клеточной функции, опосредованной FcγR, является желательной, например, при воспалении и т.п. Способы настоящего изобретения также представляют, таким образом, применение в улучшении терапевтической эффективности терапевтических антител, которые ослабляют воспалительные процессы.

3. ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

3.1 Fc-РЕЦЕПТОРЫ И ИХ РОЛИ В ИММУННОЙ СИСТЕМЕ

Взаимодействие комплексов антитело-антиген с клетками иммунной системы ведет к широкому спектру ответов, начиная с эффекторных функций, таких как антитело-зависимая цитотоксичность, дегрануляция тучных клеток и фагоцитоз, до иммуномодулирующих сигналов, таких как регулирование пролиферации лимфоцитов и секреции антител. Все эти взаимодействия инициируются посредством связывания Fc-домена антител или иммунных комплексов со специализированными клеточными поверхностными рецепторами на гемопоэтических клетках. Разнообразие клеточных ответов, запускаемых антителами и иммунными комплексами, обусловливается структурной гетерогенностью Fc-рецепторов. Fc-рецепторы имеют общее со структурно родственными лиганд-связывающими доменами, которые предположительно опосредует внутриклеточную сигнализацию.

Fc-рецепторы, члены иммуноглобулиннового генного суперсемейства белков, являются поверхностными гликобелками, которые могут связывать Fc-части иммуноглобулиновых молекул. Каждый член семейства узнает иммуноглобулины одного или нескольких изотипов через домен узнавания на α цепи Fc-рецептора. Fc-рецепторы определяются по их специфичности для подтипов иммуноглобулинов. Fc-рецепторы для IgG именуются как FcγR, для IgE - как FεR, и для IgA - как FcαR. Различные дополнительные клетки несут Fc-рецепторы для антител различного изотипа, и изотип антитела определяет, какие дополнительные клетки будет вовлечен в данный ответ (рассмотрено Ravetch J.V. et al. 1991, Annu. Rev. Immunol. 9: 457-92; Gerber J.S. et al. 2001 Microbes and Infection, 3: 131-139; Billadeau D.D. et al. 2002, The Journal of Clinical Investigation, 2(109): 161-168l; Ravetch J.V. et al. 2000, Science, 290: 84-89; Ravetch J.V. et al., 2001 Annu. Rev. Immunol. 19:275-90; Ravetch J.V. 1994, Cell, 78(4): 553-60). Различные Fc-рецепторы, клетки, которые их экспрессируют, и специфичность их изотипов хорошо известны в данной области, см., например, Immunobiology: The Immune System in Health and Disease, 4th ed. 1999, Elsevier Science Ltd/Garland Publishing, New York, которая в данный документ включена ссылкой в ее полном объеме.

Fcγ-рецепторы

Каждый член данного семейства является интегральным мембранным гликобелком, обладающим внеклеточными доменами, связанными с C2-набором иммуноглобулин-родственных доменов, одиночным мембрано-расположенным доменом и внутрицитоплазматическим доменом разной длины. Существует три известных FcγR, именуемых FcγRI(CD64), FcγRII(CD32) и FcγRIII(CD16). Три рецептора кодируются отдельными генами; тем не менее, обширная гомология между тремя членами семейства предполагает, что они происходят от общего предшественника, по-видимому, путем дупликации гена.

FcγRII(CD32)

FcγRII белки являются 40KDa интегральными мембранными гликобелками, которые связывают только комплексованные IgG благодаря низкой аффинности к мономерному Ig (106 M-1). Данный рецептор является наиболее широко экспрессированным FcγR, присутствует на всех типах гемопоэтических клеток, включая моноциты, макрофаги, B-клетки, NK-клетки, нейтрофилы, тучные клетки и тромбоциты. FcγRII имеет только два иммуноглобулин-подобных участка в иммуноглобулин-связывающей цепи и, следовательно, намного более низкую аффинность к IgG, чем FcγRI. Существует три человеческих гена FcγRII (FcγRII-A, FcγRII-B, FcγRII-C), все из которых связывают IgG в агрегаты или иммунные комплексы.

Отдельные различия в пределах цитоплазматических доменов FcγRII-A и FcγRII-B создают два функционально гетерогенных ответа при лигировании рецептора. Фундаментальное отличие состоит в том, что изоформа A инициирует внутриклеточную сигнализацию, ведущую к клеточной активации, такой как фагоцитоз и респираторный бурст, в то время как изоформа B инициирует ингибирующие сигналы, например, ингибирование активации B-клетки.

Сигнализация через FcγR

Оба, как активирующий, так и ингибиторующий, сигналы преобразовываются через последующее лигирование FcγR. Данные диаметрально противоположные функции обусловливаются структурными различиями среди различных изоформ рецепторов. Два отдельных домена в пределах цитоплазматических сигнальных доменов рецептора, названных иммуннорецепторными тирозин-основанными активирующими мотивами (ITAM) или иммуннорецепторными тирозин-основанными ингибирующими мотивами (ITIM), объясняют различные ответы. Привлечение различных цитоплазматических ферментов к данным структурам обуславливает результат FcγR-опосредованных клеточных ответов. ITAM-содержащие FcγR-комплексы включают FcγRI, FcγRIIA, FcγRIIIA, в то время как ITIM-содержащие комплексы включают только FcγRIIB.

Человеческие нейтрофилы экспрессируют ген FcγRIIA. FcγRIIA-кластеризация через иммунные комплексы или поперечное связывание специфического антитела служит для агрегации ITAM вместе с рецептор-связанными киназами, которые содействуют фосфорилированию ITAM. Фосфорилированный ITAM выступает в качестве сайта стыковки для актиации Syk-киназы, которая ведет к активации расположенных далее субстратов (например, PI3K). Клеточная активация ведет к высвобождению провоспалительных медиаторов.

FcγRIIB ген экспрессируется на B-лимфоцитах; его внеклеточный домен является на 96% идентичным FcγRIIA и связывает IgG-комплексы неотличимым образом. Присутствие ITIM в цитоплазматическом домене FcγRIIB определяет данный ингибиторный подкласс FcγR. Недавно молекулярная основа данного ингибирования была установлена. Когда связанный вместе с активирующим FcγR, ITIM в FcγRIIB становится фосфорилированным и привлекает SH2 домен инозитолфосфат-5'-фосфатазы (SHIP), которая гидрализует фосфоинозитольные мессенджеры, высвобожденные как следствие активации ITAM-содержащей FcγR-опосредованной тирозин-киназы, последовательно предотвращая вход внутриклеточного Ca++. Таким образом, поперечное связывание FcγRIIB ослабляет активирующий ответ при FcγR лигировании и ингибирует клеточную ответную реакцию. Актиация В-клетки, пролиферация В-клетки и секреция антитела таким образом прерывается.

3.2 ЗНАЧИМОСТЬ ЗАБОЛЕВАНИЙ

3.2.1 РАКОВАЯ ОПУХОЛЬ

Новообразование, или опухоль, представляет новообразуемую массу, возникающую в результате ненормального неконтролируемого клеточного роста, которая может быть доброкачественной или злокачественной. Доброкачественные опухоли, в общем, остаются локальными. Злокачественные опухоли коллективно называются раковыми опухолями. Выражение «злокачественные» в общем означает, что опухоль может вторгаться и разрушать соседствующие структуры тела и достигать удаленных сайтов, вызывая смерть (для обзора, см. Robbins и Angell, 1976, Basic Pathology, 2d Ed., W.B. Saunders Co., Philadelphia, pp. 68-122). Злокачественная опухоль может появляться во многих местах тела и ведет себя по-разному в зависимости от ее источника. Раковые клетки разрушают часть тела, в которой они возникают, и затем распространяются в другую(ие) часть(и) тела, где они начинают новый рост и вызывают большее разрушение.

У более чем 1,2 миллиона американцев обнаруживают раковую опухоль каждый год. Рак является второй ведущей причиной смерти в Соединенных Штатах и, если настоящие тенденции продолжатся, рак, как ожидается, станет ведущей причиной, вызывающей смерть к 2010 году. Рак легких и простаты являются главными убийцами мужчин в Соединенных Штатах. Рак легких и молочной железы являются главными убийцами женщин в Соединенных Штатах. У одного из двух мужчин в Соединенных Штатах будут диагностировать раковую опухоль в какое-то время в течение их жизни. У одной из трех женщин в Соединенных Штатах будут диагностировать раковую опухоль в какое-то время в течение их жизни.

Лечение для раковой опухоли все еще не найдено. Современные методы лечения, такие как хирургия, химиотерапия и лучевая терапия, являются, зачастую либо неэффективными, или характеризуются серьезными побочными эффектами.

Терапия рака

В настоящее время, терапия рака может включать хирургию, химиотерапию, гормональную терапию и/или лучевую терапию для уничтожения опухолевых клеток у пациента (Смотри, например, Stockdale, 1998, “Principles of Cancer Patient Management”, в Scientific American: Medicine, vol. 3, Rubenstein and Federman, eds., Chapter 12, Section IV). С недавних пор противораковая терапия может также включать биологическую терапию и иммунотерапию. Все данные подходы обладают существенными недостатками для пациента. Хирургия, например, может быть противопоказана из-за состояния здоровья пациента или может быть неприемлема для пациента. Дополнительно, хирургия может не полностью удалять опухолевую ткань. Лучевая терапия является эффективной только, когда опухолевая ткань проявляет большую чувствительность к облучению, чем нормальная ткань, и лучевая терапия может зачастую повлечь за собой серьезные побочные эффекты. Гормональная терапия редко назначается как исключительное средство и, хотя может быть эффективной, часто применяется для предотвращения или приостановки рецидива злокачественной опухоли после того, как другие виды лечений удалили основную часть раковых клеток. Биологические терапии/иммунотерапии ограничены в количестве и могут вызвать побочные эффекты, такие как сыпь или отеки, гриппоподобные симптомы, включая лихорадку, ознобы и усталость, проблемы пищеварительного тракта и аллергические реакции.

По отношению к химиотерапии, существует разнообразие химиотерапевтических средств, доступных для лечения злокачественной опухоли. Значительное большинство раковых химиотерапевтических препаратов действуют путем ингибирования синтеза ДНК либо непосредственно, или опосредованно путем ингибирования биосинтеза предшественников деоксирибонуклеотид-трифосфата, для предотвращения репликации ДНК и сопутствующего клеточного деления (Рассмотрено, например, Gilman et al., Goodman and Gilman's: The Pharmacological Basis of Therapeutics, Eighth Ed. (Pergamom Press, New York, 1990)). Данные средства, которые включают алкилирующие средства, такие как нитрозомочевина, анти-метаболиты, такие как метотрексат и гидроксимочевина, и другие средства, такие как этопозиды, кампатецины, блеомицин, доксорубицин, даунорубицин и т.п., хотя нет необходимости в специфичности клеточного цикла, убивают клетки во время S-фазы из-за их эффекта на репликацию ДНК. Другие средства, в частности кохицин и алкалоид барвинка, такие как винбластин и винкристин, мешают сборке микротрубочек, приводя к остановке митоза. Химиотерапевтические протоколы обычно включают введение комбинации химиотерапевтических средств для увеличения эффективности лечения.

Несмотря на доступность разнообразных химиотерапевтических средств, химиотерапия имеет много недостатков (Рассмотрено, например, Stockdale, 1998, “Principles Of Cancer Patient Management” в Scientific American Medicine, vol. 3, Rubenstein and Federman, eds., ch. 12, sect. 10). Почти все химиотерапевтическое средства являются токсическими, и химиотерапия вызвает значительные, и часто опасные, побочные эффекты, включая сильную тошноту, угнетение костного мозга, иммуносупрессию и т.п. Дополнительно, даже при введении комбинаций химиотерапевтических средств, многие опухолевые клетки являются устойчивыми или обнаруживают устойчивость к химиотерапевтическим средствам. Фактически, данные клетки, устойчивые к конкретным химиотерапевтическим средствам, применяемым в протоколе лечения, часто оказываются устойчивыми к другим лекарственным средствам, даже тем средствам, которые действуют посредством механизмов, отличных от механизмов действия лекарственных средств, применяемых в специфическом лечении; данный феномен называется плейотропным лекарственным средством или множественной лекарственной устойчивостью. Таким образом, из-за устойчивости к лекарственному средству, многие злокачественные опухоли оказываются трудноподдающимися лечению в стандартных протоколах химиотерапевтического лечения.

Существует значительная необходимость в альтернативных лечениях злокачественной опухоли, в частности, лечении злокачественной опухоли, которая оказалась трудноподдающейся лечению при стандартных лечениях злокачественной опухоли, таких как хирургия, лучевая терапия, химиотерапия и гормональная терапия. Обещающей альтернативой является иммунотерапия, при которой раковые клетки специально намечены посредством раковых антиген-специфических антител. Основные усилия были направлены на приспособление специфики иммунного ответа, например, гибридомная технология позволила наработку выбраных моноклональных антител к опухоли (Рассмотрено Green M.C. et al., 2000 Cancer Treat Rev., 26: 269-286; Weiner LM, 1999 Semin Oncol. 26(suppl. 14):43-51), и за прошедшие несколько лет, Управление по контролю за пищевыми продуктами и лекарственными средствами одобрило первый MAbs для раковой терапии: Ритуксин (анти-CD20) для неходжкинсовой лимфомы и герцептин [анти-(c-erb-2/HER-2)] для метастазной злокачественной опухоли грудной железы (Suzanne A. Eccles, 2001, Breast Cancer Res., 3: 86-90). Однако, потенциальная возможность эффекторной функции антитела, например, для опосредования антитело-зависимой клеточной цитотоксичности (“ADCC”), является препятствием для такого лечения. Таким образом, способы улучшения эффективности такой иммунотерапии необходимы.

3.2.2 ВОСПАЛИТЕЛЬНЫЕ ЗАБОЛЕВАНИЯ И АУТОИММУННЫЕ ЗАБОЛЕВАНИЯ

Воспаление является процессом, посредством которого белые кровяные клетки тела и химические вещества защищают наши тела от инфекции посторонними веществами, такими как бактерии и вирусы. Оно обычно харакреризуется болью, отеканием, разогревом и краснотой пораженного участка. Химические вещества, известные как цитокины и простагландины, контролируют данный процесс и высвобождаются в упорядоченном и самоограничивающемся каскаде в кровь или пораженные ткани. Данное высвобождение химических веществ увеличивает кровоток к зоне повреждения или инфекции и может вызывать красноту и разогрев. Некоторые из химических веществ вызывают ток жидкости в ткани, приводя к отеканию. Данный защитный процесс может стимулировать нервы и вызвать боль. Данные изменения, если происходят в ограниченный период в соответствующих областях, работают на благо тела.

При аутоиммунных и/или воспалительных расстройствах иммунная система запускает воспалительный ответ, когда отсутствуют посторонние вещества для борьбы, и обычно защищающая иммунная система организма вызвает повреждение своих собственных тканей посредством ошибочной атаки самой себя. Существуют многие различные аутоиммунные расстройства, которые действуют на организм различными путями. Например, мозг повреждается у индивидуумов с рассеянным склерозом, кишечник повреждается у индивидуумов с болезнью Крона, и синовиальная оболочка, кость и хрящ разных суставов повреждаются у индивидуумов с ревматоидным артритом. Когда аутоиммунные расстройства развиваются, разрушение одного или нескольких типов ткани организма, ненормальный рост органа или изменения в функции органа могут последовать. Аутоиммунное нарушение может повреждать только один орган или тип ткани или может повреждать многие органы и ткани. Органы и ткани, обычно повреждаемые посредством аутоиммунных расстройств, включают красные кровяные клетки, кровеносные сосуды, соединительные ткани, эндокринные железы (например, щитовидная или поджелудочная железы), мышцы, суставы и кожу. Примеры аутоиммунных расстройств включают без ограничения тиреоидит Хашимото, пернициозную анемию, болезнь Аддисона, диабет 1 типа, ревматоидный артрит, системную эритематозную волчанку, дерматомиозит, синдром Шёгрена, дерматомиозит, эритематозную волчанку, рассеянный склероз, аутоиммунное заболевание внутреннего уха, миастению гравис, синдром Рейтера, болезнь Грейвса, аутоиммунный гепатит, семейный аденоматозный полипоз и язвенный колит.

Ревматоидный артрит (RA) и ювенильный ревматоидный артрит представляют собой типы воспалительного артрита. Артрит является общим выражением, которое описывает воспаление в суставах. Некоторые, но не все, типы артрита являются результатом неправильно направленного воспаления. Кроме ревматоидного артрита, другие типы артрита, связанного с воспалением, включают следующие: псориатический артрит, синдром Рейтера, анкилозирующий спондилитный артрит и подагрический артрит. Ревматоидный артрит является типом хронического артрита, который возникает в суставах на обеих сторонах тела (как, например, обе руки, запястья или колени). Данная симметрия помогает отличить ревматоидный артрит от других типов артрита. В дополнении к повреждениям суставов, ревматоидный артрит может иногда повреждать кожу, глаза, легкие, сердце, кровь или нервы.

Ревматоидный артрит поражает примерно 1% мирового населения и представляет потенциально потерю трудоспособности. Происходит приблизительно 2,9 миллиона случаев ревматоидного артрита в Соединенных Штатах. Женщины подвергаются в два-три раза чаще, чем мужчины. Обычный возраст, когда ревматоидный артрит развивается, составляет между 25 и 50. Ювенильный ревматоидный артрит повреждет 71000 молодых американцев (в возрасте восемнадцать и ниже), поражая девочек в шесть раз чаще, чем мальчиков.

Ревматоидный артрит является аутоиммунным нарушением, при котором иммунная система организма ошибочно идентифицирует синовиальные мембраны, которые секретируют смазывающую жидкость в суставах, как чужеродные. Воспаление ведет к тому, что и хрящ, и ткани в и вокруг суставов повреждаются или разрушаются. В тяжелых случаях данное воспаление распространяется на другие соединительные ткани и окружающий хрящ, где оно может разъедать или разрушать кость и хрящ и вести к деформациям сустава. Организм замещает поврежденную ткань рубцовой тканью, являясь причиной того, что нормальне просветы в суставе становятся узкими и кости соединяются вместе. Ревматоидный артрит создает жесткость, отекание, утомляемость, анемию, потерю веса, лихорадку и, часто, деформирующую боль. Некоторые общие симптомы ревматоидного артрита включают суставную жесткость при пробуждении, которая длится час и более; отекание в специфических суставах пальца или запястья; отекание в мягкой ткани вокруг сустава; и отекание на обеих сторонах сустава. Отекание может происходить с и без боли и может прогрессивно ухудшаться или оставаться таким же годами перед дальнейшим развитием.

Диагноз ревматоидного артрита основан на комбинации факторов, включающих: специфическое местоположение и симметрию болезненных суставов, наличие жесткости сустава утром, присутствие неровностей и узелков под кожей (ревматоидных узелков), результаты рентгеновских тестов, которые предплагают ревматоидный артрит, и/или позитивные результаты тестов крови, называемых ревматоидным фактором. Многие, но не все, люди с ревматоидным артритом имеют антитело к ревматоидному-фактору в своей крови. Ревматоидный фактор может присутствовать у людей, которые не имеют ревматоидного артрита. Другие заболевания могут также вызвать продуцирование в кровь ревматоидного фактора. Вот почему диагноз ревматоидный артрит основан на комбинации нескольких факторов, а не только присутствии ревматоидного фактора в крови.

Обычное течение болезни является течением устойчивого, но колеблющегося симптома в суставе, и после примерно 10 лет 90% страдающих людей будут демонстрировать структурные повреждение кости и хряща. Малое процентное соотношение будет иметь непродолжительное заболевание, которое проходит полностью, и другое малое процентное соотношение будет иметь очень тяжелое заболевание с многочисленными деформациями сустава и иногда другие проявления заболевания. Воспалительный процесс вызывает эрозию или разрушение кости и хряща в суставах. В ревматоидном артрите существует аутоиммунный цикл устойчивой антигенной презентации, стимуляции T-клетки, секреции цитокина, активации синовиальной клетки и разрушения сустава. Это заболевание оказывает значительное влияние как на личность, так и на общество, вызывая сильную боль, нарушенные функции и инвалидность, а также расходование миллионов долларов в сфере здравоохранения и потери в заработной плате. (Смотри, например, веб-сайт NIH (Национальный институт здоровья США) и веб-сайт NIAID (Национальный институт по изучению аллергических и инфекционных заболеваний)).

В настоящее время доступная терапия артрита фокусируется на снижении воспаления суставов противовоспалительными или иммуносупресивными медикаментозными средствами. Первой линией лечения любого артрита является обычно противовоспалительные средства, такие как аспирин, ибупрофен и ингибиторы Cox-2, такие как целекоксиб и рофекоксиб. “Вторая линия лекарственных средств” включает золото, метотрексат и стероиды. Хотя они являются хорошо разработанными линиями лечения артрита, очень мало пациентов придерживаются только данных линий лечения. Недавние достижения в понимании патогенеза ревматоидного артрита привели к применению метотрексата в комбинации с антителами к цитокинам или рекомбинантным растворимым рецепторам. Например, рекомбинантные растворимые рецепторы к опухолевому некротическому фактору (TNF)-α были применены в комбинации с метотрексатом в лечении артрита. Однако, только примерно 50% пациентов, получавших лечение в комбинации метотрексата и анти-TNF-α агентов, таких как рекомбинантные растворимые рецепторы к TNF-α, показывают клинически значительное улучшение. Многие пациенты остаются трудноподдающимися лечению, несмотря на лечение. Все еще остаются сложные вопросы лечения пациентов с ревматоидным артритом. Многие современные методы лечения имеют высокую частоту побочных эффектов и не могут полностью предотвратить дальнейшее развитие болезни. До сих пор никакое лечение не является идеальным, и не существует выздоровления. Новые терапевтические средства необходимы, чтобы более эффективно лечить ревматоидный артрит и другие аутоиммунные расстройства.

3.2.3 ИНФЕКЦИОННЫЕ ЗАБОЛЕВАНИЯ

Инфекционные агенты, которые вызвают заболевание, относятся к пяти группам: вирусы, бактерии, грибы, простейшие и гельминты (черви). Удивительное разнообразие данных патогенов вызвало естественный отбор двух важнейших элементов адаптивного иммунитета. Во-первых, преимущество, заключающееся в способности узнавать широкий диапазон различных патогенов, привело к развитию равного или большего разнообразия рецепторов на В- и Т-клетках. Во-вторых, разным местам обитания и жизненным циклам патогенов пришлось противостоять посредством ряда различных эффекторных механизмов. Характерные черты каждого патогена представлены их способом распространения, их механизмом репликации, их патогенезом или способом, посредством которого он вызвает заболевание, и ответом, который он вызывает.

Данные о человеческих страданиях и смерти от оспы, холеры, тифа, дизентерии, малярии и т.д. доказывают господствующее положение инфекционных заболеваний. Несмотря на выдающиеся успехи в контроле, предоставляемом повышенной санитарией, иммунизацией и антибактериальной терапией, инфекционные заболевания продолжают оставаться общей и серьезной проблемой современной медицины. Наиболее распространенное заболевание человечества, обычная простуда, является инфекционным заболеванием, так же как и пугающее современное заболевание СПИД. Некоторые хронические неврологические заболевания, которые, как считалось ранее, являлись дегенеративными заболеваниями, оказались заразными. Существует мало сомнений, что в будущем будут продолжать выявлять инфекционные заболевания в качестве основных медицинских проблем.

Огромное количество заболеваний людей и животных происходит от вирулентных и приспосабливающихся инфекций от любого из вышеуказанных инфекционных агентов (рассмотрено Belshe (Ed.) 1984 Textbook of Human Virology, PSG Publishing, Littleton, MA).

Одна категория инфекционных заболеваний представлена вирусными инфекциями, например. Вирусные заболевания широкого спектра тканей, включая дыхательный тракт, ЦНС, кожу, мочеполовую систему, глаза, уши, иммунную систему, желудочно-кишечный тракт и опорно-двигательную систему, влияют на огромное количество людей всех возрастов (смотри Таблицу 328-2 в Wyngaarden and Smith, 1988, Cecil Textbook of Medicine , 18 th Ed., W.B. Saunders Co., Philadelphia, pp.1750-1753). Несмотря на то, что значительные усилия были вложены в разработку эффективной антивирусной терапии, вирусные инфекции продолжают угрожать жизни миллионов людей во всем мире. В общем, попытки разработать антивирусные лекарства были направлены на несколько стадий жизненного цикла вируса (Смотри, например, Mitsuya et al., 1991, FASEB J. 5:2369-2381, обсуждение HIV). Однако, общим недостатком, связанным с использованием многих современных антивирусных лекарственных средств, является их вредные побочные эффекты, такие, как токсичность для хозяина или устойчивость со стороны некоторых вирусных штаммов.

4. КРАТКОЕ ОПИСАНИЕ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

Данное изобретение относится к способам лечениия или предотвращения рака и других заболеваний, расстройств и инфекций, используя молекулы, предпочтительно полипептиды, и более предпочтительно иммуноглобулины (например, антитела), содержащие вариантный Fc-участок, имеющий одну или несколько аминокислотных модификаций (например, замещения, но также включая вставки или делеции) в одном или нескольких участках, при этом модификация(и) изменяет (по отношению к Fc-участку дикого типа) соотношение аффинностей варианта Fc-участка к активирующему FcγR (такому как FcγRIIA или FcγRIIIA) по отношению к ингибирующему FcγR (такому как FcγRIIB):

Изменение в аффинности к FcγRактивирующий варианта по отношению к дикому типу

Соотношение аффиностей =

Изменение в аффинности к FcγRингибирующий варианта по отношению к дикому типу

Особый интерес представляют соотношения аффинностей, в которых либо FcγRIIIA или FcγRIIA является FcγRАктивирующий, и FcγRIIB является FcγRИнгибирующий. Там где вариантный Fc имеет соотношение аффинностей больше чем 1, способы настоящего изобретения имеют специфическое применение в обеспечении терапевтического или профилактического лечения заболевания, нарушения, или инфекции, или улучшении симптома таковых, где повышенная эффективность эффекторной клеточной функции (например, ADCC), опосредованной через FcγR, желательна, например, рак или инфекционное заболевание. Такое увеличенное соотношение аффинностей может обуславливаться Fc-участком молекулы, имеющим (по отношению к дикому типу Fc) увеличенную аффинность к FcγRАктивирующий (например, FcγRIIIA или FcγRIIA), связанную либо с неизменной аффинностью к FcγRИнгибирующий (например, FcγRIIB) или с уменьшением аффинности к такому FcγRИнгибирующий. Альтернативно, увеличенное соотношение аффинностей может вытекать из проявления Fc-участком означенной молекулы увеличения аффинности к обоим FcγRАктивирующий и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что увеличенная аффинность к FcγRАктивирующий превышает увеличенную аффинность к FcγRИнгибирующий, или может вытекать из проявлениея Fc-участком означенной молекулы уменьшенной аффинности к обоим FcγRАктивирующий и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что уменьшение аффинности к FcγRАктивирующий является меньшим, чем уменьшение аффинности к FcγRИнгибирующий, или может вытекать из неизменной аффинностью к FcγRАктивирующий, сопряженной с уменьшением аффинности к FcγRИнгибирующий.

Там где Fv вариант имеет соотношение аффинностей менее чем 1, способы настоящего изобретения имеют специфическое применение в обеспечении терапевтического или профилактического лечения заболевания или нарушения, или улучшения симптома таковых, где сниженная эффективность эффекторной клеткой функции, опосредованная через FcγR, желательна, например, аутоиммунное или воспалительное расстройства. Такое уменьшенное соотношение аффинностей может обусловливаться Fc-участком молекулы, имеющим (по отношению к дикому типу Fc) уменьшеную аффинность к FcγRАктивирующий (например, FcγRIIIA или FcγRIIA) сопряженное либо с неизменной аффинностью к FcγRИнгибирующий (например, FcγRIIB), или увеличенной аффинностью к означенному FcγRИнгибирующий. Альтернативно, уменьшенное соотношение аффинностей может вытекать из проявления Fc-участком означенной молекулы снижения аффинности к обоим FcγRАктивирующий и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что снижение аффинности к FcγRАктивирующий превышает снижение аффинности к FcγRИнгибирующий, или может вытекать из проявления Fc-участком означенной молекулы, увеличенной аффинность к обоим FcγRАктивирующий и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что увеличение аффинности к FcγRАктивирующий является меньшим, чем увеличение аффинности к FcγRИнгибирующий, или может вытекать из неизменной аффинности к FcγRАктивирующий, сопряженной с увеличением аффинности к FcγRИнгибирующий.

Современные подходы к оптимизации функции Fc-участка (например, антитело- зависимая клеточно-опосредованная цитотоксичность, (ADCC), комплемент-зависимая цитотоксическая (CDC) активность) в терапевтических моноклональных антителах и растворимых полипептидах, слитых с Fc-участками, были сосредоточены на ограниченном числе одиночных аминокислотных изменений на основе структурного анализа и/или компьютерного конструирования. Альтернативные подходы к проектированию Fc-участков были сосредоточены на гликозилировании Fc-участка для оптимизации функции Fc-участка. Обоснованность применения соотношений аффинностей вариантного Fc для оценки их терапевтической возможности была предложена по отношению к вариантным Fc, чьи последовательности были получены с помощью компьютерных алгоритмов поиска пространственной структуры последовательности (Lazar, G.A. et al. Proc. Natl. Acad. Sci. (USA) 103:4005-4010 (2006)). Данный подход определил четыре варианта Fc: (1) S239D; (2) I322E; (3) S239D и I322E; и (4) S239D, I332E и A330L, все из которых связывали FcγRIIIa, а также FcγRIIb с большей аффинностью, чем дикий тип (Lazar, G.A. et al. Proc. Natl. Acad. Sci. (USA) 103:4005-4010 (2006). В отличие от этого, данное изобретение основывается, частично, на выборе желаемых молекул, содержащих вариантные Fc, которые демонстрируют измененное соотношение аффинностей для FcγRIII и FcγRII, из объективной библиотеки Fc вариантов. Данный подход обеспечивал возможность идентификации большей совокупности желаемых вариантов Fc, а также вариантов, имеющих соотношение аффинностей намного превышающее те, о которых сообщил Lazar, G.A. и др. (Proc. Natl. Acad. Sci. (USA) 103:4005-4010 (2006). Данное изобретение включает в себя способы проектирования Fc-участков и идентификации и скрининга новых вариантов Fc за пределами ожидаемых участков, определенных структурными исследованиями. Предполагаемые участки, как используется в данном документе, относятся к тем участкам, которые, на основе структурных и/или биохимических исследований, находятся в контакте с лигандом Fc.

Терапевтические или профилактические молекулы, которые применяются в соответствии со способами настоящего изобретения, таким образом, содержат вариантные Fc-участки, содержащие одну или несколько аминокислотных модификаций, которые демонстрируют измененное соотношение аффинностей, особенно, где FcγRАктивирующий является либо FcγRIIA, или FcγRIIIA, и FcγRИнгибирующий является FcγRIIB. В предпочтительном варианте осуществления молекулы настоящего изобретения также специфически связывают FcγRIIB (через участок Fc) с более низкой аффинностью, чем сравнительная молекула (т.е. имеющая ту же самую аминокислотную последовательность, что и молекула настоящего изобретения, за исключением одной или нескольких аминокислотных модификаций в Fc-участке), содержащая дикий тип Fc-участка, который связывает FcγRIIB. В некоторых вариантах осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, имеющими одну или несколько аминокислотных модификаций, при этом модификации увеличивают аффинность вариантного Fc-участка к FcγRIIIA и/или FcγRIIA и увеличивают аффинность вариантного Fc-участка к FcγRIIB по отношению к сравнительной молекуле с дикий типом Fc-участка. В других вариантах осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, имеющими одну или несколько аминокислотных модификаций, при этом модификации увеличивают аффинность вариантного Fc-участка к FcγRIIIA и/или FcγRIIA, но не изменяют аффинность вариантных Fc-участков к FcγRIIB по отношению к сравнительной молекуле с диким типом Fc-участка. Предпочтительный вариант осуществления представляет собой вариантный Fc-участок, который имеет увеличенную аффинность к FcγRIIIA и FcγRIIA, но уменьшенную аффинность к FcγRIIB по отношению к сравнительной молекуле с диким типом Fc-участка.

Варианты Fc настоящего изобретения могут быть объединены с другими модификациями Fc, включая без ограничения модификации, которые изменяют эффекторную функцию. Данное изобретение включает в себя объединение вариантного Fc настоящего изобретения с другими модификациями Fc для обеспечения добавочных, синергических или новых свойств в антителах или Fc-слияниях. Предпочтительно, вариантные Fc настоящего изобретения увеличивают фенотип модификации, с которой они объединены. Например, если вариант Fc настоящего изобретения объединен с известным мутантом для связывания с FcγRIIIA с более высокой аффинностью, чем сравнительная молекула, содержащая дикий тип Fc-участка; комбинация с мутантом настоящего изобретения ведет к большему в несколько раз увеличению FcγRIIIA аффинности.

В одном варианте осуществления варианты Fc настоящего изобретения могут быть объединены с другими известными вариантами Fc, такими как те, что раскрыты в Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, Mol Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al., 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett. 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al, 1996, Immunol Lett 54:101-104; Lund et al, 1996, J Immunol 157:49634969; Armour et al, 1999, Eur J Immunol 29:2613-2624; Idusogie et al, 2000, J Immunol 164:41784184; Reddy et al, 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200:16-26; Idusogie et al, 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Shields et al, 2002, J Biol Chem 277:26733-26740; Jefferis et al, 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490); Lazar, G.A. et al. Proc. Natl. Acad. Sci. (USA) 103:4005-4010 (2006); патентном документе США №5624821; патентном документе США №5885573; патентном документе США №6194551; публикации Международной заявки WO 00/42072; публикации Международной заявки WO 99/58572; публикации Международной заявки WO 04/063351; публикации патентной заявки США 2005/0037000; и публикация патентной заявки США 2005/0064514; каждый из которых включен в данный документ ссылкой во всей своей полноте. В определенных вариантах осуществления вариантные Fc настоящего изобретения могут быть объединены с одним или несколькими вариантами Fc, т.е. аминокислотными модификациями, относящимися к дикому типу участка Fc, представленными в таблицах 4, 5, 9, и 10 ниже.

Данное изобретение включает в себя молекулы, которые являются гомодимерами или гетеродимерами Fc-участков. Гетеродимеры, содержащие Fc-участки относятся к молекулам, где две цепи Fc имеют одинаковые или различные последовательности. В некоторых вариантах осуществления в гетеродимерных молекулах, содержащих вариантные Fc-участки, каждая цепь имеет одну или несколько различных модификаций от другой цепи. В других вариантах осуществления в гетеродимерных молекулах, содержащих вариантные Fc-участки, одна цепь содержит дикий тип Fc-участка, и другая цепь содержит одну или несколько модификаций. Способы проектирования гетеродимерных Fc-содержащих молекул известны в данном уровне техники и включены в данное изобретение.

В некоторых вариантах осуществления данное изобретение включает в себя молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию, относящуюся к дикому типу Fc-участка, при которой вариантный Fc-участок связывает FcγRАктивирующий,, но не связывает FcγRИнгибирующий, или связывает FcγRИнгибирующий с уменьшенной аффинностью, относительно сравнительной молекулы, содержащей дикий тип участка Fc, как было определено с помощью стандартных испытаний (например, in vitro испытаний), известных специалисту в данной области. В альтернативном варианте осуществления данное изобретение включает в себя молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc, при этом вариантный Fc-участок связывает FcγRИнгибирующий, но не связывает FcγRАктивирующий, или связывает FcγRАктивирующий с уменьшенной аффинностью, по отношению к сравнительной молекуле, содержащей дикий тип участка Fc, как было определено с помощью стандартных испытаний (например, in vitro испытаний), известных специалисту в данной области. В специфическом варианте осуществления данное изобретение включает в себя молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc, при этом вариантный Fc-участок связывает только один FcγR, где указанный FcγR является FcγIIIA. В еще одном специфическом варианте осуществления данное изобретение включает в себя молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка, при этом вариант Fc-участка связывает только один FcγR, где указанный FcγR является FcγRIIA. В еще одном варианте осуществления данное изобретение включает в себя молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc, при этом вариантный Fc-участок связывает только один FcγR, где указанный FcγR является FcγRIIB.

Аффинности и связывающие свойства молекул настоящего изобретения для FcγR изначально определяют с помощью in vitro испытаний (на основе биохимических или иммуннологических испытаний), известных в данном уровне техники для определения взаимодействий Fc-FcγR, т.е. специфического связывания Fc-участка с FcγR, включая без ограничения ELISA анализ, испытание поверхностного плазмонного резонанса, испытания иммунопреципитации (Смотри Раздел 6.2). Предпочтительно, связывающие свойства молекул настоящего изобретения также характеризуются посредством in vitro функциональных испытаний для определения одной или нескольких FcγR медиаторных эффекторных клеточных функций (Смотри Раздел 6.2.2). В самом предпочтительном варианте осуществления молекулы настоящего изобретения имеют похожие связывающие свойства в in vivo моделях (таких как те, что описаны и раскрыты в данном документе) с теми, что и в in vitro основанных испытаниях. Однако данное изобретение не исключает молекулы настоящего изобретения, которые не демонстрируют желаемый фенотип в in vitro основанных испытаниях, но действительно демонстрируют желаемый фенотип in vivo.

В специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка и проявляет соотношение аффинностей более чем 1, обеспеченное тем, что указанный вариант Fc-участка не имеет исключительно замещения в любом одном из положений 329, 331 или 332, или не включает, или не является исключительно замещением, любым одним из: (1) аланина в любом из положений 256, 290, 298, 312, 333, 334, 359, 360, 326 или 430; (2) лизина в положении 330; (3) треонина в положении 339; (4) метионина в положении 320; (5) серина в положении 326; (6) аспарагина в положении 326; (7) аспарагиновой кислоты в положении 326; (8) глутаминовой кислоты в положении 326; (9) глутамина в положении 334; (10) глутаминовой кислоты в положении 334; (11) метионина в положении 334; (12) гистидина в положении 334; (13) валина в положении 334; (14) лейцина в положении 334; (15) лизина в положении 335, или (16) только глутаминовой кислоты в положении 332; (17) только глутаминовой кислоты в положении 332 и аспарагиновой кислоты в положении 239; (18) только глутаминовой кислоты в положении 332, аспарагиновой кислоты в положении 239 и лейцина в положении 330.

Данное изобретение главным образом касается молекулы, имеющей такой вариантный Fc-участок, где указанный вариантный Fc-участок дополнительно характеризуется обладанием по меньшей мере одной аминокислотной модификацией по отношению к дикому типу Fc-участка в положении 234, 235, 243, 247, 255, 270, 284, 292, 300, 305, 316, 370, 392, 396, 416, 419 и/или 421.

Данное изобретение также касается таких молекул, где вариантные Fc-участки дополнительно характеризуются обладанием замещениями в по меньшей мере двух положениях: (a) 235 и 243; (b) 243 и 292; (c) 243 и 300; (d) 243 и 305; (e) 243 и 396; (f) 247 и 270; (g) 247 и 421; (h) 255 и 270; (i) 255 и 396; (j) 270 и 316; (k) 270 и 396; (l) 270 и 416; (m) 270 и 421; (n) 292 и 300; (o) 292 и 305; (p) 292 и 396; (q) 300 и 396; (r) 305 и 396; (s) 316 и 416; (t) 392 и 270; (u) 392 и 396; (v) 419 и 270; или (w) 419 и 396.

Данное изобретение также касается такой молекулы, где вариантные Fc-участки дополнительно характеризуются обладанием замещениями в по меньшей мере трех положениях: ((a) 243, 247 и 421; (b) 243, 292 и 300; (c) 243, 292 и 305; (d) 243, 292 и 396; (e) 243 300 и 396; (f) 243, 305 и 396; (g) 247, 270 и 421; (h) 255, 270 и 396; (i) 270, 316 и 416; (j) 270, 392 и 396; (k) 270, 396 и 419; (l) 292 300 и 396; или (m) 292, 305 и 396.

Данное изобретение также касается вариантов осуществления таких антител, где по меньшей мере одна модификация в Fc-домене содержит замещение L234 или замещение L235, или замещения обоих L234 и L235, и, особенно, где замещение L234 представлено L234F, и указанное замещение в L235 представлено L235V.

Данное изобретение дополнительно касается вышеописанных способов, где вариантный Fc-участок обладает, по меньшей мере, аминокислотными модификациями по отношению к дикому типу Fc-участка в одном или нескольких положениях: 243, 292, 300 или 396 (т.е. в положении 243, 292, 300 или 396; или как в положении 243, так и в положении 292; или как в положении 243, так и в положении 300; или как в положении 243, так и в положении 396; или как в положении 292, так и в положении 300; или как в положении 292, так и в положении 396; или как в положении 300, так и в положении 396; или в положении 243, в положении 292 и в положении 300; или в положении 243, в положении 292 и в положении 396; или в положении 292, в положении 300 и в положении 396; или в положении 243, в положении 292, в положении 300 и в положении 396). Данное изобретение особенно касается варианта осуществления вышеописаных способов, где такой вариантный Fc-участок обладает модификациями: L234F, L235I, F243L, R292P и/или Y300L.

Данное изобретение также касается таких молекул, где вариантный Fc-участок демонстрирует соотношение аффинностей большее, чем 1, и где такой вариантный Fc-участок имеет, по меньшей мере, любое из следующих замещений: (a) F243L; (b) D270E; (c) R292G; или (d) R292P.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрирует соотношение аффинностей большее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любую из следующих пар замещений: (a) F243L и R292P; (b) F243L и Y300L; (c) F243L и P396L; (d) D270E и P396L; (e) R292P и Y300L; (f) R292P и V305I; (g) R292P и P396L; (h) Y300L и P396L; и (i) P396L и Q419H.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей большее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любую из следующих троек замещений: (a) F243L, P247L и N421K; (b) F243L, R292P и Y300L; (c) F243L, R292P и Y300L; (d) F243L, R292P и V305I; (e) F243L, R292P и P396L; (f) F243L, Y300L и P396L; (g) P247L, D270E и N421K; (h) R255L, D270E и P396L; (i) D270E, G316D и R416G; (j) D270E, K392T и P396L; (k) D270E, P396L и Q419H; (l) V284M, R292L и K370N или (m) R292P, Y300L и P396L.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей большее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любую из следующих тетрад замещениий: (a) L234F, F243L, R292P и Y300L; (b) L235I, F243L, R292P и Y300L; (c) L235Q, F243L, R292P и Y300L; (d) F243L, R292P, Y300L, и P396L; (e) F243L, P247L, D270E и N421K; (f) F243L, R255L, D270E и P396L; (g) F243L, D270E, G316D и R416G; (h) F243L, D270E, K392T и P396L; (i) F243L, D270E, P396L и Q419H; (j) F243L, R292P, V305I и P396L; (k) D270E, G316D, P396L и R416G; (l) P247L, D270E, Y300L и N421K; (m) R255L, D270E, R292G и P396L; или (n) R255L, D270E, Y300L и P396L.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей большее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любую из следующих пептад замещений: (a) L235V, F243L, R292P, Y300L и P396L; (b) L235P, F243L, R292P, Y300L и P396L; (c) F243L, R292P, V305I, Y300L и P396L; или (d) F243L, R292P, Y300L, V305I и P396L.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей меньшее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любое из следующих замещений: (a) P396L или (b) Y300L.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей меньшее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любую из следующих пар замещений: (a) F243L и P396L; (b) P247L и N421K; (c) R255L и P396L; (d) R292P и V305I; (e) K392T и P396L; или (f) P396L и Q419H.

Данное изобретение также касается таких молекул, где вариантные Fc-участки демонстрируют соотношение аффинностей меньшее, чем 1, и где такие вариантные Fc-участки имеют, по меньшей мере, любое из следующих трех замещений: F243L, R292P и V305I.

В еще одном специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, что указанный полипептид специфически связывает FcγRIIA с большей аффинностью, чем сравнительная молекула, содержащая дикий тип участка Fc, который связывает FcγRIIA, обеспеченное тем, что одна или несколько аминокислотных модификаций не включают или не являются исключительно замещением аланина в любом из положений 256, 290, 326, 255, 258, 267, 272, 276, 280, 283, 285, 286, 331, 337, 268, 272 или 430; аспарагина в положении 268; глутамина в положении 272; глутамина, серина или аспарагиновой кислоты в положении 286; серина в положении 290; метионина, глутамина, глутаминовой кислоты или аргинина в положении 320; глутаминовой кислоты в положении 322; серина, глутаминовой кислоты или аспарагиновой кислоты в положении 326; лизина в положении 330; глутамина в положении 335; или метионина в положении 301.

В предпочтительном специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, что указанная молекула имеет измененную аффинность для FcγR, обеспеченную тем, что указанный вариантный Fc-участок не имеет замещения в положениях, которые совершают прямой контакт с FcγR на основе кристаллографического и структурного анализа Fc-FcγR взаимодействий, таких как те, что раскрыты у Sondermann и др. (2000 Nature, 406: 267-273, которая включенна в данный документ ссылкой во всей своей полноте). Примерами положений в пределах Fc-участка, которые создают прямой контакт с FcγR, являются аминокислоты 234-239 (шарнирный участок), аминокислоты 265-269 (B/C петля), аминокислоты 297-299 (C'/E петля) и аминокислоты 327-332 (F/G петля). В некоторых вариантах осуществления молекулы настоящего изобретения, содержащие вариантные Fc-участки, содержат модификацию по меньшей мере одного остатка, который не создает прямого контакта с FcγR на основе структурного и кристаллографического анализа, например, не находится в пределах Fc-FcγR связывающего сайта.

В еще одном предпочтительном варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, чтоб указанная молекула связывала FcγR (через его участок Fc) с измененной аффинностью по отношению к молекуле, содержащей дикий тип Fc-участка, обеспечивая то, что указанная по меньшей мере одна аминокислотная модификация не включает или не является исключительно замещением в любом из положений 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 309, 312, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438, 439. В специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc так, что указанная молекула связывает FcγR (через его участок Fc) с измененной аффинностью по отношению к молекуле, содержащей дикий тип участка Fc, обеспечивая то, что указанный вариантный Fc-участок не включает или не является исключительно замещением в любом из положений 255, 258, 267, 269, 270, 276, 278, 280, 283, 285, 289, 292, 293, 294, 295, 296, 300, 303, 305, 307, 309, 322, 329, 332, 331, 337, 338, 340, 373, 376, 416, 419, 434, 435, 437, 438, 439 и не имеет аланина в любом из положений 256, 290, 298, 312, 333, 334, 359, 360, 326 или 430; лизина в положении 330; треонина в положении 339; метионина в положении 320; серина в положении 326; аспарагина в положении 326; аспарагиновой кислоты в положении 326; глутаминовой кислоты в положении 326; глутамина в положении 334; глутаминовой кислоты в положении 334; метионина в положении 334; гистидина в положении 334; валина в положении 334; или лейцина в положении 334; лизина в положении 335, аспарагина в положении 268; глутамина в положении 272; глутамина, серина или аспарагиновой кислоты в положении 286; серина в положении 290; метионина, глутамина, глутаминовой кислоты или аргинина в положении 320; глутаминовой кислоты в положении 322; серина, глутаминовой кислоты или аспарагиновой кислоты в положении 326; лизина в положении 330; глутамина в положении 335; или метионина в положении 301.

В специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок не включает или не является исключительно замещением в любом из положений 268, 269, 270, 272, 276, 278, 283, 285, 286, 289, 292, 293, 301, 303, 305, 307, 309, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438 или 439 и не имеет гистидина, глутамина или тирозина в положении 280; серина, глицина, треонина или тирозина в положении 290, лейцина или изолейцина в положении 300; аспарагина в положении 294, пролина в положении 296; пролина, аспарагина, аспарагиновой кислоты или валина в положении 298; лизина в положении 295. В еще одном предпочтительном варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc так, что указанная молекула связывает FcγR (через его участок Fc) с уменьшенной аффинностью по отношению к молекуле, содержащей дикий тип Fc-участка, обеспечивая то, что указанный вариантный Fc-участок не имеет или не имеет только замещение в любом из положений 252, 254, 265, 268, 269, 270, 278, 289, 292, 293, 294, 295, 296, 298, 300, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439. В еще одном предпочтительном варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу участка Fc так, что указанная молекула связывает FcγR (через его участок Fc) с повышенной аффинностью по отношению к молекуле, содержащей дикий тип участка Fc, обеспечивая то, что указанный вариантный Fc-участок не имеет или не является исключительно замещением в любом из положений 280, 283, 285, 286, 290, 294, 295, 298, 300, 301, 305, 307, 309, 312, 315, 331, 333, 334, 337, 340, 360, 378, 398 или 430.

В специфическом варианте осуществления данное изобретение включает в себя молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок не включает замещение или не имеет исключительно замещение в любом из положений 330, 243, 247, 298, 241, 240, 244, 263, 262, 235, 269 или 328 и не имеет лейцина в положении 243, аспарагина в положении 298, лейцина в положении 241, и изолейцина или аланина в положении 240, гистидина в положении 244, валина в положении 330, или изолейцина в положении 328.

В специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный Fc-участок, имеющий один или несколько аминокислотных модификаций (например, замещения), при этом модификации увеличивают аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA до по меньшей мере 2-кратного уровня по отношению к сравнительной молекуле, содержащей дикий тип Fc-участка. В определенных вариантах осуществления молекулы настоящего изобретения содержат вариантный Fc-участок, имеющий одну или несколько аминокислотных модификациий (например, замещения), при этом модификации увеличивают аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA до уровня более чем 2-кратного, по меньшей мере 4-кратного, по меньшей мере 5-кратного, по меньшей мере 6-кратного, по меньшей мере 8-кратного, или по меньшей мере 10-кратного по отношению к сравнительной молекуле, содержащей дикий тип Fc-участка. В других вариантах осуществления настоящего изобретения молекулы настоящего изобретения, содержащие вариантный Fc-участок, специфически связывают FcγRIIIA и/или FcγRIIA с по меньшей мере 65%, по меньшей мере 75%, по меньшей мере 85%, по меньшей мере 95%, по меньшей мере 100%, по меньшей мере 150%, по меньшей мере 200% большей аффинностью по отношению к молекуле, содержащей дикий тип участка Fc. Такие измерения предпочтительны в in vitro испытаниях.

Данное изобретение включает в себя молекулы с измененными аффинностями для активирующего и/или ингибиторного Fcγ-рецепторов. В частности, данное изобретение предусматривает молекулы с вариантными Fc-участками, имеющими одну или несколько аминокислотных модификаций, при этом модификации увеличивают аффинность вариантного Fc-участка для FcγRIIB, но снижают аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA по отношению к сравнительной молекуле с диким типом Fc-участка. В других вариантах осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, имеющими одну или несколько аминокислотных модификаций, при этом модификации снижают аффинность вариантного Fc-участка для FcγRIIB и также снижают аффинность вариантных Fc-участков для FcγRIIIA и/или FcγRIIA по отношению к сравнительной молекуле с диким типом участка Fc. Еще в другом варианте осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, имеющими одну или несколько аминокислотных модификаций, при этом модификации увеличивают аффинность вариантного Fc-участка для FcγRIIB и также увеличивают аффинность вариантных Fc-участков для FcγRIIIA и/или FcγRIIA по отношению к сравнительной молекуле с диким типом участка Fc. Еще в другом варианте осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, при этом модификации снижают аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA, но не изменяют аффинность вариантного Fc-участка для FcγRIIB по отношению к сравнительной молекула с диким типом участка Fc. Еще в другом варианте осуществления данное изобретение включает в себя молекулы с вариантными Fc-участками, при этом модификации увеличивают аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA, но снижают аффинность вариантного Fc-участка для FcγRIIB по отношению к сравнительной молекуле с диким типом участка Fc.

В специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный Fc-участок, имеющий одну или несколько аминокислотных модификаций (например, замещения), при этом одна или несколько модификаций увеличивают аффинность вариантного Fc-участка для FcγRIIIA и снижают аффинность вариантного Fc-участка для FcγRIIB по отношению к сравнительной молекуле, содержащей дикий тип участка Fc, которая связывает FcγRIIIA и FcγRIIB с аффинностью дикого типа. В определенном варианте осуществления одна или несколько аминокислотных модификаций не являются замещением на аланин в любом из положений 256, 298, 333 или 334.

В еще одном специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный Fc-участок, имеющий одну или несколько аминокислотных модификаций (например, замещения), при этом одна или несколько модификаций увеличивают аффинность вариантного Fc-участка для FcγRIIA и снижают аффинность вариантного Fc-участка для FcγRIIB по отношению к сравнительной молекуле, содержащей дикий тип Fc-участка, который связывает FcγRIIA и FcγRIIB с диким типом аффинности. В определенном варианте осуществления одна или несколько аминокислотных модификаций не являются замещением на аргинин в положении 320.

В самых предпочтительных вариантах осуществления молекулы настоящего изобретения с измененными аффинностями для активирующих и/или ингибиторных рецепторов, имеющих вариантные Fc-участки, имеют одну или несколько аминокислотных модификаций, где указанная одна или несколько аминокислотных модификаций представляют замещение в положении 288 на аспарагин, в положении 330 на серин и в положении 396 на лейцин (MgFc10); или замещение в положении 334 на глутаминовую кислоту, в положении 359 на аспарагин и в положении 366 на серин (MgFc13); или замещение в положении 316 на аспарагиновую кислоту, в положении 378 на валин и в положении 399 на глутаминовую кислоту (MgFc27); или замещение в положении 392 на треонин и в положении 396 на лейцин (MgFc38); или замещение в положении 221 на глутаминовую кислоту, в положении 270 на глутаминовую кислоту, в положении 308 на аланин, в положении 311 на гистидин, в положении 396 на лейцин и в положении 402 на аспарагиновую кислоту (MgFc42); или замещение в положении 240 на аланин и в положении 396 на лейцин (MgFc52); или замещение в положении 410 на гистидин и в положении 396 на лейцин (MgFc53); или замещение в положении 243 на лейцин, в положении 305 на изолейцин, в положении 378 на аспарагиновую кислоту, в положении 404 на серин и в положении 396 на лейцин (MgFc54); или замещение в положении 255 на изолейцин и в положении 396 на лейцин (MgFc55); или замещение в положении 370 на глутаминовую кислоту и в положении 396 на лейцин (MgFc59); или замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин (MgFc88); или замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин и в положении 396 на лейцин (MgFc88A); или замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин (MgFc155); или замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин; или замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 396 на лейцин; или замещение в положении 243 на лейцин и в положении 292 на пролин; или замещение в положении 243 на лейцин; или замещение в положении 273 на фенилаланин; или замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В зависимом варианте осуществления вариант Fc-участка дополнительно содержит одну или несколько аминокислотных модификаций, раскрытых в таблицах 4, 5, 9, и 10 ниже.

В определенных вариантах осуществления данное изобретение включает в себя способы скрининга и идентификации терапевтических и/или профилактических молекул, содержащих вариантные Fc-участки с измененными аффинностями к FcγR (например, увеличенная аффинность к FcγRIIIA), используя технику дисплея на поверхности дрожжей (для обзора см. Boder and Wittrup, 2000, Methods in Enzymology, 328: 430-444, который включен в данный документ ссылкой во всей своей полноте). Дисплей на поверхности дрожжей полипептидов, содержащих мутантный Fc, настоящего изобретения может быть выполнен в соответствии с техниками, известными специалистам в данной области техники или описанным в данном документе (смотри, например, публикации патентных заявок США №2005/0037000 и №2005/0064514, и публикацию международной патентной заявки WO 04/063351, каждая из которых включена в данный документ ссылкой в ее полном объеме). Дисплей на дрожжах предлагает преимущество использования фактического связывания с желаемым рецептором для идентификации вариантных Fc-участков, которые имеют повышенное связывание с данным рецептором.

В определенных вариантах осуществления данное изобретение включает в себя способы скрининга и идентификации терапевтических и/или профилактических молекул, содержащих вариантные Fc-участки с измененными FcγR аффинностями (например, увеличенная FcγRIIIA аффинность), используя технику дисплея на поверхности дрожжей, известный в данном уровне техники или описанный в данном документе в комбинации с одним или несколькими основанными на биохимии испытаниями, предпочтительно высокопропускными методами. Одно или несколько биохимических испытаний могут быть любыми испытаниями, известными в данном уровне техники для идентификации Fc-FcγR взаимодействия, т.е. специфического связывания Fc-участка с FcγR, включая без ограничения ELISA анализ, испытание поверхностного плазмонного резонанса, испытание иммунопреципитации, аффинную хроматографию и равновесный диализ. В некоторых вариантах осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки с измененными FcγR аффинностями (например, увеличенной FcγRIIIA аффинностью), выполняют с применением метода дрожжевого дисплея, как описано в данном документе, в комбинации с одним или несколькими испытаниями, основанными на функциональностях, предпочтительно высокопропускным методом. Тесты, основанные на функциональностях, могут быть любым испытанием, известным в данном уровне техники для характеристики одной или нескольких FcγR опосредованных эффекторных клеточных функций, таких как те, что описаны в данном документе в Разделе 6.2.2. Неограничивающие примеры эффекторных клеточных функций, которые могут использоваться в соответствии со способами настоящего изобретения, включают без ограничения антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC), антитело-зависимый фагоцитоз, фагоцитоз, опсонизацию, опсонофагоцитоз, клеточное связывание, розеткообразование, C1q связывание и комплемент-зависимую клеточно-опосредованную цитотоксичность. В некоторых вариантах осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки с измененными FcγR аффинностями (например, увеличенная FcγRIIIA аффинность), выполняют с применением способа дрожжевого дисплея, как описано в данном документе или известно в данном уровне техники, в комбинации с одним или несколькими испытаниями, основанными на биохимии, в комбинации или парралельно с одним или несколькими испытаниями, основанными на функциональностях, предпочтительно высокопропускным методом.

В предпочтительных вариантах осуществления данное изобретение включает в себя способы скрининга и характеристики FcγR-Fc взаимодействия с применением биохимических испытаний, разработанных изобретателями и раскрытых в публикациях патентных заявок США №2005/0037000 и №2005/0064514, и публикации международрой патентной заявки WO 04/063351, каждая из которых включена в данный документ ссылкой в ее полном объеме. Раскрытые испытания делают возможным обнаружение и количественное определение FcγR-Fc взаимодействия, несмотря на изначально слабую аффинность рецептора к его лиганду, например, в микромолярном диапазоне для FcγRIIB и FcγRIIIA. Способ предполагает образование комплекса FcγR (например, FcγRIIIA, FcγRIIB), который имеет повышенный авидитет для Fc-участка по отношению к некомплексованным FcγR.

Данное изобретение включает в себя применение иммунных комплексов, образованных в соответствии со способами, описанными выше для обнаружения функциональности молекул, содержащих Fc-участок в клеточном и бесклеточном испытаниях.

В предпочтительных вариантах осуществления молекулы настоящего изобретения (например, иммуноглобулины или их фрагменты), содержащие вариантные Fc-участки, также характеризуются в животной модели на предмет взаимодействия с FcγR или животной модели состояния заболевания. Предпочтительные животные модели для применения в способах настоящего изобретения представлены, например, трансгенными мышами, экспрессирующими человеческие FcγRs, например, любые мышиные модели, описаны в патентах США №5877397 и №6676927, которые включены в данный документ ссылкой в их полном объеме. Трансгенные мыши для применения в способах настоящего изобретения включают без ограничения нокаут FcγRIIIA мышей, несущих FcγRIIIA человека; нокаут FcγRIIIA мышей, несущих FcγRIIA человека; нокаут FcγRIIIA мышей, несущих FcγRIIB человека, и FcγRIIIA человека; нокаут FcγRIIIA мышей, несущих FcγRIIB человека и FcγRIIA человека; нокаут FcγRIIIA и FcγRIIA мышей, несущих FcγRIIIA и FcγRIIA человека; и нокаут FcγRIIIA, FcγRIIA и FcγRIIB мышей, несущих FcγRIIIA, FcγRIIA и FcγRIIB человека. Мышиная линия, применяемая для исследований нокаута, может быть любой подходящий инбредной линией (например, B6), как определяется обычно в данном уровне техники. В предпочтительных вариантах осуществления мышиная линия является линией голого генотипа, т.е. иммуно-ослабленной, что делает возможным исследования ксенотрансплантации (например, модели раковой опухоль). Такие голые линии включают без ограничения FoxN1 и N/N. В других вариантах осуществления мыши, несущие один или несколько FcγR человека, дополнительно содержат одну или несколько дополнительных генетических мутаций, включая один или несколько нокаутов, например, RAG1 -/-.

В специфическом варианте осуществления данное изобретение предлагает модифицированные иммуноглобулины, содержащие вариантный Fc-участок с повышенной аффинностью для FcγRIIIA и/или FcγRIIA. Такие иммуноглобулины включают IgG молекулы, которые естественно содержат FcγR связывающие участки (например, FcγRIIIA и/или FcγRIIB связывающие участки), или производные иммуноглобулина, которые были спроектированы, для того чтобы включать в себя FcγR связывающий участок (например, FcγRIIIA и/или FcγRIIB связывающие участки). Модифицированные иммуноглобулины настоящего изобретения включают любую иммуноглобулиновую молекулу, которая связывает, предпочтительно иммуноспецифически, т.е. конкурирует с неспецифическим связыванием, как было определено с помощью иммуноиспытаний, хорошо известных в данном уровне техники, для анализа специфического связывания антиген-антитело, антиген и содержит FcγR связывающий участок (например, FcγRIIIA и/или FcγRIIB связывающий участок). Такие антитела включают без ограничения поликлональные, моноклональные, биспецифические, полиспецифические, человеческие, гуманизированные, химерные антитела, антитела с одной цепью, Fab фрагменты, F(ab')2 фрагменты, дисульфидно-связаные Fv и фрагменты, содержащие либо VL, или VH домен или даже участок, определяющий комплементность (CDR), который специфически связывает антиген, в определенных случаях, спроектированный для того, чтобы содержать или быть слитым с FcγR связывающим участком.

В определенном варианте осуществления данное изобретение включает в себя иммуноглобулины, содержащие вариантный Fc-участок с повышенной аффинностью для FcγRIIIA и/или FcγRIIA так, что иммуноглобулин имеет повышенную эффекторную функцию, например, антитело-зависимую клеточно-опосредованную цитотоксичность. Эффекторная функция молекул настоящего изобретения может быть проанализирована с применением любого испытания, описанного в данном документе или известного специалистам в данной области техники. В некоторых вариантах осуществления иммуноглобулины, содержащие вариантный Fc-участок с повышенной аффинностью для FcγRIIIA и/или FcγRIIA, имеют повышенную ADCC активность по отношению к дикому типу, по меньшей мере 2-кратную, по меньшей мере 4-кратную, по меньшей мере 8-кратную, по меньшей мере 10-кратную, по меньшей мере 50-кратную, или по меньшей мере 100-кратную.

Данное изобретение включает в себя проектирование человеческих или гуманизированных терапевтических антител (например, специфических моноклональных антител к опухоли) в Fc-участке посредством модификации (например, замещение, вставка, делеция) одного или нескольких аминокислотных остатков, при этом модификации модулируют аффинность терапевтического антитела для активирующего рецептора FcγR и/или ингибиторного рецептора FcγR. В одном варианте осуществления данное изобретение относится к проектированию человеческих или гуманизированных терапевтических антител (например, моноклональных антител специфических к опухоли) в Fc-участке посредством модификации одного или нескольких аминокислотных остатков, при этом модификации увеличивают аффинность Fc-участка для FcγRIIIA и/или FcγRIIA. В другом варианте осуществления данное изобретение относится к проектированию человеческих или гуманизированных терапевтических антител (например, моноклональных антител специфических к опухоли) в Fc-участке посредством модификации одного или нескольких аминокислотных остатков, при этом модификация увеличивает аффинность Fc-участка для FcγRIIIA и/или FcγRIIA и также снижает аффинность Fc-участка для FcγRIIB. Спроектированные терапевтические антитела могут также иметь повышенную эффекторную функцию, например, повышенную ADCC активность, фагоцитозную активность и т.п., как было определено с помощью стандартных испытаний, известных специалистам в данной области техники.

В специфическом варианте осуществления данное изобретение включает в себя проектирование моноклонального антитела специфического для Her2/neu протоонкогена (аминокислотной последовательности SEQ ID NO:31) (например, 4D5 антитело, как раскрыто в Carter et al., 1992, Proc. Natl. Acad. Sci. USA 89:4285-9; патенте США №5677171; или публикации международной патентной заявки WO 01/00245, каждый из которых в данном документе включен ссылкой в его полном объеме) посредством модификации (например, замещение, вставка, делеция) по меньшей мере одного аминокислотного остатка, при этом модификация увеличивает аффинность Fc-участка для FcγRIIIA и/или FcγRIIA. В еще одном специфическом варианте осуществления модификация гуманизированного Her2/neu моноклонального антитела может также уменьшать аффинность Fc-участка для FcγRIIB. В еще одном специфическом варианте осуществления спроектированные гуманизированные моноклональные антитела, специфические для Her2/neu, могут также иметь повышенную эффекторную функцию, как было определено с помощью стандартных испытаний, известных в данном уровне техники, и раскрыто в подтверждающих примерах в данном документе. В определенном варианте осуществления 4D5 антитело является химерным. В другом варианте осуществления 4D5 антитело является гуманизированным. В специфическом варианте осуществления 4D5 антитело, спроектированное в соответствии со способами настоящего изобретения, содержит тяжелую цепь, имеющую аминокислотную последовательность SEQ ID NO:32. В еще одном специфическом варианте осуществления 4D5 антитело, спроектированное в соответствии со способами настоящего изобретения, содержит легкую цепь, имеющую аминокислотную последовательность SEQ ID NO:33. Еще в других вариантах осуществления 4D5 антитело, спроектированное в соответствии со способами настоящего изобретения, является гуманизированным и содержит тяжелую цепь, имеющую аминокислотную последовательность SEQ ID NO:34. В дополнительных вариантах осуществления 4D5 антитело, спроектированное в соответствии со способами настоящего изобретения, является гуманизированным и содержит легкую цепь, имеющую аминокислотную последовательность SEQ ID NO:35.

В специфическом варианте осуществления антитела настоящего изобретения связывают Her2/neu. Антитела к анти-Her2/neu настоящего изобретения могут иметь вариабельный участок тяжелой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO:36), и/или CDR2 (SEQ ID NO:37), и/или CDR3 (SEQ ID NO:38), и/или вариабельный участок легкой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO:39), и/или CDR2 (SEQ ID NO:40), и/или CDR3 (SEQ ID NO:41).

В специфическом варианте осуществления данное изобретение включает в себя антитело 4D5 (например, химерное, гуманизированное), содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя 4D5 антитело, имеющие лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя 4D5 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя 4D5 антитело, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя 4D5 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя 4D5 антитело, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В еще одном специфическом варианте осуществления данное изобретение включает в себя проектирование анти-CD20 антитела посредством модификации (например, замещение, вставка, делеция) по меньшей мере одного аминокислотного остатка, при этом модификация увеличивает аффинность Fc-участка для FcγRIIIA и/или FcγRIIA. В родственном варианте осуществления анти-CD20 антитело является мышино-человеческим химерным анти-CD20 моноклональным антителом, 2H7. Дальнейшие неограничивающие примеры анти-CD20 антитела, которые могут использоваться в способах настоящего изобретения, раскрыты в патентной заявке США № 11/271140, поданной 10 ноября 2005, включенной в данный документ ссылкой в ее полном объеме. В еще одном специфическом варианте осуществления модификация анти-CD20 моноклонального антитела, 2H7, может также уменьшать аффинность Fc-участка для FcγRIIB. В еще одном специфическом варианте осуществления спроектированное анти-CD20 моноклональное антитело, 2H7, может также иметь повышенную эффекторную функцию, как было определено с помощью стандартных испытаний, известных в данном уровне техники, и раскрыто в подтверждающем примере в данном документе.

В специфическом варианте осуществления данное изобретение включает в себя 2H7 антитело (например, химерное, гуманизированное), содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя 2H7 антитело, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя 4D5 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя 2H7 антитело, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя 2H7 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя 2H7 антитело, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В еще одном специфическом варианте осуществления данное изобретение включает в себя проектирование анти-FcγRIIB антитела, в частности, анти-FcγRIIB антитела, которое специфически связывает человеческий FcγRIIB, более конкретно природный человеческий FcγRIIB, посредством модификации (например, замещение, вставка, делеция) по меньшей мере одного аминокислотного остатка, при этом модификация увеличивает аффинность Fc-участка для FcγRIIIA и/или FcγRIIA. Неограничивающие примеры типичных анти-FcγRIIB антител раскрыты в предварительной заявке США №60/403266, поданной 12 августа 2002 г.; заявке США №10/643857, поданной 14 августа 2003 г.; и публикациях патентных заявок США №2004-0185045; №2005-0260213; и №2006-0013810, все из которых включены в данный документ ссылками в их полном объеме. Примеры анти-FcγRIIB антител, которые могут быть спроектированы в соответствии со способами настоящего изобретения, представляют моноклональные антитела, выработанные посредством клона 2B6, 3H7, 8B5.4.3, 1D5, 2E1, 2H9, 2D11, 8B5 и 1F2, имеющие ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, PTA-7610 и PTA-5959, соответственно (переданы на хранение в ATCC (Американскую коллекцию типовых культур), 10801 University Boulevard, Manassas, VA 02209-2011, все из которых включены в данный документе ссылкой), или их химерные, гуманизированные или другие спроектированные версии.

В специфическом варианте осуществления данное изобретение включает в себя проектирование гуманизированного антитела, содержащего вариабельный домен тяжелой цепи и/или вариабельный домен легкой цепи 2B6, 3H7 или 8B5.3.4. В еще одном специфическом вариант осуществления, данное изобретение включает в себя проектирование гуманизированного антитела, содержащего CDR от 2B6, 3H7 или 8B5.3.4. В специфическом варианте осуществления, данное изобретение включает в себя проектирование гуманизированного антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO: 1, SEQ ID NO:2 или SEQ ID NO:3, и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO: 4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 или SEQ ID NO: 8. В специфическом варианте осуществления данное изобретение включает в себя проектирование гуманизированного антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO:9, и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO:10.

В специфическом варианте осуществления данное изобретение включает в себя проектирование гуманизированного 2B6 антитела, содержащего тяжелую цепь, имеющую аминокислотную последовательность SEQ ID NO:42. В еще одном специфическом варианте осуществления данное изобретение включает в себя проектирование гуманизированного 2B6 антитела, содержащего тяжелую цепь, имеющую аминокислотную последовательность SEQ ID NO:29. Еще в других вариантах осуществления данное изобретение включает в себя проектирование гуманизированного 2B6 антитела, содержащего легкую цепь, имеющую аминокислотную последовательность SEQ ID NO:30. В предпочтительном варианте осуществления данное изобретение включает в себя проектирование гуманизированного 2B6 антитела, включающего тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO:29, и легкую цепь, содержащую последовательность SEQ ID NO:30. В специфическом аспекте настоящего изобретения данное изобретение включает в себя применение плазмиды pMGx0675, которая включает нуклеотидные последовательности SEQ ID NO:43 и SEQ ID NO:44, которые кодируют аминокислотную последовательность тяжелой цепи SEQ ID NO:29 и аминокислотную последовательность легкой цепи SEQ ID NO:30, соответственно. Плазмида pMGx0675 была передана на хранение в Американскую коллекцию типовых культур (10801 University Boulevard, Manassas, VA. 20110-2209) 23 мая 2006 г. по постановлению Будапештского договора о международном признании депонирования микроорганизмов для целей патентной процедуры и получила инвентарный номер PTA 7609, и включается в данный документ ссылкой.

В специфических вариантах осуществления данное изобретение включает в себя проектирование антител, предпочтительно гуманизированных, которые связывают внеклеточный домен нативного FcγRIIB человека. Гуманизированные анти-FcγRIIB антитела, охваченные данным изобретением, могут иметь вариабельный участок тяжелой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO:15, SEQ ID NO:16, аминокислотную последовательность, соответствующую аминокислотам 31-35, как предусмотрено в SEQ ID NO:2, или аминокислотную последовательность, соответствующую аминокислотам 31-35, как предусмотрено в SEQ ID NO:3), и/или CDR2 (SEQ ID NO:17, SEQ ID NO:18, аминокислотная последовательность соответствующую аминокислотам 50-66, как предусмотрено в SEQ ID NO:2, или аминокислотную последовательность, соответствующую аминокислотам 50-66, как предусмотрено в SEQ ID NO:3), и/или CDR3 (SEQ ID NO:19, SEQ ID NO:20, аминокислотную последовательность, соответствующую аминокислотам 100-111, как предусмотрено в SEQ ID NO:2, или аминокислотную последовательность, соответствующую аминокислотам 100-111, как предусмотрено в SEQ ID NO:3), и/или вариабельный участок легкой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO:21, SEQ ID NO:22, или аминокислотную последовательность, соответствующую аминокислотам 24-34, как предусмотрено в SEQ ID NO:8), и/или CDR2 (SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, или аминокислотную последовательность, соответствующую аминокислотам 50-56, как предусмотрено в SEQ ID NO:62), и/или CDR3 (SEQ ID NO:27, SEQ ID NO:28, или аминокислотную последовательность, соответствующую аминокислотам 90-98, как предусмотрено в SEQ ID NO:8).

В специфическом варианте осуществления данное изобретение включает в себя 2B6 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя 2B6 антитело, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя 2B6 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя 2B6 антитело, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя 2B6 антитело, содержащее вариантный Fc-участок, имеющий замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя 2B6 антитело, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В специфическом варианте осуществления модификация анти-FcγRIIB антитела может также уменьшать аффинность Fc-участка для FcγRIIB по отношению к дикому типу антитела. В еще одном специфическом варианте осуществления спроектированное анти-FcγRIIB антитело может также иметь повышенную эффекторную функцию, как было определено с помощью стандартных испытаний, известных в данном уровне техники, и раскрыто и подтверждено примером в данном документе. В специфическом варианте осуществления анти-FcγRIIB моноклональное антитело содержит модификацию в положении 334 на глутаминовую кислоту, в положении 359 на аспарагин и в положении 366 на серин (MgFc13); или замещение в положении 316 на аспарагиновую кислоту, в положении 378 на валин и в положении 399 на глутаминовую кислоту (MgFc27); или замещение в положении 243 на изолейцин, в положении 379 на лейцин и в положении 420 на валин (MgFc29); или замещение в положении 392 на треонин и в положении 396 на лейцин (MgFc38); или замещение в положении 221 на глутаминовую кислоту, в положении 270 на глутаминовую кислоту, в положении 308 на аланин, в положении 311 на гистидин, в положении 396 на лейцин и в положении 402 на аспарагиновую (MgFc42); или замещение в положении 410 на гистидин и в положении 396 на лейцин (MgFc53); или замещение в положении 243 на лейцин, в положении 305 на изолейцин, в положении 378 на аспарагиновую кислоту, в положении 404 на серин и в положении 396 на лейцин (MgFc54); или замещение в положении 255 на изолейцин и в положении 396 на лейцин (MgFc55); или замещение в положении 370 на глутаминовую кислоту и в положении 396 на лейцин (MgFc59); или замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин (MgFc88); или замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин и в положении 396 на лейцин (MgFc88A); или замещение в положении 234 на лейцин, в положении 292 на пролин и в положении 300 на лейцин (MgFc155); или замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин; или замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 396 на лейцин; или замещение в положении 243 на лейцин и в положении 292 на пролин; или замещение в положении 243 на лейцин; или замещение в положении 273 на фенилаланин; или замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В родственном варианте осуществления вариантный Fc-участок дополнительно содержит одну или несколько аминокислотных модификаций, раскрытых в таблицах 4, 5, 9, и 10 ниже.

В специфических вариантах осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b (например, химерное, гуманизированное), содержащее вариантный Fc-участок, и применение антитела для лечения раковой опухоли. В специфических вариантах осуществления антитело, которое связывается с CD79b или CD79b, имеет замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b рецепторами, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b, содержащее вариантный Fc-участок, имеющий замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя антитело, которое связывается с CD79a или CD79b, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В специфических вариантах осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1 (например, химерное, гуманизированное), содержащее вариантный Fc-участок, и применение антитела для лечения раковой опухоли. В специфических вариантах осуществления антитело, которое связывается с ErbB1, имеет замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1 рецептором, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1, содержащее вариантный Fc-участок, имеющего замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя антитело, которое связывается с ErbB1, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В специфических вариантах осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-a рецептор, TNF-ß рецептор или TNF-γ рецептор (например, химерное, гуманизированное), содержащее вариантный Fc-участок, и применение антитела для лечения раковой опухоли. В специфических вариантах осуществления антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, имеет замещение в положении 243 на лейцин, в положении 292 на пролин, в положении 300 на лейцин, в положении 305 на изолейцин и в положении 396 на лейцин. В еще одном специфическом варианте осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, содержащее вариантный Fc-участок, имеющий замещение в положении 243 на лейцин, в положении 292 на пролин и в положении 300 на лейцин. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, содержащее вариантный Fc-участок, имеющий замещение в положении 247 на лейцин, в положении 270 на глутаминовую кислоту и в положении 421 на лизин. В другом варианте осуществления данное изобретение включает в себя антитело, которое связывает A33, CD5, CD11c, CD19, CD22, CD23, CD27, CD40, CD45, CD103, CTLA4, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

Данное изобретение также включает полинуклеотиды, которые кодируют молекулу настоящего изобретения, включая полипептиды и антитела, идентифицированные способами настоящего изобретения. Полинуклеотиды, кодирующие молекулы настоящего изобретения могут быть получены, и нуклеотидная последовательность полинуклеотидов определена посредством любого способа, известного в данном уровне техники. Данное изобретение относится к выделенной нуклеиновой кислоте, кодирующей молекулу настоящего изобретения. Данное изобретение также обеспечивает вектор, содержащий указанную нуклеиновую кислоту. Данное изобретение также обеспечивает клетки-хозяева, содержащие векторы или полинуклеотиды настоящего изобретения.

Данное изобретение также обеспечивает способы продуцирования молекул настоящего изобретения. Молекулы настоящего изобретения, включающие полипептиды и антитела, могут быть продуцированы посредством любого способа, известного специалистам в данной области техники, в частности, посредством рекомбинантной экспрессии. В специфическом варианте осуществления данное изобретение относится к способу для рекомбинантного продуцирования молекулы настоящего изобретения, указанный способ включает в себя: (i) культивирование в среде клетки-хозяина, содержащую нуклеиновую кислоту, кодирующую указанную молекулу, при условиях подходящих для экспрессии указанной молекулы; и (ii) извлечение указанной молекулы из указанной среды.

Молекулы, идентифицированные в соответствии со способами настоящего изобретения, полезны в профилактике, лечении или улучшении одного или нескольких симптомов, связанных с заболеванием, нарушением или инфекцией. Молекулы настоящего изобретения особенно полезны для лечения или предотвращения заболевания или нарушения, где повышенная эффективность эффекторной клеточной функции (например, ADCC), опосредованной с помощью FcγR, желательна, например, раковая опухоль, инфекционное заболевание, и в повышении терапевтической эффективности терапевтических антител, эффект которых опосредуется с помощью ADCC.

В одном варианте осуществления данное изобретение включает в себя способ лечения раковой опухоли у пациента, имеющего раковую опухоль, характеризуемую с помощью ракового антигена, указанный способ включает в себя применение терапевтически эффективного количества терапевтического антитела, которое связывает антиген раковой опухоли, которое было спроектировано в соответствии со способами настоящего изобретения. В специфическом варианте осуществления данное изобретение включает в себя способ лечения раковой опухоли у пациента, имеющего раковую опухоль, характеризуемую с помощью антигена раковой опухоли, указанный способ включает в себя применение терапевтически эффективного количества терапевтического антитела, которое специфически связывает указанный раковый антиген, указанное терапевтическое антитело включает в себя вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, что указанное терапевтическое антитело специфически связывает FcγRIIIA через свой Fc-участок с большей аффинностью, чем терапевтическое антитело, содержащее дикий тип Fc-участка, связывает FcγRIIIA, обеспечивая то, что указанный вариантный Fc-участок не имеет замещения в положениях 329, 331 или 332, и не имеет аланина в любом из положений 256, 290, 298, 312, 333, 334, 359, 360 или 430; лизина в положении 330; треонина в положении 339; метионина в положении 320; серина в положении 326; аспарагина в положении 326; аспарагиновой кислоты в положении 326; глутаминовой кислоты в положении 326; глутамина в положении 334; глутаминовой кислоты в положении 334; метионина в положении 334; гистидина в положении 334; валина в положении 334; или лейцина в положении 334. В еще одном специфическом варианте осуществления данное изобретение включает в себя способ лечения раковой опухоли у пациента, имеющего раковую опухоль, характеризуемую с помощью антигена раковой опухоли, указанный способ включает введение терапевтически эффективного количества терапевтического антитела, которое специфически связывает антиген раковой опухоли, указанное терапевтическое антитело включает вариантный Fc-участок, где указанный вариантный Fc-участок включает по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, что указанное терапевтическое антитело специфически связывает FcγRIIIA через свой Fc-участок с большей аффинностью, чем терапевтическое антитело, включающее дикий тип Fc-участка, связывает FcγRIIIA, и указанное терапевтическое антитело также специфически связывает FcγRIIB с более низкой аффинностью, чем терапевтическое антитело, включающее в себя дикий тип Fc-участка, связывает FcγRIIB, обеспечивая то, что указанный вариантный Fc-участок не имеет аланина в любом из положений 256, 298, 333 или 334. Данное изобретение включает способ лечения раковой опухоли у пациента, характеризуемой с помощью антигена раковой опухоли, указанный способ включает в себя применение терапевтически эффективного количества терапевтического антитела, которое специфически связывает антиген указанной раковой опухоли и указанное терапевтическое антитело, включающее вариантный Fc-участок так, что антитело имеет повышенную ADCC активность.

Данное изобретение включает способ лечении аутоиммунного нарушения и/или воспалительного нарушения у пациента, который в этом нуждается, указанный способ включает применение указанным пациентом терапевтически эффективного количества молекулы, включающей вариантный Fc-участок, где указанный вариантный Fc-участок включает в себя по меньшей мере одну аминокислотную модификацию по отношению к дикому типу Fc-участка так, что указанная молекула специфически связывает FcγRIIB через его Fc-участок с большей аффинность, чем сравнительная молекула, включающая в себя дикий тип Fc-участка, и указанная молекула также специфически связывает FcγRIIIA через его Fc-участок с более низкой аффинностью, чем сравнительная молекула, включающая в себя дикий тип Fc-участка, и указанная молекула связывает иммунный комплекс (например, комплекс антиген/антитело). Данное изобретение включает способ лечения аутоиммунного нарушения и/или воспалительного нарушения, дополнительно включающий применение одного или нескольких дополнительных профилактических или терапевтических средств, например, иммуномодуляторных средств, противовоспалительных средств, применяемых для лечения и/или предотвращения таких заболеваний.

Данное изобретение также включает способы лечения или предотвращения инфекционного заболевания у субъекта, включающие применение терапевтически или профилактически эффективного количества одной или нескольких молекул настоящего изобретения, которые связывают инфекционный агент или его клеточный рецептор. Инфекционные заболевания, которые можно лечить или предотвращать с помощью молекул настоящего изобретения, вызываются посредством инфекционных агентов, включая без ограничения вирусы, бактерии, грибы, простейшие и вирусы.

В соответствии с одним аспектом настоящего изобретения молекулы настоящего изобретения, содержащие вариантные Fc-участки, имеют повышенную эффекторную функцию антитела в отношении инфекционных агентов, например, патогенного белка, по отношению к сравнительной молекуле, содержащей дикий тип Fc-участка. В специфическом варианте осуществления молекулы настоящего изобретения увеличивают эффективность лечения инфекционного заболевания посредством увеличения фагоцитоза и/или опсонизации инфекционного агента, вызывающего инфекционное заболевание. В еще одном специфическом варианте осуществления молекулы настоящего изобретения увеличивают эффективность лечения инфекционного заболевания посредством увеличения ADCC инфицированных клеток, вызывающих инфекционное заболевание.

В некоторых вариантах осуществления молекулы настоящего изобретения могут применяться в комбинации с терапевтически или профилактически эффективным количеством одного или дополнительных терапевтических средств, известных специалистам в данной области техники для лечения и/или предотвращения инфекционного заболевания. Данное изобретение предусматривает применение молекул настоящего изобретения в комбинации с антибиотиками, известными специалистам в данной области техники для лечения и/или предотвращения инфекционного заболевания.

Данное изобретение предлагает фармацевтические композиции, содержащие молекулу настоящего изобретения, например, полипептид, содержащий вариантный Fc-участок, иммуноглобулин, содержащий вариантный Fc-участок, терапевтическое антитело, спроектированное в соответствии с данным изобретением, и фармацевтически приемлемый носитель. Данное изобретение дополнительно обеспечивает фармацевтические композиции, дополнительно содержащие одно или несколько дополнительных терапевтических средств, включая без ограничения, противораковые средства, противовоспалительные средства, иммуномодуляторные средства.

4.1 ОПРЕДЕЛЕНИЯ

Как используется в данном документе, выражение «Fc-участок» применяется для определения С-терминального участка тяжелой цепи IgG. Хотя границы могут незначительно отличаться, определено, что Fc-участок тяжелой цепи IgG человека простирается от Cys226 до карбокси-конца. Fc-участок IgG содержит два константных домена, CH2 и CH3. CH2 домен Fc-участка IgG человека (также называемый «Cγ2» домен) обычно простирается от аминокислоты 231 до аминокислоты 338. CH3 домен Fc-участка IgG человека обычно простирается от аминокислот 342 до 447. CH2 домен уникален в том, что он не находится тесно в паре с другим доменом. Скорее всего, две N-связанные разветвленные углеводные цепи вставлены между двумя СН2 доменами интактного нативного IgG.

Во всем данном описании нумерация остатков тяжелой цепи в IgG представлена нумерацией согласно индексу EU, как представелено в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1, MD (1991), прямо включенной в данный документ ссылками. «Индекс EU согласно Кабат» относится к нумерации человеческого антитела IgG1 EU.

«Шарнирный участок» в общем определяется как отрезок от Glu216 до Pro230 IgG1 человека. Шарнирные участки других изотипов IgG могут соответствовать последовательности IgG1 посредством размещения первого и последнего цистеиновых остатков, формирующих S-S связи между тяжелыми цепями в тех же самых положениях.

Как используется в данном документе, термины «антитело» и «антитела» относятся к моноклональным антителам, многоспецифическим антителам, антителам человека, гуманизированным антителам, синтетическим антителам, химерным антителам, поликлональным антителам, верблюжьим антителам, одноцепочечным Fv (scFv), одноцепочечным антителам, Fab фрагментам, F(ab') фрагментам, дисульфидно-связанным биспецифическим Fv (sdFv), интраантителам и антиидиотипическим (анти-Id) антителам (включая, например, анти-Id и анти-анти-Id антитела к антителам настоящего изобретения), и эпитоп-связывающим фрагментам любого из вышеуказанного. В частности, антитела включают иммуноглобулиновые молекулы и иммуннологически активные фрагменты иммуноглобулиных молекул, т.е. молекул, которые содержат антиген-связывающий сайт. Иммуноглобулиновые молекулы могут быть любого типа (например, IgG, IgE, IgM, IgD, IgA и IgY), класса (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или подкласса.

Как используется в данном документе, термин «вариантный Fc-участок» предназначен для обозначения Fc-участка, который был модифицирован посредством замещения, вставки или делеции одного или нескольких аминокислотных остатков по отношению к Fc-участку немодифицированной молекулы (т.е. “дикого типа” иммуноглобулина). Данное изобретение относится к молекулам, которые обладают Fc-участками, имеющими измененное соотношение аффинностей для FcγR, который активирует клеточную эффекторную функцию (т.е. “FcγRАктивирующий ,” такой как FcγRIIA или FcγRIIIA) по отношению к FcγR, который ингибирует клеточную эффекторную функцию (т.е. “FcγRИнгибирующий”, такой как FcγRIIB):

Изменение в аффинности к FcγRактивирующий варианта по отношению к дикому типу

Соотношение аффиностей =

Изменение в аффинности к FcγRингибирующий варианта по отношению к дикому типу

Таким образом, для любой конкретной молекулы, имеющей вариантный Fc-участок, молекулярное соотношение аффинностей определяется посредством расчета разницы в аффинности вариантного Fc-участка молекулы к FcγRАктивирующий (например, к FcγRIIA или к FcγRIIIA) по отношению к аффинности дикого типа иммуноглобулина к указанному FcγRАктивирующий (например, аффинностьFcγRIIIA вариантного Fc-участка - АффинностьFcγRIIIA дикого типа иммуноглобулина), и деления такой разницы на разницу в аффинности к FcγRИнгибирующий (например, FcγRIIB) вариантного Fc-участка молекулы по отношению к аффинности дикого типа иммуноглобулина к указанному FcγRИнгибирующий (например, АффинностьFcγRIIB вариантного Fc-участка - АффинностьFcγRIIB дикого типа иммуноглобулина). Увеличенное соотношение аффинностей может быть результатом того, что Fc-участок молекулы, имеющий (по отношению к дикому типу Fc) увеличение аффинности к FcγRАктивирующий (например, к FcγRIIA или к FcγRIIIA), сопряженное либо с неизмененной аффинностью с FcγRИнгибирующий (например, FcγRIIB), или уменьшением аффинности к указанному FcγRИнгибирующий. В соответствии с другим вариантом увеличенное соотношение аффинностей может вытекать из проявления Fc-участоком такой молекулы увеличения аффинности как к FcγRАктивирующий, так и FcγRИнгибирование (по отношению к дикому типу Fc), обеспеченное тем, что увеличение аффинности к FcγRАктивирующий превышает увеличение аффинности к FcγRИнгибирующий (т.е. связывание с FcγRАктивирующий является «значительно» увеличенным по сравнению со связыванием с FcγRИнгибирующий, которое является просто увеличеннным), или могут вытекать из проявления Fc-участком такой молекулы сниженной аффинности как к FcγRАктивирующий, так и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что уменьшение аффинности к FcγRАктивирующий является меньшим, чем снижение аффинности к FcγRИнгибирующий (т.е. связывание с FcγRИнгибирующий является «значительно» сниженным по сравнению со связыванием с FcγRАктивирующий, которое является просто сниженным), или могут быть результатом неизмененной аффинности к FcγRАктивирующий сопряженное с уменьшением аффинности к FcγRИнгибирующий. Уменьшенное соотношение аффинностей может быть результатом того, что Fc-участок молекулы имеет (по отношению к дикому типу Fc) уменьшение аффинности к FcγRАктивирующий, сопряженое либо с неизмененной аффинностью с FcγRИнгибирующий, или с увеличением аффинности к FcγRИнгибирующий. В соответствии с другим вариантом уменьшенное соотношение аффинностей может вытекать из проявления Fc-участком такой молекулы уменьшения аффинности как к FcγRАктивирующий, так и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что уменьшение аффинности к FcγRАктивирующий превышает снижение аффинности к FcγRИнгибирующий (т.е. связывание с FcγRАктивирующий является «значительно» сниженным по сравнению со связыванием с FcγRИнгибирующий, которое является просто сниженным), или может вытекать из проявления Fc-участком такой молекулы увеличенной аффинности как к FcγRАктивирующий, так и FcγRИнгибирующий (по отношению к дикому типу Fc), обеспеченное тем, что увеличение аффинности к FcγRАктивирующий является меньшим, чем увеличение аффинности к FcγRИнгибирующий (т.е. связывание с FcγRИнгибирующий является «значительно» увеличенным по сравнению со связыванием с FcγRАктивирующий, которое является просто увеличенным), или могут быть результатом неизмененной аффинности к FcγRАктивирующий, сопряженной с увеличением аффинности к FcγRИнгибирование.

Как используется в данном документе, выражение «производное» в контексте полипептидов или белков относится к полипептиду или белку, который содержит аминокислотную последовательность, которая была изменена посредством введения замещений аминокислотного остатка, делеций или добавлений. Выражение «производное» , как используется в данном документе, также относится к полипептиду или белку, который был модифицирован, т.е. посредством ковалентного прикрепления любого типа молекулы к полипептиду или белку. Например, но не путем ограничения, антитело может быть модифицировано, например, посредством гликозилирования, ацетилирования, пегилирования, фосфорилирования, амидирования, дериватизаци с помощью известных защищающих/блокирующих групп, протеолитического отщепления, связывания с клеточным лигандом или другим белком и т.п. Производный полипептид или белок могут продуцироваться посредством химических модификаций, используя методы, известные специалистам в данной области, включая без ограничения специфическое химическое отщепление, ацетилирование, формилирование, метаболический синтез туникамицина и т.п. Также, производный полипептид или белковое производное обладают похожей или идентичной функцией как полипептид или белок, из которого он был произведен.

Как используется в данном документе, выражение «производное» в контексте небелковоподобного производного относится ко второй органической или неорганической молекуле, которая формируется на основе структуры первой органической или неорганической молекулы. Производное органической молекулы включает без ограничения молекулу модифицированную, например, посредством добавления или удаления гидроксильной, метильной, этиловой, карбоксильной или аминовой группы. Оганическая молекула может быть также эстерифицированной, алкилированной и/или фосфорилированной.

Как используется в данном документе, термины «нарушение» и «заболевание» обычно взаимозаменяемо относятся к условию у субъекта. В частности, выражение «аутоиммунное заболевание» обычно взаимозаменяемо с выражением «аутоиммунное нарушение» относится к условию у субъекта, характеризуемому клеточным, тканевым и/или органным повреждением, вызванным посредством иммунологической реакции субъекта на свои собственные клетки, ткани и/или органы. Выражение «воспалительное заболевание» обычно взаимозаменяемо с выражением «воспалительное нарушение» относится к условию у субъекта, характеризуемому воспалением, предпочтительно хроническим воспалением. Аутоиммунные расстройства могут быть или могут не быть вызваны воспалением. Более того, воспаление может быть или может не быть вызвано аутоиммунным нарушением. Таким образом, определенные расстройства могут быть охарактеризованы и как аутоиммунные, и как воспалительные расстройства.

Как используется в данном документе, выражение «раковая опухоль» относится к новообразованию или опухоли, вызванной ненормальным неконтролируемым ростом клеток. Как используется в данном документе, раковая опухоль четко включает лейкемии и лимфомы. В некоторых вариантах осуществления раковая опухоль относится к доброкачественной опухоли, которая оставалась локальной. В других вариантах осуществления, раковая опухоль относится к злокачественной опухоли, которая вторгалась и разрушала соседствующие структуры тела и распространялась на удаленные сайты. В некоторых вариантах осуществления раковая опухоль ассоциирована со специфическим антигеном раковой опухоли.

Как используется в данном документе, выражение «иммуномодуляторное средство» и вариации такового относятся к средству, которое модулирует хозяйскую иммунную систему. В определенных вариантах осуществения иммуномодуляторное средство представлено иммунодепрессантным средством. В определенных других вариантах осуществления иммуномодуляторное средство представлено иммуностимуляторным средством. Иммуномодуляторные агенты включают без ограничения малые молекулы, пептиды, полипептиды, слитые белки, антитела, неорганические молекулы, миметические агенты и органические молекулы.

Как используется в данном документе, выражение «эпитоп» относится к фрагменту полипептида или белка или небелковой молекулы, имеющему антигенную или иммуногенную активность у животного, предпочтительно у млекопитающего, и наиболее предпочтительно у человека. Эпитоп, имеющий иммуногенную активность, является фрагментом полипептида или белка, который вызывает ответ антителом у животного. Эпитоп, имеющий антигенную активность, является фрагментом полипептида или белка, с которым антитело иммуноспецифически связывается, как определено с помощью любого способа, хорошо известного специалисту в данной области, например посредством иммуноиспытаний. Не требуется, чтобы антигеннные эпитопы были обязательно иммуногенными.

Как используется в данном документе, выражение «фрагмент» относится к пептиду или полипептиду, содержащему аминокислотную последовательность, по меньшей мере 5 смежных аминокислотых остатков, по меньшей мере 10 смежных аминокислотых остатков, по меньшей мере 15 смежных аминокислотых остатков, по меньшей мере 20 смежных аминокислотых остатков, по меньшей мере 25 смежных аминокислотых остатков, по меньшей мере 40 смежных аминокислотых остатков, по меньшей мере 50 смежных аминокислотых остатков, по меньшей мере 60 смежных амино остатков, по меньшей мере 70 смежных аминокислотых остатков, по меньшей мере 80 смежных аминокислотых остатков, по меньшей мере 90 смежных аминокислотых остатков, по меньшей мере 100 смежных аминокислотых остатков, по меньшей мере 125 смежных аминокислотых остатков, по меньшей мере 150 смежных аминокислотых остатков, по меньшей мере 175 смежных аминокислотых остатков, по меньшей мере 200 смежных аминокислотых остатков или по меньшей мере 250 смежных аминокислотых остатков аминокислотной последовательности другого полипептида. В специфическом варианте осуществления фрагмент полипептида сохраняет по меньшей мере одну функцию полипептида.

Как используется в данном документе, термины «нуклеиновые кислоты» и «нуклеотидные последовательности» включают ДНК молекулы (например, кДНК или геномную ДНК), РНК молекулы (например, мРНК), комбинации ДНК и РНК молекул или гибридные ДНК/РНК молекулы, и аналоги ДНК или РНК молекул. Такие аналоги могут быть образованы с использованием, например, нуклеотидных аналогов, которые включают без ограничения инозин или тритилированные основания. Такие аналоги могут также содержать ДНК или РНК молекулы, содержащие модифицированные каркасы, которые предоставляют полезные качества молекулам, такие как, например, устойчивость к нуклеазе или увеличенную способность пересекать клеточные мембраны. Нуклеиновые кислоты или нуклеотидные последовательности могут быть однонитевыми, двухнитевыми, могут содержать как однонитевые, так и двухнитевые части, и могут содержать трехнитевые части, но предпочтительно представлены двухнитевыми ДНК.

Как используется в данном документе, «терапевтически эффективное количество» относится к такому количеству терапевтического средства, достаточному, чтобы лечить или оказывать помощь при заболевании или нарушении. Терапевтически эффективное количество может относиться к количеству терапевтического средства, достаточному для приостановления или минимизации начала заболевания, например, для приостановления или минимизации распространения раковой опухоли. Терапевтически эффективное количество может также относиться к количеству терапевтического средства, которое обеспечивает терапевтическую пользу в лечении или оказаниии помощи при заболевании. Также, терапевтически эффективное количество по отношению к терапевтическому средству настоящего изобретения означает количество терапевтического средства самого по себе, или в комбинации с другими терапиями, что обеспечивает терапевтическую пользу в лечении или оказании помощи при заболевании.

Как используется в данном документе, термины «профилактическое средство» и «профилактические средства» относятся к любому средству(ам), которые могут использоваться для предотвращения нарушения, или предотвращения рецидива или распространения нарушения. Профилактически эффективное количество может относиться к количеству профилактического средства, достаточному для предотвращения рецедива или распространения гиперпролиферативного заболевания, особенно раковой опухоли, или случая такового у пациента, включая без ограничения предрасположенного к гиперпролиферативному заболеванию, например, такого, который генетически предрасположен к злокачественной опухоли или ранее подвергался действию карциногенов. Профилактически эффективное количество может также относиться к количеству профилактического средства, которое обеспечивает профилактическую пользу для предотвращения заболевания. Также, профилактически эффективное количество по отношению к профилактическому средству настоящего изобретения означает количество профилактического средства самого по себе, или в комбинации с другими средствами, которое обеспечивает профилактическую пользу в предотвращении заболевания.

Как используется в данном документе, термины «предотвращать», «предотвращающий» и «предотвращение» относятся к предотвращению рецидива или начала одного или нескольких симптомов нарушения у субъекта как результату введения профилактического или терапевтического средства.

Как используется в данном документе, выражение «в комбинации» относится к применению более чем одного профилактического и/или терапевтического средства. Применение выражения «в комбинации» не ограничивает порядок, в котором профилактические и/или терапевтическое средства применяются у субъекта с нарушением. Первое профилактическое или терапевтическое средство может применяться перед (например, 5 минут, 15 минут, 30 минут, 45 минут, 1 час, 2 часа, 4 часа, 6 часов, 12 часов, 24 часа, 48 часов, 72 часа, 96 часов, 1неделю, 2 недели, 3 недели, 4 недели, 5 недель, 6 недель, 8 недель, или 12 недель перед), одновременно с или последовательно с (например, 5 минут, 15 минут, 30 минут, 45 минут, 1час, 2ч аса, 4 часа, 6 часов, 12 часов, 24 часа, 48 часов, 72 часа, 96 часов, 1 неделю, 2 недели, 3 недели, 4 недели, 5 недель, 6 недель, 8 недель, или 12 недель после) введением второго профилактического или терапевтического средства субъекту с нарушением.

«Эффекторная функция», как используется в данном документе, обозначает биохимическое событие, которое вытекает из взаимодействия Fc-участка антитела с Fc-рецептором или лигандом. Эффекторные функции включают без ограничения антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC), антитело-зависимый клеточно-опосредованный фагоцитоз (ADCP) и комплемент-зависимую цитотоксичность (CDC). Эффекторные функции включают как те, что осуществляются после связывания антигена, так и те, что осуществляются независимо от связывания антигена.

«Эффекторная клетка», как используется в данном документе, обозначает клетку иммунной системы, которая экспрессирует один или несколько Fc-рецепторов и опосредует одну или несколько эффекторных функций. Эффекторные клетки включают без ограничения моноциты, макрофаги, нейтрофилы, дендритные клетки, эозинофилы, тучные клетки, тромбоциты, B-клетки, большие гранулярные лимфоциты, клетки Лангерганса, натуральные клетки-киллеры (NK), и могут быть из любого организма, включая без ограничения людей, мышей, крыс, кроликов и обезьян.

«Fc-лиганд», как используется в данном документе, обозначает молекулу, предпочтительно полипептид, из любого организма, который связывается с Fc-участком антитела для образования комплекса Fc-лиганда. Fc-лиганды включают без ограничения FcγRs, FcγRs, FcγRs, FcRn, C1q, C3, стафилококковый белок A, стрептококковый белок G и вирусный FcγR. Fc-лиганды могут включать неоткрытые молекулы, которые связывают Fc.

5. КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

ФИГ. 1. ПОРЯДОК ПРИНЯТИЯ РЕШЕНИЯ ДЛЯ ВЫБОРА Fc-МУТАНТОВ

Пример протокола для выбора Fc мутантов.

ФИГ. 2. СХЕМА ПОСЛЕДОВАТЕЛЬНОСТИ 8B5.3.4 ВАРИАБИЛЬНОГО ДОМЕНА ТЯЖЕЛОЙ ЦЕПИ

Описание 8B5.3.4 VH нуклеотида и аминокислотной последовательности (SEQ ID NOS:12 и 9, соответственно).

ФИГ. 3. СХЕМА ПОСЛЕДОВАТЕЛЬНОСТИ 8B5.3.4 ВАРИАБИЛЬНОГО ДОМЕНА ЛЕГКОЙ ЦЕПИ

Описание 8B5.3.4 VL нуклеотида и аминокислотной последовательности (SEQ ID NOS:11 и 10, соответственно).

ФИГ. 4. ЗАХВАТ CH 4-4-20 АНТИТЕЛА НА BSA-FITC ПОВЕРХНОСТИ

6 мкл антитела при концентрации приблизительно 20 мкг/мл было введно при 5 мл/мин на поверхность BSA-флуоресцеин-изотиоцианата (FITC). Показана BIAcore сенсограмма связывания ch 4-4-20 антител с мутантом Fc-участков на поверхности BSA-FITC иммобилизованного первичного преобразователя. Маркер был установлен на ответ дикого типа захваченного антитела.

ФИГ. 5. СЕНСОГРАММА В РЕАЛЬНОМ ВРЕМЕНИ СВЯЗЫВАНИЯ FcγRIIIA С CH 4-4-20 АНТИТЕЛАМИ, НЕСУЩИМИ ВАРИАНТНЫЕ Fc-УЧАСТКИ

Связывание FcγRIIIA с ch-4-4-20 антителами, несущими вариантные Fc-участки, были проанализированы при 200 нМ концентрации. Ответы были нормализованы к уровню ch-4-4-20 антитела, полученому для дикого типа.

Применяемые мутанты были следующими: Mut 6 (S219V), Mut 10 (P396L, A330S, K288N); Mut 18 (K326E); Mut 14 (K334E, K288N); Mut 11 (R255L, F243L); Mut 16 (F372Y); Mut 19 (K334N, K246I).

ФИГ. 6 A-H. АНАЛИЗ КИНЕТИЧЕСКИХ ПАРАМЕТРОВ СВЯЗЫВАНИЯ FcγRIIIA С АНТИТЕЛАМИ, НЕСУЩИМИ ВАРИАНТНЫЕ Fc-УЧАСТКИ

Кинетические параметры для связывания FcγRIIIA с антителами, несущими вариантные Fc-участки, были получены путем создания отдельных лучших сглаживаний кривых для 200 нМ и 800 нМ. Сплошная линия указывает на связанное сглаживание, которое было получено на основе значений koff, рассчитанных для кривых диссоциации в интервале 32-34 сек. Значения Kd и koff представляют среднюю величину двух концентраций.

ФИГ. 7. СЕНСОГРАММА В РЕАЛЬНОМ ВРЕМЕНИ СВЯЗЫВАНИЯ FcγRIIB-Fc СЛИТЫХ БЕЛКОВ С АНТИТЕЛАМИ, НЕСУЩИМИ ВАРИАНТНЫЕ Fc-УЧАСТКИ

Связывание FcγRIIB-Fc слитых белков с ch-4-4-20 антителами, несущими вариантные Fc-участки, были проанализированы при 200 нМ концентрации. Ответы были нормализованы к уровню ch-4-4-20 антитела, полученному для дикого типа.

ФИГ. 8 A-C. АНАЛИЗ КИНЕТИЧЕСКИХ ПАРАМЕТРОВ FcγRIIB-Fc СЛИТЫХ БЕЛКОВ С АНТИТЕЛАМИ, НЕСУЩИМИ ВАРИАНТНЫЕ Fc-УЧАСТКИ

Кинетические параметры для связывания FcγRIIB-Fc с антителами, несущими вариантные Fc-участки, были получены посредством создания отдельных лучших сглаживаний кривых для 200 нМ и 800 нМ. Сплошная линия указывает на связанное сглаживание, которое было получено на основе значений koff, рассчитанных для кривых диссоциации в 32-34 сек интервале. Значения Kd и koff представляют среднюю величину двух концентраций.

Применяемые мутанты были следующими: Mut 6 (S219V), Mut 10 (P396L, A330S, K288N); Mut 18 (K326E); Mut 14 (K334E, K288N); Mut 11 (R255L, F243L); Mut 16 (F372Y); Mut 19 (K334N, K246I).

ФИГ. 9. СООТНОШЕНИЯ K off (WT)/K off (MUT) ДЛЯ FcγRIIIA-Fc В ЗАВИСИМОСТИ ОТ ДАННЫХ ADCC

Числа больше, чем один, показывают уменьшенную скорость диссоциации для связывания FcγRIIIA и увеличенную скорость диссоциации для связывания FcγRIIB-Fc относительно дикого типа. Мутанты в прямоугольнике имеют более низкую скорость диссоциации при связывании FcγRIIIA и более высокую скорость диссоциации при связывании FcγRIIB-Fc.

ФИГ. 10. КОНКУРИРОВАНИЕ С НЕМЕЧЕННЫМ FcγRIIIA

Кинетический анализ был выполнен для идентификации мутантов Fc-участка с повышенными уровнями Koff для связывания FcγRIIIA. Библиотеку вариантных Fc-участков, содержащих P396L мутацию, инкубировали 0,1 мкМ биотинилированным FcγRIIIA-Linker-Avitag в течение одного часа и затем отмывали. Последовательно, 0,8 мкМ немеченного FcγRIIIA инкубировали с мечеными дрожжами в течение различных временных периодов. Дрожжи откручивали и немеченный FcγRIIIA удаляли. Рецептор, связанный с дрожжами, окрашивали с помощью SA (стрептовидин):PE (фикоэритрин) для FACS анализа.

ФИГ. 11 A-C. FACS АНАЛИЗ НА ОСНОВЕ КИНЕТИЧЕСКОГО АНАЛИЗА

На основе рассчитанного Koff из данных, представленных на ФИГ. 22, был выбран выбор момента времени в одну минутну. 10-кратное превышение библиотеки инкубировали 0,1 мкМ биотинилированным FcγRIIIA-Linker-Avitag мономером; клетки отмывали и инкубировали с немеченным лигандом в течение одной минуты, затем отмывали и метили с помощью SA:PE. Клетки затем сортировали посредством FACS, отбирая верхние 0,3% связующих веществ. Невыбранную P396L библиотеку сравнивали с дрожжевыми клетками, выбранными для повышенного связывания посредством FACS. Гистограммы показывают процентное соотношение клеток, в которых содержатся как FcγRIIIA/PE, так и козьи анти-человеческие Fc/FITC.

ФИГ. 12 A-B. ВЫБОР НА ОСНОВЕ ТВЕРДОФАЗНОГО ИСТОЩЕНИЯ СВЯЗУЮЩИХ ВЕЩЕСТВ FcγRIIB Fc

А. P396L библиотека была проанализирована на основе истощения FcγRIIB и отбора FcγRIIIA с использованием магнитных шариков. Истощение FcγRIIB посредством магнитных шариков повторяли 5 раз. Получаемую популяцию дрожжей проанализировали и обнаружили, что более чем 50% клеток демонстрирует окрашивание козьим анти-человеческим Fc, и очень малое процентное соотношение клеток окрашивалось FcγRIIIA. Затем клетки отбирали дважды посредством FACS с использованием 0,1 мкМ биотинилированного FcγRIIIA-linker-avitag. Дрожжевые клетки анализировали на связывание как FcγRIIIA, так и FcγRIIB после каждой сортировки и сравнивали с диким типом связывания.

B. Fc-мутантов отбирали из FcγRIIB истощенной дрожжевой популяции с использованием биотинилированного FcγRIIIA 158F linker avitag мономера в качестве лиганда. Интервал отбора устанавливали для отбора верхних 0,25% связующих веществ FcγRIIIA 158F. Получающаюся обогащенную популяцию проанализировали посредством FACS на связывание с различными FcγRIIIA (158F и 158V), FcγRIIIB и FcγRIIA (131R).

ФИГ. 13. ОТНОСИТЕЛЬНЫЕ СКОРОСТИ ЛИЗИСА КЛЕТОК-МИШЕНЕЙ SKBR3, ОПОСРЕДОВАНЫЕ ХИМЕРНЫМИ 4D5 МУТАНТАМИ, СОДЕРЖАЩИМИ FC

Относительные скорости лизиса рассчитывалсь для каждого тестируемого Fc-мутанта. Скорости лизиса для 4D5 антитела с Fc-мутантами были разделены на скорость лизиса, опосредованную диким типом 4D5 антитела. Данные от по меньшей мере 2 независимых тестов были усреднены и изображены на гистограмме. Для каждого Fc-мутанта показаны данные от двух различных концентраций антитела. Концентрации антитела были выбраны для фланкирования точки вдоль кривой, у которой лизис составлял ~50%.

ФИГ. 14. ОТНОСИТЕЛЬНЫЕ СКОРОСТИ ЛИЗИСА КЛЕТОК DAUDI, ОПОСРЕДОВАНЫЕ ХИМЕРНЫМИ 2H7 МУТАНТАМИ, СОДЕРЖАЩИМИ FC

Относительные скорости лизиса были рассчитаны для каждого тестируемого Fc-мутанта. Скорости лизиса для 2H7 антитела с Fc-мутантами были разделены на скорость лизиса, опосредованную диким типом 2H7 антитела. Данные от по меньшей мере 1-2 независимых тестов были усреднены и изображены на гистограмме. Для каждого Fc-мутанта показаны данные от двух различных концентраций антитела. Концентрации антитела были выбраны на основе точки на кривой, у которой лизис составлял ~50%.

ФИГ. 15, Панели A-E. ПРОФИЛИ Fc-РЕЦЕПТОРА ПОСРЕДСТВОМ FACS ПРИ ОБРАБОТКЕ ЦИТОКИНОМ МОНОЦИТОВ

Цитокиновая обработка моноцитов увеличивает экспрессию Fc-рецептора с низкой аффинностью. Смытые моноциты культивировали с использованием специфических цитокинов в бессывороточной среде. Профили Fc-рецептора тестировали с использованием FACS.

ФИГ. 16. УВЕЛИЧЕННОЕ УБИЙСТВО ОПУХОЛОВЫХ КЛЕТОК С ИСПОЛЬЗОВАНИЕМ FC-МУТАНТОВ В МОНОЦИТАХ, ПОЛУЧЕННЫХ ИЗ МАКРОФАГОВ, НА ОСНОВЕ ADCC

Концентрацию Ch4D5 MAb больше 2 logs тестировали с использованием соотношения эффектор:мишень 35:1. Процент лизиса рассчитан как на ФИГ. 30.

ФИГ. 17. СХЕМА АНАЛИЗА КОМПЛИМЕНТ-ЗАВИСИМОЙ ЦИТОТОКСИЧНОСТИ

Схема суммирует применяемые CDC тесты.

ФИГ. 18. КОМПЛИМЕНТ-ЗАВИСИМАЯ ЦИТОТОКСИЧЕСКАЯ АКТИВНОСТЬ

Fc-мутанты, которые показывают повышенное связывание с FcγRIIIA, также показали повышенную активность комплемента. Анти-CD20 ChMAb выше 3 порядков величины титровали. Процент лизиса рассчитывали также как на ФИГ. 30.

ФИГ. 19. СВЯЗЫВАНИЕ C1q С АНТИТЕЛОМ 2B6

A. Диаграмма изображает BIAcore формат для анализа связывания 2B6 с первым компонентом комплементного каскада.

B. Сенсограмма в реальном времени связывания антитела 2B6, несущего вариантные Fc-участки с C1q.

ФИГ. 20 A-D. СВЯЗЫВАНИЕ C1q С МУТАНТОМ АНТИТЕЛА 2B6

Сенсограмма в реальном времени связывания мутанта антитела 2B6 с C1q (3,25 нМ). Мутанты изображенные на MgFc51 (Q419H, P396L); MgFc51/60 на Панели A; MgFc55 и MgFc55/60 (Панель B), MgFc59 и MgFc59/60 (Панель C); и MgFc31/60 (Панель D).

ФИГ. 21 A-D. ВАРИАНТЫ Fc СО СНИЖЕНЫМ СВЯЗЫВАНИЕМ С FcγRIIB

Связывание FcR с ch4D5 антителами для сравнения эффекта D270E (60) на R255L, P396L двойном мутанте (MgFc55). KD проанализировали при различных концентрациях FcR; 400 нМ CD16A 158V; 800 нМ CD16A 158F; 200 нМ CD32B; 200 нМ CD32A 131H. Анализ выполняли с использованием отдельной KD, с использованием программного обеспечения Biacore 3000.

ФИГ. 22 A-D. КИНЕТИЧЕСКИЕ ХАРАКТЕРИСТИКИ МУТАНТОВ 4D5, ВЫБРАННЫХ ИЗ FcγRIIB ИСТОЩЕНИЙ/FcγRIIAH131 ОТБОРА

Связывание FcR с ch4D5 антителами, несущими различные Fc мутации отобирали посредством CD32B истощения и CD32A H131 скрининговой стратегии. KD проанализировали при различных концентрациях FcR; 400 нМ CD16A 158V; 800 нМ CD16A 158F; 200 нМ CD32B; 200 нМ CD32A 131H. Анализ выполняли с использованием отдельной KD применяя программное обеспечение Biacore 3000.

ФИГ. 23. ГРАФИК MDM ADCC ДАННЫХ ОТНОСИТЕЛЬНО K OFF, ОПРЕДЕЛЕННОЙ ДЛЯ СВЯЗЫВАНИЯ CD32A 131H, КАК ОПРЕДЕЛЕНО ПОСРЕДСТВОМ BIACORE

Мутанты представлены следующими: MgFc 25 (E333A, K334A, S298A); MgFc68 (D270E); MgFc38 (K392T, P396L); MgFc55 (R255L, P396L); MgFc31 (P247L, N421K); MgFc59(K370E, P396L).

ФИГ. 24 A-B. ADCC АКТИВНОСТЬ МУТАНТОВ В ХИМЕРНОМ МОНОКЛОНАЛЬНОМ АНТИТЕЛЕ HER2/NEU

Химерные моноклональные антитела HER2/neu, содержащие мутантные Fc-участки, оценили в двух повторностях на их ADCC активность и сравнили с ADCC активностью дикого типа, химерного Her2/neu антитела. Проанализировали следующие мутанты: MGFc88 (F243L, R292P, Y300L, V305I, P396L), MGFc88A (F243L, R292P, Y300L, P396L), MGFc155 (F243L, R292P, Y300L).

ФИГ. 25 A-B. ОЦЕНЕННЫЙ ВЕС ОПУХОЛИ У МЫШЕЙ, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-МУТАНТОМ h2B6

Balb/c голые мыши были привиты подкожно клетками Daudi и принимали 25 мкг, 2,5 мкг или 0,25 мкг ослабленных доз либо дикого типа h2B6 (A), или содержащего Fc h2B6 мутанта MGFc 0088 (F243L, R292P, Y300L, V305I, P396L) (B). Мыши, принимавшие только буфер, использовались как контроль. Вес опухоли рассчитывали на основе оцененного объема подкожной опухоли в соответствии с формулой (ширина2 X длина)/2.

ФИГ. 26 A-B. ВЫЖИВАНИЕ МЫШЕЙ, НЕСУЩИХ ОПУХОЛЬ, ПРИ ЛЕЧЕНИИ ДИКИМ ТИПОМ ИЛИ Fc-МУТАНТОМ h2B6

Голые мыши были привиты подкожно клетками Daudi и принимали 25 мкг, 2,5 мкг или 0,25 мкг ослабленных доз либо дикого типа h2B6 (A), или содержащего Fc h2B6 мутанта MGFc 0088 (F243L, R292P, Y300L, V305I, P396L) (B). Мыши, принимавшие только буфер, использовались как контроль.

ФИГ. 27. ОЦЕНЕННЫЙ ВЕС ОПУХОЛИ У ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088

mCD16-/- huCD16A+ RAG1-/- C57BI/6 мыши были привиты подкожно клетками Raji и после двух недель внутрибрюшинно принимали шестинедельно дозы либо только буфера (PBS), или 250 мкг, 25 мкг или 2,5 мкг или дикого типа h2B6 (Rituxan), или h2B6, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (MGA321). Вес опухоли рассчитывали на основе оцененного объема подкожной опухоли в соответствии с формулой (ширина2 X длина)/2. Линии, соответствующие весу опухоли, с течением времени, для каждого индивидуума-мыши тестировали.

ФИГ. 28 A-B. ОЦЕНЕННЫЙ ВЕС ОПУХОЛИ У ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088

mCD16-/- huCD16A+ RAG1-/- C57BI/6 мыши были привиты подкожно клетками Raji и после трех недель внутрибрюшинно принимали пятинедельные дозы 250 мкг, 25 мкг или 2,5 мкг дикого типа h2B6 (Rituxan “Rituximab”) (A) или h2B6, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (h2B6 0088 “MGA321”) (B). Вес опухоли рассчитывали на основе оцененного объема подкожной опухоли в соответствии с формулой (ширина2 X длина)/2.

ФИГ. 29. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 31/60

mCD16-/- huCD16A+ голые (FoxN1) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно принимали в дни 0, 1, 2, 3 и 6 либо дикий тип h2B6 1.3, или h2B6 1.3, содержащий мутант 31/60 (P247L, D270E, N421K) (h2B6 1.3 3160). Мыши, принимавшие только буфер (PBS), использовались как контроль.

ФИГ. 30. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 31/60

mCD16-/- huCD16A+ голые (FoxN1) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно примимали в дним 0-3 и 6 дозы 10 мкг/г на вес тела либо h2B6, содержащий мутант 31/60 (P247L, D270E, N421K) (h2B6 3160), или дикий тип h2B6.

ФИГ. 31 A-B. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088

(A) mCD16-/- huCD16A+ голые (FoxN1 или N/N) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно принимали в дни 0-3 дозы либо h2B6 3.5 N297Q (негативный контроль), h2B6 3.5, содержащий мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (h2B6 3.5 0088), или дикий тип h2B6 3.5. Мыши, принимавшие только буфер (PBS), использовались как контроль (B). Мыши, несущие опухоль как в А, внутрибрюшинно принимали в дни 0-3 и 6 дозы 4 мкг/г веса тела либо PBS, h2B6, содержащий мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (h2B6 0088), или дикий тип h2B6.

ФИГ. 32. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088

mCD16-/- huCD16A+ hCD32A+ голые (FoxN1 или N/N) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно принимали в дни 0-3 либо h2B6 3.5 N297Q (негативный контроль), h2B6 содержащий мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (h2B6 3.5 0088), или дикий тип h2B6 3.5. Мыши, принимавшие только буфер (PBS), использовались как контроль.

ФИГ. 33 A-C. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088

Голые (FoxN1) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно принимали в дни 0-3 либо h2B6 3.5 N297Q (негативный контроль), h2B6 содержащий мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (h2B6 3.5 88), или дикий тип h2B6 3.5. Мыши, принимавшие только буфер (PBS), использовались как контроль. Были исследованы трансгенные линии мышей (A) mCD16-/- huCD16A+, (B) mCD16-/- huCD16A+ hCD32A+ и (C) mCD16-/- hCD32A+.

ФИГ. 34. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ h2B6 0088 ПРИ ВАРЬИРОВАНИИ ИНТЕРВАЛОВ

mCD16-/- huCD16A+ голые (FoxN1 или N/N) мыши были внутрибрюшинно привиты EL4-CD32B клетками и внутрибрюшинно получали лечение h2B6, содержащим мутант FcMG0088 (F243L, R292P, Y300L, V305I, P396L) (MGA321), при определенных временных интервалах.

ФИГ. 35 A-B. ОЦЕНЕННЫЙ ВЕС ОПУХОЛИ У ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ ch4D5 0088

Голые (FoxN1) мыши с трансгенным генотипом mCD16-/- hCD16A+ (A) или mCD16-/- hCD16A+ hCD32A+ (B) были привиты подкожно mSCOV3 клетками и, начиная с дня 0, внутрибрюшинно принимали восьминедельные дозы либо ch4D5 N297Q (негативный контроль) или ch4D5, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I, P396L) (ch4D5 0088). Мыши, принимавшие только буфер (PBS), использовались как контроль. Вес опухоли рассчитывали на основе оцененного объема подкожной опухоли в соответствии с формулой (ширина2 х длина)/2.

ФИГ. 36 A-B. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ ch4D5 0088

mCD16-/- huCD16A+ голые (N/N) мыши были внутрибрюшинно привиты mSKOV3 клетками и, начиная с дня 0, внутрибрюшинно принимали шестинедельные дозы либо 100 мкг (A) или 1 мкг (B), либо дикого типа ch4D5, ch4D5 N297Q (негативный контроль) или ch4D5, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (ch4D5 0088). Мыши, принимавшие только буфер (PBS), использовались как контроль.

ФИГ. 37 A-B. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМИ ВАРИАНТАМИ ch4D5

mCD16-/- huCD16A+ голые (N/N) мыши были внутрибрюшинно привиты mSKOV3 клетками и, начиная с дня 0, внутрибрюшинно принимали восьминедельно дозы либо 100 мкг (A) или 10 мкг (B), либо дикого типа ch4D5, ch4D5 N297Q (негативный контроль), ch4D5, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (ch4D5 0088), ch4D5 мутант MGFc0155 (F243L, R292P, Y300L) (ch4D5 0155) или ch4D5 мутант MCFc3160 (P247L, D270E, N421K) («ch4D5 3160»). Мыши, принимавшие только буфер (PBS), использовались как контроль.

ФИГ. 38 A-B. ВЫЖИВАНИЕ НЕСУЩИХ ОПУХОЛЬ ТРАНСГЕННЫХ МЫШЕЙ, ЭКСПРЕССИРУЮЩИХ ЧЕЛОВЕЧЕСКИЙ Fc-РЕЦЕПТОР, КОТОРЫХ ЛЕЧАТ ДИКИМ ТИПОМ ИЛИ Fc-ОПТИМИЗИРОВАННЫМ ch4D5 0088

Голые (N/N) мыши с трансгенным генотипом mCD16-/- hCD16A+ (A) или mCD16-/- hCD16A+ hCD32A+ (B) были внутрибрюшинно привиты mSKOV3 клетками и, начиная с дня 0, внутрибрюшинно принимали восьминедельно дозы либо ch4D5, содержащего мутант FcMG0088 (F243L, R292P, Y300L, V305I P396L) (ch4D5 0088), или ch4D5 N297Q (негативный контроль). Мыши, принимавшие только буфер (PBS), использовались как контроль.

ФИГ. 39 A-D. Fc ОПТИМИЗАЦИЯ УВЕЛИЧИВАЕТ ИСТОЩЕНИЕ ОПУХОЛЕВЫХ КЛЕТОК IN VIVO

(A-B) Повышенное уменьшение нагрузки опухоли лечением Fc-спроектированными hu2B6 подкожных ксенотрансплантатов Daudi-клеток у Balb/c FoxN1 (nu/nu) мышей (6-8 мыши/группа). Статистическая значимость между кривыми было определена с помощью Т-теста Стьюдента; WT против MG12, P=0.431; WT против MG4, P = 0,002; MG4 против MG12, P = 0,002. (C-D) Графики выживания Каплана-Мейера mFcγRIII-/- человека CD16A+ FoxN1 мышей с введенными внутрибрюшинно CD32B-EL4 клетками (10 мыши/группа) и получавшими лечение либо WT-Fc hu2B6, или указанными Fc-спроектированными формами hu2B6 (C, 10 мкг/г; D, 4 мкг/г). Данные были проанализированы на значимость с использованием логрангового анализа.

ФИГ. 40. ГЛИКОЗИЛИРОВАННЫЕ ОБРАЗЦЫ АНТИТЕЛ, ИМЕЮЩИХ ИЗМЕНЕННЫЕ FC-УЧАСТКИ

(Панели A-D) показывают результаты исследований в гликозилированных образцах антител настоящего изобретения (изображенное является определяемым сигналом в люменах против времени хроматографического элюирования в минутах). Во всех панелях, ■ представляет собой GlcNAc;● представляет собой галактозу; представляет собой маннозу, и Δ представляет собой фруктозу. Панель A показывает распределение N-связанных олигосахаридов, определенных с использованием упомянутой панели антитела. Панели B и C показывают результаты по двум препаратам антитела ch45D4-FcMT2. Панель D является систематическим сводным контролем. Стрелки указывают распределения гликозилированных образцов по пикам; пунктирные стрелки указывают на предполагаемые положения гликозилированных образцов Панели A.

ФИГ. 41. GlcNAc 2 Man 9 (“Man9”) ГЛИКОЗИЛИРОВАННАЯ СТРУКТУРА

GlcNAc2Man9 (“Man9”) гликозилированая структура. Отщепление маннозных единиц ведет к образованию GlcNAc2Man8 (“Man8”), GlcNAc2Man7 (“Man7”), GlcNAc2Man6 (“Man6”) и GlcNAc2Man5 (“Man5”) структур.

ФИГ. 42. GlcNAc 2 Man 5 (“Man5”) ГЛИКОЗИЛИРОВАННАЯ СТРУКТУРА

GlcNAc2Man5 (“Man5”) структура обрабатывается посредством успешного действия гликозилтрансферазы для образования “G0F,” “G1F” и “G2F” олигосахаридов.

ФИГ. 43. ГЛИКОЗИЛИРОВАННАЯ СТРУКТУРА И FcγR СВЯЗЫВАНИЕ FC-ТЕТРА-ВАРИАНТА: F243X, R292P, Y300L, P396L

Фигура показывает эффект изменения отличительной черты остатка, замещенного в положении F243 тетра-варианта (F243X, R292P, Y300L, P396L) на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc-варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

ФИГ. 44. ГЛИКОЗИЛИРОВАННАЯ СТРУКТУРА И FcγR СВЯЗЫВАНИЕ FC-ТЕТРА-ВАРИАНТА: F243L, R292X, Y300L, P396L

Фигура показывает эффект изменения отличительной черты остатка, замещенного в положении R292 тетра-варианта (F243L, R292X, Y300L, P396L) на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc-варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

ФИГ. 45. ЭФФЕКТ ПРОГРЕССИВНОГО ИЗМЕНЕНИЯ ОСТАТКОВ R292, Y300 И P396 F243C Fc ВАРИАНТА

Фигура показывает эффект прогрессивного изменения отличительной черты остатка, замещенного в положении R292, Y300 и P396 Fc варианта F243C на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

ФИГ. 46. ЭФФЕКТ ПРОГРЕССИВНОГО ИЗМЕНЕНИЯ ОСТАТКОВ R292, Y300 И P396 F243C Fc-ВАРИАНТА

Фигура показывает эффект прогрессивного изменения отличительной черты остатка, замещенного в положении R292, Y300 и P396 Fc варианта F243L на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

ФИГ. 47. ЭФФЕКТ ПРОГРЕССИВНОГО ИЗМЕНЕНИЯ ОСТАТКОВ R292, Y300 И P396 F243R Fc ВАРИАНТА

Фигура показывает эффект прогрессивного изменения отличительной черты остатка, замещенного в положении R292, Y300 и P396 Fc варианта F243R на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

ФИГ. 48. ЭФФЕКТ ПРОГРЕССИВНОГО ИЗМЕНЕНИЯ ОСТАТКОВ R292, Y300 и P396 F243V Fc ВАРИАНТА

Фигура показывает эффект прогрессивного изменения отличительной черты остатка, замещенного в положении R292, Y300 и P396 Fc варианта F243V Fc на наблюдаемый профиль гликозилирования варианта и на относительное связывание (Kдиссоциации дикого типа / Kдиссоциации варианта) Fc варианта с Fc-рецепторами, CD16A, CD32A и CD32B.

6. ПОДРОБНОЕ ОПИСАНИЕ

Настоящее изобретение относится к способам лечения злокачественной опухоли или других заболеваний с использованием молекул, предпочтительно полипептидов и более предпочтительно иммуноглобулинов (например, антител), содержащих вариантный участок Fc, имеющий одну или несколько аминокислотных модификаций (например, замен, но также сюда относятся вставки или делеции) в одном или нескольких участках, которые эти модификации меняют, например, увеличивают или уменьшают аффинность участка Fc к FcγR. Увеличение способности иммуноглобулинов опосредовать антитело-зависимую опосредованную клетками цитотоксичность (ADCC), комплемент-зависимую цитотоксичность (CDC) или антитело-зависимый опосредованный клетками фагоцитоз (ADCP) обеспечивает подход к усилению терапевтической активности иммуноглобулинов против злокачественных опухолей и инфекционных заболеваний.

Настоящее изобретение, таким образом, охватывает терапевтические антитела для лечения или предотвращения заболевания или расстройства, или уменьшение интенсивности симптома вследствие этого, там, где желательна усиленная эффективность функции эффекторных клеток (например, ADCC), опосредованной FcγR, например, злокачественная опухоль или инфекционное заболевание, или где желательно модулирование функции эффекторных клеток, опосредованной FcγR, например, аутоиммунные или воспалительные расстройства. В некоторых вариантах осуществления настоящее изобретение охватывает применение молекул, содержащих участки Fc с аминокислотными модификациями, включая без ограничения любые из модификаций, раскрытые в публикациях патентных заявок США 2005/0037000 и 2005/0064514; и в публикации международной патентной заявки WO 04/063351. Каждая из вышеперечисленных заявок включена в данный документ ссылкой во всей своей полноте.

Полипептиды настоящего изобретения могут иметь вариантные домены Fc. Модификация домена Fc в норме ведет к измененному фенотипу, например, измененному времени полураспада в сыворотке, измененной стабильности, измененной чувствительности к клеточным ферментам или измененной эффекторной функции. Это может быть желательно для модификации антитела настоящего изобретения в отношении эффекторной функции так, чтобы увеличить эффективность антитела, например, при лечении злокачественной опухоли. Снижение или элиминация эффекторной функции желательны в некоторых случаях, например, в случае антител, чей механизм действия включает блокирование или антагонизм, но не уничтожение клеток, несущих антиген-мишень. Повышенная эффекторная функция обычно желательна, когда направлена на нежелательные клетки, такие как опухолевые и чужеродные клетки, где FcγR экспрессируются на низких уровнях, например, опухоле-специфические B-клетки с низкими уровнями FcγRIIB (например, неходжскинская лимфома, CLL, и лимфома Буркитта). В указанных вариантах осуществления молекулы настоящего изобретения с наделенной или измененной эффекторной функциональной активностью применимы для лечения и/или предотвращения заболевания, расстройства или инфекции, где желательна повышенная эффективность эффекторной функции.

В определенных вариантах осуществления молекулы настоящего изобретения содержат одну или несколько модификаций аминокислот Fc домена, которые снижают аффинность и авидность участка Fc и, таким образом, молекулы настоящего изобретения, для одного или нескольких FcγR-рецепторов. В других вариантах осуществления молекулы настоящего изобретения содержат одну или несколько модификаций аминокислот участка Fc, которые увеличивают аффинность и авидность участка Fc и, таким образом, молекулы настоящего изобретения, для одного или нескольких FcγR-рецепторов. В других вариантах осуществления молекулы содержат вариант домена Fc, где указанный вариант придает или опосредует повышенную ADCC активность и/или повышенное связывание с FcγRIIA, по сравнению с молекулой, не содержащей домен Fc или содержащей домен Fc дикого типа. В альтернативных вариантах осуществления молекулы содержат вариантный домен Fc, где указанный вариант сообщает или опосредует сниженную ADCC активность (или другую эффекторную функцию) и/или повышенное связывание с FcγRIIB, по сравнению с молекулой, не содержащей домен Fc или содержащей домен Fc дикого типа.

В некоторых вариантах осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, в которых вариантный участок Fc не обнаруживает определяемого связывания с каким-либо FcγR, по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В других вариантах осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, в которых вариантный участок Fc связывается только с одним FcγR, предпочтительно одним из FcγRIIA, FcγRIIB или FcγRIIIA.

Полипептиды настоящего изобретения могут содержать измененные аффинности для активирования и/или ингибирования Fcγ-рецептора. В одном варианте осуществления антитело или полипептид содержит вариантный участок Fc, который имеет повышенную аффинность к FcγRIIB и пониженную аффинность к FcγRIIIA и/или FcγRIIA, по сравнению с соответствующей молекулой с Fc-участком дикого типа. В другом варианте осуществления полипептиды настоящего изобретения содержат вариантный участок Fc, который имеет пониженную аффинность к FcγRIIB и повышенную аффинность к FcγRIIIA и/или FcγRIIA по сравнению с соответствующей молекулой с Fc-участком дикого типа. В еще одном варианте осуществления полипептиды настоящего изобретения содержат вариантный участок Fc, который имеет пониженную аффинность к FcγRIIB и пониженную аффинность к FcγRIIIA и/или к FcγRIIA по сравнению с соответствующей молекулой с Fc-участком дикого типа. В еще другом варианте осуществления полипептиды настоящего изобретения содержат вариантный участок Fc, который имеет неизмененную аффинность к FcγRIIB и пониженную (или повышенную) аффинность к FcγRIIIA и/или к FcγRIIA, по сравнению с соответствующей молекулой с Fc-участком дикого типа.

В определенных вариантах осуществления настоящее изобретение охватывает иммуноглобулины, содержащие вариантный участок Fc с измененной аффинностью к FcγRIIIA и/или к FcγRIIA так, что иммуноглобулины обладают усиленной эффекторной функцией, например, антитело-зависимой опосредованной клетками цитотоксичностью. Не ограничивающие примеры функций эффекторных клеток включают антитело-зависимую опосредованную клетками цитотоксичность (ADCC), антитело-зависимый фагоцитоз, фагоцитоз, опсонизацию, опсонофагоцитоз, связывание с клетками, розеткообразование, связывание с C1q и комплемент-зависимую опосредованную клетками цитотоксичность.

В предпочтительном варианте осуществления изменение аффинности или эффекторной функции является по меньшей мере 2-кратным, предпочтительно по меньшей мере 4-кратным, по меньшей мере 5-кратным, по меньшей мере 6-кратным, по меньшей мере 7-кратным, по меньшей мере 8-кратным, по меньшей мере 9-кратным, по меньшей мере 10-кратным, по меньшей мере 50-кратным, или по меньшей мере 100-кратным, по сравнению с соответствующей молекулой с Fc-участком дикого типа. В других вариантах осуществления настоящего изобретения вариантный участок Fc иммуноспецифично связывает один или несколько FcR по меньшей мере с 65%, предпочтительно с большей по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95%, 100%, 125%, 150%, 175%, 200%, 225% или 250% аффинностью по сравнению с молекулой с Fc-участком дикого типа. Такие измерения могут быть проанализированы in vivo или in vitro, и в предпочтительном варианте осуществления это анализы in vitro, такие как ELISA или поверхностный плазмонный резонанс.

В различных вариантах осуществления молекулы содержат вариант Fc-домена, где указанный вариант агонизирует по меньшей мере одну активность FcγR-рецептора, или антагонизирует по меньшей мере одну активность FcγR-рецептора. В предпочтительном варианте осуществления молекулы содержат вариант, который агонизирует (или антагонизирует) одну или несколько активностей FcγRIIB, например, рецептор-опосредованную сигнальную передачу B-клеток, активацию B-клеток, пролиферацию B-клеток, продукцию антител, поток кальция внутрь B-клеток, последовательность клеточного цикла, FcγRIIB-опосредованное ингибирование сигнальной передачи FcεRI, фосфорилирование FcγRIIB, рекрутинг SHIP, фосфорилирование SHIP и ассоциацию с Shc, или активность одной или нескольких молекул нисходящего направления (например, MAP-киназы, JNK, p38 или Akt) в FcγRIIB-пути передачи сигнала. В другом варианте осуществления молекулы содержат вариант, который агонизирует (или антагонизирует) одну или несколько активностей FcεRI, например, активацию тучных клеток, мобилизацию кальция, дегрануляцию, продукцию цитокинов или высвобождение серотонина.

В определенных вариантах осуществления молекулы содержат Fc-домен, содержащий домены или участки из двух или более изотипов IgG (например, IgG1, IgG2, IgG3 и IgG4). Разные изотипы IgG демонстрируют различные физические и функциональные свойства, включая время полураспада в сыворотке, фиксацию комплемента, аффинности связывания с FcγR и эффекторно-функциональные активности (например, ADCC, CDC и т.д.), благодаря различиям в аминокислотных последовательностях их шарнирных доменов и/или Fc-доменов, например, как описано в Flesch и Neppert (1999) J. Clin. Lab. Anal. 14:141-156; Chappel et al. (1993) J. Biol. Chem. 33:25124-25131; Chappel et al. (1991) Proc. Natl. Acad. Sci. (U.S.A.) 88:9036-9040; Brüggemann et al. (1987) J. Exp. Med 166:1351-1361. Этот тип вариантного Fc-домена может быть использован самостоятельно или в комбинации с аминокислотной модификацией для того, чтобы повлиять на Fc-опосредованную эффекторную функцию и/или связывающую активность. В комбинации аминокислотная модификация и шарнирный участок IgG/участок Fc могут демонстрировать сходные функциональные возможности (например, повышенную аффинность к FcγRIIA) и могут действовать аддитивно или, что более предпочтительно, синергично для того, чтобы модифицировать эффекторную функциональную возможность молекулы настоящего изобретения, по сравнению с молекулой настоящего изобретения, содержащей участок Fc дикого типа. В других вариантах осуществления аминокислотная модификация и участок Fc IgG могут демонстрировать противоположные функциональные возможности (например, повышенную и пониженную аффинность к FcγRIIA, соответственно) и могут действовать селективно, регулируя или снижая специфические функциональные возможности молекулы настоящего изобретения, по сравнению с молекулой настоящего изобретения не содержащей участок Fc или содержащей участок Fc дикого типа того же изотипа.

В специфических вариантах осуществления настоящее изобретение охватывает терапевтические антитела, которые иммуноспецифически связывают FcγRIIB с помощью их вариабельных доменов с большей аффинностью, чем FcγRIIA, например, антитела, полученные из моноклонального антитела мыши, продуцируемого клоном 2B6 или 3H7, имеющими инвентарные номера ATCC PTA-4591 и PTA-4592, соответственно. В других вариантах осуществления антитела к FcγRIIB настоящего изобретения происходят от моноклонального антитела мыши, продуцируемого клонами 1D5, 2E1, 2H9, 2D11 или 1F2, имеющими инвентарные номера ATCC PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959, соответственно. Гибридомы, продуцирующие антитела 2B6 и 3H7, были переданы на хранение в Американскую коллекцию типовых культур (10801 Университетский бульвар, Манассас, Вирджиния. 20110-2209) 13 августа 2002 г. по постановлению Будапештского договора о международном признании депонирования микроорганизмов для целей патентных процедур и получили инвентарные номера PTA-4591 (для гибридомы, продуцирующей 2B6) и PTA-4592 (для гибридомы, продуцирующей 3H7), соответственно, и включены в данный документ ссылкой. Гибридомы, продуцирующие 1D5, 2E1, 2H9, 2D11 и 1F2 были переданы на хранение в Американскую коллекцию типовых культур по постановлению Будапештского договора (10801 Университетский бульвар, Манассас, Вирджиния. 20110-2209) 7 мая 2004 г. и получили инвентарные номера PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959, соответственно, и включены в данный документ ссылкой. В предпочтительных вариантах осуществления антитела к FcγRIIB настоящего изобретения (например, 2B6) содержат вариантный участок Fc, где указанный вариантный участок Fc имеет замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином. В другом варианте осуществления настоящее изобретение охватывает антитело 2B6, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В других вариантах осуществления настоящее изобретение охватывает антитело 2B6, содержащее вариантный участок Fc, имеющий замену в положении 243 лейцином, в положении 292 пролином и в положении 300 лейцином. В других вариантах осуществления настоящее изобретение охватывает антитело 2B6, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления настоящее изобретение охватывает антитело 2B6, содержащее вариантный участок Fc, имеющий замену в положение 247 лейцином, в положении 270 глутаминовой кислотой и в положении 421 лизином. В другом варианте осуществления настоящее изобретение охватывает антитело 2B6, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В специфическом варианте осуществления настоящее изобретение охватывает терапевтические антитела, которые связывают протоонкоген Her2/neu (аминокислотная последовательность SEQ ID NO:31) (например, антитело Ab4D5, как раскрыто у Carter et al., 1992, Proc. Natl. Acad. Sci. USA 89:4285-9; патент США № 5677171; или публикации международной патентной заявки WO 01/00245, каждый из которых вкоючен в данный документ ссылкой во всей своей полноте). В определенном варианте осуществления антитело 4D5 является химерным. В другом варианте осуществления антитело 4D5 является гуманизированным. В специфическом варианте осуществления антитело 4D5 сконструировано так, что содержит вариантный участок Fc с модификацией (например, замена, вставка, делеция) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или к FcγRIIA, и/или снижает аффиность участка Fc к FcγRIIB, и/или модулирует эффекторную функцию антитела по сравнению с соответствующим антителом, содержащим участок Fc дикого типа. В определенных вариантах осуществления антитело 4D5 настоящего изобретения содержит вариантный участок Fc, имеющий замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином. В других вариантах осуществления настоящее изобретение охватывает антитело 4D5, имеющее лейцин в положении 243, пролин в положении 292, лейцин в положении 300, изолейцин в положении 305 и лейцин в положении 396. В еще одном варианте осуществления настоящее изобретение охватывает антитело 4D5, содержащее вариантный участок Fc, имеющий замену в положении 243 лейцином, в положении 292 пролином и в положении 300 лейцином. В других вариантах осуществления настоящее изобретение охватывает антитело 4D5, имеющее лейцин в положении 243, пролин в положении 292 и лейцин в положении 300. В других вариантах осуществления настоящее изобретение охватывает антитело 4D5, содержащее вариантный участок Fc, имеющий замещение в положении 247 лейцином, в положении 270 глутаминовой кислотой и в положении 421 лизином. В другом варианте осуществления настоящее изобретение охватывает антитело 4D5, имеющее лейцин в положении 247, глутаминовую кислоту в положении 292 и лизин в положении 421.

В некоторых вариантах осуществления настоящее изобретение охватывает молекулы содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию относительно Fc участка дикого типа, причем вариантный Fc-участок не показывает выявляемое связывание с каким-либо FcγR (например, не связывает FcγRIIA, FcγRIIB или FcγRIIIA, как определено, например, анализом ELISA), относительно аналогичной молекулы содержащий Fc-участок дикого типа.

В специфическом варианте осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению Fc-участком дикого типа, причем вариантный участок Fc связывает только один FcγR, где указанный FcγR является FcγIIIA. В другом специфическом варианте осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению Fc-участком дикого типа, причем вариантный участок Fc связывает только один FcγR, где указанный FcγR является FcγRIIA. В еще одном варианте осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению Fc-участком дикого типа, причем вариантный участок Fc связывает только один FcγR, где указанный FcγR является FcγRIIB. Настоящее изобретение, в частности, относится к модификации антител человека или гуманизированных терапевтических антител (например, опухоле-специфические антиангиогенные или противовоспалительные моноклональные антитела) для повышения эффективности терапевтических антител путем усиления, например, эффекторной функции терапевтического антитела, например, усилением ADCC.

В определенных вариантах осуществления молекулы содержат вариантный участок Fc, имеющий одну или несколько аминокислотный модификаций в одном или нескольких участках, в которых модификация(и) меняют (по сравнению Fc-участком дикого типа) соотношение аффиностей вариантного участка Fc к активирующему FcγR (такому как FcγRIIA или FcγRIIIA) относительно ингибирующего FcγR (такого как FcγRIIB):

Изменение в аффинности к FcγRактивирующий варианта по отношению к дикому типу

Соотношение аффиностей =

Изменение в аффинности к FcγRингибирующий варианта по отношению к дикому типу

Если вариант Fc имеет соотношение аффинностей больше 1, способы настоящего изобретения особо применимы для обеспечения терапевтического или профилактического лечения заболевания, расстройства или инфекции или уменьшения интенсивности их симптома, где желательна повышенная эффективность функции эффекторных клеток (например, ADCC), опосредованная FcγR, например, злокачественная опухоль или инфекционное заболевание. Если вариант Fc имеет соотношение аффинностей менее 1, способы настоящего изобретения особо применимы для обеспечения терапевтического или профилактического лечения заболевания, расстройства или инфекции или уменьшения интенсивности их симптома, где желательна пониженная эффективность функции эффекторных клеток опосредованная FcγR, например, аутоиммунные или воспалительные расстройства. Таблица 1 перечисляет типичные одиночных, двойные, тройные, четвертные и пятичленные мутации в соответствии с тем, является ли соотношение аффинностей больше или менеше 1. Данные специфического связывания для различных мутаций приведены в Таблице 2, и более подробные сведения относительно этих мутаций можно найти в области технологий конструирования антител.

Таблица 1: Примерные одиночные и множественные мутации перечислены как соотношения аффинностей
Соотношение Одиночные Двойные Тройные Четвертные Пятичленные
> 1 F243L
D270E
R292G
R292P
F243L и R292P
F243L и Y300L
F243L и P396L
D270E и P396L
R292P и Y300L
R292P и V305I
R292P и P396L
Y300L и P396L
P396L и Q419H
F243L, P247L и N421K
F243L, R292P и Y300L
F243L, R292P и V305I
F243L, R292P и P396L
F243L, Y300L и P396L
P247L, D270E и N421K
R255L, D270E и P396L
D270E, G316D и R416G
D270E, K392T и P396L
D270E, P396L и Q419H
V284M, R292L и K370N
R292P, Y300L и P396L
L234F, F243L, R292P и Y300L
L235I, F243L, R292P и Y300L
L235Q, F243L, R292P и Y300L
F243L, P247L, D270E и N421K
F243L, R255L, D270E и P396L
F243L, D270E, G316D и R416G
F243L, D270E, K392T и P396L
F243L, D270E, P396L и Q419H
F243L, R292P, Y300L, и P396L
F243L, R292P, V305I и P396L
P247L, D270E, Y300L и N421K
R255L, D270E, R292G и P396L
R255L, D270E, Y300L и P396L
D270E, G316D, P396L и R416G
L235V, F243L, R292P, Y300L и P396L
L235P, F243L, R292P, Y300L и P396L
F243L, R292P, V305I, Y300L и P396L
< 1 Y300L
P396L
F243L и P396L
P247L и N421K
R255L и P396L
R292P и V305I
K392T и P396L
P396L и Q419H
F243L, R292P и V305I
Таблица 2: Подробная информация связывания для примерных Fc вариантов
Fc последовательность CD16A
V158
CD16A
F158
CD32B Соотношение аффинностей
CD16A/CD32B
V158 F158
Соотношение аффинностей > 1
Класс I: Повышенное связывание с CD16; пониженное связывание с CD32B
F243L 4,79 3,44 0,84 5,70 4,10
F243L P247L D270E N421K 2,30 3,45 0,32 7,19 10,78
F243L P247L N421K 1,89 1,71 0,17 11,12 10,06
F243L R255L D270E P396L 1,75 1,64 0,38 4,61 4,32
F243L D270E G316D R416G 1,50 1,34 0,20 7,50 6,70
F243L D270E K392T P396L 3,16 2,44 0,44 7,18 5,55
F243L D270E P396L Q419H 1,46 1,15 0,26 5,62 4,42
F243L R292P 4,73 0,12 39,4
F243L R292P 4 1,67 0,16 25 10,44
F243L R292P P300L 6,69 2,3 0,32 20,9 7,19
F243L R292P V305I 2,56 1,43 ND >25 >25
F243L R292P V305I P396L 5,37 2,53 0,40 13,43 6,33
P247L D270E N421K 1,89 2,46 0,58 3,26 4,24
R255L D270E R292G P396L 1,39 1,30 0,65 2,14 2,00
R255L D270E Y300L P396L 1,52 1,74 0,87 1,75 2,00
R255L D270E P396L 1,34 1,65 0,87 1,54 1,90
D270E 1,25 1,48 0,39 3,21 3,79
D270E G316D R416G 2,18 2,49 0,78 2,79 3,19
D270E K392T P396L 1,81 2,28 0,79 2,29 2,89
D270E P396L 1,38 1,65 0,89 1,55 1,85
D270E P396L G316D R416G 1,22 1,07 1,14
D270E P396L Q419H 1,64 2,00 0,68 2,41 2,94
V284M R292P K370N 1,14 1,37 0,37 3,1 3,7
R292G 1,54 0,25 6,2
R292P 2,90 0,25 11,60
R292P V305I 1,32 1,28 0,37 3,6 3,46
Класс II: Пониженное связывание с CD16; очень пониженное связывание cCD32B
R292P 0,64 0,25 2,56
R292P F243L 0,6 0,12 5,00
Класс III: Повышенное связывание с CD16; неизмененное связывание с CD32B
F243I R292P Y300L V305I P396L 10,9 3,12 1,05 10,4 2,97
F243L R292P Y300L P396L 10,06 5,62 1,07 9,40 5,25
R292P V305I P396L 1,85 1,90 0,92 2,01 2,07
Класс IV: Очень повышенное связывание с CD16; повышенное связывание с CD32B
F243L R292P Y300L V305I P396L 10,06 8,25 1,38 7,29 5,98
D270E G316D P396L R416G 1,22 1,07 1,14
Соотношение аффинностей < 1
Класс V: Неизмененное связывание с CD16; повышенное связывание с CD32B
R255L P396L 1,09 2,22 0,49
Y300L 1,01 1,18 0,99
Класс VI: Повышенное связывание с CD16; очень повышенное связывание с CD32B
F243L P396L 1,49 1,60 2,22 0,67 0,72
P247L N421K 1,29 1,73 2,00 0,65 0,87
R255L P396L 1,39 2,22 0,49 0,63
R292P V305I 1,59 2,11 2,67 0,60 0,79
Таблица 2: Подробная информация связывания для примерных Fc вариантов
Fc последовательность CD16A
V158
CD16A
F158
CD32B Соотношение аффинностей
CD16A/CD32B
V158 F158
K392T P396L 1,49 1,81 2,35 0,63 0,77
P396L 1,27 1,73 2,58 0,49 0,67
P396L Q419H 1,19 1,19 1,33 0,89 0,89
Класс VII: Пониженное связывание с CD16; повышенное / неизмененное связывание с CD32B
D270E G316D P396L R416G 0,94 1,07 0,88

В других вариантах осуществления молекулы содержат вариантный участок Fc, имеющий одну или несколько аминокислотных замен, в котором эти замены меняют (по сравнению с Fc-участком дикого типа) связывание вариантного участка Fc, например, усиливают связывание с активирующим FcγR (таким как FcγRIIA или FcγRIIIA) и/или ослабляют связывание с ингибирующим FcγR (таким как FcγRIIB). Были сконструированы и проанализированы методом поверхностного плазмонного резонанса для определения koff различные мутации Fc, заключающиеся в одном или нескольких изменениях аминокислот, как показано в Таблица 3. Анализом BIAcore были определены константы скорости диссоциации для связывания различных FcγR, и их непосредственно сравнивали с таковыми для Fc дикого типа с соотношением (х = koff дт/koff мутанта), указанным колонках в Таблице 3 с правой стороны по отношению к каждому протестированному FcγR.

Имеется также подробное руководство в области технологий конструирования антител относительно желательных модификаций. типичные модификации, которые могут быть желательны в определенных обстоятельствах, перечислены ниже.

В специфическом варианте осуществления вариантные участки Fc могут содержать любые модификации аминокислот (например, замены) в любом из положений 235, 240, 241, 243, 244, 247, 262, 263, 269, 298, 328 или 330 и предпочтительно один или несколько из следующих остатков: A240, I240, L241, L243, H244, N298, I328 или V330. В другом специфическом варианте осуществления вариантные участки Fc могут содержать любые модификации аминокислот (например, замены) в любом из положений 268, 269, 270, 272, 276, 278, 283, 285, 286, 289, 292, 293, 301, 303, 305, 307, 309, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438 или 439 и предпочтительно один или несколько из следующих остатков: H280, Q280, Y280, G290, S290, T290, Y290, N294, K295, P296, D298, N298, P298, V298, I300 или L300.

В предпочтительном варианте осуществления вариантные участки Fc, которые связывают FcγR с измененной аффинностью, могут содержать любые модификации аминокислот (например, замены) в любом из положений 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 309, 312, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438 или 439. Предпочтительно, вариантный участок Fc имеет любой из следующих остатков: A256, N268, Q272, D286, Q286, S286, A290, S290, A298, M301, A312, E320, M320, Q320, R320, E322, A326, D326, E326, N326, S326, K330, T339, A333, A334, E334, H334, L334, M334, Q334, V334, K335, Q335, A359, A360 или A430.

В другом варианте осуществления вариантные участки Fc, которые связывают FcγR (через свой участок Fc) с пониженной аффинностью, могут содержать любые модификации аминокислот (например, замены) в любом из положений 252, 254, 265, 268, 269, 270, 278, 289, 292, 293, 294, 295, 296, 298, 300, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439.

В другом варианте осуществления вариантные участки Fc, которые связывают FcγR (через свой участок Fc) с повышенной аффинностью, могут содержать любые модификации аминокислот (например, замены) в любом из положений: 280, 283, 285, 286, 290, 294, 295, 298, 300, 301, 305, 307, 309, 312, 315, 331, 333, 334, 337, 340, 360, 378, 398 или 430. В другом варианте осуществления, в вар иантах участков Fc, которые связывают FcγRIIA с повышенной аффинностью может содержаться любой из следующих остатков: A255, A256, A258, A267, A268, N268, A272, Q272, A276, A280, A283, A285, A286, D286, Q286, S286, A290, S290, M301, E320, M320, Q320, R320, E322, A326, D326, E326, S326, K330, A331, Q335, A337 или A430.

В других вариантах осуществления настоящее изобретение охватывает применение любого варианта Fc, известного в данной области, такого как раскрытые у Jefferis et al. (2002) Immunol Lett 82:57-65; Presta et al. (2002) Biochem Soc Trans 30:487-90; Idusogie et al. (2001) J Immunol 166:2571-75; Shields et al. (2001) J Biol Chem 276:6591-6604; Idusogie et al. (2000) J Immunol 164:4178-84; Reddy et al. (2000) J Immunol 164:1925-33; Xu et al. (2000) Cell Immunol 200:16-26; Armour et al. (1999) Eur J Immunol 29:2613-24; Jefferis et al. (1996) Immunol Lett 54:101-04; Hinton et al; 2004, J. Biol. Chem. 279(8): 6213-6; Lund et al. (1996) J Immunol 157:4963-69; Hutchins et al. (1995) Proc. Natl. Acad. Sci. (U.S.A.) 92:11980-84; Jefferis et al. (1995) Immunol Lett. 44:111-17; Lund et al. (1995) FASEB J 9:115-19; Alegre et al. (1994) Transplantation 57:1537-43; Lund et al. (1992) Mol Immunol 29:53-59; Lund et al. (1991) J. Immunol 147:2657-62; Duncan et al. (1988) Nature 332:563-64; в патентах США №№ 5624821; 5885573; 6194551; 7276586 и 7317091; и в публикациях PCT WO 00/42072 и PCT WO 99/58572.

Предпочтительные варианты включают одну или несколько модификаций в любом из положений: 228, 230, 231, 232, 233, 234, 235, 239, 240, 241, 243, 244, 245, 247, 262, 263, 264, 265, 266, 271, 273, 275, 281, 284, 291, 296, 297, 298, 299, 302, 304, 305, 313, 323, 325, 326, 328, 330 или 332.

Особенно предпочтительные варианты включают одну или несколько модификаций, выбранных из групп A-AI:

A. 228E, 228K, 228Y или 228G;

B. 230A, 230E, 230Y или 230G;

C. 231E, 231K, 231Y, 231P или 231G;

D. 232E, 232K, 232Y, 232G;

E. 233D;

F. 234I или 234F;

G. 235D, 235Q, 235P, 235I или 235V;

H. 239D, 239E, 239N или 239Q;

I. 240A, 240I, 240M или 240T;

J. 243R, 243, 243Y, 243L, 243Q, 243W, 243H или 243I;

K. 244H;

L. 245A;

M. 247G, 247V или 247L;

N. 262A, 262E, 262I, 262T, 262E или 262F;

O. 263A, 263I, 263M или 263T;

P. 264F, 264E, 264R, 264I, 264A, 264T или 264W;

Q. 265F, 265Y, 265H, 265I, 265L, 265T, 265V, 265N или 265Q;

R. 266A, 266I, 266M или 266T;

S. 271D, 271E, 271N, 271Q, 271K, 271R, 271S, 271T, 271H, 271A, 271V, 271L, 271I, 271F, 271M, 271Y, 271W или 271G;

T. 273I;

U. 275L или 275W;

V. 281D, 281K, 281Y или 281P;

W. 284E, 284N, 284T, 284L, 284Y или 284M;

X. 291D, 291E, 291Q, 291T, 291H, 291I или 291G;

Y. 299A, 299D, 299E, 299F, 299G, 299H, 299I, 299K, 299L, 299M, 299N, 299P, 299Q, 299R, 299S, 299V, 299W или 299Y;

Z. 302I;

AA. 304D, 304N, 304T, 304H или 304L
AB. 305I;
AC. 313F;
AD. 323I;
AE. 325A, 325D, 325E, 325G, 325H, 325I, 325L, 325K, 325R, 325S, 325F, 325M, 325T, 325V, 325Y, 325W или 325P;
AF. 328D, 328Q, 328K, 328R, 328S, 328T, 328V, 328I, 328Y, 328W, 328P, 328G, 328A, 328E, 328F, 328H, 328M или 328N;
AG. 330L, 330Y, 330I или 330V;
AH. 332A, 332D, 332E, 332H, 332N, 332Q, 332T, 332K, 332R, 332S, 332V, 332L, 332F, 332M, 332W, 332P, 332G или 332Y; и
AI. 336E, 336K или 336Y.

Все же особенно предпочтительные варианты включают одну или несколько модификаций, выбранных из групп 1-105 в Таблице 4:

Таблица 4
Группа Вариант Группа Вариант
1 A330L / I332E 54 S239D / D265L / N297D / I332E
2 D265F / N297E / I332E 55 S239D / D265T / N297D / I332E
3 D265Y / N297D / I332E 56 S239D / D265V / N297D / I332E
4 D265Y / N297D / T299L / I332E 57 S239D / D265Y / N297D / I332E
5 F241E / F243Q / V262T / V264F 58 S239D / I332D
6 F241E / F243Q / V262T / V264E / I332E 59 S239D / I332E
7 F241E / F243R / V262E / V264R 60 S239D / I332E / A330I
8 F241E / F243R / V262E / V264R / I332E 61 S239D / I332N
9 F241E / F243Y / V262T / V264R 62 S239D / I332Q
10 F241E / F243Y / V262T / V264R / I332E 63 S239D / N297D / I332E
11 F241L / F243L / V262I / V264I 64 S239D / N297D / I332E / A330Y
12 F241L / V262I 65 S239D / N297D / I332E / A330Y / F241S / F243H / V262T / V264T
13 F241R / F243Q / V262T / V264R 66 S239D / N297D / I332E / K326E
14 F241R / F243Q / V262T / V264R / I332E 67 S239D / N297D / I332E / L235D
15 F241W / F243W / V262A / V264A 68 S239D / S298A / I332E
16 F241Y / F243Y / V262T / V264T 69 S239D / V264I / A330L / I332E
17 F241Y / F243Y / V262T / V264T / N297D / I332E 70 S239D / V264I / I332E
18 F243L / V262I / V264W 71 S239D / V264I / S298A / I332E
19 P243L / V264I 72 S239E / D265N
20 L328D / I332E 73 S239E / D265Q
21 L328E / I332E 74 S239E / I332D
22 L328H / I332E 75 S239E / I332E
23 L328I / I332E 76 S239E / I332N
24 L328M / I332E 77 S239E / I332Q
25 L328N / I332E 78 S239E / N297D / I332E
26 L328Q / I332E 79 S239E / V264I / A330Y / I332 E
27 L328T / I332E 80 S239E / V264I / I332 E
28 L328V / I332E 81 S239E / V264I / S298A / A330Y / I332E
29 N297D / A330Y / I332E 82 S239N / A330L / I332E
30 N297D / I332E 83 S239N / A330Y / I332E
31 N297D / I332E / S239D / A330L 84 S239N / I332D
32 N297D / S298A / A330Y / I 332E 85 S239N / I332E
33 N297D / T299L / I332E 86 S239N / I332N
34 N297D / T299F / I332E / N297D / T299H / I332E 87 S239N / I332Q
35 N297D / T299I / I332E 88 S239N1S298A / I332E
36 N297D / T299L / I332E 89 S239Q / I332D
37 N297D / T299V / I332E 90 S239Q / I332E
38 N297E / I332E 91 S239Q / I332N
39 N297S / I332E 92 S239Q / I332Q
40 P230A / E233D / I332E 93 S239Q / V264I / I332E
41 P244H / P245A / P247V 94 S298A / I332E
42 S239D / A330L / I332E 95 V264E / N297D / I332E
43 S239D / A330Y / I332E 96 V264I / A330L / I332E
44 S239D / A330Y / I332E / K326E 97 V264I / A330Y / I332E
45 S239D / A330Y / I332E / K326T 98 V264I / I332E
46 S239D / A330Y / I332E / L234I 99 V264I / S298A / I332E
47 S239D / A330Y / I332E / L235D 100 Y296D / N297D / I332E
48 S239D / A330Y / I332E / V240I 101 Y296E / N297D / I332 E
49 S239D / A330Y / I332E / V264T 102 Y296H / N297D / I332E
50 S239D / A330Y / I332E / V266I 103 Y296N / N297D / I332E
51 S239D / D265F / N297D / I332E 104 Y296Q / N297I / I332E
52 S239D / D265H / N297D / I332E 105 Y296T / N297D / I332E.
53 S239D / D265I / N297D / I332E

Эффекторную функцию можно модифицировать методиками, такими как описанные в области технологий конструирования антител, или другими средствами. Например, в участок Fc можно ввести остаток(и) цистеина, таким образом делая возможным образование межцепочечных дисульфидных связей в этом участке, результатом чего является поколение гомодимерных антител, которые могут иметь улучшенную способность к интернализации и/или повышенную способность к комплемент-опосредованному уничтожении клеток и ADCC. См. Caron et al. (1992) J. Exp Med. 176:1191-1195; и B. Shopes (1992) J. Immunol. 148:2918-2922. Гомодимерные антитела с повышенной противоопухолевой активностью можно также получить с использованием гетеробифункциональных поперечно-сшивающих средств, как описано у Wolff et al. (1993) Cancer Research 53:2560-2565. Альтернативно, можно сконструировать антитело, которое будет иметь сдвоенные участки Fc, и может, таким образом, обладать повышенной способностью к лизису комплемента и ADCC (Stevenson et al. (1989) Anti-Cancer Drug Design 3:219-230).

Аффинности и FcγR-связывающие свойства молекул настоящего изобретения сначала определяются с использованием испытаний in vitro (на основе биохимических или иммунологичских испытаний), известных в данной области для определения взаимодействий Fc-FcγR, т.е. специфического связывания участка Fc с FcγR, включая без ограничения следующией анализ ELISA, анализ поверхностно плазмонного резонанса, анализы иммунопреципитации (см. Раздел 6.2.2). Предпочтительно связывающие свойства молекул настоящего изобретения также характеризуются функциональными испытаниями in vitro для определения одной или нескольких функций эффекторных клеток, опосредованных FcγR (См. Раздел 6.2.2). В наиболее предпочтительных вариантах осуществления молекулы настоящего изобретения имеют связывающие свойства в моделях in vivo (таких как описанные и раскрытые в данном документе), сходные с таковыми в анализах in vitro. Однако настоящее изобретение не исключает молекул настоящего изобретения, которые не обнаруживают желаемого фенотипа в анализах in vitro, но обнаруживают желаемый фенотип in vivo.

В некоторых вариантах осуществления молекулы настоящего изобретения, содержащие вариантный участок Fc, содержат по меньшей мере одну аминокислотную модификацию в CH3-домене участка Fc, который определяется, как находящийся между аминокислотами в положениях 342-447. В других вариантах осуществления молекулы настоящего изобретения, содержащие вариантный участок Fc, содержат по меньшей мере одну аминокислотную модификация CH2-домене участка Fc, который определяется, как находящийся между аминокислотами в положениях 231-341. В некоторых вариантах осуществления молекулы настоящего изобретения содержат по меньшей мере две аминокислотные модификации, где одна модификация находится в CH3-участке, а другая модификация - в CH2-участке. Настоящее изобретение далее охватывает аминокислотные модификации в шарнирном участке. Молекулы настоящего изобретения с одной или несколькими аминокислотными модификациями в CH2- и/или CH3-доменах имеют измененные аффинности к FcγR, определенные с использованием способов, описанных в данном документе или известных специалисту в данной области.

В конкретном варианте осуществления настоящее изобретение охватывает аминокислотные модификации в CH1-домене участка Fc.

В особенно предпочтительных вариантах осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, где указанный вариант имеет повышенную способность связываться с FcγRIIA (CD32A) и/или повышенную активность ADCC, как было измерено с использованием способов, известных специалисту в данной области и показанных в данном документе. Анализы ADCC, используемые в соответствии со способами настоящего изобретения, могут быть NK-зависимыми или макрофаг-зависимыми.

Варианты Fc настоящего изобретения могут сочетаться с другими известными модификациями Fc, включая без ограничения модификации, которые меняют эффекторную функцию и модификации, которые меняют аффинность связывания с FcγR. В конкретном варианте осуществления вариант Fc настоящего изобретения, содержащий первую аминокислотную модификацию в CH3-домене, CH2-домене или в шарнирном участке, может сочетаться со второй модификацией Fc так, чтобы вторая модификация Fc была не в том же самом домене, что и первая, с тем, чтобы первая модификация Fc наделяла дополнительным, синергичным или новым свойством вторую модификацию Fc. В некоторых вариантах осуществления варианты Fc настоящего изобретения не имеют никаких аминокислотных модификаций в CH2-домене.

В предпочтительном специфическом варианте осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, чтобы указанная молекула имела измененную аффинность к FcγR, при условии, что указанный вариантный участок Fc не имеет замены в положениях, которые непосредственно участвуют в контакте с FcγR, что известно на основании кристаллографических и структурных анализов взаимодействий Fc-FcγR, таких, как раскрытые у Sondermann et al., 2000 (Nature, 406: 267-273, который включен в данный документ ссылкой во всей своей полноте). Примерами положений в участке Fc, которые непосредственно участвуют в контакте с FcγR, являются аминокислоты 234-239 (шарнирный участок), аминокислоты 265-269 (петля B/C), аминокислоты 297-299 (петля C'/E) и аминокислоты 327-332 (петля F/G). В некоторых вариантах осуществления молекулы настоящего изобретения, содержащие вариантный участок Fc, содержат модификации по меньшей мере одного остатка, который непосредственно участвует в контакте с FcγR, что известно на основании кристаллографических и структурных анализов.

Домен, взаимодействующий с FcγR, картируется по нижнему шарнирному участку и сайтам отбора в доменах CH2 и CH3 тяжелой цепи IgG. Аминокислотные остатки, фланкирующие фактические положения контакта и аминокислотные остатки CH3-домене, играют роль во взаимодействиях IgG/FcγR, как установлено исследованиями мутагенеза и исследованиями с использованием малых пептидных ингибиторов, соответственно (Sondermann et al., 2000 Nature, 406: 267-273; Diesenhofer et al., 1981, Biochemistry, 20: 2361-2370; Shields et al., 2001, J. Biol. Chem. 276: 6591-6604; каждый из которых включен в данный документ ссылкой во всей своей полноте). Непосредственный контакт, как используется в данном документе, относится к тем аминокислотам, которые локализованы на расстоянии по меньшей мере 1 Å, по меньшей мере 2 или по меньшей мере 3 ангстрема друг от друга или в радиусе Ван Дер Ваальса, составляющем 1 Å, 1,2 Å, 1,5 Å, 1,7 Å или 2 Å.

В другом предпочтительном варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, что указанная молекула связывается с FcγR посредством участка Fc с измененной аффинностью по сравнению с молекулой, содержащей участок Fc дикого типа, при условии, что указанный вариантный участок Fc не имеет ни одной замены ни в одном из указанных положений 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 309, 312, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438, 439. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, что указанная молекула связывается с FcγR посредством участка Fc с измененной аффинностью по сравнению с молекулой, содержащей участок Fc дикого типа, при условии, что указанный вариантный участок Fc не имеет ни одной замены ни в одном из указанных положений 255, 258, 267, 269, 270, 276, 278, 280, 283, 285, 289, 292, 293, 294, 295, 296, 300, 303, 305, 307, 309, 322, 329, 332, 331, 337, 338, 340, 373, 376, 416, 419, 434, 435, 437, 438, 439 и не имеет аланина ни в одном из положений 256, 290, 298, 312, 333, 334, 359, 360, 326 или 430; лизина в положении 330; треонина в положении 339; метионина в положении 320; серина в положении 326; аспарагина в положении 326; аспарагиновой кислоты в положении 326; глутаминовой кислоты в положении 326; глутамина в положении 334; глутаминовой кислоты в положении 334; метионина в положении 334; гистидина в положении 334; валина в положении 334 или лейцина в положении 334; лизина в положении 335; аспарагина в положении 268; глутамина в положении 272; глутамина, серина или аспарагиновой кислоты в положении 286; серина в положении 290; метионина, глутамина, глутаминовой кислоты или аргинина в положении 320; глутаминовой кислоты в положении 322; серина, глутаминовой кислоты или аспарагиновой кислоты в положении 326; лизина в положении 330; глутамина в положении 335 или метионина в положении 301.

В конкретном варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc не имеет ни одной замены ни в одном из указанных положений 268, 269, 270, 272, 276, 278, 283, 285, 286, 289, 292, 293, 301, 303, 305, 307, 309, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438 или 439 и не имеет гистидина, глутамина или тирозина в положении 280; серина, глицина, треонина или тирозина в положении 290, лейцина или изолейцина в положении 300; аспарагина в положении 294, пролина в положении 296; пролина, аспарагина, аспарагиновой кислоты или валина в положении 298; лизина в положении 295. Еще в одном предпочтительном варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, что указанная молекула связывается с FcγR посредством участка Fc с пониженной аффинностью по сравнению с молекулой, содержащей участок Fc дикого типа, при условии, что указанный вариантный участок Fc не имеет ни одной замены ни в одном из указанных положений 252, 254, 265, 268, 269, 270, 278, 289, 292, 293, 294, 295, 296, 298, 300, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438 или 439. Еще в одном предпочтительном варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, что указанная молекула связывается с FcγR посредством участка Fc с повышенной аффинностью по сравнению с молекулой, содержащей участок Fc дикого типа, при условии, что указанный вариантный участок Fc не имеет ни одной замены ни в одном из указанных положений 280, 283, 285, 286, 290, 294, 295, 298, 300, 301, 305, 307, 309, 312, 315, 331, 333, 334, 337, 340, 360, 378, 398 или 430.

В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc не включает ни одной замены ни в одном из указанных положений 330, 243, 247, 298, 241, 240, 244, 263, 262, 235, 269 или 328 и не имеет лейцина в положении 243, аспарагина в положении 298, лейцина в положении 241 и изолейцина или аланина в положении 240, гистидина в положении 244, валина в положении 330, или изолейцина в положении 328.

В наиболее предпочтительных вариантах осуществления молекулы настоящего изобретения с измененными аффинностями для активирующих и/или ингибирующих рецепторов, имеющих варианты участков Fc с одной или несколькими аминокислотными модификациями, где одна или несколько указанных аминокислотных модификаций являются замещениями в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином (MgFc10); или замещениями в положении 334 глутаминовой кислотой, в положении 359 аспарагином, и в положении 366 серином (MgFc13); или замещениями в положении 316 аспарагиновой кислотой, в положении 378 валином, и в положении 399 глутаминовой кислотой (MgFc27); или замещениями в положении 392 треонином, и в положении 396 лейцином (MgFc38); или замещениями в положении 221 глутаминовой кислотой, в положении 270 глутаминовой кислотой, в положении 308 аланином, в положении 311 гистидином, в положении 396 лейцином, и в положении 402 аспарагиновой кислотой (MgFc42); или замещениями в положении 240 аланином, и в положении 396 лейцином (MgFc52); или замещениями в положении 410 гистидином, и в положении 396 лейцином (MgFc53); замещениями в положении 243 лейцином, в положении 305 изолейцином, в положении 378 аспарагиновой кислотой, в положении 404 серином, и в положении 396 лейцином (MgFc54); или замещениями в положении 255 изолейцином, и в положении 396 лейцином (MgFc55); или замещениями в положении 370 глутаминовой кислотой и в положении 396 лейцином (MgFc59); или замещениями в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином, и в положении 396 лейцином (MgFc88); или замещениями в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, и в положении 396 лейцином (MgFc88A); или замещениями в положении 234 лейцином, в положении 292 пролином, и в положении 300 лейцином (MgFc155); или замещениями в положении 243 лейцином, в положении 292 пролином, и в положении 300 лейцином; или замещениями в положении 243 лейцином, в положении 292 пролином, и в положении 396 лейцином; или замещениями в положении 243 лейцином, и в положении 292 пролином; замещениями в положении 243 лейцином; или замещением в положении 273 фенилаланином; или замещениями в положении 247 лейцином, в положении 270 глутаминовой кислотой и в положении 421 лизином.

В одном специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит замены в положении 396 лейцином, в положении 270 глутаминовой кислотой и в положении 243 лейцином. В еще одном специфическом варианте осуществления молекула дополнительно содержит одну или несколько аминокислотных модификаций, таких как раскрытые в настоящем документе.

В некоторых вариантах осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, имеющий аминокислотную модификацию в одном или нескольких из следующих положений: 119, 125, 132, 133, 141, 142, 147, 149, 162, 166, 185, 192, 202, 205, 210, 214, 217, 219, 215, 216, 217, 218, 219, 221, 222, 223, 224, 225, 227, 288, 229, 231, 232, 233, 234, 235, 240, 241, 242, 243, 244, 246, 247, 248, 250, 251, 252, 253, 254, 255, 256, 258, 261, 262, 263, 268, 269, 270, 272, 273, 274, 275, 276, 279, 280, 281, 282, 284, 287, 288, 289, 290, 291, 292, 293, 295, 298, 300, 301, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 315, 316, 317, 318, 319, 320, 323, 326, 327, 328, 330, 333, 334, 335, 337, 339, 340, 343, 344, 345, 347, 348, 352, 353, 354, 355, 358, 359, 360, 361, 362, 365, 366, 367, 369, 370, 371, 372, 375, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 404, 406, 407, 408, 409, 410, 411, 412, 414, 415, 416417, 419, 420, 421, 422, 423, 424, 427, 428, 431, 433, 435, 436, 438, 440, 441, 442, 443, 446, 447. Предпочтительно такие мутации приводят к образованию молекул, которые имеют измененную аффинность к FcγR и/или измененную опосредованную клетками эффекторную функцию, как было установлено при использовании способов, раскрытых и проиллюстрированных в данном документе и известных специалисту в данной области.

В некоторых вариантах осуществления молекулы, предпочтительно иммуноглобулины, настоящего изобретения дополнительно содержат один или несколько сайтов гликозилирования так, что одна или несколько углеводных частей ковалентно присоединяется к молекуле. Предпочтительно антитела настоящего изобретения с одним или несколькими сайтами гликозилирования и/или одним или несколькими модификациями в участке Fc имеют усиленную антитело-опосредованную эффекторную функцию, например, повышенную активность ADCC. В некоторых вариантах осуществления настоящее изобретение дополнительно содержит антитела, содержащие одну или несколько модификаций аминокислот, которые непосредственно или косвенно взаимодействуют с углеводной частью антитела, включая без ограничения аминокислоты в положениях 241, 243, 244, 245, 245, 249, 256, 258, 260, 262, 264, 265, 296, 299 и 301. Аминокислоты, которые непосредственно или косвенно взаимодействуют с углеводной частью антитела, известны в данной области, см., например, Jefferis et al., 1995 Immunology Letters, 44: 111-7, включенную в данный документ ссылкой во всей своей полноте.

Гликозилирование это котрансляционная/посттрансляционная модификация, которая приводит к прикреплению гликозилированного олигосахарида с высоким содержанием маннозы (GlcNAc2Man9Glu3), который впоследствии процессируется, сначала до структуры GlcNAc2Man9 (“Man9”) (Фигура 41), а затем с получением GlcNAc2Man8 (“Man8”), GlcNAc2Man7 (“Man7”), GlcNAc2Man6 (“Man6”) и, в конечном счете, структуры GlcNAc2Man5 (“Man5”). Структура GlcNAc2Man5 (“Man5”) затем процессируется последовательным действием гликозилтрансфераз с образованием олигосахаридов “G0F,” “G1F” и “G2F”, которые демонстрируют комплексную диантенную структуру (Фигура 42) (Jefferis, R. (2005) “Glycosylation of Recombinant Antibody Therapeutics,” Biotechnol. Prog. 21:11-16; Kornfeld, R. et al. (1985) “Assembly Of Asparagine-Linked Oligosaccharides,” Ann. Rev. Biochem. 54:631-664).

Настоящее изобретение охватывает антитела, которые были модифицированы введением одного или нескольких сайтов гликозилирования в один или несколько сайтов антител, предпочтительно без изменения функциональных возможностей антитела, например, связывающей активности с FcγR. Сайты гликозилирования могут быть введены в вариабельный и/или константный участок антител настоящего изобретения. Как используется в данном документе, “сайты гликозилирования” включают любую специфическую аминокислотную последовательность в антителе, к которой специфически ковалентной связью будет прикрепляться олигосахарид (т.е., углевод, содержащий два или более простых сахара, соединенных вместе). Олигосахаридные боковые цепи типично связаны со скелетом антитела посредством либо N- либо O-связей. N-связанное гликозилирование относится к прикреплению олигосахаридной части к боковой цепи остатка аспарагина. O-связанное гликозилирование относится к прикреплению олигосахаридной части к гидроксиаминокислоте, например, серину, треонину. Антитела настоящего изобретения могут содержать один или несколько сайтов гликозилирования, включая N-связанные и O-связанные сайты гликозилирования. Любой сайт гликозилирования для N-связанного или O-связанного гликозилирования, известный в данной области может быть использован в соответствии с настоящим изобретением. Примером N-связанного сайта гилкозилировния, который полезен в соответствии со способами настоящего изобретения, является аминокислотная последовательность: Asn-X-Thr/Ser, где X может быть любой аминокислотой, и Thr/Ser обозначает треонин или серин. Такой сайт или сайты можно ввести в антитело настоящего изобретения, используя способы, хорошо известные в данной области, к которой принадлежит настоящее изобретение. См., например, "In Vitro Mutagenesis," Recombinant ДНК: A Short Course, J. D. Watson, et al. W.H. Freeman и Company, New York, 1983, chapter 8, pp. 106-116, которая включена в данный документ ссылкой во всей своей полноте. Типичный способ введения сайта гликозилирования в антитело настоящего изобретения может включать: модифицирование или мутацию аминокислотной последовательности антитела таким образом, что получается желаемая последовательность Asn-X-Thr/Ser.

В некоторых вариантах осуществления настоящее изобретение охватывает способы модифицирования углеводного содержания антитела настоящего изобретения путем добавления или вырезания сайта гликозилирования. Способы модифицирования углеводного содержания антител хорошо известны в данной области и охватываются данным изобретением, см., например, патент США № 6218149; европейский патент № 0359096 B1; публикацию заявки на патент США № 2002/0028486; WO 03/035835; публикацию заявки на патент США № 2003/0115614; патент США № 6218149; патент США № 6472511; все из которых включены в данный документ ссылкой во всей своей полноте. В других вариантах осуществления настоящее изобретение охватывает способы модифицирования углеводного содержания антитела настоящего изобретения путем вырезания одной или нескольких эндогенных углеводных частей антитела. В специфическом варианте осуществления настоящее изобретение охватывает сдвиг сайта гликозилирования участка Fc антитела путем модифицирования положения 297 (например, аспарагин замещается остатком без доступной аминогруппы, например, глутамином) и/или положений, примыкающих к 297. В специфическом варианте осуществления настоящее изобретение охватывает модификацию положения 296 так, что гликозилируется положение 296, а не положение 297.

Фукозилированные углеводные структуры вовлечены в разнообразные биологические и патологические процессы в эукариотических организмах, включая развитие тканей, ангиогенез, оплодотворение, адгезию клеток, воспаление и метастазирование опухолей (Ma, B. et al. (Epub 2006 Sep 14) “Fucosylation In Prokaryotes and Eukaryotes,” Glycobiology. 16(12):158R-184R). Было обнаружено, что терапевтические антитела с полным отсутствием фукозного кора Fc-олигосахаридов демонстрируют у людей гораздо более высокую ADCC, чем их фукозилированные аналоги (Iida, S. et al. (2009) “Two Mechanisms Of The Enhanced Antibody-Dependent Cellular Cytotoxicity (ADCC) Efficacy Of Non-Fucosylated Therapeutic Antibody In Human Blood,” BMC Cancer. 18:9:58). Однако получение таких антител раньше требовало ферментативного удаления остатков фукозы (например, с использованием N-гликозидазы F), которые были добавлены к антителу с помощью гликозилазы.

Один аспект настоящего изобретения относится к распознаванию, какие вариации в участке Fc антитела могут вмешиваться в механизм клеточного гликозилирования и, таким образом, давать антитела, которые демонстрируют пониженную степень гликозилирования (и, в частности, фукозилирования).

Настоящее изобретение, таким образом, обеспечивает средства для получения антител, имеющих пониженную степень гликозилирования (и, в частности, фукозилирования) путем замещения одного или более, двух, трех, четырех, пяти или больше остатков нативных остатков Fc для того, чтобы сформировать вариантный участок Fc. Без намерения привязываться к какой-либо теории механизма действия полагается, что подходящие замены дают полипептид, имеющий вариантный участок Fc, который либо менее фукозилирован, чем нативный участок Fc, либо не фукозилирован совсем, и что такие полипептиды, благодаря своей измененной (или отсутствующей) степени гликозилирования (и, в частности, фукозилирования), демонстрируют улучшенную эффекторную функцию по сравнению с полипептидами, имеющими нативный участок Fc. Полинуклеотиды, кодирующие полипептиды, которые содержат такие вариантные участки Fc, могут быть введены в клетки-хозяева (например, клетки CHO, дрожжи и т.д.), включая клетки-хозяева, способные опосредовать нормальное гликозилирование (и, в частности, нормальное фукозилирование), но они будут экспрессироваться в полипептиды, которые меньше подвергаются посттрансляционной модификации гликозилазой (или фукозилазой) или не модифицируются посттрансляционно такими ферментами совсем по сравнению с полипептидами, содержащими нативные участки Fc и, таким образом, демонстрирующие улучшенную эффекторную функцию (например, улучшенное связывание с активирующими рецепторами (например, CD16A, CD32A) и ослабленное связывание с CD32B. Такое улучшение эфекторной функции можно измерить, используя анализ скорости диссоциации. Такой анализ обеспечивает наилучший показатель потенциального улучшения FcγR-связывающей активности in vivo, потому что в качестве кинетической переменной он непосредственно отражает взаимодействие Fc-FcγR, независимое от концентрации антитела.

Как используется в данном документе, такая пониженная степень гликозилирования (и, в частности, фукозилирования) предпочтительно составляет менее чем 80%, более предпочтительно менее чем 60%, еще более предпочтительно менее чем 40%, и наиболее предпочтительно менее чем 20% от степени гликозилирования (и, в частности, фукозилирования), демонстрируемой таким антителом в отсутствие таких вариаций в его участке Fc. В более предпочтительном варианте осуществления такие вариации в участке Fc антитела будут элиминировать в значительной степени или полностью степень гликозилирования (и, в частности, фукозилирования), демонстрируемую таким антителом. Способность таких вариантов Fc снижать степень гликозилирования (и, в частности, фукозилирования) является общей характеристикой и проиллюстрирована в данном документе по отношению к антителам к Her2/neu.

Настоящее изобретение, в частности, касается полипептидов (например, антител), обладающих вариантными участками Fc, которые приводят к повышенному соотношению гликозилирования олигосахаридов с высоким содержанием маннозы к гликозилированию комплексных олихосахаридов. Как используется в данном документе, такое соотношение обозначает сравнение степени, до которой гликозилирование, демонстрируемое Fc-участком, является комплексным олигосахаридом либо G0F, G1F, либо G2F (см. Фигуру 42) со степенью, до которой гликозилирование, демонстрируемое Fc-участком, является Man5, Man6, Man7, Man8 или Man9 (см., Фигура 41). Соотношение гликозилирования олигосахаридов с высоким содержанием маннозы к гликозилированию комплексных олихосахаридов, следовательно, представляет собой: Σ (% Man5 + % Man6 + % Man7 + % Man8 + % Man9) : Σ (% G0F + % G1F + % G2F). Предпочтительно повышенное соотношению гликозилирования олигосахаридов с высоким содержанием маннозы к гликозилированию комплексных олихосахаридов будет составлять более, чем около 0,2. Более предпочтительно, это соотношение будет более, чем около 0,5, еще более предпочтительно это соотношение будет более, чем около 1,0, более, чем около 1,5, более, чем около 2,0, более, чем около 2,5, более, чем около 3,0, более, чем около 3,5, более, чем около 4,0, более, чем около 4,5, более, чем около 5,0, более, чем около 5,5 или более, чем 6,0. Наиболее предпочтительно, когда верхние диапазоны такого соотношения будут менее, чем около 10, более предпочтительно, менее, чем около 9,5, менее, чем около 9, менее, чем около 8,5, менее, чем около 8, менее, чем около 7,5, менее чем, около 7, менее, чем около 6,5, менее, чем около 6 или менее, чем около 5,5. Специфические рассмотренные диапазоны такого соотношения включают более, чем около 0,2, но менее, чем около 5,5; более, чем около 0,5, но менее, чем около 5,5; более, чем около 1,0, но менее, чем около 5,5; более, чем около 2,0, но менее, чем около 5,5; более, чем около 3,0, но менее, чем около 5,5; более, чем около 4,0, но менее, чем около 5,5; и более, чем около 5,0, но менее, чем около 5,5.

Предпочтительно, варианты Fc, демонстрирующие пониженную степень гликозилирования (и, в частности, фукозилирования), содержат аминокислотную замену либо в одном из положений L234 и/или L235, либо в обоих этих положениях. Более предпочтительно, если такие варианты Fc будут дополнительно содержать по меньшей мере одну дополнительную аминокислотную замену в любом из следующих положений: F243, R292, Y300, V305 и/или P396. Таким образом, предпочтительные варианты Fc, демонстрирующие пониженную степень гликозилирования (и, в частности, фукозилирования), содержат замены аминокислот в любом из положений L234 и/или L235, либо в обоих этих положениях, и также в положении F243; положении R292; положении Y300; положении V305; положении P396; положениях F243 и R292; положениях F243 и Y300; положениях F243 и V305; положениях F243 и P396; положениях R292 и Y300; положениях R292 и V305; положениях R292 и P396; положениях Y300 и V305; положениях Y300 и P396; положениях V305 и P396; положениях F243, R292 и Y300; положениях F243, R292 и V305; положениях F243, R292 и P396; положениях F243, Y300 и V305; положениях F243, Y300 и P396; положениях F243, V305 и P396; положениях R292, Y300 и V305, положениях R292, Y300 и P396; положениях R292, V305 и P396; положениях Y300, V305 и P396; положениях F243, R292, Y300 и V305; положениях F243, R292, Y300 и P396; положениях F243, R292, V305 и P396; положениях F243, Y300, V305 и P396; положениях R292, Y300, V305 и P396; или положениях F243, R292, Y300, V305 и P396. L234 замещения L234F и/или L235 замещения L235V являются особенно предпочтительными.

6.1 ПОЛИПЕПТИДЫ И АНТИТЕЛА С ВАРИАНТНЫМИ УЧАСТКАМИ Fc

Специалист в данной области оценит то, что помимо замен аминокислот, настоящее изобретение рассматривает другие модификации аминокислотной последовательности участка Fc для того, чтобы получить вариантные участки Fc с одним или несколькими измененными свойствами, например, измененной эффекторной функцией. Настоящее изобретение рассматривает делеции одного или нескольких аминокислотных остатков участка Fc с целью ослабления связывания с FcγR. Предпочтительно, в соответствии с этим вариантом осуществления настоящего изобретения вырезается не более 5, не более 10, не более 20, не более 30, не более 50 остатков участка Fc. Участок Fc данного изобретения, содержащий одну или несколько делеций аминокислот, будет предпочтительно сохранять по меньшей мере, приблизительно 80%, и предпочтительно по меньшей мере приблизительно 90%, и наиболее предпочтительно по меньшей мере приблизительно 95%, участка Fc дикого типа. В некоторых вариантах осуществления одно или несколько свойств молекул сохраняются, такие как, например, неиммуногенность, FcγRIIIA-связывание, FcγRIIA-связывание или сочетание этих свойств.

В альтернативных вариантах осуществления настоящее изобретение охватывает вставки аминокислот для того, чтобы получить вариантные участки Fc, которые имеют измененные свойства, включая измененную эффекторную функцию. В одном специфическом варианте осуществления настоящее изобретение охватывает введение по меньшей мере одного аминокислотного остатка, например, одного или двух аминокислотных остатков, и предпочтительно не более 10 аминокислотных остатков, примыкающих к одному или нескольким положениям участка Fc, определенным в данном изобретении. В альтернативных вариантах осуществления настоящее изобретение далее охватывает введение по меньшей мере одного аминокислотного остатка, например, одного или двух аминокислотных остатков, и предпочтительно не более 10 аминокислотных остатков, примыкающих к одному или нескольким положениям участка Fc, известным на данном уровне технологии в качестве влияющих на взаимодействие и/или связывание с FcγR.

Настоящее изобретение также охватывает включение искусственных аминокислот для получения вариантных Fc настоящего изобретения. Такие способы известны специалистам в данной области техники, например, те, которые используются в естественном биосинтетическом аппарате для того, чтобы сделать возможным включение искусственных аминокислот в белки, см., например, Wang et al., 2002 Chem. Comm. 1: 1-11; Wang et al., 2001, Science, 292: 498-500; van Hest et al., 2001. Chem. Comm. 19: 1897-1904, каждый из которых включен в данный документ ссылкой во всей своей полноте. Альтернативные стратегии сфокусированы на ферментах, ответственных за биосинтез аминоацил-тРНК, смотри, например, Tang et al., 2001, J. Am. Chem. 123(44): 11089-11090; Kiick et al., 2001, FEBS Lett. 505(3): 465; каждый из которых включен в данный документ ссылкой во всей своей полноте.

Аффинности и связывающие свойства вариантных Fc или их фрагментов, использующихся в данном изобретении, первоначально определяются с использованием системы индикации для дрожжей, предпочтительно в сочетаниями с анализами in vitro (биохимическими или иммунологическими анализами), известными на данном уровне техники для определения взаимодействий Fc-FcγR, т.е. специфического связывания участка Fc с FcγR, включая без ограничения анализы ELISA, поверхностный плазмонный резонанс, иммунопреципитацию (Смотри Раздел 6.2.1). В определенных вариантах осуществления кандидаты вариантных Fc, идентифицированные с использованием системы индикации для дрожжей, далее встраиваются в антитело или его фрагмент для тестирования в указанном анализе in vitro. Предпочтительно, связывающие свойства молекулы настоящего изобретения также характеризуются функциональными анализами in vitro для определения одной или нескольких FcγR-опосредованных функций эффекторных клеток (Смотри Раздел 6.2.5). Такие способы были ранее раскрыты изобретателями, смотри, например, публикации патентных заявок США 2005/0037000 и 2005/0064514, публикацию международной патентной заявки WO 04/063351, каждая из которых включена в данный документ ссылкой во всей своей полноте, и были использованы для идентификации и характеристики новых мутаций Fc на основе связывающих характеристик с FcγRIIIA и FcγRIIB, смотри, например, Таблицу 5.

ТАБЛИЦА 5
Fc МУТАЦИИ, ОПРЕДЕЛЕННЫЕ С ПОМОЩЬЮ ДРОЖЖЕВОГО ДИСПЛЕЯ И ИСПЫТАНИЯ ELISA
Клон # Сайты мутации Домен IIIA
связывание
IIB связывание
4 A339V, Q347H CH2, CH3 + +
5 L251P, S415I CH2, CH3 + +
8 V185M, K218N, R292L, D399E CH1, шарнир, CH2,
CH3
без изменений -
12 K290E, L142P CH1,CH2 + не испытан
16 A141V, H268L, K288E, P291S CH1,CH2 - не испытан
19 L133M, P150Y, K205E, S383N, N384K CH1,CH2,CH3 - не испытан
21 P396L CH3 •+
ТАБЛИЦА 5
Fc МУТАЦИИ, ОПРЕДЕЛЕННЫЕ С ПОМОЩЬЮ ДРОЖЖЕВОГО ДИСПЛЕЯ И ИСПЫТАНИЯ ELISA
Клон # Сайты мутации Домен IIIA
связывание
IIB связывание
25 P396H CH3 ••• ••
6 K392R CH3 без изменений без изменений
15 R301C, M252L, S192T CH1,CH2 - не испытан
17 N315I CH2 без изменений не испытан
18 S132I CH1 без изменений не испытан
26 A162V CH1 без изменений не испытан
27 V348M, K334N, F275I, Y202M, K147T CH1,Ch2 + +
29 H310Y, T289A, G337E CH2 - не испытан
30 S119F, G371S, Y407N, E258D CH1,CH2,CH3 + без изменений
31 K409R, S166N CH1,CH3 без изменений не испытан
20 S408I, V215I, V125I CH1,Шарнир,CH3 + без изменений
24 G385E, P247H CH2, CH3 ••• +
16 V379M CH3 •• без изменений
17 S219Y Шарнир -
18 V282M CH2 -
31 F275I, K334N, V348M CH2 + без изменений
35 D401V CH3 + без изменений
37 V280L, P395S CH2 + -
40 K222N Шарнир без изменений
41 K246T, Y319F CH2 без изменений
42 F243I, V379L CH2,CH3 •+ -
43 K334E CH2 •+ -
44 K246T, P396H CH2,CH3 ••+
45 H268D, E318D CH2 •+ •••••
49 K288N, A330S, P396L CH2,CH3 ••••• •••
50 F243L, R255L, E318K CH2 -
53 K334E, T359N, T366S CH2,CH3 без изменений
54 I377F CH3 •+ +
57 K334I CH2 без изменений
58 P244H, L358M, V379M, N384K, V397M CH2,CH3 •+ •+
ТАБЛИЦА 5
Fc МУТАЦИИ, ОПРЕДЕЛЕННЫЕ С ПОМОЩЬЮ ДРОЖЖЕВОГО ДИСПЛЕЯ И ИСПЫТАНИЯ ELISA
Клон # Сайты мутации Домен IIIA
связывание
IIB связывание
59 K334E, T359N, T366S
(независимый изолят)
CH2,CH3 •+ без изменений
61 I377F (независимый изолят) CH3 ••• ••+
62 P247L CH2 •• ••+
64 P217S, A378V, S408R Шарнир, CH3 •• ••••+
65 P247L, I253N, K334N CH2 ••• ••+
66 K288M, K334E CH2 ••• -
67 K334E, E380D CH2,CH3 •+ -
68 P247L (независимый изолят) CH2 + ••••
69 T256S, V305I, K334E, N390S CH2,CH3 •+ без изменений
70 K326E CH2 •+ ••+
71 F372Y CH3 + •••••+
72 K326E (независимый изолят) CH2 + ••
74 K334E, T359N, T366S
(независимый изолят)
CH2,CH3 •• без изменений
75 K334E (независимый изолят) CH2 ••+ без изменений
76 P396L (независимый изолят) CH3 •+ без изменений
78 K326E (независимый изолят) CH2 •• •••+
79 K246I, K334N CH2 ••••
80 K334E (независимый изолят) CH2 без изменений
81 T335N, K370E, A378, T394M, S424L CH2,CH3 без изменений
82 K320E, K326E CH2
84 H224L Шарнир •••••
87 S375C, P396L CH3 •+ ••••+
89 E233D, K334E CH2 •+ без изменений
91 K334E (независимый изолят) CH2 без изменений
92 K334E (независимый изолят) CH2 без изменений
94 K334E, T359N, T366S, Q386R CH2 без изменений
относительно сравнимой молекулы с Fc-участком дикого типа, • ≡ 1-кратное повышение аффинности; + ≡ до 50% повышение аффинности; и - ≡ 1-кратное понижение аффинности

В самых предпочтительных вариантах осуществления молекулы настоящего изобретения имеют связывающие свойства в моделях in vivo (таких как раскрытые здесь и/или известные в данном уровне техники), сходные со свойствами, установленными в анализах in vitro. Однако, настоящее изобретение не исключает молекулы настоящего изобретения, которые не демонстрируют желаемый фенотип в анализах in vitro, но демонстрируют желаемый фенотип in vivo. Репрезентативная схема последовательности операций скрининга и характеристики молекул настоящего изобретения описана на ФИГ. 1.

Настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, который связывается с более высокой аффинностью с одним или несколькими FcγRs. Такие молекулы предпочтительно опосредуют эффекторную функцию более эффективно, как обсуждается ниже. В других вариантах осуществления настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, который связывается с более низкой аффинностью с одним или несколькими FcγRs. Снижение или элиминация эффекторной функции желательны в определенных случаях, например, в случае антител, чей механизм действия включает блокировку или антагонизм, но не уничтожение клеток, несущих антиген-мишень. Снижение или элиминация эффекторной функции были бы желательны в случаях аутоиммунных заболеваних, где блокировались бы активирующие рецепторы block FcγR в эффекторных клетках (Этот тип функции присутствовал бы в клетках-хозяевах). В основном, повышенная эффекторная функция направлена против опухолей и чужеродных клеток.

Варианты Fc настоящего изобретения могут комбинироваться с другими модификациями Fc, включая без ограничения модификации, которые меняют эффекторную функцию. Настоящее изобретение охватывает сочетания вариантных Fc настоящего изобретения с другими модификациями Fc с целью обеспечения добавочных, синергичных или новых свойств антител или интеграцию Fc. Предпочтительно, вариантные Fc настоящего изобретения усиливают фенотип модификации, с которой они комбинируются. Например, если вариант Fc настоящего изобретения комбинируется с мутантом, о котором известно, что он связывается с FcγRIIIA с большей аффинностью, чем соответствующая молекула, содержащая участок Fc дикого типа, комбинация с мутантом настоящего изобретения приводит к более многократному увеличению аффинности к FcγRIIIA.

В одном варианте осуществления варианты Fc настоящего изобретения могут комбинироваться с другими известными вариантными Fc, такими как раскрытые в Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, Mol Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al. , 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett. 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al, 1996, Immunol Lett 54:101-104; Lund et al, 1996, J Immunol 157:49634969; Armour et aL, 1999, Eur J Immunol 29:2613-2624; Idusogie et al, 2000, J Immunol 164:41784184; Reddy et al, 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200:16-26; Idusogie et al, 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Jefferis et al, 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490); US 5624821; US 5885573; US 6194551; PCT WO 00/42072; PCT WO 99/58572; каждый из которых включен в данный документ ссылкой во всей своей полноте.

В некоторых вариантах осуществления вариантные Fc настоящего изобретения встроены в антитело или в объединение Fc, которое содержит одну или несколько сконструированных гликоформ, т.е. углеводную композицию, ковалентно прикрепленную к молекуле, содержащей участок Fc, где указанная углеводная композиция химически отличается от композиции исходной молекулы, содержащей участок Fc. Сконструированные гликоформы могут быть полезны для разнообразных целей, включая без ограничения усиление или ослабление эффекторной функции. Сконструированные гликоформы можно получить любым способом, известным специалисту в данной области, например, используя сконструированные штаммы или вариантные экспрессирующие штаммы, коэкспрессией с одним или несколькими ферментами, например, DI N-ацетилглюкозаминилтрансферазой III (GnTI11), экспрессией молекулы, содержащей участок Fc в различных организмах или клеточных линиях из различных организмов или модификацией углевода(ов) после того, как молекула, содержащая участок Fc, была экспрессирована. Способы производства сконструированных гликоформ известны в данном уровне техники, и включают без ограничения те, которые описаны в Umana et al, 1999, Nat. Biotechnol 17:176-180; Davies et al., 20017 Biotechnol Bioeng 74:288-294; Shields et al, 2002, J Biol Chem 277:26733-26740; Shinkawa et aL, 2003, J Biol Chem 278:3466-3473) US 6602684; USSN 10/277370; USSN 10/113929; PCT WO 00/61739A1; PCT WO 01/292246A1; PCT WO 02/311140A1; PCT WO 02/30954A1; Potillegent™ technology (Biowa, Inc. Принстон, Нью-Джерси); GlycoMAb™ glycosylation engineering technology (GLYCART biotechnology AG, Цюрих, Швейцария); каждый из которых включен в данный документ ссылкой во всей своей полноте. См., например, WO 00061739; EA01229125; US 20030115614; Okazaki et al., 2004, JMB, 336: 1239-49, каждый из которых включен в данный документ ссылкой во всей своей полноте.

Вариантные Fc настоящего изобретения могут быть оптимизированы для разнообразия свойств. Свойства, которые могут быть оптимизированы, включают без ограничения повышенную или сниженную аффинность к FcγR, усиленную или ослабленную эффекторную функцию. В предпочтительном варианте осуществления вариантные Fc настоящего изобретения оптимизированы так, чтобы они обладали повышенной аффинностью к активирующему рецептору FcγR человека, предпочтительно FcγR, FcγRIIA, FcγRIIc, FcγRIIIA, и FcγRIIIB, наиболее предпочтительно к FcγRIIIA. В альтернативном предпочтительном варианте осуществления вариантные Fc оптимизированы так, чтобы они обладали пониженной аффинностью к ингибирующему рецептору FcγRIIB человека. Ожидается, что эти предпочтительные варианты осуществления обеспечат и объединения Fc с усиленными терапевтическими свойствами у людей, например, усиленной эффекторной функцией и более высокой противораковой активностью, как описано и проиллюстрировано в данном документе. Ожидается, что эти предпочтительные варианты осуществления обеспечат и объединения Fc со способностью к усиленной элиминации опухолей на моделях ксенотрансплантатов опухолей у мышей.

В альтернативном варианте осуществления вариантные Fc настоящего изобретения оптимизированы так, чтобы иметь сниженную аффинность к человеческому FcγR, включая без ограничения к FcγRI, FcγRIIA, FcγRIIB, FcγRIIc, FcγRIIIA и FcγRIIIB. Ожидается, что эти варианты осуществления обеспечат антитела и объединения Fc с повышенными терапевтическими свойствами у людей, например, сниженной эффекторной функцией и сниженной токсичностью.

В альтернативных вариантах осуществления вариантные Fc настоящего изобретения обладают повышенной или пониженной аффинностью к FcγRs из нечеловеческих организмов, включая без ограничения мышей, крыс, кроликов и обезьян. Вариантные Fc, которые оптимизированы для связывания нечеловеческих FcγR, могут найти применение в экспериментальных работах. Например, модели на мышах доступные для разнообразных заболеваний, которые дают возможность тестировать такие свойства, как эффективность, токсичность и фармакокинетику кандидата в лекарственные средства. Как известно в данном уровне техники, клетки злокачественной опухоли могут быть трансплантированы или введены в мышей для имитации злокачественной опухоли человека, процесс, называемый ксенотрансплантацией. Тестирование антител или объединений Fc, которые содержат вариантные Fc, оптимизированные для одного или нескольких мышинных FcγRs, могут предоставить ценную информацию в отношении эффективности антитела или объединения Fc, его механизма действия и т.п. В определенных вариантах осуществления молекулы настоящего изобретения, содержащие вариантный участок Fc человека, тестируются на трансгенных мышах, экспрессирующих один или несколько рецепторов Fcγ человека (например, FcγRIIIA, FcγRIIA, FcγRIIB).

В то время как предпочтительным является изменение связывания с FcγR, настоящее изобретение далее рассматривает вариантные Fc с измененной аффинностью связывания с неонатальным рецептором (FcRn). Хотя, не намереваясь привязываться к конкретному механизму действия, ожидается, что вариантные участки Fc с улучшенной аффинностью к FcRn будут иметь более длительный период полураспада в сыворотке, и такие молекулы будут иметь полезное применение в способах лечения млекопитающих, где желателен более длительный период полураспада в сыворотке применяемого полипептида, например, для лечения хронического заболевания или расстройства. Хотя, не намереваясь привязываться к конкретному механизму действия, ожидается, что варианты участка Fc с пониженной аффинностью связывания с FcRn, наоборот, будут иметь более короткий период полураспада в сыворотке, и такие молекулы могут, например, применяться у млекопитающего, где сокращенное время циркуляции может быть выгодным, например, для диагностической визуализации in vivo или для полипептидов, которые имеют токсические побочные эффекты при циркуляции в кровеносном потоке на протяжении длительных периодов. Ожидается, что варианты участка Fc с пониженной аффинностью связывания с FcRn будут с меньшей вероятностью проникать через плаценту, и таким образом, могут быть использованы в лечении заболеваний или расстройств беременных женщин.

В других вариантах осуществления эти варианты могут быть скомбинированы с другими известными модификациями Fc с измененной аффинностью к FcRn, такими как раскрытые в международных публикациях №№ WO 98/23289; и WO 97/34631; и патенте США №6277375, каждый из которых включен в данный документ ссылкой во всей своей полноте.

Настоящее изобретение охватывает любой другой способ, известный в данном уровне техники, для производства антител, имеющих увеличенный срок полураспада in vivo, например, путем введения одной или нескольких аминокислотных модификаций (т.е. замещения, вставки или делеции) в константный домен IgG или его FcRn-связывающий фрагмент (предпочтительно Fc или фрагмент шарнирного Fc-домена). Смотри, например, международные публикации №№ WO 98/23289; и WO 97/34631; и патент США №6277375, каждый из которых включен в данный документ ссылкой во всей своей полноте для использования в комбинации с вариантными Fc настоящего изобретения. Далее, антитела настоящего изобретения могут быть конъюгированы с альбумином, чтобы получить антитело или фрагмент антитела, более стабильные in vivo или имеющие более длительный срок полураспада in vivo. Методики, хорошо известные на данном уровне техники, смотри в, например, международных публикациях №№ WO 93/15199, WO 93/15200, и WO 01/77137, и Европейском патенте № EP 413622, каждый из которых включен в данный документ ссылкой во всей своей полноте.

Вариант(ы), описанный(е) в данном документе могут подвергаться дальнейшим модификациям, часто зависящим от намеченного применения варианта. Такие модификации могут включать дальнейшее изменение аминокислотной последовательности (замещение, вставка и/или делеция аминокислотных остатков), слияние с гетерологическими пептидом(ами) и/или ковалентные модификации. Такие дальнейшие модификации могут производиться до, одновременно с или после аминокислотной(ых) модификацией(ями), раскрытой в данном документе, которые ведут к изменению свойств, например, изменению связывания с рецептором Fc и/или активности ADCC .

Альтернативно или дополнительно, настоящее изобретение охватывает комбинирование аминокислотных модификаций, раскрытых в данном документе, с одной или несколькими дополнительными аминокислотными модификациями, которые меняют связывание с C1q и/или комплемент-зависимую цитотоксическую функцию участка Fc, как было определено in vitro и/или in vivo. Предпочтительно, исходная молекула, представляющая особый интерес в данном документе, является той, которая обычно связывается с C1q и обнаруживает комплемент-зависимую цитотоксичность (CDC). Дальнейшие аминокислотные замещения, описанные в данном документе, будут в целом служить для изменения способности исходной молекулы связываться с C1q и/или модификации ее комплемент-зависимой цитотоксической функции, например, чтобы снизить и, предпочтительно, разрушить эти эффекторные функции. В других вариантах осуществления молекулы, содержащие замещения в одном или нескольких из описанных положений, с улучшенным связыванием C1q и/или комплемент-зависимой цитотоксической (CDC) функцией рассматриваются в данном документе. Например, исходная молекула может быть неспособна связывать C1q и/или опосредовать CDC, и ее можно модифицириовать в соответствиями с указаниями в данном документе так, чтобы она приобрела эти эффекторные функции в дальнейшем. Более того, молекулы с уже существующей способностью к связыванию C1q и необязательно имеющие способность опосредовать CDC можно модифицировать так, чтобы одна или обе эти активности были изменены, например, повышены. В некоторых вариантах осуществления настоящее изобретение охватывает вариантные участки Fc с измененной CDC активностью без изменения связывания C1q. В других вариантах осуществления настоящее изобретение охватывает вариантные участки Fc с измененной CDC активностью и измененным связыванием C1q.

Чтобы получить участок Fc с измененным связыванием C1q и/или комплемент-зависимой цитотоксичской (CDC) функцией, положения аминокислот, которые должны быть модифицированы, обычно выбираются из следующих положений: 270, 322, 326, 327, 329, 331, 333 и 334, где нумерация остатков в тяжелой цепи IgG это та, которая принята в индексации Евросоюза, как в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (199). Эти аминокислотные модификации могут быть скомбинированы с одной или несколькими Fc-модификациями, раскрытыми в данном документе, для получения синергичного или дополнительного эффекта на связывание C1q и/или CDC активность. В других вариантах осуществления настоящее изобретение охватывает варианты Fc с измененным связыванием C1q и/или комплемент-зависимой цитотоксической (CDC) функцией, содержащие замещение аминокислоты в положении 396 на лейцин и в положении 255 на лейцин; или замещение аминокислоты в положении 396 на лейцин и в положении 419 на гистидин; замещение аминокислоты в положении 396 на лейцин и в положении 370 на глутаминовую кислоту; замещение аминокислоты в положении 396 на лейцин и в положении 240 на аланин; замещение аминокислоты в положении 396 на лейцин и в положении 392 на треонин; замещение аминокислоты в положении 247 на лейцин и в положении 421 на лизин. Настоящее изобретение охватывает любые известные модификации участка Fc, которые изменяют связывание C1q и/или комплемент-зависимую цитотоксическую (CDC) функцию, такие как раскрытые в Idusogie et al., 2001, J. Immunol. 166(4) 2571-5; Idusogie et al., J. Immunol. 2000 164(8): 4178-4184; каждый из которых включен в данный документ ссылкой во всей своей полноте.

Как раскрыто выше, настоящее изобретение охватывает участок Fc с измененной эффекторной функцией, например, модифицированным связыванием C1q и/или FcR и, таким образом, измененной CDC активностью и/или ADCC активностью. В специфических вариантах осуществления настоящее изобретение охватывает вариантные участки Fc с улучшенным связыванием C1q и FcγRIII; например, имеющие улучшенные ADCC и CDC активности. В альтернативных вариантах осуществления настоящее изобретение охватывает вариантные участки Fc с пониженной CDC активностью и/или пониженной ADCC активностью. В других вариантах осуществления можно повысить только одну из этих активностей и факультативно также снизить другую активность, например, создать вариантный участок Fc с улучшенной ADCC активностью, но со сниженной CDC активностью, и наоборот.

6.1.1 МУТАНТЫ С ПОВЫШЕННЫМИ ИЗМЕНЕННЫМИ АФФИННОСТЯМИ К FCγRIIIA И/ИЛИ FCγRIIA

Настоящее изобретение охватывает молекулы, содержащие вариантный участок Fc, имеющие одну или несколько аминокислотных модификаций (например, замещений) в одном или нескольких участках, где такие модификации меняют аффинность вариантного участка Fc к активирующему FcγR. В некоторых вариантах осуществления молекулы настоящего изобретения содержат вариантный участок Fc, имеющий одну или несколько аминокислотных модификаций (например, замещений) в одном или нескольких участках, где эти модификации повышают аффинность вариантного участка Fc к FcγRIIIA и/или FcγRIIA по меньшей мере в 2 раза по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В другом специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный участок Fc, имеющий одну или несколько аминокислотных модификаций (например, замещений) в одном или нескольких участках, где эти модификации повышают аффинность вариантного участка Fc к FcγRIIIA и/или FcγRIIA больше, чем в 2 раза по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В других вариантах осуществления настоящего изобретения одна или несколько аминокислотных модификаций повышают аффинность вариантного участка Fc к FcγRIIIA и/или FcγRIIA по меньшей мере в 3 раза, 4 раза, 5 раз, 6 раз, 8 раз или 10 раз по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В других вариантах осуществления настоящего изобретения одна или несколько аминокислотных модификаций снижают аффинность вариантного участка Fc к FcγRIIIA и/или FcγRIIA по меньшей мере в 3 раза, 4 раза, 5 раз, 6 раз, 8 раз или 10 раз по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. Увеличения такой кратности предпочтительно определять с помощью ELISA или поверхностного плазмонного резонанса. В специфическом варианте осуществления одна или несколько аминокислотных модификаций не включают замещения ни в одном из положений 329, 331 или 322 никакой аминокислотой. В определенных вариантах осуществления одна или несколько аминокислотных модификаций не включают замещение аланином ни в одном из положений 256, 290, 298, 312, 333, 334, 359, 360 или 430; лизином в положении 330; треонином в положении 339; метионином в положении 320; серином, аспарагином, аспарагиновой кислотой или глутаминовой кислотой в положении 326; глутамином, глутаминовой кислотой, метионином, гистидином, валином или лейцином в положении 334. В еще одном специфическом варианте осуществления одна или несколько аминокислотных модификаций не включают или сами не являются заместителями ни в одном из положений 280, 290, 300, 294 или 295. В еще одном более специфическом варианте осуществления, одна или несколько аминокислотных модификаций не включают сами не являются заместителями в положении 300 лейцином или изолейцином; в положении 295 лизином; в положении 294 аспарагином; в положении 298 валином; аспарагиновой кислотой, пролином, аспарагином или валином; в положении 280 гистидином, глутамином или тирозином; в положении 290 серином, глицином, треонином или тирозином.

В другом специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный участок Fc, где указанный вариантный участок Fc содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа так, что указанный полипептид специфически связывается с FcγRIIA через свой участок Fc с более высокой аффинностью, чем соответствующая молекула, содержащая участок Fc дикого типа, связывает FcγRIIA при условии, что указанный вариантный участок Fc не имеет аланина ни в одном из следующих положений 256, 290, 326, 255, 258, 267, 272, 276, 280, 283, 285, 286, 331, 337, 268, 272 или 430; аспарагина в положении 268; глутамина в положении272; глутамина, серина или аспарагиновой кислоты в положении 286; серина в положении 290; метионина, глутамина, глутаминовой кислоты или аргинина в положении 320; глутаминовой кислоты в положении 322; серина, глутаминовой кислоты или аспарагиновой кислоты в положении 326; лизина в положении 330; глутамина в положении 335; или метионина в положении 301. В специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный участок Fc, имеющий одну или несколько аминокислотных модификаций (например, замещений) в одном или нескольких участках, где эти модификации повышают аффинность вариантного участка Fc к FcγRIIA по меньшей мере в 2 раза по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В другом специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный участок Fc, содержащий одну или несколько аминокислотных модификаций (например, замещений) в одном или нескольких участках, где эти модификации повышают аффинность вариантного участка Fc к FcγRIIA больше, чем в 2 раза по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа. В других вариантах осуществления настоящего изобретения одна или несколько аминокислотных модификаций повышают аффинность вариантного участка Fc к FcγRIIA по меньшей мере в 3 раза, 4 раза, 5 раз, 6 раз, 8 раз или 10 раз по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа.

В специфическом варианте осуществления настоящее изобретение охватывает молекулы, предпочтительно полипептиды, и более предпочтительно иммуноглобулины (например, антитела), содержащие вариантный участок Fc, имеющий одну или несколько аминокислотных модификаций (например, замещений, но также сюда включаются вставки или делеции), которые повышают аффинность вариантного участка Fc к FcγRIIIA и/или FcγRIIA по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, по меньшей мере на 100%, по меньшей мере на 150%, и по меньшей мере на 200% по сравнению с соответствующей молекулой, содержащей участок Fc дикого типа.

В специфическом варианте осуществления одна или несколько аминокислотных модификаций, которые повышают аффинность вариантного участка Fc к одному или нескольким активирующим FcγRs, содержат замещение в положении 347 гистидином и в положении 339 валином; или замещение в положении 425 изолейцином и в положении 215 фенилаланином; или замещение в положении 408 изолейцином, в положении 215 изолейцином, и в положении 125 лейцином; или замещение в положении 385 глутаминовой кислотой и в положении 247 гистидином; или замещение в положении 348 метионином, в положении 334 аспарагином, в положении 275 изолейцином, в положении 202 метионином и в положении 147 треонином; или замещение в положении 275 изолейцином, в положении 334 аспарагином и в положении 348 метионином; или замещение в положении 279 лейцином и в положении 395 серином; или замещение в положении 246 треонином и в положении 319 фенилаланином; или замещение в положении 243 изолейцином и в положении 379 лейцином; или замещение в положении 243 лейцином, в положении 255 лейцином и в положении 318 лизином; или замещение в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином; или замещение в положении 288 метионином и в положении 334 глутаминовой кислотой; или замещение в положении 334 глутаминовой кислотой и в положении 380 аспарагиновой кислотой; или замещение в положении 256 серином, в положении 305 изолейцином, в положении 334 глутаминовой кислотой и в положении 390 серином; или замещение в положении 335 аспарагином, в положении 370 глутаминовой кислотой, в положении 378 валином, в положении 394 метионином и в положении 424 лейцином; или замещение в положении 233 аспарагиновой кислотой и в положении 334 глутаминовой кислотой; или замещение в положении 334 глутаминовой кислотой, в положении 359 аспарагином, в положении 366 серином и в положении 386 аргинин; или замещение в положении 246 треонином и в положении 396 гистидином; или замещение в положении 268 аспарагиновой кислотой и в положении 318 аспарагиновой кислотой; или замещение в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином; или замещение в положении 244 гистидином, в положении 358 метионином, в положении 379 метионином, в положении 384 лизином и в положении 397 метионином; или замещение в положении 217 серином, в положении 378 валином и в положении 408 аргинином; или замещение в положении 247 лейцином, в положении 253 аспарагином и в положении 334 аспарагином; или замещение в положении 246 изолейцином и в положении 334 аспарагином; или замещение в положении 320 глутаминовой кислотой и в положении 326 глутаминовой кислотой; или замещение в положении 375 цистеином и в положении 396 лейцином; или замещение в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином; или замещение в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином и в положении 396 лейцином; или замещение в положении 234 лейцином, в положении 292 пролином и в положении 300 лейцином; или замещение в положении 234 лейцином, в положении 292 пролином и в положении 396 лейцином; или замещение в положении 234 лейцином, в положении 292 пролином и в положении 305 изолейцином; или замещение в положении 234 лейцином и в положении 292 пролином; или замещение в положении 234 лейцином; или замещение в положении 247 лейцином, в положении 270 глутаминовой кислотой и в положении 421 лизином. Примеры других замещений аминокислот, которые приводят к повышенной аффинности к FcγRIIIA in vitro, раскрываются ниже и обобщены в Таблице 3.

Настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 243 изолейцином и в положении 379 лейцином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 5 раз выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 243 лейцином и в положении 255 лейцином так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1 раз выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 288 метионином и в положении 334 глутаминовой кислотой, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 3 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 316 аспарагиновой кислотой, в положении 378 валином и в положении 399 глутаминовой кислотой, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления, настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 315 изолейцином, в положении 379 метионином и в положении 399 глутаминовой кислотой, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1 раз выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 243 изолейцином, в положении 379 лейцином и в положении 420 валином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 2,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 247 лейцином и в положении 421 лизином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 3 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положение 392 треонином и в положении 396 лейцином так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 4,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 293 валином, в положении 295 глутаминовой кислотой и в положении 327 треонином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 1,5 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 268 аспарагином и в положении 396 лейцином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 2 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA. В специфическом варианте осуществления настоящее изобретение охватывает молекулу, содержащую вариантный Fc-участок, где указанный вариантный Fc-участок содержит замену в положении 319 фенилаланином, в положении 352 лейцином и в положении 396 лейцином, так, чтобы указанная молекула связывала FcγRIIIA с аффинностью приблизительно в 2 раза выше, чем аффинность, с которой сравнимая молекула, содержащая Fc-участок дикого типа, связывает FcγRIIIA, как установлено с помощью испытания ELISA.

В специфическом варианте осуществления настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, где указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 396 гистидином. В специфическом варианте осуществления настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, где указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 248 метионином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью, сходной со сравнимым полипептидом, содержащим Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 392 аргинином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью, сходной со сравнимым полипептидом, содержащим Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 315 изолейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью, сходной со сравнимым полипептидом, содержащим Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 132 изолейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью, сходной со сравнимым полипептидом, содержащим Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 162 валином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 396 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 379 метионином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 219 тирозином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 282 метионином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 401 валином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 222 аспарагином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 334 глутаминовой кислотой. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 377 фенилаланином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 334 изолейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислота модификация содержит замену в положении 247 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 326 глутаминовой кислотой. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислота модификация содержит замену в положении 372 тирозином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 224 лейцином.

Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 275 тирозином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 398 валином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 334 аспарагином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 400 пролином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 407 изолейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 372 тирозином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью, сходной со сравнимым полипептидом, содержащим Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 366 аспарагином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более низкой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 414 аспарагином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более низкой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 225 серином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более низкой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 377 аспарагином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 243 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 292 пролином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 300 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 305 изолейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 396 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с более высокой аффинностью, чем сравнимый полипептид, содержащий Fc-участок дикого типа, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 273 фенилаланином.

В специфическом варианте осуществления, настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью приблизительно в 2 раза выше, чем сравнимый полипептид, содержащий Fc-участок дикого типа, как установлено с помощью испытания ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 379 метионином. В другом специфическом варианте осуществления настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, чтобы указанный полипептид специфично связывал FcγRIIIA с аффинностью приблизительно в 1,5 раза выше, чем сравнимый полипептид, содержащий Fc-участок дикого типа, как установлено с помощью испытания ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 248 метионином.

В некоторых вариантах осуществления молекулы настоящего изобретения имеют измененную аффинность к FcγRIIIA и/или FcγRIIA, как было определено, применяя испытания in vitro (биохимические или иммунологические испытания), известные на данном уровне техники, для определения взаимодействий Fc-FcγR, т.е., специфического связывания Fc-участка с FcγR, включая, но без ограничения, испытания ELISA, испытания поверхностного плазмонного резонанса и испытания иммунопреципитации (См. Раздел 6.2.5.1). Предпочтительно связывающие свойства этих молекул с измененными аффинностями для активирующих рецепторов FcγR также коррелируют с их активностью, как определено in vitro функциональными анализами для определения одной или нескольких FcγR опосредованных функций эффекторных клеток (См. Раздел 6.2.7), например, молекулы с вариантными Fc-участками с повышенной аффинностью к FcγRIIIA имеют повышенную ADCC активность. В наиболее предпочтительных вариантах осуществления молекулы настоящего изобретения, которые имеют измененные свойства связывания по отношению к активирующему Fc рецептору, например, FcγRIIIA в испытании in vitro также имеет измененное свойство связывания в моделях in vivo (таких, как описанные и раскрытые в данном документе). Однако настоящее изобретение не исключает молекулы настоящего изобретения, которые не проявляют изменения связывания FcγR в анализах in vitro, но проявляют желаемый фенотип in vivo.

6.1.2 МУТАНТЫ С ПОВЫШЕННОЙ АФФИННОСТЬЮ К FcγRIIIA И ПОНИЖЕННОЙ АФФИННОСТЬЮ К FcγRIIB ИЛИ СОВСЕМ НЕ ОБЛАДАЮЩИЕ АФФИННОСТЬЮ К FcγRIIB

В специфическом варианте осуществления молекулы настоящего изобретения содержат вариантный Fc-участок, имеющий одну или несколько аминокислотных модицикаций (т.е., замен) в одном или нескольких участках, при этом одна или несколько модификаций повышают аффинность вариантного Fc-участка к FcγRIIIA и снижают аффинность вариантного Fc-участка к FcγRIIB по сравнению с сопоставимой молекулой, содержащей Fc-участок дикого типа, который связывает FcγRIIIA и FcγRIIB с аффинностью дикого типа. В определенном варианте осуществления одна или несколько аминокислотных модификаций не включают или не являются исключительно заменой аланином в любом из положений 256, 298, 333, 334, 280, 290, 294, 298 или 296; или замены в положении 298 аспарагином, валином, аспарагиновой кислотой или пролином; или замены в положении 290 серином. В определенных аминовоплощениях одна или несколько аминокислотных модификаций повышают аффинность вариантного Fc-участка к FcγRIIIA по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, по меньшей мере на 100%, по меньшей мере на 200%, по меньшей мере на 300%, по меньшей мере на 400% и снижают аффинность вариантного Fc-учаска к FcγRIIB по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, по меньшей мере на 100%, по меньшей мере на 200%, по меньшей мере на 300%, по меньшей мере на 400%.

В специфическом варианте осуществления молекула настоящего изобретения, содержащая вариантный Fc-участок с повышенной аффинностью к FcγRIIIA и пониженной аффинностью или не обладающая аффинностью к FcγRIIB, как было определено на основании испытания ELISA и/или испытания на основе ADCC с использованием антитела ch-4-4-20, или испытания поверхностного плазмонного резонанса с использованием химерного антитела 4D5, несущего вариантный Fc-участок, содержит замену в положении 275 изолейцином, в положении 334 аспарагином и в положении 348 метионином; или замену в положение 279 лейцином и в положении 395 сериномом; или замену в положении 246 треонином и в положении 319 фенилаланином; или замену в положении 243 лейцином, в положении 255 лейцином и в положении 318 лизином; или замену в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином; или замену в положении 334 глутаминовой кислотой и в положении 380 аспарагиновой кислотой; или замену в положении 256 серином, в положении 305 изолейцином, в положении 334 глутаминовой кислотой и в положении 390 серином; или замену в положении 335 аспарагином, в положении 370 глутаминовой кислотой, в положении 378 валином, в положении 394 метионином и в положении 424 лейцином; или замену в положении 233 аспарагиновой кислотой и в положении 334 глутаминовой кислотой; или замену в положении 334 глутаминовой кислотой, в положении 359 аспарагином, в положении 366 серином и в положении 386 аргинином; или замену в положении 312 глутаминовой кислотой, в положении 327 аспарагином и в положении 378 серином; или замену в положении 288 аспарагином и в положении 326 аспарагином; или замену в положении 247 лейцином и в положении 421 лизином; или замену в положении 298 аспарагином и в положении 381 аргинином; или замену в положении 280 глутаминовой кислотой, в положении 354 фенилаланином, в положении 431 аспарагиновой кислотой и в положении 441 изолейцином; или замену в положении 255 глутамином и в положении 326 глутаминовой кислотой; или замену в положении 218 аргинином, в положении 281 аспарагиновой кислотой и в положении 385 аргинином; или замену в положении 247 лейцином, в положении 330 треонином и в положении 440 глицином; или замену в положении 284 аланином и в положении 372 лейцином; или замену в положении 335 аспарагином, в положении 387 серином и в положении 435 глутамином; или замену в положении 247 лейцином, в положении 431 валином и в положении 442 фенилаланином; или замену в положении 243 лейцином, в положении 292 пролином, в положении 305 изолейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином, и в положении 305 изолейцином; или замену в положении 292 пролином, в положении 305 изолейцином и в положении 396 лейцином; или замену в положении 243 лейцином и в положении 292 пролином; или замену в положении 292 пролином; или замену в положении 243 лейцином, в положении 292 пролином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином; или замену в положении 243 лейцином.

В специфическом варианте осуществления молекула настоящего изобретения, содержащая вариантный Fc-участок с повышенной аффинностью к FcγRIIIA и пониженной аффинностью или не обладающий аффинностью к FcγRIIB, как было определено на основании испытания ELISA и/или испытания на основании ADCC с использованием антитела ch-4-4-20, несущего вариантный Fc-участок, содержит замену в положении 379 метионином; в положении 219 тирозином; в положении 282 метионином; в положении 401 валином; в положении 222 аспарагином; в положении 334 изолейцином; в положении 334 глутаминовой кислотой; в положении 275 тирозином; в положении 398 валином. В еще одном конкретном варианте осуществления молекула настоящего изобретения, содержащая вариантный Fc-участок с повышенной аффинностью к FcγRIIIA и пониженной аффинностью или не обладающий аффинностью к FcγRIIB, как было определено на основании испытания ELISA и/или на основании испытания ADCC с использованием антитела ch-4-4-20 или испытания поверхностного плазмонного резонанса с использованием химерного антитела 4D5, несущего вариантный Fc-участок, содержит замену в положении 243 лейцином; в положении 292 пролином; и в положении 300 лейцином.

Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 3 раза ниже, чем сравнимый полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 10-15 раз ниже, чем сравнимый полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 316 аспарагиновой кислотой, в положении 378 валином и в положении 399 глутаминовой кислотой. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 10 раз ниже, чем сравнимый полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 315 изолейциномом, в положении 379 метионином и в положении 399 глутаминовой кислотой. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 7 раз ниже, чем соответствующий полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 243 изолейциномом, в положении 379 лейцином и в положении 420 валином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 3 раза ниже, чем соответствующий полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислоная модификация содержит замену в положении 392 треонином и в положении 396 лейцином. Настоящее изобретение охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 5 раз ниже, чем соответствующий полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 268 аспарагином и в положении 396 лейцином. Настоящее изобретение также охватывает изолированный полипептид, содержащий вариантный Fc-участок, где указанный вариантный Fc-участок содержит по меньшей мере одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, так, что указанный полипептид специфично связывает FcγRIIB с аффинностью приблизительно в 2 раза ниже, чем соответствующий полипептид, содержащий Fc-участок дикого типа, как было определено испытанием ELISA, при этом указанная по меньшей мере одна аминокислотная модификация содержит замену в положении 319 фенилаланином, в положении 352 лейцином и в положении 396 лейцином.

6.1.3 МУТАНТЫ С ПОВЫШЕННОЙ АФФИННОСТЬЮ К FcγRIIIA И FcγRIIB

Настоящее изобретение охватывает молекулы, содержащие вариантные Fc-участки, имеющие одну или несколько аминокислотных модификаций, модификации которых повышают аффинность вариантного Fc-участка к FcγRIIIA и FcγRIIB по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, по меньшей мере на 100%, по меньшей мере на 200%, по меньшей мере на 300%, по меньшей мере на 400% и снижают аффинность вариантного Fc-участка к FcγRIIB по по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, по меньшей мере на 100%, по меньшей мере на 200%, по меньшей мере на 300%, по меньшей мере на 400%. В специфическом варианте осуществления молекула настоящего изобретения, содержащая вариантный Fc-участок с повышенной аффинностью к FcγRIIIA и повышенной аффинностью к FcγRIIB (как было определено на основании испытания ELISA и/или на основании испытания ADCC с использованием антитела ch-4-4-20 или испытания поверхностного плазмонного резонанса с использованием химерного антитела 4D5, несущего вариантный Fc-участок, описанный в данном документе), содержит замену в положении 415 изолейцином и в положении 251 фенилаланином; или замену в положении 399 глутаминовой кислотой, в положении 292 лейцином и в положении 185 метионином; или замену в положении 408 изолейцином, в положении 215 изолейцином и в положении 125 лейцином; или замену в положении 385 глутаминовой кислотой и в положении 247 гистидином; или замену в положении 348 метионином, в положении 334 аспарагином, в положении 275 изолейцином, в положении 202 метионином и в положении 147 треонином; или замену в положении 246 треонином и в положении 396 гистидином; или замену в положении 268 аспарагиновой кислотой и в положении 318 аспарагиновой кислотой; или замену в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином; или замену в положении 244 гистидином, в положении 358 метионином, в положении 379 метионином, в положении 384 лизином и в положении 397 метионином; или замену в положении 217 серином, в положении 378 валином и в положении 408 аргинином; или замену в положении 247 лейцином, в положении 253 аспарагином и в положении 334 аспарагином; или замену в положении 246 изолейцином и в положении 334 аспарагином; или замену в положении 320 глутаминовой кислотой и в положении 326 глутаминовой кислотой; или замену в положении 375 цистеином и в положении 396 лейцином; или замену в положении 343 серином, в положении 353 лейцином, в положении 375 изолейцином, в положении 383 аспарагином; или замену в положении 394 метионином и в положении 397 метионином; или замену в положении 216 аспарагиновой кислотой, в положении 345 лизином и в положении 375 изолейцином; или замену в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином; или замену в положении 247 лейцином и в положении 389 глицином; или замену в положении 222 аспарагином, в положении 335 аспарагином, в положении 370 глутаминовой кислотой, в положении 378 валином и в положении 394 метионином; или замену в положении 316 аспарагиновой кислотой, в положении 378 валином и в положении 399 глутаминовой кислотой; или замену в положении 315 изолейцином, в положении 379 метионином и в положении 394 метионином; или замену в положении 290 треонином и в положении 371 аспарагиновой кислотой; или замену в положении 247 лейцином и в положении 398 глутамином; или замену в положении 326 глутамином; в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином; или замену в положении 247 лейцином и в положении 377 фенилаланином; или замену в положении 378 валином, в положении 390 изолейцином и в положении 422 изолейцином; или замену в положении 326 глутаминовой кислотой и в положении 385 глутаминовой кислотой; или замену в положении 282 глутаминовой кислотой, в положении 369 изолейцином и в положении 406 фенилаланином; или замену в положении 397 метионином; в положении 411 аланином и в положении 415 аспарагином; или замену в положении 223 изолейцином, в положении 256 серином и в положении 406 фенилаланином; или замену в положении 298 аспарагином и в положении 407 аргинином; или замену в положении 246 аргинином, в положении 298 аспарагином и в положении 377 фенилаланином; или замену в положении 235 пролином, в положении 382 метионином, в положении 304 глицином, в положении 305 изолейцином и в положении 323 изолейцином; или замену в положении 247 лейцином, в положении 313 аргинином и в положении 388 глицином; или замену в положении 221 тирозином, в положении 252 изолейцином, в положении 330 глицином, в положении 339 треонином, в положении 359 аспарагином, в положении 422 изолейцином и в положении 433 лейцином; или замену в положении 258 аспарагиновой кислотой и в положении 384 лизином; или замену в положении 241 лейцином и в положении 258 глицином; или замену в положении 370 аспарагином и в положении 440 аспарагином; или замену в положении 317 аспарагином и делецию в положении 423; или замену в положении 243 изолейцином, в положении 379 лейцином и в положении 420 валином; или замену в положении 227 серином и в положении 290 глутаминовой кислотой; или замену в положении 231 валином, в положении 386 гистидином и в положении 412 метионином; или замену в положении 215 пролином, в положении 274 аспарагином, в положении 287 глицином, в положении 334 аспарагином, в положении 365 валином и в положении 396 лейцином; или замену в положении 293 валином, в положении 295 глутаминовой кислотой и в положении 327 треонином; или замену в положении 319 фенилаланином, в положении 352 лейцином и в положении 396 лейцином; или замену в положении 392 треонином и в положении 396 лейцином; замену в положении 268 аспарагином и в положении 396 лейцином; или замену в положении 290 треонином, в положении 390 изолейцином и в положении 396 лейцином; или замену в положении 326 изолейцином и в положении 396 лейцином; или замену в положении 268 аспарагиновой кислотой и в положении 396 лейцином; или замену в положении 210 метионином и в положении 396 лейцином; или замену в положении 358 пролином и в положении 396 лейцином; или замену в положении 288 аргинином, в положении 307 аланином, в положении 344 глутаминовой кислотой и в положении 396 лейцином; или замену в положении 273 изолейцином, в положении 326 глутаминовой кислотой, в положении 328 изолейцином и в положении 396 лейцином; или замену в положении 326 изолейцином, в положении 408 аспарагином и в положении 396 лейцином; или замену в положении 334 аспарагином и в положении 396 лейцином; или замену в положении 379 метионином и в положении 396 лейцином; или замену в положении 227 серином и в положении 396 лейцином; или замену в положении 217 серином и в положении 396 лейцином; или замену в положении 261 аспарагином, в положении 210 метионином и в положении 396 лейцином; или замену в положении 419 гистидином и в положении 396 лейцином; или замену в положении 370 глутаминовой кислотой и в положении 396 лейцином; или замену в положении 242 фенилаланином и в положении 396 лейцином; или замену в положении 255 лейцином и в положении 396 лейцином; или замену в положении 240 аланином и в положении 396 лейцином; или замену в положении 250 серином и в положении 396 лейцином; или замену в положении 247 серином и в положении 396 лейцином; или замену в положении 410 гистидином и в положении 396 лейцином; или замену в положении 419 лейцином и в положении 396 лейцином; или замену в положении 427 аланином и в положении 396 лейцином; или замену в положении 258 аспарагиновой кислотой и в положении 396 лейцином; или замену в положении 384 лизином и в положении 396 лейцином; или замену в положении 323 изолейцином и в положении 396 лейцином; или замену в положении 244 гистидином и в положении 396 лейцином; или замену в положении 305 лейцином и в положении 396 лейцином; или замену в положении 400 фенилаланином и в положении 396 лейцином; или замену в положении 303 изолейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 305 изолейцином, в положении 378 аспарагиновой кислотой, в положении 404 серином и в положении 396 лейцином; или замену в положении 290 глутаминовой кислотой, в положении 369 аланином, в положении 393 аланином и в положении 396 лейцином; или замену в положении 210 аспарагином, в положении 222 изолейцином, в положении 320 метионином и в положении 396 лейцином; или замену в положении 217 серином, в положении 305 изолейцином, в положении 309 лейцином, в положении 390 гистидином и в положении 396 лейцином; или замену в положении 246 аспарагином; в положении 419 аргинином и в положении 396 лейцином; или замену в положении 217 аланином, в положении 359 аланином и в положении 396 лейцином; или замену в положении 215 изолейцином, в положении 290 валином и в положении 396 лейцином; или замену в положении 275 лейцином, в положении 362 гистидином, в положении 384 лизином и в положении 396 лейцином; или замену в положении 334 аспарагином; или замену в положении 400 пролином; или замену в положении 407 изолейцином; или замену в положении 372 тирозином; или замену в положении 366 аспарагином; или замену в положении 414 аспарагином; или замену в положении 352 лейцином; или замену в положении 225 серином; или замену в положении 377 аспарагином; или замену в положении 248 метионином; или замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином и в положении 396 лейцином; или замену в положении 243 лейцином и в положении 396 лейцином; или в положении 292 пролином и в положении 305 изолейцином.

6.1.4 МУТАНТЫ, НЕ СВЯЗЫВАЮЩИЕ КАКОЙ-ЛИБО FcγR

В некоторых вариантах осуществления настоящее изобретение включает молекулы, содержащие вариантный Fc-участок, где указанный вариантный Fc-участок содержит, по меньшей мере, одну аминокислотную модификацию по сравнению с Fc-участком дикого типа, вариантный Fc-участок которого не связывает ни один FcγR, как определяется известными стандартными испытаниями, известными в данной области и описанные в данном документе, по сравнению со сравниваемой молекулой, содержащей Fc-участок дикого типа. В определенном варианте осуществления одна или несколько аминокислотных модификаций, которые отменяют связывание для всех FcγRs, содержат замену в положении 232 серином и в положении 304 глицином; или замену в положении 269 лизином, в положении 290 аспарагином, в положении 311 аргинином и в положении 433 тирозином; или замену в положении 252 лейцином; или замену в положении 216 аспарагиновой кислотой, в положении 334 аргинином и в положении 375 изолейцином; или замену в положении 247 лейцином и в положении 406 фенилаланином, или замену в положении 335 аспарагином, в положении 387 серином и в положении 435 глутамином; или замену в положении 334 глутаминовой кислотой, в положении 380 аспарагиновой кислотой и в положении 446 валином; или замену в положении 303 изолейцином, в положении 369 фенилаланином и в положении 428 лейцином; или замену в положении 251 фенилаланином и в положении 372 лейцином; или замену в положении 246 глутаминовой кислотой, в положении 284 метионином и в положении 308 аланином; или замену в положении 399 глутаминовой кислотой и в положении 402 аспарагиновой кислотой; или замену в положении 399 глутаминовой кислотой и в положении 428 лейцином.

6.1.5 МУТАНТЫ С ИЗМЕНЕННЫМИ FcγR-ОПОСРЕДОВАННЫМИ ЭФФЕКТОРНЫМИ ФУНКЦИЯМИ

Настоящее изобретение включает иммуноглобулинсодержащие Fc-варианты с измененными эффекторными функциями. В некоторых вариантах осуществления иммуноглобулины, содержащие Fc-варианты, опосредуют эффекторную функцию более эффективно в присутствии эффекторных клеток, что определено с использованием известных в данной области испытаний и приведено в данном документе в качестве примеров. В других вариантах осуществления иммуноглобулины, содержащие Fc-варианты, опосредует эффекторную функцию менее эффективно в присутствии эффекторных клеток, что определено с использованием известных в данной области испытаний и приведено в данном документе в качестве примеров. В определенных вариантах осуществления Fc-вариант настоящего изобретения может быть объединен с другими известными Fc-модификациями, которые изменяют эффекторную функцию, так, чтобы эта комбинация имела добавочный, синергетический эффект. Fc-варианты настоящего изобретения обладают измененной эффекторной функцией in vitro и/или in vivo.

В определенном варианте осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют повышенную FcγR-опосредованную эффекторную функцию, что определено с помощью испытаний ADCC активности, описанных в данном документе. Примеры эффекторных функций, которые могут быть опосредованы молекулами настоящего изобретения, включают без ограничения C1q связывание, комплемент-зависимую цитотоксичность, антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC), фагоцитоз и др. Эффекторные функции молекул настоящего изобретения могут быть испытаны с использованием стандартных способов, известных на данном уровне техники, примеры которых раскрыты в разделе 6.2.6.

В определенном варианте осуществления, иммуноглобулины настоящего изобретения, содержащие вариантный Fc-участок с повышенной аффинностью к FcγRIIIA и/или FcγRIIA опосредуют антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC) в 2 раза более эффективно, чем иммуноглобулин, содержащий Fc-участок дикого типа. В других вариантах осуществления иммуноглобулины настоящего изобретения, содержащие вариантный Fc-участок с повышенным аффинностьм к FcγRIIIA и/или FcγRIIA опосредуют антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC) по меньшей мере в 4 раза, по меньшей мере в 8 раз, по меньшей мере в 10 раз, по меньшей мере в 100 раз, по меньшей мере в 1000 раз, по меньшей мере в 104 раз, по меньшей мере в 105 раз более эффективно, чем иммуноглобулин, содержащий Fc-участок дикого типа. В другом определенном варианте осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют измененную C1q связывающую активность. В некоторых вариантах осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют по меньшей мере в 2 раза, по меньшей мере в 4 раза, по меньшей мере в 8 раз, по меньшей мере в 10 раз, по меньшей мере в 100 раз, по меньшей мере в 1000 раз, по меньшей мере в 104 раз, по меньшей мере в 105 раз более высокую C1q связывающую активность, чем иммуноглобулин, содержащий Fc-участок дикого типа. Еще в одном определенном варианте осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют измененную комплемент-зависимую цитотоксичность. Еще в одном определенном варианте осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют повышенную комплемент-зависимую цитотоксичность по сравнению с иммуноглобулином, содержащим Fc-участок дикого типа. В некоторых вариантах осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют по меньшей мере в 2 раза, по меньшей мере в 4 раза, по меньшей мере в 8 раз, по меньшей мере в 10 раз, по меньшей мере в 100 раз, по меньшей мере в 1000 раз, по меньшей мере в 104 раз, по меньшей мере в 105 раз более высокую комплемент-зависимую цитотоксичность, чем иммуноглобулин, содержащий Fc-участок дикого типа.

В определенных вариантах осуществления Fc-варианты настоящего изобретения могут быть объединены с или включать в себя любой из Fc-вариантов, предварительно определенных авторами изобретения для модулирования эффекторной функции, как описано в публикациях патентных заявок США 2005/0037000 и 2005/0064514, и публикации WO 04/063351, каждая из которых включена в данный документ посредством ссылок в полном объеме. Примеры таких Fc-вариантов, предварительно идентифицированных авторами, приведены в Таблицах 6 и 7 ниже.

В других вариантах осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют увеличенную фагоцитарную активность по сравнению с иммуноглобулином, содержащим Fc-участок дикого типа, как определено стандартными испытаниями, известными специалистам в данной области или раскрытыми в данном документе. В некоторых вариантах осуществления иммуноглобулины настоящего изобретения с повышенной аффинностью к FcγRIIIA и/или FcγRIIA имеют по меньшей мере в 2 раза, по меньшей мере в 4 раза, по меньшей мере в 8 раз, по меньшей мере в 10 раз более высокую фагоцитарную активность по отношению к иммуноглобулину, содержащему Fc-участок дикого типа.

Таблица 6
Краткое описание ADCC активности мутантов в ch4D5
Fc вариант ADCC
Метка Станд. Вариант аминокислоты 1 мкг/мл 0,5 мкг/мл
% специфического лизиса Нормализовано % специфического лизиса Нормализовано
MGFc-27 2C4 G316D, A378V, D399E 33% 2,24 22% 3,60
MGFc-31 3B9 P247L, N421K 30% 2,05 17% 2,90
MGFc-10 1E1 K288N, A330S, P396L 24% 1,66 10% 1,67
MGFc-28 2C5 N315I, V379M, T394M 20% 1,37 10% 1,69
MGFc-29 3D11 F243I, V379L, G420V 20% 1,35 7% 1,17
CH4-4-20 (P54008) 15% 1,00 6 1,00
MGFc-35 3D2 R255Q, K326E 11% 0,79 3% 0,53
MGFc-36 3D3 K218R, G281D, G385R 10% 0,67 5% 0,78
MGFc-30 3A8 F275Y 9% 0,64 2% 0,37
MGFc-32 3C8 D280E, S354F, A431D,L441I 9% 0,62 4% 0,75
MGFc-33 3C9 K317N, F423Δ 3% 0,18 -1% -0,22
MGFc-34 3B10 F421L, E258G -1% -0,08 -4% -0,71
MGFc-26 D265A 1% 0,08 -3% -0,45

Таблица 7: КРАТКОЕ ОПИСАНИЕ МУТАНТОВ

Fc
вариант
Изменения аминокислоты FcR3A,
K D /K off
FcR2B,
K D /K off
ELISA
IIIA
связывание
ELISA
IIB
связывание
Фагоцитоз
(мутант/дикий тип)
4-4-20
ADCC
(мутант/дикий тип)
Анти-HER2
ADCC
(мутант/дикий тип)
Wt ни сколько 198/0,170 94/,094 1 1 1 1 1
MGFc 5 V379M 160/0,167 70/0,10 2X N/C 0,86 2,09 1,77
MGFc 9 P243I, V379L 99,7/0,105 120/0,113 1,5X уменьшено ? 2,25 2,04
MGFc 10 K288N, A330S, P396L 128/0,115 33,4/0,050 5X 3X 1,2 2,96 2,50
MGFc 11 F243L, R255L 90/0,075 74,7/0,09 1x уменьшено 0,8 2,38 1,00
MGFc13 K334E, T359N, T366S 55,20,128 72/0,11 1,5X N/C [ 1,57 3,67
MGFc 14 K288M, K334E 75,4/0,1 95,6/0,089 3X уменьшено [ 1,74
MGFc 23 K334E, R292L 70,2/0,105 108/0,107 [ 2,09 1,6
MGFc 27 G316D, A378V, D399E 72/0,117 46/0,06 1,5X 14X 1,4 3,60 6,88
MGFc 28 N315I, A379M, D399E 1X 9X 1,37 1,69 1,00
MGFc 29 P243I, V379L, G420V 108/0,082 93,4/,101 2,5X 7X 0,93 1,17 1,00
MGFc 31 P247L, N421K 62/0,108 66/0,065 3X N/C 1,35 2,90 1,00
MGFc 37 K248M 154/0,175 100/0,091 1,4X уменьшено 0,98 3,83 0,67
MGFc 38 K392T, P396L 84/0,104 50/0,041 4,5X 2,5X 1,4 3,07 2,50
MGFc 39 E293V, Q295E, A327T 195/0,198 86/0,074 1,4X уменьшено 1,5 4,29 0,50
MGFc 40 K248M 180/0,186 110/0,09 1,4X уменьшено 1,14 4,03
MGFc 41 H268N, P396L 178/0,159 46,6/0,036 2,2X 4,5X 1,96 2,24 0,67
MGFc 43 Y319F, P352L, P396L 125/0,139 55,7/0,041 3,5X 2X 1,58 1,09

В определенном варианте осуществления настоящее изобретение включает иммуноглобулин, содержащий вариантный Fc-участок с одной или несколькими аминокислотными модификациями, с повышенной аффинностью к FcγRIIIA и/или FcγRIIA, так, что иммуноглобулин обладает повышенной эффекторной функцией, например, антител-зависимой клеточно-опосредованной цитотоксичностью или фагоцитозом. В особом варианте осуществления одна или несколько аминокислотных модификаций, которые увеличивают аффинность вариантного Fc-участка к FcγRIIIA и/или FcγRIIA и увеличивают ADCC активность иммуноглобулина, содержат замену в положении 379 метионином; или a замену в положении 243 изолейцином и в положении 379 лейцином; или замену в положении 288 аспарагином, в положении 330 серином и в положении 396 лейцином; или замену в положении 243 лейцином и в положении 255 лейцином; или замену в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином; или замену в положении 288 метионином и в положении 334 глутаминовой кислотой; или замещении в положение 334 глутаминовой кислотой и в положении 292 лейцином; или замену в положении 316 аспарагиновой кислотой, в положении 378 валином и в положении 399 глутаминовой кислотой; или замену в положении 315 изолейцином, в положении 379 метионином и в положении 399 глутаминовой кислотой; или замену в положении 243 изолейцином, в положении 379 лейцином и в положении 420 валином; или замену в положении 247 лейцином и в положении 421 лизином; или замену в положении 248 метионином; или замену в положении 392 треонином и в положении 396 лейцином; или замену в положении 293 валином, в положении 295 глутаминовой кислотой и в положении 327 треонином; или замену в положении 268 аспарагином и в положении 396 лейцином; или замену в положении 319 фенилаланином, в положении 352 лейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином, в положение 300 лейцином и в положении 396 лейцином; или замену в положении 243 лейцином, в положении 292 пролином и в положении 300 лейцином.

В другом определенном варианте осуществления одна или несколько аминокислотных модификаций, которые увеличивают ADCC активность иммуноглобулина, являются одной из мутаций, перечисленных ниже в Таблице 8.

ТАБЛИЦА 8. АМИНОКИСЛОТНАЯ МОДИФИКАЦИЯ, КОТОРАЯ ПОВЫШАЕТ ADCC

E333A, K334A T250S, P396L
R292L, K334E P247S, P396L
V379M K290E, V369A, T393A, P396L
S219Y K210N, K222I, K320M, P396L
V282M L410H, P396L
K222N Q419L,P396L
F243I,V379L V427A, P396L
F243L,R255L,E318K P217S, V305I, I309L, N390H, P396L
K334I E258D, P396L
K334E,T359N,T366S N384K, P396L
K288M, K334E V323I, P396L
K288N, A330S,P396L K246N, Q419R, P396L
K326E V273I, K326E, L328I, P396L
G316D,A378V,D399E K326I, S408N, P396L
N315I,V379M,T394M K334N, P396L
F243I,V379L,G420V V379M, P396L
E293V,Q295E,A327T P227S, P396L
Y319F,P352L,P396L P217S, P396L
K392T,P396L K261N, K210M, P396L
K248M Q419H, P396L
H268N,P396L K370E, P396L
K290T, N390I, P396L L242F, P396L
K326I, P396L F243L, V305I, A378D, F404S, P396L
H268D, P396L R255L, P396L
K210M, P396L V240A, P396L
L358P, P396L P217A, T359A, P396L
K288R, T307A, K344E,P396L P244H, P396L
D270E, G316D, R416G V215I, K290V, P396L
P247L, N421K F275L, Q362H, N384K, P396L
P247L, N421K, D270E V305L, P396L
Q419H, P396L, D270E S400F, P396L
K370E, P396L, D270E V303I, P396L
R255L, P396L, D270E F243L, R292P, Y300L, V305I, P396L
V240A, P396L, D270E F243L, R292P, Y300L, P396L
K392T, P396L, D270E F243L, R292P, Y300L

Альтернативно или дополнительно может быть полезным объединить приведенные выше аминокислотные модификации или любые другие аминокислотные модификации, описанные в данном документе, с одной или несколькими дополнительными аминокислотными модификациями, которые изменяют C1q связывание и/или комплемент-зависимую цитотоксическую функцию Fc-участка. Исходная молекула, представляющая особый интерес в данном документе, является, как правило, одной из тех, что связывает C1q и проявляет комплемент-зависимую цитотоксичность (CDC). Дополнительные аминокислотные замещения, описанные в данном документе, обычно послужат для изменения способности исходной молекулы связывать C1q и/или модифицировать комплемент-зависимую цитотоксическую функцию, например, уменьшать и предпочтительно отменять эти эффекторные функции. Однако, в данном документе рассматриваются молекулы, содержащие замещения в одном или нескольких описанных позициях с улучшенным C1q связыванием и/или комплемент-зависимой цитотоксической (CDC) функцией. Например, исходная молекула может быть неспособна связывать C1q и/или опосредовать CDC и может быть модифицирована согласно рекомендациям в данном документе так, что она приобретает эти дополнительные эффекторные функции. Более того молекулы с существующей ранее C1q связывающей активностью, при необходимости в дальнейшем способны опосредовать CDC, могут быть модифицированы так, что одна или обе эти активности увеличиваются.

Как описано выше можно создать Fc-участок с измененной эффекторной функцией, например, модифицируя C1q связывание и/или FcR связывание и таким образом изменяя CDC активность и/или ADCC активность. Например, можно образовать вариантный Fc-участок с улучшенным C1q связыванием и улучшенным FcγRIII связыванием; например, обладающий и улучшенной ADCC активностью, и улучшенной CDC активностью. Альтернативно, если желают, чтобы эффекторная функция была уменьшена или устранена, можно создать вариантный Fc-участок с уменьшенной CDC активностью и/или уменьшенной ADCC активностью. В других вариантах осуществления можно увеличить только одну из этих активностей и, необязательно, также снизить другую активность, например, создать вариантный Fc-участок с улучшенной ADCC активностью, но сниженной CDC активностью, и наоборот.

Настоящее изобретение заключает определенные варианты Fc-участков, которые были идентифицированы путем использования способов настоящего изобретения из библиотеки дрожжевых мутантов после 2-го - 4-го цикла сортировки, приведены в Таблице 9. В Таблице 9 суммирует различные мутанты, которые были идентифицированы с использованием способов настоящего изобретения. Мутанты испытаны с использованием испытания ELISA для определения связывания к FcγRIIIA и FcγRIIB. Мутанты были также протестированы испытанием ADCC, путем клонирования Fc-вариантов в антитело ch 4-4-20 с использованием способов, раскрытых и приведенных в качестве примеров в данном документе. Выделенные жирным шрифтом пункты относятся к экспериментам, в которых ch4-4-20 были очищены до испытания ADCC. Концентрация использованных антител была в диапазоне 0,5 мкг/мл - 1,0 мкг/мл.

ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
pYD-CH1 библиотека FACS сортировки с A тетрамером
Q347H; A339V CH3 ↑-0,5x NT
S415I; L251F CH2,CH3 -↑-0,5x ↑-- ,75x 0,82
K392R CH3 N/C NT
D399E; R292L; V185M CH1,CH2,CH3 N/C ↑--0,5x 0,65 0,9
K290E; L142P CH1, CH2 N/C NT
R301C; M252L; S192T CH1,CH2 ↓,5x NT
P291S; K288E; H268L: A141V CH1,CH2 ↓,5x NT
N315I CH2 N/C -↑- ,75x
S132I CH1 N/C NT
S383N; N384K; T256N; V262L; K218E; R214I; K205E; F149Y; K133M Все ↑0,5x NT
S408I; V215I; V125L CH1,CH2,CH3 -↑-0,5x ↑-- ,75x 0,62
P396L CH3 -↑-1x ↑--1x 0,55
G385E; P247H; CH2, CH3 -↑-1x ↑-- ,75x 0,44
P396H CH3 -↑-1x -↑-1x 0,58
A162V CH1 N/C NT
V348M; K334N; F275I; Y202M; K147T CH1,CH2,CH3 -↑-0,5x ↑--,75x 0,33
H310Y; T289A; G337E CH2 ↑,5x NT
S119F; G371S; Y407V; E258D CH1,CH2,CH3 N/C N/C 0,29
K409R; S166N CH1, CH3 N/C NT
in vitro сайт направленные мутанты
R292L CH2 NT NT 0,82
T359N CH3 NT NT 1,06
T366S CH3 NT NT 0,93
E333A, K334A CH2 NT NT 1,41
R292L, K334E CH2 NT NT 1,41; 1,64
R292L, P396L, T359N CH2, CH3 NT NT 0,89; 1,15
V379L CH3 NT NT 0,83
K288N CH2 NT NT 0,78
ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
A330S CH2 NT NT 0,52
F243L CH2 NT NT 0,38
E318K CH2 NT NT 0,86
K288N, A330S CH2 NT NT 0,08
R255L, E318K CH2 NT NT 0,82
F243L, E318K CH2 NT NT 0,07
Мутанты в 4-4-20 мини-библиотеке
Повышенное FcγRIIIA связывание, пониженное или без изменений связывание с FcγRIIB
N/C означает без изменений; N/B означает без связывания; NT означает не испытано
V379M CH3 - ↑-2x N/C 1,47
S219Y Шарнир - ↑-1x ↓ или N/B 1,28
V282M CH2 - ↑-1x ↓ или N/B 1,25; 1
F275I, K334N,V348M CH2 - ↑-0,5x N/C
D401V CH3 -↑- 0,5x N/C
V279L,P395S CH2 -↑- 1x N/C
K222N Шарнир -↑- 1x ↓или N/B 1,33; 0,63
K246T,Y319F CH2 -↑- 1x N/C
F243I,V379L CH2,CH3 - ↑-1,5x ↓ или N/B 1,86; 1,35
F243L,R255L,E318K CH2 ↑- 1x ↓ или N/B 1,81; 1,45
K334I CH2 -↑- 1x N/C 2,1; 1,97
K334E,T359N,T366S CH2,CH3 - ↑-1,5x N/C 1,49; 1,45
K288M, K334E CH2 ↑-- 3x ↓ или N/B 1,61; 1,69
K334E,E380D CH2,CH3 - ↑-1,5x N/C
T256S,V305I, K334E,N390S CH2,CH3 - ↑-1,5x N/C
K334E CH2 - ↑-2,5x N/C 1,75; 2,18
T335N,K370E,A378V,T394M,S424L CH2,CH3 - ↑-0,5x N/C
E233D,K334E CH2 - ↑-1,5x N/C 0,94; 1,02
K334E, T359N, T366S, Q386R CH2 ↑-- 1x N/C
Повышенное связывание с FcγIIIA и FcγRIIB
K246T,P396H CH2,CH3 -↑- 1x -↑- 2,5x
H268D,E318D CH2 - ↑-1,5x ↑-- 5x
K288N, A330S,P396L CH2,CH3 ↑-- 5x ↑-- 3x 2,34; 1,66; 2,54
I377F CH3 - ↑-1,5x - ↑-0,5x
P244H,L358M, V379M,N384K,V397M CH2,CH3 - ↑-1,75x - ↑-1,5x
P217S, A378V,S408R Шарнир,CH3 -↑- 2x - ↑-4,5x
P247L, I253N, K334N CH2 -↑- 3x -↑- 2,5x
P247L CH2 - ↑-0,5x ↑-- 4x 0,91; 0,84
F372Y CH3 - ↑-0,75x - ↑-5,5x 0,88; 0,59
K326E CH2 -↑- 2x -↑- 3,5x 1,63; 2
K246I, K334N CH2 - ↑-0,5x ↑-- 4x 0,66; 0,6
K320E,K326E CH2 -↑- 1x ↑-- 1x
H224L Шарнир - ↑-0,5x ↑-- 5x 0,55; 0,53
ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
S375C,P396L CH3 - ↑-1,5x - ↑-4,5x
D312E,K327N,I378S CH2,CH3 - ↑0,5x N/C
K288N, K326N CH2 ↑- 1x N/C
F275Y CH2 ↑- 3x N/C 0,64
P247L,N421K CH2,CH3 -↑ 3x N/C 2,0
S298N,W381R CH2,CH3 -↑ 2x N/C
D280E,S354F,A431D,L441I CH2,CH3 -↑ 3x N/C 0,62
R255Q,K326E CH2 -↑ 2x N/C 0,79
K218R,G281D,G385R H,CH2,CH3 - ↑3.5x N/C 0,67
L398V CH3 - ↑1,5x N/C
P247L,A330T,S440G CH2,CH3 - ↑0,75x ↓ 0,25x
V284A,F372L CH2,CH3 - 1x N/C
T335N,P387S,H435Q CH2,CH3 - 1,25x N/C
P247L,A431V,S442F CH2,CH3 - 1x N/C
Повышенное связывание с FcγRIIIA и FcγRIIB
P343S,P353L,S375I,S383N CH3 ↑- 0,5x ↑- 6x
T394M,V397M CH3 - ↑0,5x -↑ 3x
E216D,E345K,S375I H, CH2,CH3 -↑ 0,5x ↑- 4x
K334N, CH2 - ↑0,5x -↑ 2x
K288N,A330S,P396L CH2,CH3 - ↑0,5x ↑- 9x
P247L,E389G CH2,CH3 - ↑1,5x ↑- 9x
K222N,T335N,K370E,A378V,T394M H, CH2,CH3 ↑- 1x ↑- 7x
G316D,A378V,D399E CH2,CH3 - ↑1,5x ↑- 14x 2,24
N315I,V379M,T394M CH2,CH3 ↑- 1x ↑- 9x 1,37
K290T,G371D, CH2,CH3 -↑ 0,25x ↑- 6x
P247L,L398Q CH2,CH3 -↑ 1,25x ↑- 10x
K326Q,K334E,T359N,T366S CH2,CH3 -↑ 1,5x ↑- 5x
S400P CH3 -↑ 1x ↑- 6x
P247L,I377F CH2,CH3 -↑ 1x ↑- 5x
A378V,N390I,V422I CH3 -↑ 0,5x -↑ 5x
K326E,G385E CH2,CH3 - ↑0,5x - ↑15x
V282E,V369I,L406F CH2,CH3 -↑ 0,5x -↑ 7x
V397M,T411A,S415N CH3 -↑ 0,25x - ↑5x
T223I,T256S,L406F H, CH2,CH3 -↑ 0,25x -↑ 6x
S298N,S407R CH2,CH3 - ↑0,5x -↑ 7x
K246R,S298N,I377F CH2,CH3 -↑ 1x -↑ 5x
S407I CH3 -↑ 0,5x - ↑4x
F372Y CH3 - ↑0,5x - ↑4x
L235P,V382M,S304G,V305I,V323I CH2,CH3 -↑ 2x -↑ 2x
P247L,W313R,E388G CH2,CH3 - ↑1,5x - ↑1x
ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
D221Y,M252I,A330G,A339T,T359N,V422I,H433L H, CH2,CH3 -↑2,5x -↑ 6x
E258D,N384K CH2,CH3 - ↑1,25x - ↑4x
F241L,E258G CH2 -↑ 2x -↑ 2,5x -0,08
K370N,S440N CH3 - ↑1x -↑ 3,5x
K317N,F423-deleted CH2,CH3 -↑ 2,5x -↑ 7x 0,18
F243I,V379L,G420V CH2,CH3 -↑ 2,5x - ↑3,5x 1,35
P227S,K290E H, CH2 -↑ 1x -↑ 0,5x
A231V,Q386H,V412M CH2,CH3 - ↑1,5x -↑ 6x
T215P,K274N,A287G,K334N,L365V,P396L H, CH2,CH3 - ↑2x -↑ 4x
Повышенное связывание с FcγRIIB но не с FcγRIIIA
K334E,E380D CH2,CH3 N/C - ↑4,5x
T366N CH3 N/C ↑- 5x
P244A,K326I,C367R,S375I,K447T CH2,CH3 N/C -↑ 3x
C229Y,A287T,V379M,P396L,L443V H, CH2,CH3 ↓ 0,25x - ↑10x
Пониженное связывание с FcγRIIIA и FcγRIIB
R301H, K340E,D399E CH2,CH3 ↓ 0,50x ↓ 0,25x
K414N CH3 ↓ 0,25x N/B
P291S,P353Q CH2,CH3 ↓ 0,50x ↓ 0,25x
V240I, V281M CH2 ↓ 0,25x ↓ 0,25x
P232S, S304G CH2 N/B N/B
E269K,K290N,Q311R,H433Y CH2,CH3 N/B N/B
M352L CH3 N/B N/B
E216D,K334R,S375I H, CH2,CH3 N/B N/B
P247L,L406F CH2,CH3 N/B N/B
T335N,P387S,H435Q CH2,CH3 N/B N/B
T225S CH2 ↓ 0,25x ↓ 0,50x
D399E,M428L CH3 ↓ 0,50x ↓ 0,50x
K246I,Q362H,K370E CH2,CH3 N/B ↓ 0,50x
K334E,E380D,G446V CH2,CH3 N/B N/B
I377N CH3 ↓ 0,50x N/B
V303I,V369F,M428L CH2,CH3 N/B N/B
L251F,F372L CH2,CH3 N/B N/B
K246E,V284M,V308A CH2,CH3 N/B N/B
D399E,G402D CH3 N/B N/B
D399E,M428L CH3 N/B N/B
FcγRIIB сокращение / FcγRIIIA отбор: исходная Fc библиотека.
ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
E293V,Q295E,A327T CH2 ↑-0,4x ↓ или N/B 4,29
Y319F,P352L,P396L CH2,CH3 ↑-3,4x ↑-2x 1,09
K392T,P396L CH3 ↑- 4,5x ↑- 2,5x 3,07
K248M CH2 -↑0,4x ↓ или N/B 4,03
H268N,P396L CH2,CH3 ↑- 2,2x ↑- 4,5x 2,24
Конкуренция растворов 40X FcγRIIB-G2:P396L библиотека
D221E, D270E, V308A, Q311H, P396L, G402D -↑3,6x -↑0,1x 3,17
Сбалансированная сортировка: 0.8 µM FcγRIIIA мономер: P396L библиотека
K290T, N390I, P396L CH2, CH3 -↑2,8x ↑- 6,1x 1,93
K326I, P396L CH2, CH3 -↑2,9x -↑ 5,9x 1,16
H268D, P396L CH2, CH3 -↑3,8x ↑-13,7x 2,15
K210M, P396L CH1, CH3 - ↑1,9x -↑ 4,6x 2,02
L358P, P396L CH3 - ↑1,9x ↑- 4,2x 1,58
K288R, T307A, K344E,P396L CH2, CH3 ↑- 4,1x ↑- 2,3x 3,3
V273I, K326E, L328I, P396L CH2, CH3 -↑ 1,3x - ↑10,8x 0,78
K326I, S408N, P396L CH2, CH3 - ↑4x -↑ 9,3x 1,65
K334N, P396L CH2, CH3 - ↑3,1x ↑- 3x 2,43
V379M, P396L CH3 - ↑1,9x - ↑5,6x 2,01
P227S, P396L CH2, CH3 - ↑1,5x ↑- 4x 2,01
P217S, P396L H, CH3 - ↑1,6x - ↑4,5x 2,04
K261N, K210M, P396L CH2, CH3 -↑ 2x -↑ 4,2x 2,06
Кинетическая сортировка: O,8 µM, 1' с холодным 8 µM FcγRIIIA: P396L библиотека
термин M, P396L CH3 - ↑1,9x ↑- 7,2x 3,09
Q419H, P396L CH3 -↑ 2x -↑ 6,9x 2,24
K370E, P396L CH3 - ↑2x - ↑6,6x 2,47
L242F, P396L CH2, CH3 -↑ 2,5x -↑ 4,1x 2,4
F243L, V305I, A378D, F404S, P396L CH2, CH3 - ↑1,6x - ↑5,4x 3,59
R255L, P396L CH2, CH3 - ↑1,8x -↑ 6x 2,79
V240A, P396L CH2, CH3 -↑ 1,3x ↑- 4,2x 2,35
T250S, P396L CH2, CH3 -↑ 1,5x - ↑6,8x 1,60
P247S, P396L CH2,CH3 -↑ 1,2x -↑ 4,2x 2,10
K290E, V369A, T393A, P396L CH2,CH3 - ↑1,3x -↑ 6,7x 1,55
K210N, K222I, K320M, P396L H, CH2,CH3 -↑ 2,7x -↑ 8,7x 1,88
L410H, P396L CH3 -↑ 1,7x -↑ 4,5x 2,00
Q419L,P396L CH3 -↑ 2,2x -↑ 6,1x 1,70
V427A, P396L CH3 -↑ 1,9x - ↑4,7x 1,67
P217S, V305I, I309L, N390H, P396L H, CH2,CH3 - ↑2x -↑ 7x 1,54
E258D, P396L CH2,CH3 -↑ 1,9x -↑ 4,9x 1,54
N384K, P396L CH3 -↑ 2,2x - ↑5,2x 1,49
V323I, P396L CH2,CH3 -↑ 1,1x ↑- 8,2x 1,29
K246N, Q419R, P396L CH2,CH3 - ↑1,1x -↑ 4,8x 1,10
P217A, T359A, P396L H,CH2,CH3 - ↑1,5x ↑- 4,8x 1,17
P244H, P396L CH2,CH3 - ↑2,5x ↑- 4x 1,40
V215I, K290V, P396L H,CH2,CH3 - ↑2,2x ↑- 4,6x 1,74
ТАБЛИЦА 9: МУТАЦИИ, ВЫЯВЛЕННЫЕ В Fc УЧАСТКЕ
Мутации Домен Связывание с FcγRIIIA (ELISA) Связывание с FcγRIIB (ELISA) 4-4-20 ADCC (относительно лизиса (мутант/дикий тип)
F275L, Q362H, N384K, P396L CH2,CH3 -↑ 2,2x ↑- 3,7x 1,51
V305L, P396L CH2,CH3 - ↑1,3x ↑- 5,5x 1,50
S400F, P396L CH3 - ↑1,5x - ↑4,7x 1,19
V303I, P396L CH3 - ↑1,1x -↑ 4x 1,01
FcγRIIB сокращение FcγRIIIA 158V отбор твердой фазы: исходная библиотека
A330V, H433Q, V427M CH2,CH3 NT NT NT
V263Q, E272D, Q419H CH2,CH3 NT NT NT
N276Y, T393N, W417R CH2,CH3 NT NT NT
V282L, A330V, H433Y, T436R CH2,CH3 NT NT NT
A330V, Q419H CH2,CH3 NT NT NT
V284M, S298N, K334E, R355W CH2,CH3 NT NT NT
A330V, G427M, K438R CH2,CH3 NT NT NT
S219T, T225K, D270E, K360R CH2,CH3 NT NT NT
K222E, V263Q, S298N CH2 NT NT NT
V263Q, E272D CH2 NT NT NT
R292G CH2 NT NT NT
S298N CH2 NT NT NT
E233G, P247S, L306P CH2 NT NT NT
D270E CH2 NT NT NT
S219T, T225K, D270E CH2 NT NT NT
K326E, A330T CH2 NT NT NT
E233G CH2 NT NT NT
S254T, A330V, N361D, P243L CH2,CH3 NT NT NT
FcγRIIB сокращение FcγRIIIA 158F отбор твердой фазы: исходная библиотека
158F by FACS top 0.2%
V284M, S298N, K334E, R355W R416T CH2,CH3 NT NT
FcγRIIB сокращение FcgRIIA 131H отбор твердой фазы: исходная библиотека
R292P, V305I CH2,CH2 NT NT
D270E, G316D, R416G CH2,CH3 NT NT
V284M, R292L, K370N CH2,CH3 NT NT
R292P, V305I, F243L CH2 NT NT

В предпочтительных вариантах осуществления настоящее изобретение обеспечивает модификацию молекулы иммуноглобулина (например, антитела) с вариантными Fc-участками, имеющей одну или несколько аминокислотных модификации, из которых одна или несколько аминокислотных модификаций увеличивают аффинность молекул к FcγRIIIA и/или FcγRIIA. Такие иммуноглобулины включают молекулы IgG, которые естественно содержат FcγR связывающие участки (например, FcγRIIIA и/или FcγRIIB связывающий участок), или дериваты иммуноглобулина, которые были сконструированы, чтобы содержать FcγR связывающий участок (например, FcγRIIIA и/или FcγRIIB связывающий участок). Модифицированные иммуноглобулины настоящего изобретения включают любую иммуноглобулиновую молекулу, которая связывает предпочтительно иммуноспецифично, т.е., конкурирует с неспецифическим связыванием, что определено с помощью хорошо известных в данном уровне техники иммунологических испытаний для оценки специфического связывания антиген-антитело, антиген и содержит FcγR связывающий участок (например, FcγRIIIA и/или FcγRIIB связывающий участок). Такие антитела включают, без ограничения, поликлональные, моноклональные, би-специфические, мульти-специфические, человеческие, гуманизированные, химерные антитела, одноцепочечные антитела, Fab фрагменты, F(ab')2 фрагменты, дисульфид-связанные Fvs и фрагменты, содержащие или VL, или VH домен, или даже участок, определяющий комплемент (CDR), который особым образом связывает антиген, в отдельных случаях сконструированный, чтобы содержать или «сплавляться» FcγR связывающий участок.

В некоторых вариантах осуществления молекулы настоящего изобретения содержат части Fc-участка. Выражение “часть Fc-участка”, как используется в данном документе, относится к фрагментам Fc-участка, предпочтительно часть с эффекторной активностью и/или FcγR связывающей активностью (или сравнимый участок мутанта, лишенного подобной активности). Фрагмент Fc-участка может изменяться в размере от 5 аминокислот до полного Fc-участка минус одна аминокислота. Часть Fc-участка может быть лишена до 10, до 20, до 30 аминокислот из N-конца или C-конца.

Молекулы IgG настоящего изобретения являются предпочтительно IgG1 подклассами IgGs, но могут также быть любыми другими IgG подклассами данных животных. Например, у людей класс IgG включает IgG1, IgG2, IgG3 и IgG4; а мышиный IgG включает IgG1, IgG2a, IgG2b, IgG2c и IgG3.

Иммуноглобулины (и другие полипептиды, используемые в данном документе) могут быть от животного любого происхождения, включая птиц и млекопитающих. Предпочтительно антитела являются антителами человека, грызуна (например, мыши и крысы), осла, овцы, кролика, козла, морской свинки, верблюда, лошади или цыпленка. Как используется в данном документе, “человеческие” антитела включают антитела, имеющие аминокислотную последовательность человеческого иммуноглобулина и включают антитела, выделенные из человеческих иммуноглобулиновых библиотек или из трансгенных животных к одному или нескольким иммуноглобулинам человека, и которые не экспрессируют эндогенные иммуноглобулины, как описано ниже и, например, в патенте США № 5 939 598, Kucherlapati и др.

Антитела настоящего изобретения могут быть моноспецифичными, биспецифичными, триспецифичными или большей мультиспецифичности. Мультиспецифические антитела могут быть специфичными к разным эпитопам полипептида или могут быть специфичными к гетерологичным эпитопам, таким как гетерологичный полипептид или твердый материал носителя. См., например, PCT публикации WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt, и др., J. Immunol., 147:60-69, 1991; патенты США №№ 4 474 893; 4 714 681; 4 925 648; 5 573 920; 5 601 819; Kostelny и др., J. Immunol., 148:1547-1553, 1992.

Мультиспецифические антитела имеют связывающие специфичности по меньшей мере к двум различным антигенам. Хотя такие молекулы обычно будут только связывать два антигена (т.е. биспецифические антитела, BsAbs), антитела с дополнительными особенностями, такие как триспецифические антитела, охвачены настоящим изобретением. Примеры BsAbs включают без ограничения те, которые с одной стороны направлены против антигена раковых клеток, а с другой стороны направлены против цитотоксической молекулы.

Способы создания биспецифических антител известны в данном уровне техники. Традиционное производство всей длины биспецифических антител основано на коэкспрессии двух пар тяжелой цепи и легкой цепи иммуноглобулина, где две цепи имеют различные специфичности (Millstein et al., Nature, 305:537-539 (1983); включено в данный документ посредством ссылки вполном объеме). Из-за случайного подбора тяжелой и легкой цепей иммуноглобулина эти гибридомы (квадромы) производят потенциальную смесь из 10 различных молекул антител, из которых только одна имеет подходящую биспецифическую структуру. Очистка подходящей молекулы, которая обычно производится путем ступенчатой аффинной хроматографии, является довольно трудоемкой, а выход продукта - малым. Подобная процедура раскрыта в международной заявке WO 93/08829 и в Traunecker et al., EMBO J., 10:3655-3659 (1991).

Согласно различным подходам, вариабельные домены антитела с желаемыми связывающими способностями (антитело-антиген объединенные сайты) сливаются в последовательности постоянных доменов иммуноглобулина. «Слияние» предпочтительно производится с постоянным доменом тяжелой цепи иммуноглобулина, содержащим по меньшей мере часть петли, CH2 и CH3 участки. Предпочтительно иметь первый постоянный участок тяжелой цепи (CH1), содержащий сайт, необходимый для связывания легкой цепи, представленный по меньшей мере в одном из сплавов. DNA, кодирующие сплавы тяжелой цепи иммуноглобулина и, при необходимости, легкой цепи иммуноглобулина, вставляются в отдельные векторы экспрессии и совместно трансфектируются в подходящий организм хозяина. Это обеспечивает большую гибкость в корректировке совместных пропорций трех полипептидных фрагментов в вариантах осуществления, когда неравные соотношения трех полипептидных цепей, используемых при конструировании, дают оптимальный выход. Однако, является возможным вставить кодирующие последовательности двух или всех трех полипептидных цепей в один вектор экспрессии, когда экспрессия по меньшей мере двух полипептидных цепей в равных соотношениях приводит к высокому выходу или когда соотношения не имеют особенного значения.

В предпочтительном варианте осуществления этого подхода биспецифические антитела состоят из тяжелой цепи гибридного иммуноглобулина с первой связывающей специфичностью с одной стороны и пары легкой и тяжелой цепей гибридного иммуноглобулина (обеспечивающей вторую связывающую специфичность) с другой стороны. Оказалось, что эта асимметрическая структура облегчает разделение желаемого биспецифического соединения от нежелаемых комбинаций цепей иммуноглобулина, поскольку наличие легкой цепи иммуноглобулина только в одной половине биспецифичной молекулы обеспечивает простой способ разделения. Этот подход раскрыт в международной заявке WO 94/04690. Для получения более подробной информации о создании биспецифических антител смотри, например, Suresh et al., Methods in Enzymology, 121:210 (1986). Согласно другому подходу, описанному в международной заявке WO96/27011, пара молекул антител может быть создана, чтобы максимализировать процентное соотношение гетеродимеров, которые получены из рекомбинантной клеточной культуры. Предпочтительная область контакта содержит по меньшей мере часть CH3 домена антитела постоянного домена. В этом способе одна или несколько маленьких аминокислотных боковых цепей области контакта первой молекулы антитела замещается большими боковыми цепями (например, тирозином или триптофаном). Компенсирующие "впадины" идентичных или подобных размеров большой боковой(ых) цепи(ей) образуются на области контакта второй молекулы антитела путем замещения крупных боковых цепей аминокислот более мелкими (например, аланином или треонином). Это обеспечивает механизм увеличения выхода гетеродимера по сравнению с другими нежелательными конечными продуктами, такими как гомодимеры.

Биспецифические антитела включают перекрестносшитые или "гетероконъюгатные" антитела. Например, одно из антител в гетеорконъюгате может быть связано с авидином, другое - с биотином. Такие антитела, например, предложены, чтобы нацелить иммунную систему клеток на нежелательные клетки (патент США № 4 676 980) и для лечения ВИЧ-инфекции (международные заявки WO 91/00360, WO 92/200373 и европейский патентный документ EP 03089). Гетероконъюгантные антитела могут быть созданы с использованием любых удобных способов перекрестной сшивки. Подходящие агенты перекрестной сшивки хорошо известны на данном уровне техники и раскрыты в патенте США № 4 676 980 наряду со многими техниками для перекрестной сшивки.

Рассмотрены антитела с более чем двумя валентностями. Например, могут быть приготовлены триспецифические антитела. См., например, Tutt et al. J. Immunol. 147: 60 (1991), который включен в данный документ ссылкой.

Антитела настоящего изобретения включают дериваты, которые модифицированы иным способом, т.е. путем ковалентного присоединения молекулы любого типа к антителу так, что ковалентное присоединение не мешает антителу связанного антигена и/или образованию анти-идиотипической реакции. Например, но без ограничения, дериваты антитела включают антитела, которые были модифицированы, например, путем гликозилирования, ацетилирования, пегилирования, фосфорилирования, амидирования, дериватизации известными протектирующими/блокирующими группами, протеолитического расщепления, связывания с клеточным лигандом или другим белком и т. д. Любые из многочисленных химических модификаций могут осуществляться известными техниками, включая, но без ограничения, специфическое химическое расщепление, ацетилирование, формилирование, метаболический синтез тиникамицина и т. д. Кроме того, дериват может содержать одну или несколько неклассических аминокислот.

Для некоторых применений, включая in vivo применение антител у людей и in vitro испытаний на обнаружение, может быть предпочтительно применять химерные, гуманизированные или человеческие антитела. Химерное антитело является молекулой, в котором различные части антитела получены из различных видов животных, например, антитела, имеющие вариабельный участок, получены из мышиного моноклонального антитела, а постоянный участок получен из человеческого иммуноглобулина. Способы производства химерных антител известны в данном уровне техники. См., например, Morrison, Science, 229:1202, 1985; Oi et al., BioTechniques, 4:214 1986; Gillies et al., J. Immunol. Methods, 125:191-202, 1989; патенты США №№ 5 807 715; 4 816 567 и 4 816 397, которые включены в данный документ в качестве ссылок во всем их объеме. Гуманизированные антитела представляют собой молекулы антител видов животных за исключением человека, которые связывают желаемый антиген, имеющий один или несколько участков, определяющих комплемент (CDR), видов животных за исключением человека и каркасные участки и постоянные домены молекулы человеческого иммуноглобулина. Часто остатки каркаса в человеческих каркасных участках будут заменены соответствующим остатком из CDR донорного антитела для изменения, предпочтительно улучшения, связывания антигена. Эти замены каркаса идентифицируются способами, хорошо известными на данном уровне техники, например, путем моделирования взаимодействий CDR и остатков каркаса для идентификации остатков каркаса, важных для связывания антигена, и сравнения последовательностей для идентификации необычных остатков каркаса в определенной позиции. См., например, Queen et al., патент США № 5 585 089; Riechmann et al., Nature, 332:323, 1988, которые включены в данный документ в качестве ссылок во всем их объеме. Антитела могут быть гуманизированы с использованием разнообразных техник, известных на данном уровне техники, включая, например, CDR-прививку (европейский патент 239 400; PCT публикация WO 91/09967; патенты США №№ 5 225 539; 5 530 101 и 5 585 089), венирование (veneering) или ресюрфейсинг (resurfacing) (европейский патент 592 106; европейский патент 519 596; Padlan, Molecular Immunology, 28(4/5):489-498, 1991; Studnicka et al., Protein Engineering, 7(6):805-814, 1994; Roguska et al., Proc Natl. Acad. Sci. USA, 91:969-973, 1994), и перетасовку цепи (патент США № 5 565 332), каждый из которых включен в данный документ в качестве ссылки во всем их объеме. Гуманизированные антитела могут быть созданы с использованием любого из способов, раскрытых в патентах США № 5 693 762 (Protein Design Labs), 5 693 761, (Protein Design Labs) 5 585 089 (Protein Design Labs), 6 180 370 (Protein Design Labs) и публикациях США №№ 20040049014, 200300229208, каждый из которых включен в данный документ в качестве ссылки во всем их объеме.

Полностью человеческие антитела являются особенно пригодными для терапевтического лечения пациентов-людей. Человеческие антитела могут быть созданы с помощью разнообразных способов, известных на данном уровне техники, включая методы фагового отображения, описанные выше с использованием библиотек антител, полученных из последовательностей иммуноглобулина человека. См. патенты США №№. 4 444 887 и 4 716 111; и PCT публикации WO 98/46645; WO 98/50433; WO 98/24893; WO 98/16654; WO 96/34096; WO 96/33735; и WO 91/10741, каждый из которых включен в данный документ в качестве ссылки во всем его объеме.

Человеческие антитела также могут быть получены с использованием трансгенных мышей, которые не способны экспрессировать функциональные эндогенные иммуноглобулины, но которые могут экспрессировать гены иммуноглобулинов человека. Для обзора технологий получения человеческих антител см. Lonberg и Huszar, Int. Rev. Immunol., 13:65-93, 1995. Для детального рассмотрения вопроса по технологиям получения человеческих антител и моноклональных человеческих антител и протоколов получения таких антител см., например, PCT публикации WO 98/24893; WO 92/01047; WO 96/34096; WO 96/33735; европейский патент 0 598 877; патенты США №№ 5 413 923; 5 625 126; 5 633 425; 5 569 825; 5 661 016; 5 545 806; 5 814 318; 5 885 793; 5 916 771; и 5 939 598, которые включены в данный документ в качестве ссылок во всем их объеме. К тому же, такие компании как Abgenix, Inc. (Freemont, CA), Medarex (NJ) и Genpharm (San Jose, CA) могут заниматься обеспечением человеческими антителами, направленными против выбранного антигена, с использованием похожей технологии на ту, которая описана выше.

Полностью человеческие антитела, которые распознают отобранный эпитоп, могут быть созданы с использованием техники, именуемой “направленный отбор" В этом подходе отобранное моноклональное антитело видов животных, за исключением человека, например, мышиное антитело, используется, чтобы направить отбор полностью человеческого антитела, распознающего тот же эпитоп (Jespers et al., Bio/technology, 12:899-903, 1988).

Настоящее изобретение включает конструирование человеческих или гуманизированных терапевтических антител (например, моноклональных антител, специфичных к опухоли) в Fc-участке путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. В другом варианте осуществления настоящее изобретение относится к конструированию человеческих или гуманизированных терапевтических антител (например, моноклональных антител, специфичных к опухоли) в Fc-участке путем модификации по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA и далее уменьшает аффинность Fc-участка к FcγRIIB. Сконструированные терапевтические антитела могут в дальнейшем иметь усиленную эффекторную функцию, например, усиленную ADCC активность, фагоцитозную активность и т. д., что определяется стандартными испытаниями, известными специалистам данной области техники.

В определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного моноклонального антитела, специфичного к Her2/neu протоонкогену (например, Ab4D5 гуманизированное антитело, как раскрыто в Carter et al., 1992, Proc. Natl. Acad. Sci. USA 89:4285-9), путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. В другом определенном варианте осуществления модификация гуманизированного Her2/neu моноклонального антитела также в дальнейшем может уменьшать аффинность Fc-участка к FcγRIIB. В еще одном определенном варианте осуществления сконструированные гуманизированные моноклональные антитела, специфичные к Her2/neu, могут в дальнейшем иметь увеличенную эффекторную функцию, что определено стандартными испытаниями, известными на данном уровне техники, раскрыто и приведено в данном документе в качестве примеров.

В другом определенном варианте осуществления настоящее изобретение включает конструирование мышино-человеческого химерного анти-CD20 моноклонального антитела, 2H7 путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. В другом определенном варианте осуществления модификация анти-CD20 моноклонального антитела, 2H7 также в дальнейшем может уменьшить аффинность Fc-участка к FcγRIIB. В ещё одном определенном варианте осуществления сконструированное анти-CD20 моноклональное антитело, 2H7 может в дальнейшем иметь усиленную эффекторную функцию, что определено стандартными испытаниями, известными на данном уровне техники, раскрыто и приведено в данном документе в качестве примеров.

В другом определенном варианте осуществления настоящее изобретение включает конструирование антитела, которое связывает A33, CD5, CD11c, CD19, CD20, CD22, CD23, CD27, CD40, CD45, CD79a, CD79b, CD103, CTLA4, ErbB1, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор, или TNF-γ рецептор (особенно гуманизированную или химерную форму антитела) путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. В другом определенном варианте осуществления модификация антитела, которое связывает A33, CD5, CD11c, CD19, CD20, CD22, CD23, CD27, CD40, CD45, CD79a, CD79b, CD103, CTLA4, ErbB1, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, также в дальнейшем может уменьшать аффинность Fc-участка к FcγRIIB. В ещё одном определенном варианте осуществления, антитело, которое связывает A33, CD5, CD11c, CD19, CD20, CD22, CD23, CD27, CD40, CD45, CD79a, CD79b, CD103, CTLA4, ErbB1, ErbB3, ErbB4, VEGF рецептор, TNF-α рецептор, TNF-ß рецептор или TNF-γ рецептор, может в дальнейшем обладать усиленной эффекторной функцией, что определено стандартными испытаниями, известными на данном уровне техники, раскрыто и приведено в данном документе в качестве примеров.

В определенных вариантах осуществления настоящее изобретение включает конструирование антитела (или химерной, гуманизированной или других его сконструированных версий), содержащего вариабельный домен тяжелой цепи и/или вариабельный домен легкой цепи моноклонального антитела, полученного клонами 2B6, 3H7, 8B5.4.3, 1D5, 2E1, 2H9, 2D11 или 1F2, обладающих ATCC инвентарными номерами PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно (депонированы ATCC, 10801 University Boulevard, Manassas, VA 02209-2011, все из которых включены в данный документ в качестве ссылок). В определенных вариантах осуществления настоящее изобретение включает конструирование гуманизированного антитела, содержащего вариабельные домены тяжелой цепи и/или вариабельные домены легкой цепи 2B6, 3H7 или 8B5.3.4. В другом определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного антитела, содержащего CDR 2B6, 3H7 или 8B5.3.4. В другом определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO: 1, SEQ ID NO:2 или SEQ ID NO:3 и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO: 4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 или SEQ ID NO: 8. В другом определенном варианте осуществления настоящее изобретение включает конструирование анти-FcγRIIB антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO:13 и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO:14. В другом определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного анти-FcγRIIB антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO:3 и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO:8. В другом определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного анти-FcγRIIB антитела, содержащего вариабельный домен тяжелой цепи, имеющий аминокислотную последовательность SEQ ID NO:9 и вариабельный домен легкой цепи, имеющий аминокислотную последовательность SEQ ID NO:10.

В другом определенном варианте осуществления настоящее изобретение включает конструирование анти-FcγRIIB антитела, охватывая без ограничения любые антитела, раскрытые в предварительной заявке США № 60/403 266, поданной 12 августа 2002 года, заявке США № 10/643 857, поданной 14 августа 2003 года, предварительной заявке США № 60/562 804, поданной 16 апреля 2004 года, предварительной заявке США № 60/582 044, поданной 21 июня 2004 года, предварительной заявке США №60/582 045, поданной 21 июня 2004 года, предварительной заявке США №60/636 663, поданной 15 декабря 2004 года, и заявке США серийного № 10/524 134, поданной 11 февраля 2005 года, путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. В другом определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного анти-FcγRIIB антитела, охватывая без ограничения любые антитела, раскрытые в предварительной заявке США № 60/569 882, поданной 10 мая 2004 года, предварительной заявке США № 60/582 043, поданной 21 июня 2004 года, и заявке США № 11/126 978, поданной 10 мая 2005 года путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. Каждая из упомянутых заявок включена в данный документ в качестве ссылки в полном объеме. Примерами анти-FcγRIIB антител, которые могут или не могут быть гуманизированы, но могут быть сконструированы в соответствии со способами настоящего изобретения, представляют собой 2B6 моноклональное антитело, обладающее ATCC инвентарным номером PTA-4591, и 3H7, обладающее ATCC инвентарным номером PTA-4592, 1D5 моноклональное антитело, обладающее ATCC инвентарным номером PTA-5958, 1F2 моноклональное антитело, обладающее ATCC инвентарным номером PTA-5959, 2D11 моноклональное антитело, обладающее ATCC инвентарным номером PTA-5960, 2E1 моноклональное антитело, обладающее ATCC инвентарным номером PTA-5961, 8B5.3.4, обладающее ATCC инвентарным номером PTA-7610, и 2H9 моноклональное антитело, обладающее ATCC инвентарным номером PTA-5962 (все задепонированы в 10801 University Boulevard, Manassas, VA 02209-2011), которые включены в данный документ в качестве ссылки. В другом определенном варианте осуществления модификация анти-FcγRIIB антитела может в дальнейшем также увеличивать аффинность Fc-участка к FcγRIIB. В ещё одном определенном варианте осуществления сконструированное анти-FcγRIIB антитело может в дальнейшем иметь усиленную эффекторную функцию, что определено с использованием стандартных испытаний, известных специалистам в данной области, раскрыто и приведено в данном документе в качестве примеров.

В определенном варианте осуществления настоящее изобретение включает конструирование анти-FcγRIIB антитела, согласно способам настоящего изобретения, которое содержит один или несколько комплемент-определяющих участков (CDR), предпочтительно все 6 CDR, антитела, полученного клонами 2B6, 3H7 или 8B5.3.4 с ATCC инвентарными номерами PTA-4591, PTA-4592 и PTA-7610 соответственно (например, CDR3 тяжелая цепь). В определенном варианте осуществления анти-FcγRIIB антитело, сконструированное согласно способам настоящего изобретения, содержит один или несколько комплемент-определяющих участков (CDR), предпочтительно все 6 CDR, антитела, полученного клонами 1D5, 2E1, 2H9, 2D11 и 1F2, имеющих ATCC инвентарные номера PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно (например, CDR3 тяжелая цепь). В другом варианте осуществления анти-FcγRIIB антитело, сконструированное согласно способам настоящего изобретения, связывается с тем же эпитопом, что и мышиное моноклональное антитело, полученное клонами 2B6, 3H7 или 8B5.3.4 с ATCC инвентарными номерами PTA-4591, PTA-4592 и PTA-7610 соответственно, и/или конкурирует с мышиным моноклональным антителом, полученным клонами 2B6, 3H7 или 8B5.3.4 с ATCC инвентарными номерами PTA-4591, PTA-4592 и PTA-7610 соответственно, как определено, например, в испытании ELISA или другом соответствующем конкурентноспособном иммуноанализе, а также связывает FcγRIIB с большей аффинностью, чем указанное антитело или его фрагмент связывают FcγRIIA. В другом варианте осуществления анти-FcγRIIB антитело, сконструированное согласно способам настоящего изобретения, связывается с тем же эпитопом, что и мышиное моноклональное антитело, полученное из клонов 1D5, 2E1, 2H9, 2D11 и 1F2, имеющих ATCC инвентарные номера PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно, и/или конкурирует с мышиным моноклональным антителом, полученным из клонов 1D5, 2E1, 2H9, 2D11 и 1F2, имеющих ATCC инвентарные номера PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно, как определено, например, в испытании ELISA или другом соответствующем конкурентноспособном иммуноанализе, а также связывает FcγRIIB через его вариабельный участок с большей аффинностью, чем указанное антитело или его фрагмент связывают FcγRIIA.

Настоящее изобретение также включает конструирование анти-FcγRIIB антитела, содержащего вариабельный домен тяжелой цепи и/или вариабельный домен легкой цепи, аминокислотная последовательность которого по меньшей мере на 45%, по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, или по меньшей мере на 99% идентична аминокислотной последовательности вариабельного домена тяжелой цепи и/или вариабельного домена легкой цепи мышиного моноклонального антитела, полученного клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно. Настоящее изобретение кроме того включает конструирование анти-FcγRIIB антител, содержащих аминокислотную последовательность одного или нескольких CDR, которая по меньшей мере на 45%, по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична аминокислотной последовательности одного или нескольких CDR мышиного моноклонального антитела, полученного клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно. Вычисление процентной идентичности двух аминокислотных последовательностей может быть определено любым способом, известным специалистам в данной области техники, включая программу поиска белков - BLAST.

Настоящее изобретение также включает конструирование одного или нескольких анти-FcγRIIB антител, содержащих один или несколько вариабельных доменов, кодируемых нуклеотидной последовательностью, которая гибридизируется с нуклеотидной последовательностью одного или нескольких вариабельных доменов мышиного моноклонального антитела, полученного клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно, при жестких условиях. В предпочтительном варианте осуществления настоящее изобретение включает конструирование одного или нескольких анти-FcγRIIB антител, содержащих вариабельный домен легкой цепи и/или вариабельный домен тяжелой цепи, кодируемый нуклеотидной последовательностью, которая гибридизируется при жестких условиях с нуклеотидной последовательностью вариабельного домена легкой цепи и/или вариабельного домена тяжелой цепи мышиного моноклонального антитела, произведенного клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно, при жестких условиях. В другом предпочтительном варианте осуществления настоящее изобретение обеспечивает конструирование анти-FcγRIIB антитела, содержащего один или несколько CDR, кодируемых нуклеотидной последовательностью, которая гибридизируется при жестких условиях с нуклеотидной последовательностью одного или нескольких CDR мышиного моноклонального антитела, произведенного клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно. Условия жесткой гибридизации включают, без ограничения, гибридизацию с иммобилизированной на фильтре ДНК в 6X хлориде натрия / цитрате натрий (SSC) при около 45°C с последующей одной или несколькими промывками в 0,2X SSC/0,1% SDS при около 50-65°C, крайне жесткие условия, такие как гибридизация с иммобилизированной на фильтре ДНК в 6X SSC при около 45°C с последующей одной или несколькими промывками в 0,1X SSC/0,2% SDS при около 60°C или любые другие условия жесткой гибридизации, известные специалистам данной области техники (см., например, Ausubel, F.M. et al., eds. 1989 Current Protocols in Molecular Biology, vol. 1, Green Publishing Associates, Inc. and John Wiley and Sons, Inc., NY at pages 6.3.1 to 6.3.6 and 2.10.3, включенные в данный документ в качестве ссылок).

В предпочтительном варианте осуществления сконструированные антитела настоящего изобретения гуманизируются любым способом, известным на данном уровне техники или описанным в данном документе, и/или содержат CDR участки гуманизированного FcγRIIB специфического антитела или гуманизированного CD20 специфического антитела, где указанные CDR получены из мышиного антитела, специфического к FcγRIIB или CD20 соответственно. В некоторых вариантах осуществления гуманизированные антитела, описанные в данном документе, содержат изменения, включая, без ограничения, аминокислотные делеции, вставки, модификации, акцепторного антитела, т.е., человеческие вариабельные домены тяжелой цепи и/или вариабельные домены легкой цепи каркасного участка, которые необходимы для удержания связывающей специфичности моноклонального антитела донора. В некоторых вариантах осуществления участки каркаса гуманизированных антител, описанных в данном документе, не обязательно состоят из точной аминокислотной последовательности участка каркаса встречающегося в природе вариабельного участка человеческого антитела, но содержат различные изменения, включая, без ограничения, аминокислотные делеции, вставки, модификации, которые изменяют свойства гуманизированного антитела, например, улучшают связывающие свойства вариабельного участка гуманизированного антитела, специфичного для той же цели, что и мышиное FcγRIIB или CD20 специфическое антитело. В наиболее предпочтительных вариантах осуществления создано минимальное число изменений в участке каркаса для того, чтобы избежать крупносерийных введений остатков каркаса видов животных, за исключением человека, и обеспечить минимальную иммуногенность гуманизированного антитела настоящего изобретения у людей. Донорное моноклональное антитело предпочтительно является моноклональным антителом, произведенным клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2 (имеющими ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно), которые связывают FcγRIIB, или моноклональное антитело является CD20 антителом, таким как ритуксимаб или 2H7.

В определенном варианте осуществления настоящее изобретение включает конструирование CDR-привитого антитела, которое содержит вариабельный участок тяжелой цепи домена, содержащего участки каркаса антитела реципиента и остатки из моноклонального антитела донора, который в частности связывает FcγRIIB, например, моноклональное антитело, произведенное клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2, имеющих ATCC инвентарные номера PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960 и PTA-5959 соответственно. В другом определенном варианте осуществления настоящее изобретение включает конструирование CDR-привитого антитела, которое содержит вариабельный участок легкой цепи домена, содержащего остатки каркаса антитела реципиента и остатки из моноклонального антитела донора, которое в частности связывает FcγRIIB, например, моноклональное антитело, произведенное клонами 2B6, 3H7, 8B5.3.4, 1D5, 2E1, 2H9, 2D11 или 1F2.

Предпочтительно FcγRIIB гуманизированные антитела связывают внеклеточный домен нативного человеческого FcγRIIB. Гуманизированные анти-FcγRIIB антитела этих комбинаций могут иметь вариабельный участок тяжелой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO: 15 или SEQ ID NO: 16) и/или CDR2 (SEQ ID NO:17 или SEQ ID NO:18) и/или CDR3 (SEQ ID NO: 19 or SEQ ID NO:20) и/или вариабельный участок легкой цепи, содержащий аминокислотную последовательность CDR1 (SEQ ID NO:21 или SEQ ID NO:22) и/или CDR2 (SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, или SEQ ID NO:26) и/или CDR3 (SEQ ID NO:27 или SEQ ID NO:28).

В определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного анти-FcγRIIB антитела с вариабельным доменом тяжелой цепи, имеющим аминокислотную последовательность SEQ ID NO:1, SEQ ID NO:2 или SEQ ID NO:3, и вариабельным доменом легкой цепи, имеющим аминокислотную последовательность SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6; SEQ ID NO:7 или SEQ ID NO:8.

В одном определенном варианте осуществления настоящее изобретение включает конструирование гуманизированного анти-FcγRIIB антитела, где VH участок FcγRIIB антитела включает FR сегменты VH сегмента VH1-18 зародышевой линии человека (Matsuda et al., 1998, J. Exp. Med. 188:2151062), и JH6 (Ravetch et al., 1981, Cell 27(3 Pt. 2): 583-91), и один или несколько CDR участков 2B6 VH, имеющей аминокислотную последовательность SED ID NO: 1, SEQ ID NO:17 или SEQ ID NO:19. В одном варианте осуществления 2B6 VH имеет аминокислотную последовательность SEQ ID NO:1, SEQ ID NO:3 или SEQ ID NO:29. В другом определенном варианте осуществления гуманизированное анти-FcγRIIB антитело дополнительно содержит VL участок, который состоит из FR сегментов VL сегмента VK-A26 зародышевой линии человека (Lautner-Rieske et al., 1992, Eur. J. Immunol. 22:1023-1029) и JK4 (Hieter et al., 1982, J. Biol. Chem. 257:1516-22), и один или несколько CDR участков 2B6VL, имеющей аминокислотную последовательность SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 и SEQ ID NO:27. В одном варианте осуществления 2B6 VL имеет аминокислотную последовательность SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6; SEQ ID NO:7, SEQ ID NO:8 или SEQ ID NO:30 и при необходимости в комбинации с одной из приведенных выше в качестве ссылки 2B6 VH.

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VH цепь и/или VH домен, содержащий аминокислотную последовательность (H2B6VH-3) (SEQ ID NO:3):

QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIHWVRQAPGQGLEWIGVIDPSDTYPNYNKKFKGRVTMTVDTSTSTAYMELRSLRSDDTAVYYCARNGDSDYYSGMDYWGQGTTVTVSS

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VL цепь и/или VL домен, содержащий аминокислотную последовательность (H2B6VL-5) (SEQ ID NO:8):

EIVLTQSPDFQSVTPKEKVTFTCRTSQSIGTNIHWYQQKPDQSPKLLIKEVSESISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSNTWPFTFGGGTKVEIK

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VH цепь и/или VH домен, содержащий аминокислотную последовательность (H2B6VH-3):

QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIHWVRQAPGQGLEWIGVIDPSDTYPNYNKKFKGRVTMTVDTSTSTAYMELRSLRSDDTAVYYCARNGDSDYYSGMDYWGQGTTVTVSS (SEQ ID NO:3), и VL цепь и/или VL домен, содержащий аминокислотную последовательность (H2B6VL-5) (SEQ ID NO:8):

EIVLTQSPDFQSVTPKEKVTFTCRTSQSIGTNIHWYQQKPDQSPKLLIKEVSESISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSNTWPFTFGGGTKVEIK

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VH домен и/или VH цепь, содержащую аминокислотную последовательность (8B5.3.4 VH, см. ФИГ. 2):

EVKLEESGGGLVQPGGSMKLSCEASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKAKNHATYYAESVIGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCGALGLDYWGQGTTLTVSS (SEQ ID NO:9).

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VL домен и/или VL цепь, содержащую аминокислотную последовательность (8B5.3.4 VL, см. РИС. 3) (SEQ ID NO:10):

DIQMTQSPSSLLAALGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSESGSDYSLTISSLESEDFADYYCLQYFSYPLTFGAGTKLELK

В некоторых вариантах осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, имеет VH домен и/или VH цепь, содержащую аминокислотную последовательность (8B5.3.4 VH) (SEQ ID NO:9, см. РИС. 2):

EVKLEESGGGLVQPGGSMKLSCEASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKAKNHATYYAESVIGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCGALGLDYWGQGTTLTVSS, и VL домен и/или VL цепь, содержащую аминокислотную последовательность (8B5.3.4 VL, см. РИС. 3) (SEQ ID NO:10):

DIQMTQSPSSLLAALGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSESGSDYSLTISSLESEDFADYYCLQYFSYPLTFGAGTKLELK

В другом определенном варианте осуществления анти-FcγRIIB антитело, сконструированное в соответствии со способами настоящего изобретения, является гуманизированным 3H7 антителом, где FcγRIIB VH участок состоит из FR сегментов из VH сегмента зародышевой линии человека и CDR участков 3H7 VH, имеющих аминокислотную последовательность SED ID NO: 37. В другом определенном варианте осуществления гуманизированное 3H7 антитело дополнительно содержит VL участок, который состоит из FR сегментов VH сегмента зародышевой линии человека и CDR участков 3H7VL, имеющих аминокислотную последовательность SEQ ID NO:7.

В частности настоящее изобретение включает конструирование анти-FcγRIIB антитела, где антитело иммуноспецифически связывается с внеклеточным доменом нативного человеческого FcγRIIB, а указанное FcγRIIB антитело, содержащее (или альтернативно, состоящее из) CDR последовательности 2B6, 3H7 или 8B5.3.4 в любой из последующих комбинаций: VH CDR1 и VL CDR1; VH CDR1 и VL CDR2; VH CDR1 и VL CDR3; VH CDR2 и VL CDR1; VH CDR2 и VL CDR2; VH CDR2 и VL CDR3; VH CDR3 и VH CDR1; VH CDR3 и VL CDR2; VH CDR3 и VL CDR3; VH1 CDR1, VH CDR2 и VL CDR1; VH CDR1, VH CDR2 и VL CDR2; VH CDR1, VH CDR2 и VL CDR3; VH CDR2, VH CDR3 и VL CDR1, VH CDR2, VH CDR3 и VL CDR2; VH CDR2, VH CDR2 и VL CDR3; VH CDR1, VL CDR1 и VL CDR2; VH CDR1, VL CDR1 и VL CDR3; VH CDR2, VL CDR1 и VL CDR2; VH CDR2, VL CDR1 и VL CDR3; VH CDR3, VL CDR1 и VL CDR2; VH CDR3, VL CDR1 и VL CDR3; VH CDR1, VH CDR2, VH CDR3 и VL CDR1; VH CDR1, VH CDR2, VH CDR3 и VL CDR2; VH CDR1, VH CDR2, VH CDR3 и VL CDR3; VH CDR1, VH CDR2, VL CDR1 и VL CDR2; VH CDR1, VH CDR2, VL CDR1 и VL CDR3; VH CDR1, VH CDR3, VL CDR1 и VL CDR2; VH CDR1, VH CDR3, VL CDR1 и VL CDR3; VH CDR2, VH CDR3, VL CDR1 и VL CDR2; VH CDR2, VH CDR3, VL CDR1 и VL CDR3; VH CDR2, VH CDR3, VL CDR2 и VL CDR3; VH CDR1, VH CDR2, VH CDR3, VL CDR1 и VL CDR2; VH CDR1, VH CDR2, VH CDR3, VL CDR1 и VL CDR3; VH CDR1, VH CDR2, VL CDR1, VL CDR2, и VL CDR3; VH CDR1, VH CDR3, VL CDR1, VL CDR2, и VL CDR3; VH CDR2, VH CDR3, VL CDR1, VL CDR2, и VL CDR3; или любой их комбинаци из VH CDR и VL CDR, раскрытой в данном документе.

В определенном варианте осуществления анти-FcγRIIB моноклональное антитело содержит модификацию в положении 334 глутаминовой кислотой, в положении 359 аспарагином и в положении 366 серином (MgFc13); или замену в положении 316 аспарагиновой кислотой, в положении 378 валином и в положении 399 глутаминовой кислотой (MgFc27); или замену в положении 243 изолейцином, в положении 379 лейцином и в положении 420 валином (MgFc29); или замену в положении 392 треонином и в положении 396 лейцином (MgFc38); или замену в положении 221 глутаминовой кислотой, в положении 270 глутаминовой кислотой, в положении 308 аланином, в положении 311 гистидином, в положении 396 лейцином и положении 402 аспарагиновой кислотой (MgFc42); или замену в положении 410 гистидином и в положении 396 лейцином (MgFc53); или замену в положении 243 лейцином, в положении 305 изолейцином, в положении 378 аспарагиновой кислотой, в положении 404 серином и в положении 396 лейцином (MgFc54); или замену в положении 255 изолейцином и в положении 396 лейцином (MgFc55); или замену в положении 370 глутаминовой кислотой и в положении 396 лейцином (MgFc59); или замену в положение 243 лейцином, в положении 292 пролином, в положении 300 лейцином, в положении 305 изолейцином и в положении 396 лейцином (MgFc88); или замену в положении 243 лейцином, в положении 292 пролином, в положении 300 лейцином и в положении 396 лейцином (MgFc88A); или замену в положении 234 лейцином, в положении 292 пролином и в положении 300 лейцином (MgFc155); или замену в положении 243 лейцином, в положении 292 пролином и в положении 300 лейцином; или замену в положении 243 лейцином, в положении 292 пролином и в положении 396 лейцином; или замену в положении 243 лейцином и в положении 292 пролином; или замену в положении 243 лейцином; или замену в положении 273 фенилаланином.

6.1.6 ПОЛИПЕПТИДЫ И КОНЪЮГАТЫ АНТИТЕЛ

Молекулы настоящего изобретения (т.е. полипептиды, антитела), содержащие вариантные Fc-участки, могут быть рекомбинантно сплавлены или химически сконъюгированы (включая как ковалентную, так и нековалентную конъюгацию) в гетерологичные полипептиды (т.е. неродственные полипептиды; или их часть, предпочтительно по меньшей мере 10, по меньшей мере 20, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90 или по меньшей мере 100 аминокислот полипептида) для создания сплавленных белков. Сплавление не обязательно должно быть прямым, оно может возникнуть через линкерные последовательности.

Более того, молекулы настоящего изобретения (т.е. полипептиды, антитела), содержащие вариантные Fc-участки, могут быть сопряжены с терапевтическим средством или фрагментом лекарственного средства, которое модифицирует данную биологическую реакцию. Терапевтические средства или фрагменты лекарственных средств не должны рассматриваться, ограничиваясь только как классическими химическими терапевтическими средствами. Например, фрагмент лекарственного средства может быть белком или полипептидом, обладающим направленной биологический активностью. Такие белки могут включать, например, токсин, такой как абрин, рицин A, эндотоксин синегнойной палочки (т.е., PE-40) или дифтерийный токсин, рицин, гелонин, и фитолакковый противовирусный белок, белок, такой как фактор некроза опухоли, интерфероны, включая без ограничения α-интерферон (IFN-α), β-интерферон (IFN-β), фактор роста нервов (NGF), тромбоцитарный фактор роста (PDGF), тканевой активатор плазмогена (TPA), апоптический агент (например, TNF-α, TNF-β, AIM I, как раскрыто в PCT публикации № WO 97/33899), AIM II (см., PCT публикацию № WO 97/34911), Fas лиганд (Takahashi et al., J. Immunol., 6:1567-1574, 1994), и VEGI (PCT публикация № WO 99/23105), тромболитическое средство или антиангиогенное средство (например, ангиостатин или эндостатин), или модификатор биологической реакции, такой как, например, лимфокин (например, интерлейкин-1 (“IL-1”), интерлейкин-2 (“IL-2”), инерлейкин-6 (“IL-6”), гранулоцитарно-макрофагальный колониестимулирующий фактор (“GM-CSF”), и гранулоцитарный колониестимулирующий фактор (“G-CSF”), макрофагальный колониестимулирующий фактор (“M-CSF”) или фактор роста (например, гормон роста (“GH”); протеазы или рибонуклеазы.

Молекулы настоящего изобретения (т.е. полипептиды, антитела) могут быть сплавлены с маркерной последовательностью, такой как пептид для облегчения очистки. В предпочтительных вариантах осуществления, маркерная аминокислотная последовательность является гекса-гистидиновым пептидом, таким как метка, представленная в pQE векторе (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 91311), среди прочих, многие из которых являются коммерчески доступными. Как описано в Gentz et al., 1989, Proc. Natl. Acad. Sci. USA, 86:821-824, например, гекса-гистидин предусмаривается для подходящей очистки сплавленного белка. Другие пептидные метки, удобные для очистки, включают без ограничения гемагглютинирующую “HA” метку, которая соответствует эпитопу, полученному из белка гемагглютинина гриппа (Wilson et al., Cell, 37:767 1984), и “flag” метку (Knappik et al., Biotechniques, 17(4):754-761, 1994).

Дополнительные сплавленные белки могут быть произведены через техники ген-шаффлинг, мотив-шаффлинг, экзон-шаффлинг и/или кодон-шаффлинг (совместно именуемые “ДНК шаффлинг”). ДНК шаффлинг может быть применен для изменения активностей молекул настоящего изобретения (например, антител с наивысшими аффинностями и наиболее низкими скоростями диссоциации). См. в общем патент США № 5 605 793; 5 811 238; 5 830 721; 5 834 252; и 5 837 458, и Patten et al., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol. 16:76; Hansson, et al., 1999, J. Mol. Biol. 287:265; and Lorenzo and Blasco, 1998, BioTechniques 24:308 (каждый из этих патентов и публикаций присутствует в данном документе в качестве ссылок в полном объеме). Молекулы настоящего изобретения, содержащие вариантные Fc-участки, или нуклеиновые кислоты, кодирующие молекулы настоящего изобретения, могут быть в дальнейшем изменены, будучи подвергнутыми случайному мутагенезу путем ПЦР пониженной точности, случайных нуклеотидных вставок или других способов предварительной рекомбинации. Одна или несколько частей полинуклеотида, кодирующего молекулы настоящего изобретения, могут быть рекомбинированы с одним или несколькими компонентами, мотивами, секциями, частями, доменами, фрагментами, и т. д. одной или нескольких гетерологических молекул.

Настоящее изобретение также включает молекулы настоящего изобретения, содержащие вариантные Fc-участки (т.е. антитела, полипептиды), сопряженные с диагностическим или терапевтическим средством или любой другой молекулой, время полужизни которой в крови желательно увеличить и/или направить на определенную субпопуляцию клеток. Молекулы настоящего изобретения могут использоваться с помощью диагностики, например, для слежения за развитием или прогрессированием заболевания, нарушения или инфекции как части клинической тестовой процедуры, например, для определения эффективности данной схемы лечения. Обнаружение может быть облегчено путем связывания молекул настоящего изобретения с определяемым веществом. Примеры определяемых веществ включают различные ферменты, протезные группы, флуоресцентные материалы, люминистцентные материалы, биолюминисцентные материалы, радиоактивные материалы, позитрон-эмиссионные металлы и нерадиоактивные парамагнитные ионы металлов. Определяемое вещество может быть связано или сопряжено как непосредственно с молекулами настоящего изобретения, так и опосредовано через промежуточное вещество (такое как, например, линкер, известный на данном уровне техники) с использованием техник, известных на данном уровне развития техники. См., например, патент США № 4 741 900, касающийся ионов металлов, которые могут быть сопряжены с антителами для применения в качестве диагностического средства согласно настоящего изобретения. Такие диагностика и определение могут быть осуществлены путем связывания молекул настоящего изобретения с определяемыми веществами, включая без ограничения различные ферменты, ферменты, включающие без ограничения пероксидазу хрена, алкалиновую фосфатазу, бета-галактозидазу или ацетилхолинэстеразу; комплексы протезных групп, таких как, без ограничения, стрептавидин/биотин и авидин/биотин; флуоресцентные материалы, такие как, без ограничения, умбеллиферон, флуоресцеин, флуоресцеин изотиоцианат, родамин, дихлортриазиниламин флуоресцеин, дансил хлорид или фикоэритрин; люминисцентный материал, такой как, без ограничения, люминал; биолюминисцентные материалы, такие как, без ограничения, люцифераза, люциферин и экворин; радиоактивный материал, такой как, без ограничения, висмут (213Bi), углерод (14C), хром (51Cr), кобальт (57Co), фтор (18F), гадолиний (153Gd, 159Gd), галлий (68Ga, 67Ga), германий (68Ge), гольмий (166Ho), индий (115In, 113In, 112In, 111In), йод (131I, 125I, 123I, 121I), лантан (140La), лютеций (177Lu), марганец (54Mn), молибден (99Mo), палладий (103Pd), фосфор (32P), празеодимий (142Pr), прометий (149Pm), рений (186Re, 188Re), родий (105Rh), рутений (97Ru), самарий (153Sm), скандий (47Sc), селен (75Se), стронций (85Sr), сера (35S), технеций (99Tc), таллий (201Ti), олово (113Sn, 117Sn), тритий (3H), ксенон (133Xe), иттербий (169Yb, 175Yb), иттрий (90Y), цинк (65Zn); позитрон-эмиссионные металлы, используемые в различных позитрон-эмиссионных томографиях, и нерадиоактивные парамагнитные ионы металлов.

Молекулы настоящего изобретения (т.е. антитела, полипептиды), содержащие вариантный Fc-участок, могут быть сопряжены с терапевтическими фрагментами, такими как цитотоксин (например, цитостатическое средство или средство, разрушающее клетки), терапевтическое средство или радиоактивный элемент (например, альфа-излучатели, гамма-излучатели и т. д.). Цитотоксины или цитотоксические агенты включают любой агент, который является губительным для клетки. Примеры включают паклитаксел, цитохалазин B, грамицидин D, этидиум бромид, эметин, митомицин, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин, дигидрокси антрацин дион, митоксантрон, митрамицин, актиномицин D, 1-дегидротестостерон, глюкокортикоиды, прокаин, тетракаин, лидокаин, пропранолол и пиромицин и их аналоги или гомологи. Терапевтические средства включают без ограничения антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацил декарбазин), алкилирующие агенты (например, мехлоретамин, тиотепа хлорамбуцил, мелфалан, кармустин (BSNU) и ломустин (CCNU), циклотосфамид, бусульфан, дибромоманнитол, стрептозотоцин, митомицин С и цисдихлордиамин платины (II) (DDP) цисплатин), антрациклины (например, даунорубицин (ранее дауномицин) и доксорубицин), антибиотики (например, дактиномицин (ранее актиномицин), блеомицин, митрамицин и антрамицин (AMC) и анти-митотические агенты (например, винкристин и винбластин).

Более того молекула настоящего изобретения может быть сопряжена с терапевтическими фрагментам, такими как радиоактивные материалы или макроциклические хелаторы, пригодные для конъюгирования ионов радиометаллов (см. выше примеры радиоактивных материалов). В определенных вариантах осуществления макроциклическим хелатором является 1,4,7,10-тетраазациклододекан-N,N',N'',N'''-тетрауксусной кислоты (DOTA), который может быть присоединен к антителу через линкерную молекулу. Такие линкерные молекулы широко известны на данном уровне техники и описаны в Denardo et al., 1998, Clin Cancer Res. 4:2483-90; Peterson et al., 1999, Bioconjug. Chem. 10:553; and Zimmerman et al., 1999, Nucl. Med. Biol. 26:943-50, каждый из которых включен в данный документ в качестве ссылки во всем его объеме.

Техники конъюгирования таких терапевтических фрагментов с антителами являются хорошо известными; см., например, Arnon et al., “Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy”, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), 1985, pp. 243-56, Alan R. Liss, Inc.); Hellstrom et al., “Antibodies For Drug Delivery”, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), 1987, pp. 623-53, Marcel Dekker, Inc.); Thorpe, “Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review”, in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), 1985, pp. 475-506); “Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy”, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), 1985, pp. 303-16, Academic Press; and Thorpe et al., Immunol. Rev., 62:119-58, 1982.

В одном варианте осуществления, где молекула настоящего изобретения является антителом, содержащим вариантный Fc-участок, он может быть введен с или без терапевтического фрагмента, сопряженного с ним, введен самостоятельно или в комбинации с цитотоксическим фактором(ами) и/или цитокином(ами) для применения в качестве терапевтического лечения. Альтернативно антитело настоящего изобретения может быть сопряжено со вторым антителом для формирования гетероконъюгата антитела как описано в патенте США № 4 676 980, Segal, который включен в данный документ ссылкой во всем его объеме. Антитела настоящего изобретения также могут быть присоединены к твердым носителям, которые особенно полезны при иммунологических анализах или очистке целевого антигена. Такие твердые носители включают без ограничения стекло, целлюлозу, полиакриламид, нейлон, полистирол, поливинилхлорид или полипропилен.

6.2 СКРИНИНГ МОЛЕКУЛ С ВАРИАНТНЫМИ Fc-УЧАСТКАМИ ДЛЯ УВЕЛИЧЕНИЯ FcγRIII СВЯЗЫВАНИЯ И ИХ ХАРАКТЕРИСТИКИ

В предпочтительных вариантах осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки с измененными FcγR свойствами (например, увеличенная FcγRIIIA аффинность), выполнены с использованием техники дрожжевого дисплея в комбинации с одним или несколькими испытаниями на основе биохимии предпочтительно с высокой пропускной способностью, как описано в данном документе или как раскрыто в публикациях патентных заявок США 2005/0037000 и 2005/0064514 и в публикации международной патентной заявке WO 04/063351, каждый из которых включен в данный документ в качестве ссылки во всем его объеме. Один или несколько биохимических испытаний могут быть любым из испытаний, известных на данном уровне техники для идентифицирования Fc-FcγR взаимодействия, т.е. специфическое связывание Fc-участка с FcγR, включая без ограничения испытание ELISA, испытания поверхностного плазмонного резонанса, испытание иммунопреципитации, аффинной хроматографии и равновесного диализа. В некоторых вариантах осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки с измененными FcγR аффинностями (например, повышенная FcγRIIIA аффинность), выполнены с использованием техники дрожжевого дисплея, как описано в данном документе в комбинации с одним или несколькими функциональными испытаниями, предпочтительно с высокой пропускной способностью. Функциональные испытания могут быть любыми испытаниями, известными на данном уровне техники для характеристики одной или нескольких FcγR опосредованных эффекторных клеточных функций, таких как те, что описаны в данном документе в Разделе 6.2.7. Неограничивающие примеры эффекторных клеточных функций, которые могут использоваться в соответствии со способами настоящего изобретения, включают без ограничения антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC), антитело-зависимый фагоцитоз, фагоцитоз, опсонизацию, опсонофагоцитоз, клеточное связывание, розеткообразование, C1q связывание и комплемент-зависимую клеточно-опосредованную цитотоксичность. В некоторых вариантах осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки с измененными FcγR аффинностями (например, увеличенной FcγRIIIA аффинностью), выполнены с использованием техники дрожжевого дисплея, как описано в данном документе в комбинации с одним или несколькими биохимическими испытаниями в комбинации или параллельно с одним или несколькими функциональными испытаниями, предпочтительно с высокой пропускной способностью.

Термин "специфическое связывание" Fc-участка с FcγR относится к взаимодействию Fc-участка и отдельного FcγR, который имеет аффинную константу по меньшей мере около 150 нМ в случае мономерного FcγRIIIA и по меньшей мере около 60 нМ в случае димерного FcγRIIB, что определено с использованием, например, испытания ELISA или испытания поверхностного плазмонного резонанса (например, BIAcore™). Аффинная константа Fc-участка мономерного FcγRIIIA может быть 150 нМ, 200 нМ или 300 нМ. Аффинная константа Fc-участка для димерного FcγRIIB может быть 60 нМ, 80 нМ, 90 нМ или 100 нМ. Димерный FcγRIIB для применения в способах настоящего изобретения может быть создан с помощью способов, известных специалистам в данной области техники. Как правило, внеклеточный участок FcγRIIB ковалентно связан с гетерологичным полипептидом, который способен к димеризации, так, что полученный сплавленный белок является димером, например, см., заявку США № 60/439 709, поданную 13 января 2003 года (дело патентного поверенного № 11183-005-888), которая включена в данный документ ссылкой во всем объеме. Конкретное взаимодействие в целом является стабильным при физиологических условиях, включая, например, условия, которые случаются в жизни индивидуума, такого как человек, или же позвоночного или беспозвоночного животного, а также при условиях, которые случаются в клеточной культуре таких условий, которые используются для поддержания и культивирования клеток млекопитающих или клеток других позвоночных организмов и беспозвоночных организмов.

В определенном варианте осуществления скрининг и идентификация молекул, содержащих вариантные Fc-участки и измененные FcγR аффинности, включают: отображение молекулы, содержащей вариантный Fc-участок на поверхности дрожжей; и описание связывания молекулы, содержащей вариантный Fc-участок с FcγR (один или несколько), используя биохимическое испытание для определения Fc-FcγR взаимодействия, предпочтительно, испытание на основе ELISA. Как только молекула, содержащая вариантный Fc-участок, описана для ее взаимодействия с одним или несколькими FcγRs и определена, как имеющая измененную аффинность к одному или нескольким FcγR, путем по меньшей мере одного биохимического испытания, например, испытания ELISA, молекула может быть сконструирована в полноценный иммуноглобулин, используя способы стандартной рекомбинантной ДНК-технологии, известные на данном уровне техники, и иммуноглобулин, содержащий вариантный Fc-участок, экспрессированный в клетки млекопитающих для дальнейшего биохимического описания. Иммуноглобулин, в который вставлен вариантный Fc-участок настоящего изобретения (например, заменив Fc-участок иммуноглобулина), может быть любым иммуноглобулином, включая без ограничения поликлональные антитела, моноклональные антитела, биспецифические антитела, мультиспецифические антитела, гуманизированные анитела и химерные антитела. В предпочтительных вариантах осуществления вариантный Fc-участок вводится в иммуноглобулин, специфичный к рецептору поверхности клетки, опухолевому антигену или антигену злокачественной опухоли. Иммуноглобулин, в который вводится вариантный Fc-участок настоящего изобретения, может специфически связываться с антигеном злокачественной опухоли или опухолевым антигеном, например, включая без ограничения KS 1/4 карциноидный антиген (Perez and Walker, 1990, J. Immunol. 142: 3662-3667; Bumal, 1988, Hybridoma 7(4): 407-415), антиген карциномы яичников (CA125) (Yu et al., 1991, Cancer Res. 51(2): 468-475), простатический кислый фосфат (Tailor et al., 1990, Nucl. Acids Res. 18(16): 4928), простат-специфический антиген (Henttu and Vihko, 1989, Biochem. Biophys. Res. Comm. 160(2): 903-910; Israeli et al., 1993, Cancer Res. 53: 227-230), связанным с меланомой антиген p97 (Estin et al., 1989, J. Natl. Cancer Instit. 81(6): 445-446), антиген gp75 меланомы (Vijayasardahl et al., 1990, J. Exp. Med. 171(4): 1375-1380), высокомолекулярный антиген меланомы (HMW-MAA) (Natali et al., 1987, Cancer 59: 55-63; Mittelman et al., 1990, J. Clin. Invest. 86: 2136-2144), простат-специфический мембранный антиген, карциноэмбриональный антиген (CEA) (Foon et al., 1994, Proc. Am. Soc. Clin. ncol. 13: 294), антиген полиморфного эпителиального муцина, антиген жировых глобул грудного молока, антигены, связанные с колоректальной опухолью, такие как: CEA, TAG-72 (Yokata et al., 1992, Cancer Res. 52: 3402-3408), CO17-1A (Ragnhammar et al., 1993, Int. J. Cancer 53: 751-758); GICA 19-9 (Herlyn et al., 1982, J. Clin. Immunol. 2: 135), CTA-1 и LEA, антиген-38,13 лимфомы Беркитта, CD19 (Ghetie et al., 1994, Blood 83: 1329-1336), антиген-CD20 В-лимфомы человека (Reff et al., 1994, Blood 83:435-445), CD33 (Sgouros et al., 1993, J. Nucl. Med. 34:422-430), антигены, специфический к меланоме, такие как ганглиозид GD2 (Saleh et al., 1993, J. Immunol., 151, 3390-3398), ганглиозид GD3 (Shitara et al., 1993, Cancer Immunol. Immunother. 36:373-380), ганглиозид GM2 (Livingston et al., 1994, J. Clin. Oncol. 12: 1036-1044), ганглиозид GM3 (Hoon et al., 1993, Cancer Res. 53: 5244-5250), антиген опухоли конкретного трансплантационного типа клеточной поверхности (TSTA), такие как антигены опухолей, вызванных вирусом, включая T-антиген опухолевых ДНК вирусов и капсульные антигены опухолевых РНК вирусов, онкофетальный антиген- альфа-фетопротеин, такой как CEA толстой кишки, антиген опухоли мочевого пузыря (Hellstrom et al., 1985, Cancer. Res. 45:2210-2188), дифференцированные антигены, такие как антигены L6, L20 карциномы легких человека (Hellstrom et al., 1986, Cancer Res. 46: 3917-3923), антигены фибросаркомы, антиген-Gp37 Т-клеточной лейкемии человека (Bhattacharya-Chatterjee et al., 1988, J. of Immun. 141:1398-1403), неогликопротеин, сфигнолипиды, антеген злокачественной опухоли груди, такой как EGFR (рецептор эпидермального фактора роста), HER2 антиген (p185HER2), полиморфный эпителиальный муцин (PEM) (Hilkens et al., 1992, Trends in Bio. Chem. Sci. 17:359), антиген-APO-1 злокачественных лимфоцитов человека (Bernhard et al., 1989, Science 245: 301-304), дифференцированный антиген (Feizi, 1985, Nature 314: 53-57), такой как антиген I, обнаруженный в эритроцитах плода, основной эндодермальный антиген I, обнаруженный в эритроцитах взрослого чекловека, предимплантационных зародышах, I(Ma), обнаружен в аденокарциномах желудка, M18, M39, обнаруженные в эпителии молочной железы, SSEA-1, обнаруженный в миелоидных клетках, VEP8, VEP9, Myl, VIM-D5, D156-22, обнаруженные в колоректальной злокачественной опухоли, TRA-1-85 (группа крови H), C14, обнаруженный в аденокарциноме прямой кишки, F3, обнаруженный в аденокарциноме легких, AH6, обнаруженный в злокачественной опухоли желудка, Y гаптен, Ley, обнаруженные в клетках эмбриональной карциномы, TL5 (группа крови A), EGF рецептор, обнаруженный в A431 клетках, группы E1 (группа крови B), обнаруженные в злокачественной опухоли поджелудочной железы, FC10.2, обнаруженный в клетках эмбриональной карциномы, антеген желудочной аденокарциномы, CO-514 (группа крови Lea), обнаруженный в Аденокарциноме, NS-10, обнаруженный в аденокарциномах, CO-43 (группа крови Leb), G49, обнаруженный в EGF рецепторе клеток A431, MH2 (группа крови ALeb/Ley), обнаруженный в аденокарциноме толстого кишечника, 19.9, обнаруженный в злокачественной опухоли толстого кишечника, муцинах злокачественной опухоли желудка, T5A7, обнаруженный в миелоидных клетках, R24, обнаруженный в меланоме, 4.2, GD3, D1.1, OFA-1, GM2, OFA-2, GD2, и M1:22:25:8, обнаруженные в клетках эмбриональной карциномы, и SSEA-3 и SSEA-4, обнаруженные в эмбрионе от 4-й до 8-й клеточной стадии гистации. В одном варианте осуществления антиген является пептидом, полученным из рецептора Т-клетки, из лимфомы Т-клеток кожи (см., Edelson, 1998, The Cancer Journal 4:62).

Настоящее изобретение в частности касается варианта осуществления, в котором связывание Fc-участка с FcγR активирует клеточный эффектор, который нацелен на клетки, что структурируют антигены злокачественной опухоли, такие как A33 (антиген колоректальной карциномы; Almqvist, Y. 2006, Nucl Med Biol. Nov;33(8):991-998); B1 (Egloff, A.M. et al. 2006, Cancer Res. 66(1):6-9); BAGE (Bodey, B. 2002 Expert Opin Biol Ther. 2(6):577-84); бета- катенин (Prange W. et al. 2003 J Pathol. 201(2):250-9); CA125 (Bast, R.C. Jr. et al. 2005 Int J Gynecol Cancer 15 Suppl 3:274-81); CD5 (Calin, G.A. et al. 2006 Semin Oncol. 33(2):167-73; CD19 (Troussard, X. et al. 1998 Hematol Cell Ther. 40(4):139-48); CD20 (Thomas, D.A. et al. 2006 Hematol Oncol Clin North Am. 20(5):1125-36); CD22 (Kreitman, R.J. 2006 AAPS J. 18;8(3):E532-51); CD23 (Rosati, S. et al. 2005 Curr Top Microbiol Immunol. 5;294:91-107); CD25 (Troussard, X. et al. 1998 Hematol Cell Ther. 40(4):139-48); CD27 (Bataille, R. 2006 Haematologica 91(9):1234-40); CD28 (Bataille, R. 2006 Haematologica 91(9):1234-40); CD36 (Ge, Y. 2005 Lab Hematol. 11(1):31-7); CD40/CD154 (Messmer, D. et al. 2005 Ann N Y Acad Sci. 1062:51-60); CD45 (Jurcic, J.G. 2005 Curr Oncol Rep. 7(5):339-46); CD56 (Bataille, R. 2006 Haematologica 91(9):1234-40); CD79a/CD79b (Troussard, X. et al. 1998 Hematol Cell Ther. 40(4):139-48; Chu, P.G. et al. 2001 Appl Immunohistochem Mol Morphol. 9(2):97-106); CD103 (Troussard, X. et al. 1998 Hematol Cell Ther. 40(4):139-48); CDK4 (Lee, Y.M. et al. 2006 Cell Cycle 5(18):2110-4); CEA (карциноэмбриональный антиген; Mathelin, C. 2006 Gynecol Obstet Fertil. 34(7-8):638-46; Tellez-Avila, F.I. et al. 2005 Rev Invest Clin. 57(6):814-9); CTLA4 (Peggs, K.S. et al. 2006 Curr Opin Immunol. 18(2):206-13); EGF-R (рецептор эпидермального фактора роста; Adenis, A. et al. 2003 Bull Cancer. 90 Spec No:S228-32); Erb (ErbB1; ErbB3; ErbB4; Zhou, H. et al. 2002 Oncogene 21(57):8732-40; Rimon, E. et al. 2004 Int J Oncol. 24(5):1325-38); GAGE (GAGE-1; GAGE-2; Akcakanat, A. et al. 2006 Int J Cancer. 118(1):123-8); GD2/GD3/GM2 (Livingston, P.O. et al. 2005 Cancer Immunol Immunother. 54(10):1018-25); gp100 (Lotem, M. et al. 2006 J Immunother. 29(6):616-27); HER-2/neu (Kumar, Pal S et al. 2006 Semin Oncol. 33(4):386-91); папилломавирус E6 человека / папилломовирус E7 человека (DiMaio, D. et al. 2006 Adv Virus Res. 66:125-59; KSA (17-1A) (Ragupathi, G. 2005 Cancer Treat Res. 123:157-80); MAGE (MAGE-1; MAGE-3; (Bodey, B. 2002 Expert Opin Biol Ther. 2(6):577-84); MART (Kounalakis, N. et al. 2005 Curr Oncol Rep. 7(5):377-82; MUC-1 (Mathelin, C. 2006 Gynecol Obstet Fertil. 34(7-8):638-46); MUM-1 (Castelli, C. et al. 2000 J Cell Physiol. 182(3):323-31); N-ацетилглукозаминилтрансфераза (Dennis, J.W. 1999 Biochim Biophys Acta. 6;1473(1):21-34); p15 (Gil, J. et al. 2006 Nat Rev Mol Cell Biol. 7(9):667-77); PSA (специфический антиген простаты; Cracco, C.M. et al. 2005 Minerva Urol Nefrol. 57(4):301-11); PSMA (Ragupathi, G. 2005 Cancer Treat Res. 123:157-80); sTn (Holmberg, L.A. 2001 Expert Opin Biol Ther. 1(5):881-91); TNF-рецептор (TNF-α рецептор, TNF-ß рецептор; или TNF-γ рецептор; van Horssen, R. et al. 2006 Oncologist. 11(4):397-408; Gardnerova, M. et al. 2000 Curr Drug Targets. 1(4):327-64); или рецептор VEGF (O'Dwyer. P.J. 2006 Oncologist. 11(9):992-8). Также представляют интерес антигены, специфические к особым инфекционным агентам, например, вирусные агенты включают без ограничения вирус иммунодефицита человека (HIV), вирус гепатита B (HBV), гриппа, вирус папилломы человека (HPV), ног и рта (вирусы коксаки), вирус бешенства, вирус простого герпеса (HSV), и возбудители гастроэнтеритов, включая ротавирусы, аденовирусы, калицивирусы, астровирусы и вирус Норуолк; бактериальные агенты включают без ограничения E. coli, Salmonella thyphimurium, Pseudomonas aeruginosa, Vibrio cholerae, Neisseria gonorrhoeae, Helicobacter pylori, Hemophilus influenzae, Shigella dysenteriae, Staphylococcus aureus, Mycobacterium tuberculosis и Streptococcus pneumoniae, грибковые агенты и паразиты, такие как Giardia.

В некоторых вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в анти-флуоресцентное моноклональное антитело, 4-4-20 (Kranz et al., 1982 J. Biol. Chem. 257(12): 6987-6995; который включен в данный документ ссылкой во всем его объеме). В других вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в мышино-человечское химерное анти-CD20 моноклональное антитело 2H7, которое распознает фосфопротеин поверхности клетки CD20 на В клетках (Liu et al., 1987, Journal of Immunology, 139: 3521-6; который включен в данный документ ссылкой во всем его объеме). В других вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в гуманизированное антитело (Ab4D5) против рецептора 2 эпидермального фактора роста человека (p185 HER2), как описано Carter et al. (1992, Proc. Natl. Acad. Sci. USA 89: 4285-9; который включен в данный документ ссылкой во всем его объеме). В других же вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в гуманизированное анти-TAG72 антитело (CC49) (Sha et al., 1994 Cancer Biother. 9(4): 341-9). В других вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в Ритуксан, который используется для лечения лимфом.

В другом определенном варианте осуществления настоящее изобретение включает конструирование анти-FcγRIIB антитела, включая без ограничения любые антитела, раскрытые в публикациях патентных заявок США 2005/02157667; 2004/0185045; 2005/0260213; или 2006/013810; международных публикациях патентных заявок WO 2005/110474 или WO 2005/115452; патентной заявке США 11/305787, поданной 15 декабря 2005 года; или предварительных заявках № 60/809,116; 60/816,126; или 60/816,688, поданных 26 мая 2006 года, 23 июня 2006 года или 26 июня 2006 года соответственно путем модификации (например, замещения, вставки, делеции) по меньшей мере одного аминокислотного остатка, модификация которого увеличивает аффинность Fc-участка к FcγRIIIA и/или FcγRIIA. Каждый из упомянутых выше материалов вставлен в данный документ в качестве ссылки во всем его объеме. Примерами анти-FcγRIIB антител, которые могут быть или не могут быть гуманизированы, что может быть сконструировано в соответствии со способами настоящего изобретения, являются 2B6 моноклональным антителом, имеющим ATCC регистрационный номер PTA-4591 и 3H7, имеющим ATCC регистрационный номер PTA-4592, 1D5 моноклональное антитело, имеющее ATCC регистрационный номер PTA-5958, 1F2, имеющее ATCC регистрационный номер PTA-5959, 2D11 моноклональное антитело, имеющее ATCC регистрационный номер PTA-5960, 2E1 моноклональное антитело, имеющее ATCC регистрационный номер PTA-5961, и 2H9 моноклональное антитело, имеющее ATCC регистрационный номер PTA-5962 (все задепонированы 10801 University Boulevard, Manassas, VA 02209-2011), которые вставлены в данный документ в качестве ссылок. В другом определенном варианте осуществления модификация анти-FcγRIIB антитела может также в дальнейшем уменьшить аффинность Fc-участка к FcγRIIB. В еще одном определенном варианте осуществления сконструированное анти-FcγRIIB антитело может в дальнейшем иметь усиленную эффекторную функцию, как определено стандартными испытаниями, известными на данном уровне техники и раскрыто и приведено в данном документе в качестве примера. В некоторых вариантах осуществления вариантный Fc-участок настоящего изобретения вводится в терапевтическое моноклональное антитело, специфическое к антигену злокачественной опухоли или рецептору поверхности клетки, включая без ограничения Erbitux™ (также известный как IMC-C225) (ImClone Systems Inc.), химерное моноклональное антитело против EGFR; HERCEPTIN® (Трастузумаб) (Genentech, CA), которое является гуманизированным анти-HER2 моноклональным антителом для лечения пациентов с метастатическим раком молочной железы; REOPRO® (абциксимаб) (Centocor), который является анти-гликопротеиновым IIb/IIIa рецептором тромбоцитов для предотвращения образование тромбов; ZENAPAX® (даклизумаб) (Roche Pharmaceuticals, Швейцария), который является иммунодепрессивным, гуманизированным анти-CD25 моноклональным антителом для предотвращения острого отторжения почечного аллотрансплантата. Другими примерами являются гуманизированное анти-CD18 F(ab')2 (Genentech); CDP860, которое представляет собой гуманизированное анти-CD18 F(ab')2 (Celltech, Великобритания); PRO542, которое представляет собой анти-HIV gp120 антитело сплавленное с CD4 (Progenics/Genzyme Transgenics); C14, которое представляет собой анти-CD14 антитело (ICOS Pharm); гуманизированное анти-VEGF IgG1 антитело (Genentech); OVAREX™, которое представляет собой мышиное анти-CA 125 антитело (Altarex); PANOREX™, которое представляет собой мышиное IgG2a антитело анти-17-IA антигена клеточной поверхности (Glaxo Wellcome/Centocor); IMC-C225, которое представляет собой химерное анти-EGFR IgG антитело (ImClone System); VITAXIN™, которое представляет собой гуманизированное анти-αVβ3 интегриновое антитело (Applied Molecular Evolution/MedImmune); Кампат 1H/LDP-03, которое представляет собой гуманизированное анти CD52 IgG1 антитело (Leukosite); Smart M195, которое представляет собой гуманизированное анти-CD33 IgG антитело (Protein Design Lab/Kanebo); RITUXAN™, которое является химерным анти-CD20 IgG1 антителом (IDEC Pharm/Genentech, Roche/Zettyaku); LYMPHOCIDE™, которое представляет собой гуманизированное анти-CD22 IgG антитело (Immunomedics); Smart ID10, которое представляет собой гуманизированное анти-HLA антитело (Protein Design Lab); ONCOLYM™ (Lym-1) представляет собой радиоактивно меченное мышиное анти-HLA DR антитело (Techniclone); анти-CD11a представляет собой гуманизированное IgG1 антитело (Genetech/Xoma); ICM3 представляет собой гуманизированное анти-ICAM3 антитело (ICOS Pharm); IDEC-114 представляет собой приматизированное анти-CD80 антитело (IDEC Pharm/Mitsubishi); ZEVALIN™ представляет собой радиоактивно меченное мышиное анти-CD20 антитело (IDEC/Schering AG); IDEC-131 представляет собой гуманизированное анти-CD40L антитело (IDEC/Eisai); IDEC-151 представляет собой приматизированное анти-CD4 антитело (IDEC); IDEC-152 представляет собой приматизированное анти-CD23 антитело (IDEC/Seikagaku); SMART anti-CD3 представляет собой гуманизированное анти-CD3 IgG антитело (Protein Design Lab); 5G1.1 представляет собой гуманизированное анти-комплементное антитело фактора 5 (C5) (Alexion Pharm); IDEC-151 представляет собой приматизированное анти-CD4 IgG1 антитело (IDEC Pharm/SmithKline Beecham); MDX-CD4 представляет собой гуманизированное анти-CD4 IgG антитело (Medarex/Eisai/Genmab); CDP571 представляет собой гуманизированное анти-TNF-α IgG4 антитело (Celltech); LDP-02 представляет собой гуманизированное анти-α4β7 антитело (LeukoSite/Genentech); OrthoClone OKT4A представляет собой гуманизированное анти-CD4 IgG антитело (Ortho Biotech); ANTOVA™ представляет собой гуманизированное анти-CD40L IgG антитело (Biogen); ANTEGREN™ представляет собой гуманизированное анти-VLA-4 IgG антитело (Elan); MDX-33 представляет собой человеческое анти-CD64 (FcγR) антитело (Medarex/Centeon); rhuMab-E25 представляет собой гуманизированное анти-IgE IgG1 антитело (Genentech/Norvartis/Tanox Biosystems); IDEC-152 представляет собой приматизированное анти-CD23 антитело (IDEC Pharm); ABX-CBL представляет собой мышиное анти CD-147 IgM антитело (Abgenix); BTI-322 представляет собой крысиное анти-CD2 IgG антитело (Medimmune/Bio Transplant); Orthoclone/OKT3 представляет собой мышиное анти-CD3 IgG2a антитело (ortho Biotech); SIMULECT™ представляет собой химерное анти-CD25 IgG1 антитело (Novartis Pharm); LDP-01 представляет собой гуманизированное анти-β2-интегрин IgG антитело (LeukoSite); Anti-LFA-1 представляет собой мышиное анти CD18 F(ab')2 (Pasteur-Merieux/Immunotech); CAT-152 представляет собой человеческое анти-TGF-β2 антитело (Cambridge Ab Tech); и Corsevin M представляет собой химерное анти-Фактор VII антитело (Centocor).

Вариантные Fc-участки настоящего изобретения, предпочтительно в контексте иммуноглобулина, могут быть в дальнейшем охарактеризованы с использованием одного или нескольких биохимических испытаний и/или одного или нескольких функциональных испытаний предпочтительно с высокой пропускной способностью. В некоторых альтернативных вариантах осуществления вариантные Fc-участки настоящего изобретения не вводятся в иммуноглобулин и далее характеризуются с использованием одного или нескольких биохимических испытаний и/или одного или нескольких функциональных испытаний с высокой пропускной способностью. Один или несколько биохимических испытаний могут быть любым испытанием, известным на данном уровне техники, для идентифицирования Fc-FcγR взаимодействий, включая без ограничения испытание ELISA, и метод поверхностного плазмонного резонанса для определения кинетических параметров Fc-FcγR взаимодействия, например, BIAcore испытание. Одним или несколькими функциональными испытаниями может быть любое известное на данном уровне техники испытание для характеристики одной или нескольких FcγR опосредованных эффекторных клеточных функций, как известно специалистам в данной области техники или описано в данном документе. В определенных вариантах осуществления иммуноглобулины, содержащие вариантные Fc-участки, исследуются испытанием ELISA для связывания одного или нескольких FcγRs, например, FcγRIIIA, FcγRIIA, FcγRIIA; с последующим одним или несколькими ADCC испытаниями. В некоторых вариантах осуществления иммуноглобулины, содержащие вариантные Fc-участки, анализировали в дальнейшем, используя испытание поверхностного плазмонного резонанса, например, BIAcore. Метод поверхностного плазмонного резонанса является хорошо известным на данном уровне техники, в дальнейшем обсуждается в Разделе 6.2.7 и приводится в данном документе в качестве примера в Примере 7.8.

Пример испытания с высокой пропускной способностью для характеристики иммуноглобулинов, содержащих вариантные Fc-участки, может включать: введение вариантного Fc-участка настоящего изобретения, например, путем методов стандартной рекомбинантной ДНК технологии, в 4-4-20 антитело; характеристику специфического связывания 4-4-20 антитела, содержащего вариантный Fc-участокс FcγR (например, FcγRIIIA, FcγRIIB) в испытании ELISA; характеристику 4-4-20 антитела, содержащего вариантный Fc-участок в испытании ADCC (используя способы, раскрытые в данном документе), где целевые клетки опсонизируются с 4-4-20 антителом, содержащим вариантный Fc-участок; вариантный Fc-участок затем может быть клонирован во второй иммуноглобулин, например, 4D5, 2H7, и этот второй иммуноглобулин характеризуется в испытании ADCC, где целевые клетки опсонизируются со вторым антителом, содержащим вариантный Fc-участок. Второе антитело, содержащее вариантный Fc-участок затем анализируется с использованием испытания ELISA для подтверждения специфического связывания с FcγR.

Предпочтительно, чтобы вариантный Fc-участок настоящего изобретения связывал FcγRIIIA и/или FcγRIIA с более высокой аффинностью, чем Fc-участок дикого типа, что определено в испытании ELISA. Наиболее предпочтительно, чтобы вариантный Fc-участок настоящего изобретения связывал FcγRIIIA и/или FcγRIIA с более высокой аффинностью и связывал FcγRIIB с меньшей аффинностью, чем Fc-участок дикого типа, что определено в испытании ELISA. В некоторых вариантах осуществления вариантный Fc-участок связывает FcγRIIIA и/или FcγRIIA с по крайней мере в 2-раза большей, по крайней мере в 4-раза большей, более предпочтительно по крайней мере в 6-раз большей, наиболее предпочтительно по крайней мере от 8 до 10-раз большей аффинностью, чем Fc-участок дикого типа связывает FcγRIIIA и/или FcγRIIA и связывает FcγRIIB с по крайней мере в 2-раза меньшей, по крайней мере в 4-раза меньшей, более предпочтительно по крайней мере в 6-раз меньшей, наиболее предпочтительно по крайней мере от 8 до 10-раз меньшей аффинностью, чем Fc-участок дикого типа связывает FcγRIIB, что определено в испытании ELISA.

Иммуноглобулин, содержащий вариантные Fc-участки, может быть проанализирован в любой момент, используя испытание на основе поверхностного плазмонного резонанса, например, BIAcore, для определения кинетических параметров Fc-FcγR взаимодействия, используя способы, раскрытые в данном документе и известные специалистам в данной области техники. Предпочтительно, чтобы Kd вариантного Fc-участка настоящего изобретения для связывания мономерного FcγRIIIA и/или FcγRIIA, как определено с помощью испытания BIAcore, составлял около 100 нМ, предпочтительно около 70 нМ, более предпочтительно около 40 нМ.; и Kd вариантного Fc-участка настоящего изобретения для связывания димерного FcγRIIB составляет около 80 нМ, около 100 нМ, более предпочтительно около 200 нМ.

В большинстве предпочтительных вариантах осуществления иммуноглобулин, содержащий вариантные Fc-участки, также характеризуется в модельном животном для взаимодействия с FcγR. Предпочтительными модельными животными для использования в способах настоящего изобретения являются, например, трансгенные мыши, экспрессирующие человеческий FcγRs, например, любая мышиная модель, описанная в патентах США №№ 5 877 397 и 6 676 927, которые включены в данный документ в качестве ссылок во всем их объеме. Трансгенные мыши для применения в способах настоящего изобретения включают без ограничения нокаутированные голые FcγRIIIA мышей, несущие человеческий FcγRIIIA; нокаутированные голые FcγRIIIA мышей, несущие человеческий FcγRIIA; нокаутированные голые FcγRIIIA мышей, несущие человеческий FcγRIIB и человеческий FcγRIIIA; нокаутированные голые FcγRIIIA мышей, несущие человеческий FcγRIIB и человеческий FcγRIIA; нокаутированные голые FcγRIIIA и FcγRIIA мышей, несущие человеческие FcγRIIIA и FcγRIIA и нокаутированные голые FcγRIIIA, FcγRIIA и FcγRIIB мышей, несущие человеческие FcγRIIIA, FcγRIIA и FcγRIIB.

6.2.1 СТРАТЕГИИ РАЗРАБОТКИ

Настоящее изобретение охватывает способы конструирования получения Fc вариантов, включая без ограничения вычислительные стратегии разработки, библиотечные способы получения и способы экспериментального получения и проверки. Эти стратегии можно применить индивидуально или в различных комбинациях для конструирования Fc-вариантов настоящего изобретения.

В большинстве предпочтительных вариантов осуществления способы конструирования настоящего изобретения содержат способы, в которых аминокислоты на границе контакта между Fc-участком и Fc-лигандом не модифицированы. Fc-лиганды включают, но не ограничиваются, FcγR, C1q, FcRn, C3, рецептором маннозы, белком A, белком G, рецептором маннозы и неисследованными молекулами, которые связывают Fc. Аминокислоты на границе контакта между Fc-участком и Fc-лигандом определяют, как те аминокислоты, которые прямо и/или непрямо связывают Fc-участок и лиганд, играют структурную роль в определении конформации границы контакта или в пределах по меньшей мере 3 ангстрем, в основном, по меньшей мер 2 ангстрем друг от друга, что определено структурным анализом, таким как рентгеновской кристаллографией и молекулярным моделированием. Аминокислоты на границе контакта между Fc-участком и Fc-лигандом включают такие аминокислоты, которые прямо контактируют с FcγR на основе кристаллографических и структурных анализов Fc-FcγR взаимодействий подобных, раскрытых Sondermann и соавт., (2000, Nature, 406: 267-273; что включенно в данный документ ссылкой во всей своей полноте). Примеры положений в пределах Fc-участка, который прямо контактирует с FcγR, являются аминокислоты 234-239 (шарнирный участок), аминокислоты 265-269 (B/C петля), аминокислоты 297-299 (C'/E петля) и аминокислоты 327-332 (F/G) петля. В некоторых вариантах осуществления, молекулы настоящего изобретения, содержащие различные Fc-участки, включают модификацию по меньшей мере одного остатка, который не имеет прямого контакта с FcγR на основе структурного и кристаллографического анализов, например, не в пределах Fc-FcγR сайта связывания.

Преимущественно способы конструирования в настоящем изобретении не модифицируют никакие из аминокислот, что идентифицировано Shields и соавт., находящихся в CH2 домене Fc-участка, ближайшему к шарнирному участку, например, Leu234-Pro238; Ala327, Pro329, и влияют на связывание Fc-участка со всеми FcγR человека.

В других вариантах осуществления, настоящее изобретение включает Fc варианты с измененным сродством FcγR и/или измененными эффекторными функциями, так, что Fc вариант не имеет модификации аминокислоты в положении на границе между Fc-участком и Fc-лигандом. Предпочтительно, такие Fc варианты в комбинации с одним или несколькими другими аминокислотными модификациями на границе между Fc-участком и Fc-лигандом имеют дальнейшее влияние на частично измененное свойство, например измененное сродство FcγR. Модифицирование аминокислот на границе между Fc и Fc-лигандом может быть достигнуто с использованием способов, известных в данном уровне техники, например на основании структурного анализа комплексов Fc-лигандов. Например, но без ограничения, исследованием энергетически предпочтительных замен в Fc позициях, что влияет на границу связывания, варианты могут быть созданы так, чтобы выбрать новые конформации границы контакта, некоторые из которых могут улучшать связывание с Fc-лигандом, некоторые из которых могут снижать связывание с Fc-лигандом и некоторые из которых могут иметь другие предпочтительные свойства. Такие новые конформации границы контакта могут быть результатом, например, прямого взаимодействия с остатками Fc-лиганда, формирующими границу или непрямыми воздействиями, вызванными аминокислотными модификациями, такими как перестройка боковой цепи или скелетные конформации.

Настоящее изобретение включает создание Fc вариантов, включающих любую из аминокислотных модификаций, раскрытых в данном документе в комбинации с другими модификациями, в которых изменена конформация Fc углевода в положении 297. Настоящее изобретение включает конформационные и композиционные изменения в углеводе N297, что приводит к требуемому свойству, например к увеличению или снижению сродства для FcγR. Такие модификации могут в дальнейшем усиливать фенотип исходной аминокислотной модификации Fc вариант настоящего изобретения. Хотя не предполагается связь по определенному механизму действия, подобная стратегия сопровождается наблюдением, что структура и конформация углевода существенно влияет на связывание Fc-FcγR и Fc/Cl q (Umaha et aL, 1999, Nat Biotechnol 17:176-180; Davies et aL, 2001, Biotechnol Bioeng 74:288-294; Mimura et aL, 2001, J Biol Chem 276:45539 ; Radaev et aL, 2001, J Biol Chem 276:16478-16483; Shields et aL 2002, J Biol Chem 277:26733-26740; Shinkawa et aL, 2003, J Biol Chem 278:3466-3473).

Другая стратегия разработки для создания Fc вариантов в соответствии с данным изобретением предусматривает перестройку Fc-участка для устранения структурной и функциональной зависимости от гликозилирования. Эта стратегия разработки включает оптимизацию Fc структуры, стабильности, растворимости и/или Fc функции (например, сродство Fc к одному или нескольким Fc-лигандам) в отсутствии углевода N297. В одном подходе позиции, которые подвергают воздествию расторителя в отсутствии гликозилирования, создают так, что они стабильны, структурно связанны с Fc структурой и не имеют склонности к агрегации. Подходы к оптимизации негликозилированного Fc могут включать, но не ограничиваться, разработками модификаций аминокислот, которые повышают стабильность и/или растворимость негликозилированных Fc, путем включения полярных и/или заряженных остатков, оказывающихся внутри оси димера Cg2-Cg2 и путем создания модификаций аминокислот, прямо усиливающих границу контакта негликозилированных Fc-FcγR или границу контакта негликозилированного Fc с некотрым другим Fc-лигандом.

Fc варианты настоящего изобретения можно объединить с другими Fc модификациями, включая, без ограничения, модификации, которые изменяют эффекторную функцию. Настоящее изобретение включает комбинирование Fc варианта настоящего изобретения с другими Fc модификациями для того, чтобы предоставить добавочные, синергичные или новые свойства антител или Fc слияний. Такие модификации могут быть в CH1, CH2 или CH3 доменах или их комбинациях. Предпочтительно Fc варианты настоящего изобретения усиливают свойство модификации, с которой они объединяются. Например, если Fc вариант настоящего изобретения объединить с мутантом, известным тем, что связывает FcγRIIIA с бόльшим сродством, чем аналогичная молекула, содержащая дикий тип Fc-участка; комбинация с мутантом настоящего изобретения приводит к многократному усилению в сродстве FcγRIIIA.

В одном варианте осуществления, Fc варианты настоящего изобретения могут быть объединены с другими известными Fc вариантами, как например теми раскрытыми в Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, Mol Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al., 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett. 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al, 1996, Immunol Lett 54:101-104; Lund et al, 1996, J Immunol 157:49634969; Armour et aL, 1999, Eur J Immunol 29:2613-2624; Idusogie et al, 2000, J Immunol 164:41784184; Reddy et al, 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200:16-26; Idusogie et al, 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Jefferis et al, 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490); патенты США: 5624821, 5885573, 6194551; PCT WO 00/42072; PCT WO 99/58572; каждый из которых включен в данный документ ссылкой во всей своей полноте.

6.2.2 ФУНКЦИОНАЛЬНОЕ ИССЛЕДОВАНИЕ МОЛЕКУЛЫ С ВАРИАНТНЫМИ Fc-УЧАСТКАМИ

Настоящее изобретение включает характеристику молекул настоящего изобретения (например, антитело, содержащее измененный Fc-участок, идентифицированное с помощью технологии дрожжевого дисплея и исследования связывания FcγR-Fc, раскрытые в публикациях заявок на патенты США №№ 2005/0037000 и 2005/0064514 и в публикации международной патентной заявки WO 04/063351 (каждый из которых включен ссылкой полностью в настоящий документ); или терапевтические моноклональные антитела, сконструированные в соответствии со способами настоящего изобретения), используя исследования, известные специалистам данной области техники для идентификации эффекторной клеточной функции молекул. В частности, настоящее изобретение включает характеризуемые молекулы настоящего изобретения для FcγR-опосредованной эффекторной функции клетки. Примеры эффекторных функций клеток, которые могут быть исследованы согласно настоящему изобретению, включают, но не ограничиваются, антитело-зависимую клеточную цитотоксичность, фагоцитоз, опсонизацию, опсонофагоцитоз, связывание C1q и комплемент зависимую опосредованную клеткой цитотоксичность. Для определения функциональной эффекторной активности клетки могут быть использованы любые клеточные или бесклеточные исследования, известные специалистам в данной области техники (Для исследований эффекторных клеток, см. Perussia et al., 2000, Methods Mol. Biol. 121: 179-92; Baggiolini et al., 1998 Experientia, 44(10): 841-8; Lehmann et al., 2000 J. Immunol. Methods, 243(1-2): 229-42; Brown EJ. 1994, Methods Cell Biol., 45: 147-64; Munn et al., 1990 J. Exp. Med., 172: 231-237, Abdul-Majid et al., 2002 Scand. J. Immunol. 55: 70-81; Ding et al., 1998, Immunity 8:403-411, каждый из которых включен ссылкой в данный документ во всей своей полноте).

В одном варианте осуществления, молекулы настоящего изобретения могут быть исследованы для FcγR-опосредованного фагоцитоза в моноцитах человека. Альтернативно, FcγR-опосредованный фагоцитоз молекул настоящего изобретения может быть исследован в других фагоцитах, например, нейтрофилах (полиморфноядерных лейкоцитах; PMN); моноцитах периферической крови человека, макрофаги, полученные из моноцитов, которые могут быть получены стандартными способами, известными специалистам в данной области техники (например, см. Brown EJ. 1994, Methods Cell Biol., 45: 147-164). В одном варианте осуществления функцию молекул настоящего изобретения характеризуют путем определениея способности THP-1 клеток к фагоцитозу флуоресцентных IgG-опсонированных овечьих эритроцитов (SRBC) ранее описанными способами (Tridandapani et al., 2000, J. Biol. Chem. 275: 20480-7). Например, характерное исследование фагоцитоза молекулы настоящего изобретения, содержащей вариантные Fc-участки с усиленным сродством к FcγRIIIA, составляющие: обработку THP-1 клеток с молекулой настоящего изобретения или с контрольным антителом, которое не связывается с FcγRIIIA, сравнение уровней активности указанных клеток, где разница в активностях клеток (например, активности розеткообразования (количество THP-1 клеток, связывающих IgG-покрытые SRBC), активность адгезии (общее количество SRBC связанных с THP-1 клетками) и скорость фагоцитоза) будет указывать на функциональность молекулы настоящего изобретения. Специалистом в данной области может быть высоко оценено то, что этот характерное исследование может использоваться для исследования любых молекул, идентифицированных способами настоящего изобретения.

Другой характерное исследование для определения фагоцитоза молекул настоящего изобретения - антитело-зависимая опсоно-фагоцитарная реакция (ADCP), которая заключается в следующем: покрытая мишенью биочастица, такая как Escherichia coli-меченный FITC (молекулярные зонды) или Staphylococcus aureus-FITC с (i) антителом дикого типа 4-4-20, антителом к флуоресцеину (см. Bedzyk et al., 1989, J. Biol. Chem, 264(3): 1565-1569, который включен в данный документ ссылкой во всей своей полноте), в качестве контрольного антитела для FcγR-зависимого ADCP; или (ii) 4-4-20 антитело, содержащее мутацию D265A, которое делает невозможным связывание с FcγRIII, в качестве предпосылки контроля для FcγR-зависимого ADCP, (iii) 4-4-20 антитело, несущее вариантные Fc-участки, идентифицированные способами настоящего изобретения и полученные как представлено в Примере 7.6; и формируя опсонированную частицу; добавляя любую из описанных (i-iii) опсонированных частиц к THP-1 эффекторным клеткам (клеточная линия моноцитов доступная от ATCC) в соотношении 60:1 позволяет произойти FcγR-опосредованному фагоцитозу; предпочтительно инкубирование клеток и E. coli-FITC/антитело при 37°C на протяжении 1,5 часов; добавление трипана синего после инкубации (предпочтительно при комнатной температура в течение 2-3 мин.) к клеткам для подавления флуоресценции бактерий, которые адгезируются на поверхности клеток, не будучи поглощенным; перенос клеток в FACS буфер (например, 0,1%, BSA в PBS, 0,1%, азид натрия), анализ флуоресценции THP1 клеток с использованием FACS (например, BD FACS Calibur). Предпочтительно, THP-1 клетки, использованные в исследовании, анализировались FACS на экспрессию FcγR на клеточной поверхности. THP-1 клетки экспрессируют как CD32A, так и CD64. CD64 - FcγR с высоким сродством, который блокируется при проведении ADCP исследования в соответствии со способами настоящего изобретения. THP-1 клетки предпочтительно блокируются 100 мкг/мл растворимого IgG1 или 10% сывороткой человека. Для анализа степени ADCP, ворота предпочтительно устанавливают на THP-1 клетках, и вычисялют среднюю интенсивность флуоресценции. ADCP активность для отдельных мутантов вычисляют и описывают в качестве нормального значения для полученного дикого типа chMab 4-4-20. Опсонированные частицы добавляют к THP-1 клеткам так, чтобы соотношение опсонированных частиц к THP-1 клеткам составляло 30:1 или 60:1. В более предпочтительных вариантах осуществления, ADCP исследование проводят с контролем, таким как E. coli-FITC в среде, E. coli-FITC и THP-1 клетками (для обеспечения в качестве FcγR-независимой ADCP активности), E. coli-FITC, THP-1 клетки и антитело дикого типа 4-4-20 (для обеспечения в качестве FcγR-зависимой ADCP активности), E coli-FITC, THP-1 клетки, 4-4-20 D265A (для обеспечения в качестве фонового контроля для FcγR-зависимой ADCP активности).

В другом варианте осуществления, молекулы настоящего изобретения могут быть исследованы на FcγR-опосредованную ADCC активность в эффекторных клетках, например, натуральных клетках-киллерах, с использованием одного из стандартных способов, известных специалистам в данной области техники (См., например, Perussia et al., 2000, Methods Mol. Biol. 121: 179-92). Характерным исследованием для определения ADCC активности молекулы настоящего изобретения является таковое на основе анализа высвобождения 51Cr, который включает в себя следующее: клетки-мишени, меченные [51Cr]Na2CrO4 (эта клетачно-мембранная растворимая молекула широко испльзовалась для мечения, поскольку она связывает цитоплазматические белки и, несмотря на то, что она спонтанно высвобождается из клеток со слабой кинетикой, она высвобождается массово, приводя к некрозу клеток-мишеней); опсонирование клеток-мишеней молекулами настоящего изобретения, содержащими вариантные Fc-участки; комбинирование опсонированных клеток-мишеней с радоиактивной меткой с эфекторными клетками в микротирационном планшете в подходящем соотношении клеток-мишеней к эффекторным клеткам; инкубирование смеси клеток на протяжении 16-18 часов при 37°C; сбор супернатантов; и анализ радиоактивности. Цитотоксичность молекул настоящего изобретения может быть затем определена, например использованием следующей формулы: % лизиса = (экспериментальное количество в минуту - вытекание целевой клетки количество в минуту)/(детергентный лизис количество в минуту - вытекание целевой клетки количество в минуту) x 100%. Альтернативно, % лизиса =(ADCC-AICC)/(максимум спонтанного высвобождения). Специфический лизис может быть вычислен по формуле: специфический лизис = % лизиса с молекулами настоящего изобретения - % лизиса в отсутствии молекул настоящего изобретения. Диаграмму можно построить в зависимости от цели: соотношение эффекторных клеток или концентрация антител.

В еще одном варианте осуществления, молекулы настоящего изобретения характеризуют на антитело зависимую клеточную цитотоксичность (ADCC) см., например, Ding et al., Immunity, 1998, 8:403-11; который включен в данный документ ссылкой во всей своей полноте.

Предпочтительно, эффекторные клетки, используемые в ADCC исследованиях настоящего изобретения, это мононуклеарные клетки периферической крови (PBMC), которые в основном получают из нормальной человеческой крови, с использованием стандартных способов, известных специалистам в данной области, например, с использованием центрифугирования в градиенте плотности Ficoll-Paque. Предпочтительные эффекторные клетки, применяемые в способах настоящего изобретения, экспрессируют различные FcγR активирующие рецепторы. Настоящее изобретение включает, эффекторные клетоки, THP-1, экспрессирующие FcγRI, FcγRIIA и FcγRIIB и первичные макрофаги полученные из моноцитов полученных из цельной крови человека, экспрессирующие как FcγRIIIA, так и FcγRIIB, для определения того, демонстрируют ли мутанты Fc антител сниженную ADCC активность и фагоцитоз, по сравнению с диким типом IgG1 антител.

Клеточная линия моноцитов человека, THP-1, активирует фагоцитоз через экспрессию высоко аффинного рецептора FcγRI и низко аффинного рецептора FcγRIIA (Fleit et al., 1991, J. Leuk. Biol. 49: 556). THP-1 клетки не конститутивно экспрессируют FcγRIIA или FcγRIIB. Стимулирование этих клеток цитокинами вызывает паттерн экспрессии FcR (Pricop et al., 2000 J. Immunol. 166: 531-7). Рост THP-1 клеток в присутствии цитокина IL4 индуцирует экспрессию FcγRIIB и вызывает снижение экспрессии FcγRIIA и FcγRI. FcγRIIB экспрессия также может быть усилена увеличением плотности клеток (Tridandapani et al., 2002, J. Biol Chem. 277: 5082-9). В отличие от этого, было показано, что IFNγ может привести к экспрессии FcγRIIIA (Pearse et al., 1993 PNAS USA 90: 4314-8). Присутствие или отсутсвие рецепторов на клеточной поверхности моно определить с помощью FACS, с использование общих способов, известных специалистам в данной области. Индуцированная цитокинами экспрессия FcγR на клеточной поверхности обеспечивает комплекс для определения как активации, так и ингибирования в присутствии FcγRIIB. Если THP-1 клетки не могут экспрессировать FcγRIIB, настоящее изобретение также включает другую линию моноцитов человека, U937. Было показано, что эти клетки необратимо дифференцируются в макрофаги в присутствии IFNγ и TNF (Koren et al., 1979, Nature 279: 328-331).

FcγR зависимое уничтожение опухолевых клеток опосредованое макрофагами и NK клетками в мышиных моделях опухолей (Clynes et al., 1998, PNAS USA 95: 652-656). Настоящее изобретение включает применение отмытых моноцитов доноров в качестве эффекторных клеток для анализа эффективности Fc мутантов для запуска клеточной цитотоксичности клеток-мишеней в исследованиях, как фагоцитоза, так и ADCC. Паттерны экспрессии FcγRI, FcγRIIIA и FcγRIIB вызывают различными условиями роста. Экспрессия FcγR из замороженных отмытых моноцитов, свежих отмытых моноцитов, моноцитов, полученных в 10% FBS и моноцитов, культивированных в FBS + GM-CSF и или в сыворотке человека может быть определена с использованием известных способов, известных специалистам в данной области техники. Например, клетки могут быть окрашены FcγR специфическими антителами и проанализированы с помощью FACS для определения профилей FcR. Условия, которые наилучшим образом воспроизводят экспрессию FcγR макрофагов in vivo, в дальнейшем используют для способов настоящего изобретения.

В некоторых вариантах осуществления, настоящее изобретение включает применение клеток мышей, особенно, когда не могут быть получены клетки человека с правильными профилями FcγR. В некоторых вариантах осуществления, настоящее изобретение включает RAW264.7(ATCC) клеточную линию макрофагов мышей, которая может быть трансфицирована человеческими FcγRIIIA и стабильные трасфектанты изолированы, с использованием способов, известных в данном уровне техники, см., например, Ralph et al., J. Immunol. 119: 950-4). Трансфектанты могут быть количественно проанализированы на экспрессию FcγRIIIA с помощью FACS с использованием обычных способов и высоко экспрессирующих линий, которые можно использовать в анализе ADCC настоящего изобретения. В других вариантах осуществления, настоящее изобретение включает изолирование перитонеальных макрофагов селезенки, экспрессирующих FcγR человека от нокаутных трансгенных мышей, таких как раскрыты в данном документе.

Лимфоциты могут быть получены из периферической крови доноров (PBM) с использованием градиента Ficoll-Paque (Pharmacia). В изолированной мононуклеарной популяции клеток большинство ADCC активности происходит посредством натуральных клеток-киллеров (NK), содержащих FcγRIIIA, но не FcγRIIB на своей поверхности. Результаты с этими клетками показывают эффективность мутантов на запуск ADCC NK клеток и устанавливают реагенты для тестирования отмытых моноцитов.

Клетки-мишени, используемые в исследованиях ADCC настоящего изобретения, включают, но не ограничиваются, клеточные линии опухоли груди, например, SK-BR-3 с ATCC номером доступа HTB-30 (см., например, Tremp et al., 1976, Cancer Res. 33-41); B-лимфоциты; клетки полученные из лимфомы Бёркита, например, клетки Раджи с ATCC номером доступа CCL-86 (см., например, Epstein et al., 1965, J. Natl. Cancer Inst. 34: 231-240),и клетки Дауди с ATCC номером доступа CCL-213 (см., например, Klein et al., 1968, Cancer Res. 28: 1300-10). Для анализа клетки-мишени должны быть узнаны антигенами сайта связывания иммуноглобулина.

ADCC исследование основывается на способности NK клеток опосредовать клеточную смерть через апоптический путь. NK клетки опосредуют клеточную смерть частично за счет FcγRIIIA узнавания IgG, связанного с антигеном на клеточной поверхности. Исследования ADCC, используемые в соответствии со способами настоящего изобретения, могут быть исследования, основанные на радиоактивности или исследования, основанные на радиоактивности флуоресценции. ADCC исследование, использованное для характеристики молекул настоящего изобретения, включающих вариантные Fc-участки, содержит меченные клетки-мишени, например, SK-BR-3, MCF-7, OVCAR3, Раджи, клетки Дауди, опсонирование клеток-мишеней с антителом, которое узнает рецептор клеточной поверхности на клетке-мишени через свой антиген-связывающий сайт; комбинирование меченных опсонированных клеток-мишеней и эффекторных клеток в подходящем соотношении, которое можно определить в ходе обычного эксперимента; сбор клеток; определение меток в супернатанте лизированных клеток-мишеней, используя подходящую схему определения, основанную на использовании меток. Клетки-мишени могут быть помечены, или радиоактивными метками, или флуоресцентными метками, используя стандартные способы, известные в данном уровне техники. Например, метки включают, но не ограничиваются, [51Cr]Na2CrO4; и ацетоксиметиловый сложный эфир лиганда усиливающего флуоресценцию, 2,2':6',2”-тетрпиридин-6-6”-дикарбоксилат (TDA).

В отдельном предпочтительном варианте осуществления, используется флуориметрическое исследование с временным разрешением для измерения ADCC активности против клеток-мишеней, меченных ацетоксиметиловым сложным эфиром лиганда усиливающего флуоресценцию, 2,2':6',2”-тетрпиридин-6-6”-дикарбоксилатом (TDA). Такие флуориметрические исследования известны в данном уровне техники, например, см., Blomberg et al., 1996, Journal of Immunological Methods, 193: 199-206; включенный в данный документ ссылкой во всей своей полноте. Вкратце, клетки-мишени метят мембрано растворимым ацетоксиметильным диэфиром TDA (бис(ацетоксиметил) 2,2':6',2”-терпиридин-6-6”-дикарбоксилат, (BATDA), который быстро проникает через клеточную мембрану жизнеспособных клеток. Внутриклеточные эстеразы отщепляют группы сложных эфиров и регенерируют мембрану, нерастворимая молекула TDA остается внутри клетки. После инкубации эффектора и клеток-мишеней, например, на протяжении по меньшей мере от двух часов до 3,5 часов, при 37°C, в 5% CO2, TDA, высвобожденный из лизированных клеток-мишеней, хелатируют Eu3+ и сформировавшиеся флуоресцирующие хелаты Европий-TDA количественно измеряют на флуориметре с временным разрешением (например, Victor 1420, Perkin Elmer/Wallac).

В другом отдельном варианте осуществления, ADCC исследование, использованное для характеристики молекул настоящего изобретения, содержащих вариантные Fc-участки, включает следующие этапы: предпочтительно 4-5x106 клеток-мишеней (например, SK-BR-3, MCF-7, OVCAR3, клетки Раджи) метят бис(ацетоксиметил)-2,2':6',2”-терпиридин-t-6”-дикарбоксилатом (DELFIA BATDA Reagent, Perkin Elmer/Wallac). Для оптимальной эффективности мечения количество клеток-мишеней, используемых в ADCC исследовании, не должно превышать 5x106. BATDA реагент добавляют к клеткам, и смесь инкубируют при 37ºC предпочтительно в 5% CO2, на протяжении по меньшей мере 30 минут. Затем клетки отмывают физиологическим раствором, например, PBS с 0,125 мМ сульфинпиразолом и средой, содержащей 0,125 мМ сульфинпиразола. Меченые клетки-мишени затем опсонируют (покрывают) молекулами настоящего изобретения, включающими вариантный Fc-участок, т.е., иммуноглобулином, включающим вариантый Fc-участок настоящего изобретения, включая, но не ограничиваясь, поликлональное антитело, моноклональное антитело, биспецифичное антитело, мультиспецифичное антитело, гуманизированное антитело или химерное антитело. В предпочтительных вариантах осуществления иммуноглобулин, содержащий вариантый Fc-участок, который использовали в ADCC исследовании, является специфиченым к рецептору клеточной поверхности, опухолевому антигену или антигену рака. Иммуноглобулин, в который включают вариантый Fc-участок настоящего изобретения, может специфично связывать любой раковый или опухолевый антиген такой, как представлены в Пункте 6.4. Дополнительно, иммуноглобулин, в который включают вариантый Fc-участок настоящего изобретения, может быть любым терапевтическим антителом специфичным к раковому антигену такому, как те, что представлены в Пункте 6.4. В некоторых вариантах осуществления иммуноглобулин, содержащий вариантый Fc-участок, использовали в ADCC исследовании, является анти-флуоресцеиновым моноклональным антителом, 4-4-20 (Kranz et al., 1982 J. Biol. Chem. 257(12): 6987-6995) мышино-человеческое химерное моноклональное антитело 2H7 к CD20 (Liu et al., 1987, Journal of Immunology, 139: 3521-6); или гуманизированное антитело (Ab4D5) к рецептору 2 эпидермального фактора роста человека (p185 HER2) (Carter et al. (1992, Proc. Natl. Acad. Sci. USA 89: 4285-9). Клетки-мишени в ADCC исследовании выбирают в соответствии с иммуноглобулином, в который включен вариантый Fc-участок настоящего изобретения таким образом, чтобы иммуноглобулин специфически связывал рецептор клеточной поверхности в особенности на клетке-мишени. Предпочтительно, ADCC исследования настоящего изобретения выполнены с использованием, более одного созданного антитела, например, анти Her2/neu, 4-4-20, 2B6, Ритуксан и 2H7, содержащего Fc варианты настоящего изобретения. В наиболее предпочтительных вариантах осуществления, Fc варианты настоящего изобретения включают по меньшей мере в 3 антитела и тестируют их активности ADCC. Хотя не предполагается связь с определенным механизмом действия, проверка по меньшей мере 3 антител в этих функциональных исследованиях снизит шанс ошибочной элиминации жизнеспособных Fc мутаций.

Опсонированные клетки-мишени добавляют к эффекторным клеткам, например, PBMC, для получения соотношений эффектор:мишень приблизительно 50:1, 75:1 или 100:1. В отдельном варианте осуществления, когда иммуноглобулин, содержащий вариантый Fc-участок имеет вариабельный домен 4-4-20, соотношение эффектор:мишень составляет 75:1. Эффекторные клетки и клетки-мишени инкубируют по меньшей мере от двух часов до 3,5 часов, при 37°C, в 5% CO2. Получают клеточные супернатанты и добавляют в кислый раствор европия (например, DELFIA Раствор Европия, Perkin Elmer/Wallac). Сформированная флуоресценция хелатов Европий-TDA количественно измеряют на флуориметре с временным разрешением (например, Victor 1420, Perkin Elmer/Wallac). Максимальный выход (MR) и спонтанный выход (SR) определяют по инкубации клеток-мишеней с 1% TX-100 и одной средой, соответственно. Антитело-независимая клеточная цитотоксичность (AICC) измеряют путем инкубирования клеток-мишеней и эффекторных клеток в отсутствии антитела. Каждое исследование предпочтительно выполнять троекратно. Значение процентного соотношения специфического лизиса вычисляют как:

Экспериментальный выход (ADCC) - AICC)/(MR-SR) x 100.

Настоящее изобретение включает характеристику Fc вариантов, как в NK-зависимых, так и макрофаг-зависимых ADCC исследованиях. Fc варианты настоящего изобретения имеют измененный фенотип также, как и измененную эффекторную функцию, что было показано в NK-зависимом или макрофаг-зависимом исследовании.

Настоящее изобретение включает исследования, известные в данном уровне техники и подтвержденные здесь примерами, для связывания C1q и опосредованной комлемент-зависимой цитотоксичности (CDC). Для определения связывания C1q может быть использовано C1q связывающее ELISA. Анализ образцов может содержать следующее: анализируемые планшеты могут быть иммобилизированы в течение ночи при 4C с полипептидным вариантом или стартовым полипептидом (контроль) в буфере для сенсибилизации поверхности. Потом планшеты могут быть отмыты и блокированы. Следом за отмывкой в каждое гнездо можно добавить аликвоту C1q человека и инкубировать в течение 2 часов при комнатной температуре. После дальнейшего отмывания 100 мкл в каждое гнездо можно добавить овечьи антитела, конъюгированные с анти-комплемент C1q пероксидазой и инкубировать 1 час при комнатной температуре. Планшет снова можно отмыть отмывочным буфером и добавить в каждую лунку 100 мкл субстратного буфера, содержащего OPD (O-фенилендиамин дигидрохлорид (Sigma)). Реакция окисления, наблюдаемая по появлению желтого цвета, может продолжаться в течение 30 минут и быть остановлена добавлением 100 мкл 4,5 NH2 SO4. Абсорбцию можно затем считать при (492-405) нм.

Предпочтительный вариант в соответствии с данным изобретением является таковой, который демонстрирует значительное снижение в связывании C1q, как показано и измерено в этом и подобных исследованиях. Предпочтительно молекула, содержащая Fc вариант, демонстрирует 50-кратное снижение, примерно 60-кратное, примерно 80-кратное, или примерно 90-кратное снижение в C1q связывании по сравнению с контрольным антителом, имеющим немутированный Fc-участок IgG1. В наиболее предпочтительном варианте осуществления, молекула, содержащая Fc вариант, не связывает C1q, т.е. вариант демонстрирует почти 100-кратное или более снижение в C1q связывании по сравнению с контрольным антителом.

Другим экземпляром варианта является такой, который имеет лучшее сродство связывания к C1q человека, чем молекула, содержащая дикий тип Fc-участка. Такая молекула может демонстрировать, например, примерно двукратное или более, и, предпочтительно, примерно пятикратное или более, улучшение в связывании C1q человека, по сравнению с родительской молекулой, содержащей дикий тип Fc-участка. Например, связывание C1q человека может быть от около двукратного до примерно 500-кратного, и предпочтительно от примерно двукратного или пятикратного до примерно 1000-кратного усиления, по сравнению с молекулой, содержащей Fc-участок дикого типа.

Для оценки активации комплемента, может быть выполнен анализ комплемент-зависимой цитотоксичности (CDC), например, как описано у Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), который включен в данный документ ссылкой во всей своей полноте. Вкратце, различные концентрации молекул, содержащих вариантый Fc-участок, и комплемент человека могут быть разведены в буфере. Клетки, которые экспрессируют антиген, к которому прикрепляется молекула, содержащая вариантый Fc-участок, могут быть разведены в плотности примерно 1x106 клеток/мл. Смеси молекул, содержащие вариантый Fc-участок, растворенный комплемент человека и клетки, экспрессирующие антиген, можно добавить в плоскодонный 96 лунковый планшет для культивирования тканей и инкубировать 2 часа при 37°C и 5% CO2 для облегчения комплемент-опосредованного клеточного лизиса. Затем в каждую лунку можно добавить 50 мкл alamar blue (Accumed International) и инкубировать в течение ночи при 37°C. Абсорбцию измеряют, используя 96-луночный флуориметр с длиной волны возбуждения 530 нм и эмиссией при 590 нм. Результаты могут быть выражены в относительных единицах флуоресценции (RFU). Показано, что концентрации образца могут быть вычислены по стандартной кривой, и процент активности по сравнению с неизмененной молекулой, т.е., молекулой, содержащей Fc-участок дикого типа.

В некоторых вариантах осуществления, Fc вариант настоящего изобретения не активирует комплемент. Предпочтительно, вариант, похоже, не имеет CDC активности в вышеприведенном CDC анализе. Настоящее изобретение также принадлежит к варианту с усиленной CDC, по сравнению с родительской молекулой (молекулой, содержащей Fc-участок дикого типа), например, демонстрирующее около двухкратного до примерно 100-кратного усиления в CDC активности in vitro или in vivo (например, при значениях IC50 для каждой сравниваемой молекулы). Исследования комплемента могут быть осуществлены на сыворотке морских свинок, кроликов или человека. Комплементарный лизис клеток-мишеней можно диагностировать отслеживанием высобождения таких внутриклеточных ферментов, как лактатдегидрогеназа (LDH), как описано в Korzeniewski et al., 1983 Immunol. Methods 64(3): 313-20; и Decker et al., 1988 J. Immunol Methods 115(1): 61-9, каждый из которых включен в данный документ ссылкой во всей своей полноте; или высвобождение таких внутриклеточных меток, как европий, хром 51 или индий 111, клетки-мишени мечены, как описано в данном документе.

6.2.3 ДРУГИЕ ИССЛЕДОВАНИЯ

Молекулы настоящего изобретения, содержащие вариантые Fc-участки, можно также проанализировать с использованием исследований, основаных на поверхностном плазмонном резонансе, известных в данном уровне техники для характеристики кинетических параметров связывания Fc-FcγR взаимодействия. Любой SPR инструмент коммерчески доступен, включая, но не ограничиваясь, BIAcore Инструментами, предоставленные Biacore AB (Uppsala, Sweden); IAsys инструменты, предоставленные Affinity Sensors (Franklin, MA.); IBIS система, предоставленная Windsor Scientific Limited (Berks, UK), SPR-CELLIA сисетмы, предоставленные Nippon Laser и Electronics Lab (Hokkaido, Japan), и SPR Detector Spreeta, предоставленный Texas Instruments (Dallas, TX) могут быть использованы в настоящем изобретении. Для обзора технологии, основанной на SPR см. Mullet et al., 2000, Methods 22: 77-91; Dong et al., 2002, Review in Mol. Biotech., 82: 303-23; Fivash et al., 1998, Current Opinion in Biotechnology 9: 97-101; Rich et al., 2000, Current Opinion in Biotechnology 11: 54-61; все ссылки включены в данный документ во всей своей полноте. Дополнительно, любой из SPR инструментов и способов для исследования белок-белковых взаимодействий, основанных на SPR, описаных в патентах США №№ 6373577; 6289286; 5322798; 5341215; 6268125, предполагаются в способах настоящего изобретения, все из которых полностью включены в настоящий документ.

Вкратце, исследования, основанные на SPR, включают иммобилизацию члена связанной пары на поверхности и отслеживание его взаимодействия с другим членом связанной пары в растворе в реальном времени. SPR основан на измерении изменения преломляющего индекса растворителя возле поверхности, что происходит при комплексообразовании или диссоциации. Поверхность, на которой происходит иммобилизация, является сенсорным чипом, который находится в центре SPR технологии; он состоит из стеклянной поверхности, покрытой тонким слоем золота, и формирует основу ассортимента специализированных поверхностей, разработанных для оптимизации связывания молекулы с поверхностью. Разнообразие сенсорных чипов коммерчески доступно, особенно для компаний, перечисленных выше, все из которых могут быть использованы в способах настоящего изобретения. Примеры сенсорных чипов включают следующие, предоставленные BIAcore AB, Inc., например, Сенсорный чип CM5, SA, NTA, и HPA. Молекула настоящего изобретения может быть иммобилизирована на поверхности сенсорного чипа любым из иммобилизационных способов, известных в данном уровне техники, включая, но не ограничиваясь, прямое ковалентное соединения через аминогруппы, прямое ковалентное соединение через сульфгидрильные группы, прикрепление биотина к авидин покрытой поверхности, альдегидное связывание с углеводными группами, и прикрепление через гистидиновую метку с NTA чипами.

В некоторых вариантах осуществления, кинетические параметры связывания молекул настоящего изобретения, содержащи вариантные Fc-участки, например, иммуноглобулины, содержащие вариантный Fc-участок, с FcγR, может быть определен с использованием инструмента BIAcore (например, BIAcore инструмент 1000, BIAcore Inc., Piscataway, NJ). Может использоваться любой FcγR для оценки взаимодействия с молекулами настоящего изобретения, содержащими вариантные Fc-участки. В специфическом варианте осуществления FcγR является FcγRIIIA, предпочтительно растворимым мономерным FcγRIIIA. Например, в одном варианте осуществления, растворимый мономерный FcγRIIIA является внеклеточным участком FcγRIIIA, присоединенный к линкерной AVITAG последовательности (см., предварительная заявка на патент США № 60/439498, поданная 9 января 2003 г. (дело патентного поверенного № 11183-004-888) и предварительная заявка на патент США № 60/456041, поданная 19 марта 2003 г., которые полностью включены в данный документ). В другом специфическом варианте осуществления, FcγR - это FcγRIIB, предпочтительно растворимый димерный FcγRIIB. Например, в одном варианте осуществления, растворимый димерный FcγRIIB белок готовится в соответствии со способом, описанном в предварительной заявке на патент США № 60/439709 поданной 13 января 2003 г., которая включена в данный документ ссылкой во всей своей полноте.

Характерное исследование образца для определения кинетических параметров молекулы, содержащей вариантный Fc-участок, где молекула представляет собой 4-4-20 антитело, к FcγR с использованием BIAcore инструмента, содержит следующее: BSA-FITC иммоблизируют на одной из четырех проточных ячеек поверхности сенсорного чипа, предпочтительно через химию связывания амина так, чтобы около 5000 ответных единиц (RU) BSA-FITC были иммобилизованы на поверхности. После того, как подходящая поверхность приготовлена, через поверхность проводят 4-4-20 антитела, несущие Fc мутации, предпочтительно за одну минуту 20 мкг/мл раствора при скорости потока 5 мкл/мл. Уровень 4-4-20 антител, прикрепленных к поверхности, варьирует между 400 и 700 RU. Далее, серии разведений рецептора (FcγRIIA и FcγRIIB-Fc слитый белок) в HBS-P буфере (20 мМ HEPES, 150 мМ NaCl, 3мМ EDTA, pH 7,5) впрыскиваются на поверхность при 100 мкл/мин. Регенерация антитела между различными растворами рецепторов выполняется, предпочтительно, однократным 5 секундным впрыскиванием 100 мМ NaHCO3 pH 9,4; 3 M NaCl. Любая техника регенерации, известная в данном уровне техники, рассматривается в способе настоящего изобретения.

После сбора всех данных, глобльно подготавливают результирующие кривые связывания, используюя компьютерные алгоритмы, которые поставляются производителями SPR инструментов, например, BIAcore, Inc. (Piscataway, NJ). Эти алгоритмы вычисляют, как Kon и Koff, из которых состоит истинное равновесие связывания, Kd выводят из соотношения двух скоростных констант (т.е., Koff/Kon). Более детальное изложение получения индивидуальных скоростных констант можно найти в руководстве по BIAevaluaion Программному обеспечению (BIAcore, Inc., Piscataway, NJ). Анализ общих данных могут быть выполнены с использованием любого способа, известного в данном уровне техники. Для обзора различных способов интерпретации полученных кинетических данных см. Myszka, 1997, Current Opinion in Biotechnology 8: 50-7; Fisher et al., 1994, Current Opinion in Biotechnology 5: 389-95; O'Shannessy, 1994, Current Opinion in Biotechnology, 5:65-71; Chaiken et al., 1992, Analytical Biochemistry, 201: 197-210; Morton et al., 1995, Analytical Biochemistry 227: 176-85; O'Shannessy et al., 1996, Analytical Biochemistry 236: 275-83; все из которых включены в данный документ ссылками в полном объеме.

В предпочтительных вариантах осуществления, кинетические параметры определяли используя SPR анализы, например, BIAcore, могут быть использованы в качестве предсказывающий измерения того, как молекула настоящего изобретения будет функционировать в функциональном исследовании, например, ADCC. Характерный способ для предсказания эффективности молекулы настоящего изобретения на основе полученных из SPR исследований кинетических параметров может содержать следующее: определение значений Koff для связывания молекулы настоящего изобретения с FcγRIIIA и FcγRIIB; составление графика (1) Koff (д.т.)/Koff (мутации) для FcγRIIIA; (2) Koff (мутации)/Koff (д.т.) для FcγRIIB против ADCC данных. Числа выше единицы показывают сниженную скорость диссоциации для FcγRIIIA и увеличенную скорость диссоциации для FcγRIIB по сравнению с диким типом; и обладают усиленной ADCC функцией.

6.3 СПОСОБЫ РЕКОМБИНАНТНОГО ПОЛУЧЕНИЯ МОЛЕКУЛЫ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

6.3.1 ПОЛИНУКЛЕОТИДЫ, КОДИРУЮЩИЕ МОЛЕКУЛЫ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

Настоящее изобретение также включает полинуклеотиды, которые кодируют молекулы настоящего изобретения, включая полипептиды и антитела, идентифицированные способами настоящего изобретения. Могут быть получены полинуклеотид-кодирующие молекулы настоящего изобретения, и определена нуклеотидная последовательность полинуклеотидов любым способом, известным в данном уровне техники.

После определения нуклеотидной последовательности молекул (например, антитела), идентифицированных способами настоящего изобретения, с нуклеотидной последовательностью можно обращаться с использованием способов, хорошо известных в данном уровне техники, например, техники рекомбинантных ДНК, сайт-направленного мутагенеза, ПЦР, и др. (см., например, техники, описанные в Sambrook et al., 2001, Molecular Cloning, A Laboratory Manual, 3rd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY; и Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY, обе представлены ссылками в данном документа в полном объеме), для получения, например, антител, имеющих различную аминокислотную последовательность, например путем получения аминокислотных замен, делеций, и/или вставок.

В специфическом варианте осуществления, когда нуклеиновые кислоты кодируют антитела, один или несколько CDR включают в участки структуры, используя стандартные техники рекомбинантных ДНК. Участки структуры могут быть встречающиеся в природе или консенсусные участки структуры, и предпочтительно участки структуры человека (see, например, Chothia et al., 1998, J. Mol. Biol. 278: 457-479 для перечня каркасных участков человека).

В другом варианте осуществления, человеческие библиотеки или любые другие библиотеки, доступные в данном уровне техники, могут быть продемонстрированы стандартными способами, известными в данном уровне техники, для клонирования нуклеиновых кислот, кодирующих молекулы настоящего изобретения.

6.3.2 РЕКОМБИНАНТНАЯ ЭКСПРЕССИЯ МОЛЕКУЛЫ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

После получения последовательности нуклеиновой кислоты, кодирующей молекулы настоящего изобретения (т.е., антитела), вектор для продукции молекул может быть получен путем использования технологии рекомбинантной ДНК, хорошо известной в данном уровне техники. Способы, которые хорошо известны специалистам данной области техники, могут быть использованы для построения экспрессионных векторов, содержащих кодирующую последовательность для молекул настоящего изобретения и соответствующие транскрипционные и трансляционные контрольные сигналы. Эти способы включают, например, техники рекомбинантной ДНК in vitro, синтетические техники, и генетические рекомбинации in vivo. (См., например, техники, описанные в Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY и Ausubel et al. eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY).

Экспрессионный вектор, содержащий нуклеотидную последовательность молекулы, идентифицированной способами настоящего изобретения (т.е., антитело) может быть перенесен в хозяйскую клетку стандартными методиками (например, электропорация, липосомальная трансфекция, и преципитация фосфатом кальция), и трансфектированные клетки затем культивируют обычными методами для получения молекул настоящего изобретения. В специфических вариантах осуществления, экспрессия молекул настоящего изобретения регулируется конститутивным, индуцибельным или специфическим, тканевым промотором.

Хозяйские клетки, используемые для экспрессии молекул, идентифицированных способами настоящего изобретения, могут быть или бактериальными клетками, такими как Escherichia coli, или, предпочтительно, эукариотическими клетками, особенно для экспрессии целых рекомбинантных иммуноглобулиновых молекул. В частности, клетки млекопитающих, такие как клетки яичника китайского хомячка (CHO) в сопряжении с вектором таким, как основной промежуточный элемент промотора раннего гена из цитомегаловируса человека, является эффективной экспрессионной системой для иммуноглобулинов (Foecking et al., 1998, Gene 45:101; Cockett et al., 1990, Bio/Technology 8:2).

Разнообразие хозяин-экспрессирующих векторных систем может быть использовано для экспрессирования молекул, идентифицированных способами настоящего изобретения. Такие хозяин-экспрессирующие системы представляют собой транспорт, благодаря которому могут быть получены и впоследствии очищены кодирующие последовательности молекул настоящего изобретения, а также представляют собой клетки, которые могут, после трансформации или трансфекции с соответствующими кодирующими последовательностями нуклеотидов экспрессировать молекулы настоящего изобретения in situ. Это включает, но не ограничивается, микроорганизмы, такие как бактерии (например, E. coli и B. subtilis), трансформированные с рекомбинантной ДНК бактериофага, плазмидой ДНК или экспрессирующие векторы космиды ДНК, содержащие кодирующие последовательности для молекул, идентифицированных способами настоящего изобретения; дрожжи (например, Saccharomyces Pichia), трансформированные с рекомбинантными дрожжевыми экспрессирующими векторми, содержащими кодирующие последовательности для молекул, идентифицированных способами настоящего изобретения; клеточные системы насекомых, инфицированные рекомбинантными вирусными экспрессирующими векторми (например, бакуловирус), содержащие последовательности, кодирующие молекулы, идентифицированные способами настоящего изобретения; клеточные системы растений, инфицированные рекомбинантными вирусными экспрессирующими векторами (например, вирус мозаики цветной капусты (CaMV) и вирус тобачной мозаики (TMV) или трансформированы рекомбинантными плазмидными экспрессирующими векторами (например, Ti плазмида), содержащие последовательности, кодирующие молекулы, идентифицированные способами настоящего изобретения; или клеточные системы млекопитающих (например, COS, CHO, BHK, 293, 293T, 3T3 клетки, лимфатические клетки (см. U.S. 5,807,715), Per C.6 клетки (клетки сетчатки глаза человека, открытые Crucell), скрывающие рекомбинантные экспрессирующие конструкции, содержащие промоторы, полученные из генома клеток млекопитающих (например, металлотионеин промотор) или из вирусов млекопитающих (например, аденовирусный поздний промотор 7.5K промотор вируса коровьей оспы).

В бактериальных системах, ряд экспрессирующих векторов могут быть преимущественно селектированы в зависимости от предназначенного применения экспрессированных молекул. Например, когда продуцируется большое количество такого белка, для получения фармацевтических составов антител, могут требоваться векторы, которые напрявляют экспрессию большого уровня уже очищенных слитых белковых продуктов. Такие векторы включают, но не ограничиваясь ими, экспрессирующий вектор pUR278 E. coli (Ruther et al., 1983, EMBO J. 2:1791), в котором антитело кодирующая последовательность может быть лигирована в вектор в рамку с lac Z кодирующим участком для продукции слитого белка; pIN векторы (Inouye & Inouye, 1985, Nucleic Acids Res. 13:3101-3109; Van Heeke & Schuster, 1989, J. Biol. Chem. 24:5503-5509); и т.п.. pGEX векторы могут быть также использованы для экспрессии чужеродных полипептидов как слитых белков с глутатион-S-трансферазой (GST). В основном, такие слитые белки являются растворимыми и легко могут быть очищены из лизированных клеток путем абсорбции и прикрепления к матриксу глутатион-агарозных гранул с последующей десорбцией в присутствии свободного глутатиона. Были разработаны pGEX векторы для включения тромбиновых или Xa протеазных расщепляющих сайтов для того, чтобы клонированный продукт гена-мишени мог быть высвобожден из GST части.

В системе насекомых, ядерный полиэдрозный вирус Autographa californica (AcNPV) используется в качестве вектора для экспрессии чужеродных генов. Вирус растет в клетках Spodoptera frugiperda. Антитело кодирующая последовательность может быть клонирована индивидуально в несущественный участок (например, ген полигедрина) вируса и помещена под контроль AcNPV промотора (например, промотор полигедрина).

В хозяйских клетках млекопитающих можно использовать ряд вирусных экспрессирующих систем. В случаях, когда аденовирус используется как экспрессирующий вектор, интересующая антитело-кодирующая последовательность может быть лигирована к аденовирусному транскрипционно/трансляционному контрольному комплексу, например, поздний промотор и трехкомпонентная лидирующая последовательность. Этот химерный ген может быть затем вставлен в аденовирусный геном in vitro или in vivo рекомбинацией. Вставка во второстепнный участок вирусного генома (например, участок E1 или E3) приведет к рекомбинации вируса, который будет жизнеспособным и способным экспрессировать иммуноглобулиновую молекулу в инфицированных хозяевах (например, see Logan & Shenk, 1984, Proc. Natl. Acad. Sci. USA 81:355-359). Могут быть необходимы специфические инициирующие сигналы для эффективной трансляции вставленных антитело-кодирующих последовательностей. Эти сигналы включают ATG инициирующий кодон и примыкающие последовательности. Кроме того, инициирующий кодон должен быть в фазе с рамкой считывания желаемой кодирующей последовательности для правильной трансляции всей вставки. Эти экзогенные трансляционные контролирующие сигналы и инициирующие кодоны могут быть различного происхождения, как натуральными, так и синтетическими. Эффективность экспрессии может быть увеличена включением транскрипционных энхансерных элементов, транскрипционных терминаторов, и т.п. (см. Bittner et al., 1987, Methods in Enzymol. 153:51-544).

К тому же может быть выбрана линия клеток-хозяев, которая модулирует экспрессию встроенных последовательностей, или модифицирует и производит генетический продукт необходимым способом. Такие модификации (например, гликозилирование) и процессинг (например, расщепление) белковых продуктов может быть важен для функционирования белка. Различные клетки-хозяева имеют характеристику и специфические механизмы для пост-трансляционного процессинга и модификации белковых и генных продуктов. Могут быть выбраны подходящие клеточные линии или хозяйские системы для уверенности в правильной модификации и процессинге экспрессированного чужеродного белка. С этой целью могут быть использованы эукариотические клетки-хозяева, которые обладают клеточным аппаратом для нужного процессинга первичного транскрипта, гликозилирования и фосфорилирования генетического продукта. Такие клетки-хозяева млекопитающих включают, но не ограничиваются, CHO, VERY, BHK, Hela, COS, MDCK, 293, 293T, 3T3, WI38, BT483, Hs578T, HTB2, BT20 и T47D, CRL7030 и Hs578Bst.

Для длительной продукции рекомбинантных белков с высоким выходом предпочтительна стабильная экспрессия. Например, могут быть разработаны клеточные линии, которые стабильно экспрессируют антитело настоящего изобретения. Вместо использования экспрессирующих векторов, которые содержат репликацию вирусного происхождения, клетки-хозяева могут быть трасформированы с котролируемой ДНК с соответсвующими контрольными элементами экспрессии (например, промотор, энхансер, последовательности, терминаторы транскрипции, полиаденилирующие сайты и т.п.), и селектируемым маркером. После встраивания чужеродной ДНК, производимым клеткам позволяют расти 1-2 дня в обогащенной среде, и затем переносят в селективную среду. Селектируемый маркер в рекомбинантной плазмиде дает устойчивасть к селекции и позволяет клеткам стабильно интегрировать плазмиду в свои хромосомы и расти, формируя очаги, которые, в свою очередь, могут быть клонированы и расширены до клеточной линии. Этот способ может быть преимущественно использован для создания клеточных линий, которые экспрессируют антитела настоящего изобретения. Такие созданные клеточные линии могут быть частично полезны в демонстрации и оценке веществ, которые взаимодействуют прямо или опосредованно с антителами настоящего изобретения.

Может быть использован ряд селекционных систем, включая, но не ограничиваясь, тимидин киназу простого вируса герпеса (Wigler et al., 1977, Cell 11: 223), гипоксантин-гуаниновую фосфорибозилтрансферазу (Szybalska & Szybalski, 1992, Proc. Natl. Acad. Sci. USA 48: 202), и аденин фосфорибозилтрансферазу (Lowy et al., 1980, Cell 22: 817), гены которых можно применять в tk-, hgprt- или aprt-клетках, соответственно. Также, антиметаболитная устойчивость может использоваться как основа селекции для следующих генов: dhfr, который придает устойчивость к метотрексату (Wigler et al., 1980, Proc. Natl. Acad. Sci. USA 77:357; O'Hare et al., 1981, Proc. Natl. Acad. Sci. USA 78: 1527); gpt, который придает устойчивость к микофеноловой кислоте (Mulligan & Berg, 1981, Proc. Natl. Acad. Sci. USA 78: 2072); neo, который придает устойчивость к аминогликозиду G-418 Clinical Pharmacy 12: 488-505; Wu и Wu, 1991, 3:87-95; Tolstoshev, 1993, Ann. Rev. Pharmacol. Toxicol. 32:573-596; Mulligan, 1993, Science 260:926-932; и Morgan и Anderson, 1993, Ann. Rev. Biochem. 62:191-217; May, 1993, TIB TECH 11(5):155-215). Общеизвестные в данном уровне техники способы технологии рекомбинантной ДНК, которые могут быть использованы, описаны у Ausubel et al. (eds.), 1993, Current Protocols in Molecular Biology, John Wiley & Sons, NY; Kriegler, 1990, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY; и in Chapters 12 и 13, Dracopoli et al. (eds), 1994, Current Protocols in Human Genetics, John Wiley & Sons, NY.; Colberre-Garapin et al., 1981, J. Mol. Biol. 150:1; и hygro, который придает устойчивость к гигромицину (Santerre et al., 1984, Gene 30:147).

Уровни экспрессии антитела настоящего изобретения могут быть увеличены векторной амплификацией (для обзора, см. Bebbington и Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987). Когда в векторной системе, экспрессирующей антитело, амплифицирован маркер, увеличение уровня ингибитора, присутствующего в культуре клеток-хозяев, будет увеличивать число копий маркерного гена. Поскольку амплифицированный участок ассоциирован с нуклеотидной последовательностью антитела, продукция антитела будет также увеличиваться (Crouse et al., 1983, Mol. Cell. Biol. 3:257).

Клетка-хозяин может быть трасфицирована с двумя экспрессирующими векторами настоящего изобретения, первый вектор, кодирующий тяжелую цепь полученного полипептида, а второй вектор, кодирующий легкую цепь полученного полипептида. Два вектора могут содержать идентичные селектируемые маркеры, которые позволяют равно экспрессировать тяжелую и легкую цепи полипетидов. Альтернативно, может быть использован одиночный вектор, который кодирует как тяжелую, так и легкую цепь полипептидов. В таких ситуациях, легкая цепь должна быть расположена перед тяжелой цепью, чтобы избежать избытка токсичной свободной тяжелой цепи (Proudfoot, 1986, Nature 322:52; Kohler, 1980, Proc. Natl. Acad. Sci. USA 77:2197). Кодирующие последовательности для тяжелой и легкой цепей могут содержать cDNA или геномную ДНК.

Как только молекула настоящего изобретения (т.е., антитела) будет рекомбинантно экспрессирована, она может быть очищена любым способом, известным в данном уровне техники для очистки полипептидов или антител, например, хромтографией (например, ионообменной, аффинной, особенно с аффинитетом к специфическому антигену к Белку A и ситовой колоночной хроматографией), центрифугированием, различной растворимостью или любой другой стандартной техникой для очистки полипептидов или антител.

6.4 ПРОФИЛАКТИЧЕСКИЕ И ТЕРАПЕВТИЧЕСКИЕ МЕТОДЫ

Настоящее изобретение включает применение одной или нескольких молекул настоящего изобретения (например, антитела) у животных, предпочтительно у млекопитающих, и наиболее предпочтительно у человека, для предупреждения, лечения или улучшения одного или нескольких симптомов, связанных с заболеванием, оклонение или инфекцией. Молекулы настоящего изобретения особенно полезны для лечения или предупреждения заболевания или нарушения, когда требуется усиленная эффективность эффекторной клеточной функции (например, ADCC), опосредованной FcγR. Способы и композиции настоящего изобретения особенно полезны для лечения и предупреждения первичного или метастатического неопластического заболевания (т.е., злокачественной опухоли), и инфекционных заболеваний. Молекулы настоящего изобретения могут быть предоставлены в фармацевтически приемлемых композициях, как известно в данном уровне техники или как описано в данном документе. Как детализировано ниже, молекулы настоящего изобретения могут использоваться в способах лечения или предупреждения злокачественных опухолей (особенно в пассивной иммунотерапии), аутоиммунных заболеваний, воспалительных расстройств или инфекционных заболеваний.

Молекулы настоящего изобретения могут таже преимущественно быть использованы в комбинации с другими терапевтическими средствами, известными в данном уровне техники для лечения или предупреждения злокачественных опухолей, аутоиммунных заболеваний, воспалительных расстройств или инфекционных заболеваний. В специфическом варианте осуществления, молекулы настоящего изобретения могут быть использованы в комбинации с моноклональными или химерными антителами, лимфокинами или гемопоэтическими факторами роста (такими как, например, IL-2, IL-3 и IL-7), которые, например, служат для увеличения количества или активности эффекторных клеток, которые взаимодействуют с молекулами и усиливают иммунный ответ. Молекулы настоящего изобретения могут также быть преимущественно использованы в комбинациях с одним или несколькими лекарственными средствами, используемыми для лечения заболевания, отклонения или инфекции такими, как, например, противораковые агенты, противовоспалительные агенты или противовирусные агенты, например, как детально представленов в Пунктах 6.4.1.2 и 6.4.2.1 ниже.

6.4.1 ЗЛОКАЧЕСТВЕННЫЕ ОПУХОЛИ

Настоящее изобретение включает способы и композиции для лечения или профилактики злокачественных опухолей или метастазов у субъекта, включающий применение у субъекта терапевтически эффективного количества одной или нескольких молекул, содержащих вариантный Fc-участок.

Молекулы настоящего изобретения (т.е., полипептиды, антитела), содержащие вариантные Fc-участки, могут использоваться для предотвращения, ингибирования или снижения роста первичных опухолей или метастазов злокачественных опухолевых клеток. В одном варианте осуществления, молекула настоящего изобретения содержит вариантный Fc, который связывает FcγRIIIA и/или FcγRIIA с большей аффинностью, чем сравниваемый полипептид, содержащий Fc-участок дикого типа, связывает FcγRIIIA и/или FcγRIIA, и/или указанный вариантный Fc-участок имеет усиленную эффекторную функцию, например, ADCC, CDC, фагоцитоз, опсонизация, и т.п.. Такие молекулы могут использоваться самостоятельно для лечения или предупреждения злокачественной опухоли. В другом варианте осуществления, молекула настоящего изобретения содержит вариантный Fc-участок, который связывает FcγRIIIA и/или FcγRIIA с большей аффинностью, чем сравниваемый полипептид, содержащий Fc-участок дикого типа, связывает FcγRIIIA и/или FcγRIIA, и далее связывает FcγRIIB с меньшей аффинностью, чем сравниваемый полипептид, содержащий Fc-участок дикого типа, связывает FcγRIIB, и/или указанный вариантный Fc-участок повышенную эффекторную функцию, ADCC, CDC, фагоцитоз, опсонизацию и т.п.. Такие молекулы также могут быть использованы самостоятельно для лечения или предупреждения злокачественной опухоли.

В некоторых вариантах осуществления, настоящее изобретение включает способы и композиции для лечения или предупреждения злокачественной опухоли у субъекта с FcγR полиморфизмом, таким как гомозиготность по FγRIIIA-158V или FcγRIIIA-158F аллелям. В некоторых вариантах осуществления, настоящее изобретение включает создание терапевтических антител, например, специфических опухолевых моноклональных антител, в соответствии со способами настоящего изобретения так, чтобы созданные антитела имели повышенную эффективность у пациентов, гомозиготных по низко аффинной аллели FcγRIIIA (158F). В других вариантах осуществления, настоящее изобретение включает создание терапевтических антител, например, специфических опухолевых моноклональных антител в соответствии со способами настоящего изобретения так, чтобы созданные антитела имели повышенную эффективность у пациентов, гомозиготных по высоко аффинной аллели FcγRIIIA (158V).

В некоторых вариантах осуществления, созданные антитела настоящего изобретения особенно эффективны в лечении и/или предупреждении не-ходжкинской лимфомы (NHL). Созданные антитела настоящего изобретения терапевтически более эффективны, чем используемые в настоящее время терапевтически режимы для NHL, включая без ограничения химиотерапию, и иммунотерапию, используя анти-CD20 mAb, Ритуксимаб. Эффективность анти-CD20 моноклональных антител, однако, зависит от FcγR полиморфизма субъекта (Carton et al., 2002 Blood, 99: 754-8; Weng et al., 2003 J Clin Oncol.21(21):3940-7, оба из которых представлены ссылками в настоящем документе в полном объеме). Эти рецепторы экспрессируются на поверхности эффекторных клеток и опосредуют ADCC. Высокоаффинные аллели низкоаффинных активирующих рецепторов, улучшают эффекторную способность клеток к опосредованию ADCC. Способы настоящего изобретения позволяют создавать анти-CD20 антитела, содержащие Fc мутации, для усиления их аффинности к FcγR на эффекторных клетках через их измененные Fc домены. Созданные антитела настоящего изобретения являются лучшими реагентами иммунотерапии для пациентов, независимо от их FcγR полиморфизма.

Образцовый способ для определения эффективности созданных анти-CD20 антител у субъекта может включать следующее: плазмиды, содержащие гены химерной анти-HER2/neu тяжелой цепи с Fc мутациями, которые демонстрируют существенное снижение цитолиза в ADCC, могут быть использованы в качестве скелета для переноса вариабельного домена из гена тяжелой цепи Ритуксимаба. Вариабельный участок из анти-HER2/neu Fc вариант заменяется вариабельным участком из Ритуксимаба. Плазмиды, содержащие Fc домены дикого типа или D265A мутацию для отмены FcR связывания или Fc варианты к CD20 скоротечно котрасфицируют с геном легкой цепи Ритуксимаба в 293H клетках, среда отвечающая стандартам и антитело очищают через колонку G белока , используя стандартные способы.

mAb к CD20, содержащие Fc-варианты, тестируют с ADCC использованием культивированной B линии клеток для определения способности Fc мутаций усиливать ADCC. Стандарт ADCC достигается использованием способов, раскрытых в данном документе. Лимфоциты получают из периферической крови с использование градиента Ficoll-Paque (Pharmacia). Клетки-мишени Дауди, B-клеточную линию, экспрессирующую CD20, вводят с европием (PerkinElmer) и инкубируют с эффекторами 4 часа при 37oC. Высвободившийся Европий регистрируют с использованием флуоресцентного планшетного ридера (Wallac). Данные результирующего ADCC демонстрируют эффективность Fc вариант в запуске опосредованной NK-клетками цитотоксичности и установке, какие анти-CD20 Fc-варианты могут быть протестированы как с образцами пациента, так и отмытыми моноцитами. Fc варианты, демонстрирующие наибольший потенциал для усиления эффективности анти-CD20 антитела, затем тестируют в ADCC анализе, используя PBMC от пациентов. PBMC from healthy donors are used as effector cells. In vitro ADCC исследования, с использованием анти-CD20 вариантов и ритуксимаба, выполняются в клетках первичной лимфомы от пациентов с фолликулярной лимфомой. Специфический FcγR полиморфизм доноров определяют и катологизируют, используя способы, известные в данном уровне техники. ADCC анализ выполняют эффекторными клетками от пациентов с дразличными FcγRIIIA и FcγRIIA генотипами.

Согласно аспекту настоящего изобретения, молекулы (например, антитела) настоящего изобретения, содержащие вариантные Fc-участки, усиливают эффективность иммунотерапии злокачественной опухоли, путем уменьшения силы эффекторной функции антитела по отношению к молекуле, содержащей Fc-участок дикого типа, например, ADCC, CDC, фагоцитоз, опсонизация, и т.п. В специфическом варианте осуществления, антитело зависимая клеточная токсичность и/или фагоцитоз опухолевых клеток повышается при использовании молекул настоящего изобретения с вариантными Fc-участками. Молекулы настоящего изобретения могут повышать эффективность лечения злокачественных опухолей иммунотерапией путем усиления, по меньшей мере, одной антитело-опосредованной эффекторной функции. В одном определенном варианте осуществления, молекула настоящего изобретения, содержащая вариантный Fc-участок, увеличивает эффективность лечения иммунотерапией путем усиления комплемент зависимого каскада. В другом варианте осуществления настоящего изобретения, молекула настоящего изобретения, содержащая вариантный Fc-участок, усиливает эффективность лечения иммунотерапией путем усиления фагоцитоза и/или опсонизации опухолевых клеток-мишеней. В другом варианте осуществления настоящего изобретения, молекула настоящего изобретения, содержащая вариантный Fc-участок, усиливает эффективность лечения путем усиления антитело-зависимой клеточно опосредованной цитотоксичности (“ADCC”) в деструкции опухолевых клеток-мишеней.

Настоящее изобретение далее рассматривает создание терапевтических антител (например, специфических опухолевых моноклональных антител) для усиления терапевтической эффективности терапевтического антитела, например, путем усиления эффекторной функции терапевтического антитела (например, ADCC). Предпочтительно терапевтическое антитело является цитотоксическим и/или опсонирующим антителом. Это будет оценено специалистами в данной области, что, поскольку идентифицированы молекулы настоящего изобретения с требуемыми связывающими свойствами (например, молекулы с вариантными Fc-участками с, по меньшей мере, одной аминокислотной модификацией, которая усиливает аффинность вариантного Fc-участка для FcγRIIIA и/или FcγRIIA по отношению к сравниваемой молекуле, содержащей Fc-участок дикого типа) (См. Пункт 6.2 и Таблицу 9) в соответствии со способами настоящего изобретения, могут быть созданы терапевтические антитела с использованием стандартной техники рекомбинантной ДНК и любой известной мутагенной техники, как описано в Пункте 6.2.2 для получения разработанных лекарственных средств, несущих идентифицированные мутационные сайты с требуемыми связывающими свойствами. Любые из терапевтических антител, представленные в Таблице 10, которые продемонстрировали терапевтическую полезность в лечении злокачественных опухолей, могут быть созданы в соответствии со способами настоящего изобретения, например, путем модифицирования Fc-участка для усиленного аффинитета к FcγRIIIA и/или FcγRIIA, по сравнению с терапевтическим антителом, имеющим Fc-участок дикого типа, и использованы для лечения или предупреждения злокачественных опухолей, характеризующихся антигеном злокачественной опухоли. Другие терапевтические антитела включают антитела против таких патогенных агентов, как серотип 6B Streptococcus pneumoniae, см., например, Sun et al., 1999, Infection и Immunity, 67(3): 1172-9.

Fc варианты настоящего изобретения могут быть включены в терапевтические антитела, такие как те, что раскрыты в данном документе или другие Fc слитые клинические кандидаты, т.е., молекула, включающая Fc-участки, которые были одобрены клиническими испытаниями или любые другие молекулы, которые могут полезны из Fc-вариантов настоящего изобретения или их очеловеченных, со зрелым сродством, модифицированных или сконструированных версий.

Настоящее изобретение также включает создание любых других полипептидов, содержащих Fc-участок, который имеет терапевтическую пользу, включая, но не ограничиваясь, ENBREL, в соответсвии со способами настоящего изобретения, с целью усиления терапевтической эффективности таких полипептидов, например, путем усиления эффекторной функции полипептида, содержащего Fc-участок.

ТАБЛИЦА 10. ТЕРАПЕВТИЧЕСКИЕ АНТИТЕЛА, КОТОРЫЕ МОГУТ БЫТЬ РАЗРАБОТАНЫ В СООТВЕТСТВИИ СО СПОСОБАМИ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ
Фирма Продукт Заболевание Цель
Abgenix ABX-EGF™ Злокачественная опухоль EGF рецептор
AltaRex OvaRex™ Яичниковая злокачественная опухоль опухолевый антиген CA125
BravaRex™ Метастатические злокачественные опухоли опухолевый антиген MUC1
Antisoma Theragyn™ (pemtumomabytrrium-90) Яичниковая злокачественная опухоль PEM антиген
Therex™ злокачественная опухоль молочной железы PEM антиген
Boehringer Ingelheim Blvatuzumab злокачественная опухоль головы и шеи CD44
Фирма Продукт Заболевание Цель
Centocor/J&J Panorex™ Колоректальная злокачественная опухоль 17-1A
ReoPro™ PTCA gp IIIb/IIIa
ReoPro™ Острый MI gp IIIb/IIIa
ReoPro™ Ишемический инсульт gp IIIb/IIIa
Corixa Bexocar™ НХЛ CD20
CRC Technology MAb, idiotypic 105AD7 Колоректальная злокачественная опухоль вакцина gp72
Crucell Anti-EpCAM злокачественная опухоль Ep-CAM
Cytoclonal MAb, злокачественная опухоль легкого Не мелкоклеточная легочная злокачественная опухоль NA
Genentech Herceptin® Метастатическаязлокачественная опухоль молочной железы HER-2
Herceptin® Начальная стадия злокачественной опухоли молочной железы HER-2
Rituxan® рецидив/трудноподдающийся лечениюслабо выраженный или фолликулообразный НХЛ CD20
Rituxan® Переходный и высокодеференцированный НХЛ CD20
MAb-VEGF NSCLC, метестатический VEGF
MAb-VEGF Колоректальная злокачественная опухоль, метестатическая VEGF
AMD™ Fab возрастная дегенерация макулы CD18
E-26™ (2nd gen. IgE) аллергическая бронхиальная астма и риниты IgE
IDEC Zevalin™ (Rituxan™ + иттрий-90) слабо выраженный фолликулообразный, рецидивированный или трудноподдающийся лечению, CD20-положительный, B-клеточный НХЛ и Ритуксимаб-трудноподдающийся CD20
Фирма Продукт Заболевание Цель
лечению НХЛ
ImClone Cetuximab™ + иннотекан трудноподдающаяся лечению колоректальная карцинома EGF рецептор
Cetuximab™ + цисплатин и радиация впервые диагносцированная или повторяющаяся время от времени злокачественная опухоль головы и шей EGF рецептор
Cetuximab™ + гемцитабин впервые диагностированная метестатическая панкреатическая карцинома EGF рецептор
Cetuximab™ + цисплатин + 5FU или Taxol повторяющаяся время от времени или метестатическая злокачественная опухоль EGF рецептор
Cetuximab™ + карбоплатин + паклитаксел Впервые диагностированная не мелкоклеточная карцинома легкого EGF рецептор
Cetuximab™ + Cisplatin™ злокачественная опухоль головы и шеи (обширный неизличимый участок заболевания и отдаленные метастазы) EGF рецептор
Cetuximab + радиация местнораспространенная карцинома головы и шеи EGF рецептор
BEC2 + Bacillus Calmette Guerin Мелкоклеточная карцинома легкого Симулирования ганглиозид GD3
BEC2 + Bacillus Calmette Guerin меланома Симулирования ганглиозид GD3
IMC-1C11 колоректальная злокачественная опухоль с печеночными метастазами VEGF-рецептор
ImmonoGen nuC242-DM1 Колоректальная, желудочная и панкреатическая злокачественная опухоль nuC242
ImmunoMedics LymphoCide™ Неходжкинские лимфомы CD22
Фирма Продукт Заболевание Цель
LymphoCide Y-90™ Неходжкинские лимфомы CD22
CEA-Cide™ Метестатическая солидная опухоль CEA
CEA-Cide Y-90™ Метестатическая солидная опухоль CEA
CEA-Scan™ (Tc-99m-меченный арцитумомаб) Колоректальная злокачественная опухоль радиоизображение) CEA
CEA-Scan™ (Tc-99m-меченный арцитумомаб) Злокачественная опухоль молочной железы (радиоизображение) CEA
CEA-Scan™ (Tc-99m-меченный арцитумомаб) Легочная злокачественная опухоль (радиоизображение) CEA
CEA-Scan™ (Tc-99m-меченный арцитумомаб) Интраоперационные опухоли (радиоизображение) CEA
LeukoScan™ (Tc-99m-меченный сулезомаб) Инфекция мягкой ткани (радиоизображение) CEA
LymphoScan™ (Tc-99m-меченный) Лимфомы (радиоизображение) CD22
AFP-Scan™ (Tc-99m-меченный) Печеночные 7 гем-клеточные злокачественные опухоли (радиоизображение) AFP
Intracel HumaRAD-HN (+ иттрий-90) Злокачественная опухоль головы и шеи NA
HumaSPECT Колоректальная визуализация NA
Medarex MDX-101 (CTLA-4) Простатическая и другие злокачественные опухоли CTLA-4
MDX-210 (her-2 сверхэкспрессия) Простатическая злокачественная опухоль HER-2
MDX-210/MAK Злокачественная опухоль HER-2
MedImmune Vitaxin™ Злокачественная опухоль αvβ3
Merck KGaA MAb 425 Различные злокачественныеопухоли EGF рецептор
Фирма Продукт Заболевание Цель
IS-IL-2 Различные злокачественныеопухоли Ep-CAM
Millennium Campath® (аалемтузумаб) Хронический лимфолейкоз CD52
NeoRx CD20-стрептавидин (+ биотин-иттрий 90) Неходжкинские лимфомы CD20
Avidicin (альбумин + NRLU13) Метестатическая злокачественная опухоль NA
Peregrine Oncolym™ (+ йод-131) Неходжкинские лимфомы HLA-DR 10 beta
Cotara™ (+ йод-131) Нерезектабельная злокачественная глиома ДНК- примесные белки
Pharmacia Corporation C215 (+ стафилококковый энтеротоксин) Панкреатическая злокачественная опухоль NA
MAb, легочная/почечная злокачественная опухоль Злокачественная опухоль головы и шеи NA
nacolomab tafenatox (C242 + стафилококковый энтеротоксин) злокачественная опухоль вызванная кишечной бактерией и панкреатическая NA
Белок Design Labs Nuvion™ Т-лимфоцитные злокачественные опухоли CD3
SMART M195™ AML CD33
SMART 1D10™ НХЛ HLA-DR антиген
Titan CEAVac™ колоректальная злокачественная опухоль, проггресирующая CEA
TriGem™ Метестатическая меланома и мелкоклеточная злокачественная опухоль легкого GD2-ганглиозид
TriAb™ Метестатическая злокачественная опухоль молочной железы MUC-1
Trilex CEAVa™c Колоректальная злокачественная опухоль, прогресирующая CEA
TriGem™ Метестатическая меланома и мелкоклеточная GD2-ганглиозид
Фирма Продукт Заболевание Цель
злокачественная опухоль легкого
TriAb™ Метестатическая злокачественная опухоль молочной железы MUC-1
Viventia Biotech NovoMAb-G2 радиомеченный Неходжкинские лимфомы NA
Monopharm C™ Колоректальная и панкреатическая карцинома SK-1 антиген
GlioMAb-H™ (+ гелонин токсин) Глиома, меланома и нейробластома NA
Xoma Rituxan™ Рецидивированный/трудноподдающийся лечению слабо выраженный или фолликулообразный НХЛ CD20
Rituxan™ Посреднический и высокодеференцированный НХЛ CD20
ING-1 Аденокарцинома Ep-CAM

Таким образом, настоящее изобретение предоставляет способы предупреждения или лечения злокачественных опухолей, характеризованных антигеном злокачественной опухоли, используя терапевтическое антитело, которое связывает антиген злокачественной опухоли и является цитотоксичным, и было модифицировано в одном или нескольких сайтах Fc-участка, по настоящему изобретению, чтобы связывать FcγRIIIA и/или FcγRIIA с большей аффинностью, чем родительское терапевтическое антитело, и/или опосредует эффекторную функцию (например, ADCC, фагоцитоз) более эффективно. В другом варианте осуществления, настоящее изобретение предоставляет способы предупреждения или лечения злокачественных опухолей, характеризованных антигеном злокачественной опухоли, используя терапевтическое антитело, которое связывает антиген злокачественной опухоли и является цитотоксичным, и было создано по настоящему изобретению для связывания FcγRIIIA и/или FcγRIIA с большей аффинностью и связывания FcγRIIB с меньшей аффинностью, чем родительское терапевтическое антитело, и/или опосредует эффекторную функцию (например, ADCC, фагоцитоз) более эффективно. Терапевтические антитела, которые были созданы по настоящему изобретению, полезны для предупреждения или лечения злокачественных опухолей, поскольку они имеют повышенную цитотоксическую активность (например, усиленный цитолиз опухолевых клеток и/или усиленная, например, ADCC активность или CDC активность).

Злокачественные опухоли связанные с раковым антигеном могут лечиться или предупреждаться путем введения терапевтического антитела, которое связывает раковый антиген и оказывает цитотоксический эффект и было разработано в соответсвии со способами настоящего изобретения и имеет, например, повышенную эффекторную функцию. В одном отдельном варианте осуществления, терапевтические антитела, разработанные в соответствии со способами настоящего изобретения, повышают антитело-обусловленный цитотоксический эффект антитела прямо на опухолевый антиген. Например, но не ограничиваясь, злокачественные опухоли, связанные со следующими опухолевыми антигенами, могут лечиться или предотвращаться в соответствии со способами настоящего изобретения: KS 1/4 антиген пан-карциномы (Perez и Walker, 1990, J. Immunol. 142:32-37; Bumal, 1988, Hybridoma 7(4):407-415), антиген карциномы яичника (CA125) (Yu et al., 1991, Cancer Res. 51(2):48-475), ортофосфорная кислота простаты (Tailor et al., 1990, Nucl. Acids Res. 18(1):4928), специфический антиген простаты (Henttu и Vihko, 1989, Biochem. Biophys. Res. Comm. 10(2):903-910; Israeli et al., 1993, Cancer Res. 53:227-230), меланома-связанный антиген p97 (Estin et al., 1989, J. Natl. Cancer Instit. 81(6):445-44), антиген меланомы gp75 (Vijayasardahl et al., 1990, J. Exp. Med. 171(4):1375-1380), высокомолекулярный антиген меланомы (HMW-MAA) (Natali et al., 1987, Cancer 59:55-3; Mittelman et al., 1990, J. Clin. Invest. 86:2136-2144)), специфический мембранный антиген простаты, карциноэмбриональный антиген (CEA) (Foon et al., 1994, Proc. Am. Soc. Clin. Oncol. 13:294), полиморфный эпителиальный муциновый антиген, антиген жировой глобулы грудного молока, колоректальные опухоле связанные антигены такие как: CEA, МЕТКА-72 (Yokata et al., 1992, Cancer Res. 52:3402-3408), CO17-1A (Ragnhammar et al., 1993, Int. J. Cancer 53:751-758); GICA 19-9 (Herlyn et al., 1982, J. Clin. Immunol. 2:135), CTA-1 и LEA, антиген лимфомы Беркитта - 38.13, CD19 (Ghetie et al., 1994, Кровь 83:1329-1336), человеческий антиген B-lymphoms - CD20 (Reff et al., 1994, Кровь 83:435-445), CD33 (Sgouros et al., 1993, J. Nucl. Med. 34:422-430), меланома специфические антигены такие как ганглиозид GD2 (Saleh et al., 1993, J.Immunol., 151, 3390-3398), ганглиозид GD3 (Shitara et al., 1993, Cancer Immunol. Immunother. 36:373-380), ганглиозид GM2 (Livingston et al., 1994, J. Clin. Oncol. 12:1036-1044), ганглиозид GM3 (Hoon et al., 1993, Cancer Res. 53:5244-5250), опухолеспецифический трансплантационный тип поверхностно-клеточного антигена (TSTA): вирус-индуцированные опухолевые антигены, включая T-антиген ДНК вирусов опухолей и антигены оболочки РНК вирусов опухолей, онкофетальный антиген-альфа-фетопротеин, такой как CEA толстого кишечника, онкофетальный антиген опухоли мочевого пузыря (Hellstrom et al., 1985, Cancer Res. 45:2210-2188), дифференцировочный антиген, такой как антиген карциномы легких человека L6, L20 (Hellstrom et al., 1986, Cancer Res. 46:3917-3923), антигены фибросаркомы, Т - клеточный антиген лейкемии человека-Gp37 (Bhattacharya-Chatterjee et al., 1988, J. of Immun. 141:1398-1403), неогликопротеин, сфинголипиды, опухолевый антиген рака груди, такой как EGFR (эпидермальный фактор роста рецептора), HER2 антиген (p185HER2), полиморфный эпителиальный муцин (PEM) (Hilkens et al., 1992, Trends in Bio. Chem. Sci. 17:359), опухолевый лимфоцитарный антиген человека-APO-1 (Bernhard et al., 1989, Science 245:301-304), дифференцировочный антиген (Feizi, 1985, Nature 314:53-57), такой как I антиген обнаруженный в фетальных эритроцитах и первичной эндодерме, I(Ma) обнаруженный в аденокарциномах желудка, M18 и M39 обнаруженные в эпителии груди, SSEA-1 обнаружен в миелоидных клетках, VEP8, VEP9, Myl, VIM-D5 и D156-22 обнаружены в колоректальной злокачественной опухоли, TRA-1-85 (кровь группы H), C14 обнаружен в аденокарциноме толстой кишки, F3 обнаружен в аденокарциноме легких, AH6 обнаружен в злокачественной опухоли желудка, Y гаптен, Ley обнаружен в клетках эмбриональной карциномы, TL5 (кровь группы A), EGF рецептор обнаружен в A431 клетках, E1 серия (кровь группы B) обнаружена в злокачественной опухоли поджелудочной железы, FC10.2 обнаружен в клетках эмбриональной карциномы, аденокарциноме желудка, CO-514 (кровь группы Lea) обнаружен в аденокарциноме, NS-10 обнаружен в аденокарциномах, CO-43 (кровь группы Leb), G49, EGF рецептор, (кровь группы ALeb/Ley) обнаружен в аденокарциноме толстого кишечника, 19.9 обнаружен в злокачественной опухоли толстого кишечника, муцины злокачественной опухоли желудка, T5A7 обнаружен в миелоидных клетках, R24 обнаружен в меланоме, 4.2, GD3, D1.1, OFA-1, GM2, OFA-2, GD2, M1:22:25:8 обнаружен в клетках эмбриональной карциномы и SSEA-3, SSEA-4 обнаружен в эмбрионах на стадии 4-8-ми клеток. В другом варианте осуществления, антигеном является T клеточный рецептор производный пептида из T клеточной лимфомы кожи (см. Edelson, 1998, The Cancer Journal 4:62).

Злокачественные опухоли и связанные нарушения, которые могут быть лечены или предупреждены способами и композициями настоящего изобретения, включают, но не ограничиваясь, следующим: лейкемии, включая, без ограничения, острая лейкемия, острая лимфотическая лейкемия, острые миелоцитарные лейкемии такие как миелобластическая, промиелоцитарная, миеломоноцитарная, моноцитарная, эритролейкемия и миелодиспластический синдром, хронические лейкемии, такие как хроническая миелоцитарная (гранулоцитарная) лейкемия, хроническая лимфоцитарная лейкемия, лейкоз ворсистых клеток; истинная полицитемия; лимфомы, такие как заболевание Ходжкина, неходжкинское заболевание; множественные миеломы, такие как вялотекущая множественная миелома, несекреторная миелома, остеосклеротическая миелома, плазмоклеточный лейкоз, солитарная плазмацитома и экстрамедуллярная плазмацитома; макроглобулинемия Вальденстрома; моноклональная гаммапатия неустановленной этиологии; доброкачественная моноклональная гаммапатия; болезнь тяжёлых цепей; остео и соединительно тканые саркомы, такие как саркома кости, остеосаркома, хондросаркома, саркома Юинга, гигантоклеточная саркома, фибросаркома кости, хордома, периостальная саркома, паренхиматозные саркомы, ангиосаркома (гемангиосаркома), фибросаркома, саркома Капоши, лейомиосаркома, липосаркома, лимфангиосаркома, неврилеммома, рабдомиосаркома, синовиальная саркома; опухоли головного мозга, включая без ограничения, глиома, астроцитома, глиома стволовой части мозга, эпендимома, олигодендроглиома, неглиальная опухоль, неврилеммома слухового нерва, краниофарингиома, медуллобластома, менингиома, пинеоцитома, пинеобластома, первичная мозговая лимфома; рак груди, включая, без ограничения, аденокарцинома, лобулярная (мелкоклеточная) карцинома, интрадуктальная карцинома, медуллярный рак груди, муцинозный рак груди, тубулярный рак груди, папиллярный рак груди, болезнь Паджета, и воспалительный рак груди; злокачественные опухоли надпочесников, включая без ограничения, феохромоцитома и адренокортикокарцинома, злокачественные опухоли щитовидной железы, такие как, без ограничения, папиллярная или фолликулярная злокачественная опухоль щитовидной железы, медуллярная злокачественная опухоль щитовидной железы и анапластическая злокачественная опухоль щитовидной железы; злокачественная опухоль поджелудочной железы, включая без ограничения, инсулинома, гастринома, глюкагонома, випома, соматостатин секретирующая опухоль и карциноидная или опухоль островков поджелудочной железы; злокачественные опухоли гипофиза, включая без ограничения, болезнь Кушинга, пролактинсекретирующая опухоль, акромегалия и несахарный диабет; злокачественные опухоли глаз, включая без ограничения, глазная меланома, такая как меланома радужки, хороидальная меланома, меланома ресничного тела и ретинобластома; злокачественные опухоли влагалища, включая без ограничения, плоскоклеточная карцинома, аденокарцинома и меланома; vulvar злокачественная опухоль наружнх половых органов, включая без ограничения, плоскоклеточная карцинома, меланома, аденокарцинома, базальноклеточная карцинома, саркома и болезнь Педжета; цервикальные злокачественные опухоли, включая без ограничения, плоскоклеточная карцинома и аденокарцинома; злокачественные опухоли матки, включая без ограничения, эндометриальная карцинома и sarcoma матки; злокачественные опухоли яичников, включая без ограничения, эпителиальная карцинома яичников, пограничная опухоль, герминома и стромальная опухоль; злокачественные опухоли пищевода, включая без ограничения, плоскоклеточная злокачественная опухоль, аденокарцинома, аденоиднкистозная карцинома, мукоэпидермоидная карцинома, аденосквамозная карцинома, саркома, меланома, плазмацитома, бородавчатая карцинома и овсяно-клеточная (мелкоклеточная) карцинома; злокачественные опухоли желудка, включают без ограничения, аденокарцинома, некротическая язва (полипоидный), изъязвления, поверхностно распространенная, диффузно распространенная, злокачественная лимфома, липосаркома, фибросаркома и карциносаркома; злокачественные опухоли толстой кишки; злокачественные опухоли прямой кишки; злокачественные опухоли печени, включая без ограничения, гепатоклеточная карцинома и гепатобластома, злокачественные опухоли жёлчного пузыря, включая без ограничения, аденокарцинома; холангиокарцинома, ключая без ограничения, папиллярный, узелковый и диффузный; злокачественные опухоли легких, включая без ограничения, немелкоклеточный рак легкого, плоскоклеточная карцинома (эпидеомоидная карцинома), аденокарцинома, крупноклеточная карцинома и мелкоклеточная злокачественная опухоль легких; тестикулярные злокачественные опухоли, включают без ограничения, герминома, семинома, анапластическая, классическая (типичная), сперматоцитная, несперматоцитома, эмбриональная карцинома, тератомная карцинома, хориокарцинома (опухоль желточного мешка), злокачественные опухоли простаты, включают без ограничения, аденокарцинома, лейомиосаркома и рабдомиосаркома; раки пенеса; злокачественные опухоли полости рта, включают без ограничения, плоскоклеточная карцинома; базальные злокачественные опухоли; злокачественные опухоли слюнных желез, включают без ограничения, аденокарцинома, мукоэпидермоидная карцинома и аденокистозная карцинома; злокачественные опухоли глотки, включают без ограничения, плоскоклеточный рак и бородавчатый; злокачественные опухоли кожи, включают без ограничения, базальноклеточная карцинома, плоскоклеточная карцинома и меланома, поверхностнорасположенная меланома, узелковая меланома, меланома родимого пятна, акральная лентигиозная меланома; злокачественные опухоли почек, включают без ограничени, злокачественная опухоль эпителиальных клеток почки, аденокарцинома, гипернефрома, фибросаркома, переходноклеточная злокачественная опухоль (почечная лоханка и/ или мочеточник); опухоль Вильмса; злокачественные опухоли мочевого пузыря, включают без ограничения, переходноклеточная карцинома, плоскоклеточная злокачественная опухоль, аденокарцинома, карциносаркома. К тому же злокачественные опухоли включают миксосаркому, остеогенную саркому, эндотелиосаркому, лимфангиоэндотелиосаркому, мезотелиому, синовиому, гемангиобластому, эпителиальную карциному, цистаденокарциному, бронхогенную карциному, карциному потовых желез, карциному сальных желез, сосочковую карциному и сосочковую аденокарциному (для обзора данных заболеваний, см. Fishman et al., 1985, Medicine, 2d Ed., J.B. Lippincott Co., Philadelphia and Murphy et al., 1997, Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery, Viking Penguin, Penguin Books U.S.A., Inc., United States of America).

Согласно способам и композиции настоящего изобретения, оно также полезно в лечении или предотвращении разнообразных злокачественных опухолей или других нетипичных пролиферативных заболеваний, включая (без ограничения) следующие: карцинома следующих органов - мочевого пузыря, груди, толстого кишечника, почек, печени, легких, яичников, поджелудочной железы, желудка, простаты, шейки матки, щитовидной железы и кожи; включая плоскоклеточную карциному; гематопоэтические опухоли лимфоидной дифференцировки, включая лейкемию, острую лимфоцитную лейкемию, острую лимфобластную лейкемию, B-клеточную лимфому, T-клеточную лимфому, лимфому Беркитта; гематопоэтичекие опухоли миелоидной дифференцировки, включая острую и хроническую миелогенную лейкемию и промиелоцитарную лейкимию; опухоли мезинхимального происхождения, включая фибросаркому и рабдомиосаркому и другие опухоли, включая меланому, семиному, тетратокарциному, нейробластому и глиому; опухоли центральной и периферичекой нервных систем, включая астроцитому, нейробластому, глиому и шваннома; опухоли мезинхимального происхождения, включая фибросаркому, рабдомиосаркому и остеосаркому и другие опухоли, включая меланому, пигментную ксеродерму, кератоакантому, семиному, злокачественная опухоль щитовидной железы и тератокарцинома. Предположительно злокачественные опухоли, вызванные оберрациями в апоптозе, могут также лечиться способами и композицией настоящего изобретения. Такие злокачественные опухоли могут включать, но не ограничиваться, фолликулярной лимфомой, карциномами с p53 мутациями, гормон зависимыми опухолями груди, простаты и яичников, и предраковыми состояниями, такими как семейный аденоматозный полипоз и миелодиспластический синдром. In отдельном варианте осуществления, злокачественные новообразования или диспролиферативные изменения (такие как метаплазия и дисплазия), или гиперпролиферативные нарушения могут лечиться или предотвращаться способами и композицией настоящего изобретения в яичниках, мочевом пузыре, груди, толстом кишечнике, легких, коже, поджелудочной железе или матке. В других специфических вариантах осуществления, саркома, меланома или лейкемия могут лечиться или предотвращаться способами и композицией настоящего изобретения.

В специфическом варианте осуществления, молекула настоящего изобретения (например, антитело, содержащее вариантный Fc-участок, или терапевтическое моноклональное антитело созданное в соответствие со способами настоящего изобретения) ингибирует или снижает рост первичной опухоли или метастазов раковых клеток по меньшей мере на 99%, по меньшей мере на 95%, по меньшей мере на 90%, по меньшей мере на 85%, по меньшей мере на 80%, по меньшей мере на 75%, по меньшей мерена 70%, по меньшей мере на 60%, по меньшей мере на 50%, по меньшей мере на 45%, по меньшей мере на 40%, по меньшей мере на 45%, по меньшей мере на 35%, по меньшей мере на 30%, по меньшей мере на 25%, по меньшей мере на 20%, или по меньшей мере на 10% по отношению к росту первичной опухоли или метастазов в случае отсутствия указанной молекулы настоящего изобретения.

6.4.1.1 КОМБИНИРОВАННАЯ ТЕРАПИЯ

Настоящее изобретение далее включает применение молекул настоящего изобретения в комбинации с другими методами лечения, известными специалистам данной области техники, для лечения и предупреждения злокачественных опухолей, включая без ограничения, текущие стандартные и экспериментальные химиотерапии, гормональные терапии, биологические терапии, иммунотерапии, радиационные терапии или хирургию. В некоторых вариантах осуществления, молекулы настоящего изобретения могут быть применены в комбинации с терапевтически или профилактически эффективным количеством одного или нескольких противораковых агентов, терапевтическими антителами (например, антитела, представленные в Таблице 10), или другими антителами, известными специалистам данной области техники, для лечения и/или предупреждения злокачественных опухолей (См. пункт 6.4.1.2).

В определенных вариантах осуществения, одна или несколько молекул настоящего изобретения применяются у млекопитающих, предпочтительно у людей, одновременно с одним или несколькими другими терапевтическими средствами, полезными для лечения злокачественной опухоли. Выражение “одновременно” не означает введение профилактических или терапевтических средств в тоже самое время, скорее это означает, что молекула настоящего изобретения и другое средство применяются у млекопитающего последовательно и с временным интервалом так, чтобы молекула настоящего изобретения могла действовать совместно с другим средством для обеспечения лучшего результата, чем, если они будут применяться независимо. Например, каждое профилактическое или терапевтическое средство (например, химиотерапия, радиационная терапия, гормональная терапия или биологическая терапия) могут быть применены в одно и то же время или последовательно в любой очередности в различное время; однако, если они не применяются в одно и то же время, они должны быть применены максимально близко по времени так, чтобы обеспечить требуемый терапевтический или профилактический эффект. Каждое терапевтическое средство может быть введено отдельно, в любой подходящей форме и любым подходящим способом. В различных вариантах осуществления профилактические или терапевтические средства вводятся с интервалом менее 1 часа, с интервалом приблизительно 1 час, с интервалом от приблизительно 1 часа до приблизительно 2 часов, с интервалом от приблизительно 2 часов до приблизительно 3 часов, с интервалом от приблизительно 3 часов до приблизительно 4 часов, с интервалом от приблизительно 4 часов до приблизительно 5 часов, с интервалом от приблизительно 5 часов до приблизительно 6 часов, с интервалом от приблизительно 6 часов до приблизительно 7 часов, с интервалом от приблизительно 7 часов до приблизительно 8 часов, с интервалом от приблизительно 8 часов до приблизительно 9 часов, с интервалом от приблизительно 9 часов до приблизительно 10 часов, с интервалом от приблизительно 10 часов до приблизительно 11 часов, с интервалом от приблизительно 11 часов до приблизительно 12 часов, с интервалом не более 24 часов или с интервалом не более 48 часов. В предпочтительных вариантах осуществления, два или более компонента применяются за один визит пациента.

В других вариантах осуществления, профилактические или терапевтические средства вводятся с интервалом приблизительно от 2 до 4 дней, с интервалом приблизительно от 4 до 6 дней, с интервалом приблизительно неделю, с интервалом приблизительно от 1 до 2 недель или с интервалом более 2 недель. В предпочтительных вариантах осуществления, профилактические или терапевтические средства применяются во временной рамке, когда оба агента все еще активны. Специалист в данной области может определить такую временную рамку по определению времени полужизни применяемых агентов.

В определенных вариантах осуществения, профилактические или терапевтические средства настоящего изобретения применяются у субъекта циклически. Циклическая терапия включает введение первого средства в период времени, следующий за периодом времени введения второго средства и/или третьего средства и повторение этой последовательности введение. Циклическая терапия может уменьшить развитие устойчивости к одному или нескольким методам лечения, избежать или уменьшить побочные эффекты одной из терапий, и/или улучшить эффективность лечения.

В определенных вариантах осуществения, профилактические или терапевтические средства применяются в цикле менее, чем 3 недели, примерно раз в 2 недели, примерно раз каждые 10 дней или примерно каждую неделю. Один цикл может содержать введение терапевтического или профилактического средства путем инфузии более 90 минут на каждый цикл, около 1 часа на каждый цикл, около 45 минут на каждый цикл. Каждый цикл может содержать по меньшей мере 1 неделю отдыха, по меньшей мере 2 недели отдыха, по меньшей мере 3 недели отдыха. Число вводимых циклов - от 1 до примерно 12 циклов, более типично от примерно 2 до примерно 10 циклов, и менее типично от примерно 2 до примерно 8 циклов.

В других вариантах осуществления, терапевтические и профилактические агенты настоящего изобретения применяются в равномерно дозированных режимах, или путем продолжительной инфузии, или частого введения без продолжительных периодов отдыха. Такое равномерное введение может включать дозирование в определенных интервалах без периодов отдыха. Типично, терапевтические средства, в частности цитотоксические агенты, используются в меньших дозах. Такие дозированные режимы охватывают хроническое ежедневное введение относительно низких доз для расширенного периода времени. В предпочтительных вариантах осуществления, применение более низких доз может минимизировать токсические побочные эффекты и убрать периоды отдыха. В определенных вариантах осуществения, терапевтические и профилактические агенты вводят хроническим низко-дозовым или продолжительным инфузионным ранжированием от примерно 24 часов до примерно 2 дней, до примерно 1 недели, до примерно 2 недель, до примерно 3 недель, до примерно 1 месяца, до примерно 2 месяцев, до примерно 3 месяцев, до примерно 4 месяцев, до примерно 5 месяцев, до примерно 6 месяцев. Планирование таких дозовых режимов может быть оптимизировано квалифицированными онкологами.

В других вариантах осуществления, курсы лечения применяют у млекопитающих параллельно, т.е., индивидуальные дозы лекарств применяют отдельно все же в пределах временного интервала так, чтобы молекулы настоящего изобретения могли работать вместе с другим средством или агентом. Например, один компонент можно применять один раз в неделю в комбинации с другими компонентами, которые могут быть прменены раз в две недели или раз в каждые три недели. Другими словами, дозовые режимы для лекарств выполняются параллельно, даже если лекарства не применяют одновременно или в один визит пациента.

При использовании в комбинациях с другими профилактическими и/или терапевтическими средствами, молекулы настоящего изобретения и профилактическое и/или терапевтическое средство могут действовать совокупно или, более предпочтительно, синергично. В одном варианте осуществления, молекула настоящего изобретения применяется параллельно с одним или несколькими терапевтическими средствами в той же фармацевтической композиции. В другом варианте осуществления, молекула настоящего изобретения применяется параллельно с одним или несколькими другими терапевтическими средствами в раздельной фармацевтической композиции. В том же другом варианте осуществления, молекула настоящего изобретения применяется до или следом за введением другого профилактического или терапевтического средства. Настоящее изобретение рассматривает введение молекулы настоящего изобретения в комбинации с другими профилактическими или терапевтическими средствами теми же или различными путями введения, например, оральный и парентеральный. В определенных вариантах осуществения, когда молекула настоящего изобретения применяется параллельно с другим профилактическим или терапевтическим средством, что потенциально продуцирует неблагоприятные побочные эффекты, включая, без ограничения, токсичность, профилактическое или терапевтическое средство может преимущественно быть применено в дозе ниже пороговой величины, вызывающей неблагоприятный эффект.

Дозированные количества и частота введение, представленные здесь, охватываются терминами терапевтически эффективный и профилактически эффективный. Дозировка и частота далее будут типично варьировать в зависимости от факторов, специфичных для каждого пациента, зависящих от применяемых специфических терапевтических или профилактических агентов, тяжести и типа злокачественной опухоли, способа введения, а также возраста, веса, реакции, и прошлой медицинской истории пациента. Подходящие режимы могут быть выбраны специалистами в данной области после рассмотрения таких факторов и после, например, дозировок, представленных в литературе и рекомендованных в Physician's Desk Reference (56th ed., 2002).

6.4.1.2 ДРУГИЕ ТЕРАПЕВТИЧЕСКИЕ/ПРОФИЛАКТИЧЕСКИЕ

АГЕНТЫ

В особых вариантах осуществления, способы настоящего изобретения включают введение одной или нескольких молекул настоящего изобретения с одним или несколькими терапевтическими средствами, используемыми для лечения и/или предупреждения злокачественной опухоли. В одном варианте осуществления, ингибиторы ангиогенеза могут применяться в комбинации с молекулами настоящего изобретения. Ингибиторы ангиогенеза, которые могут использоваться в способах и композициях настоящего изобретения включают но не ограничиваются: ангиостатин (фрагмент плазминогена); антиангиогенный антитромбин III; ангиозим; ABT-627; Bay 12-9566; бенефин; бевацизумаб; BMS-275291; ингибитор полученный из хряща (CDI); CAI; CD59 фрагмент комплемента; CEP-7055; Col 3; комбретастатин A-4; эндостатин (фрагмент XVIII коллагена); фрагмент фибронектина; Gro-бета; галофугинон; гепариназы; гексасахаридный фрагмент гепарина; HMV833; гонадотропин человека (hCG); IM-862; Интерферон альфа/бета/гамма; Интерферон индуцируемый белок (IP-10); Интерлейкин-12; Крингл 5 (фрагмент плазминогена); маримастат; ингибиторы металлопротеиназ (TIMPs); 2-метоксиэстрадиол; MMI 270 (CGS 27023A); MoAb IMC-1C11; неовастат; NM-3; панзем; PI-88; плацентарный ингибитор рибонуклеазы; ингибитор активатора плазминогена; тромбоцитарный фактор-4 (PF4); приномастат; фрагмент пролактина 16 кДа; пролиферин-связанный белок (PRP); PTK 787/ZK 222594; ретиноиды; солимастат; скваламин; SS 3304; SU 5416; SU6668; SU11248; тетрагидрокортизол-S; тетратиомоливдат; талидомид; тромбоспондин-1 (TSP-1); TNP-470; трансформирующий фактор роста-бета (TGF-b); васкулостатин; вазостатин (фрагмент калретикулина); ZD6126; ZD 6474; ингибиторы фарнезилтрансферазы (FTI) и бисфосфонаты.

Противоопухолевые агенты, которые могут использоваться в комбинации с молекулами настоящего изобретения в различных вариантах осуществления настоящего изобретения, включая фармацевтические композиции и лекарственные формы и наборы настоящего изобретения, включают, но не ограничиваются: ацивицин; акларубицин; акодазол гидрохлорид; акронин; адозелезин; альдеслейкин; альтретамин; амбомицин; аметантрон ацетат; аминоглутетимид; амсакрин; анастрозол; антрамицин; аспарагиназа; асперлин; азацитидин; азетепа; азотомицин; батимастат; бензодепа; Бикалутамид; бизантрен гидрохлорид; биснафид димесилат; бизелесин; блеомицин сульфат; брехинар натрия; бропиримин; бусулфан; кактиномицин; калустерон; карацемид; карбитимер; карбоплатин; кармустин; карубицин гидрохлорид; карзелезин; цедефингол; хлорамбуцил; циролемицин; цисплатин; кладрибин; кризнатол мезилат; циклофосфамид; цитарабин; дакарбазин; дактиномицин; даунорубицин гидрохлорид; децитабин; дексормаплатин; дезагуанин; дезагуанин мезилат; диазигуон; доцетаксел; доксорубицин; доксорубицин гидрохлорид; дролоксифен; дролоксифен цитрат; дромостанолон пропионат; дуазомицин; идатрексат; эфлорнитин гидрохлорид; эльзамитруцин; энлоплатин; энпромат; эпипропидин; эпирубицин гидрохлорид; эрбулозол; эзорубицин гидрохлорид; эстрамустин; эстрамустина фосфат натрия; этанидазол этопозид; этопозид фосфат; этоприн; фадрозол гидрохлорид; фазарабин; фенретинид; флоксуридин; флударабин фосфат; фторурацил; флуроцитабин; фосхидон; фостриецин натрийя; гемцитабин; гемцитабин гидрохлорид; гидроксимочевина; идарубицин гидрохлорид; ифосфамид; илмофозин; интерлейкин II (включая рекомбинантный интерлейкин II, или rIL2), интерферон альфа-2a; интерферон альфа-2b; интерферон альфа-n1; интерферон альфа-n3; интерферон бета-I a; интерферон гамма-I b; ипроплатин; иринотекан гидрохлорид; ланреотид ацетат; летрозол; леупролид ацетат; лиарозол гидрохлорид; лометрексол натрия; ломустин; лозоксантрон гидрохлорид; мазопрокол; майтансин; хлорметин гидрохлорид; мегестрол ацетат; меленгестрол ацетат; мелфалан; меногарил; меркаптопурин; метотрексат; метотрексат натрия; метоприн; метуредепа; митиндомид; митокарцин; митокромин; митогиллин; митомалцин; митомицин; митоспер; митотан; митоксантрон гидрохлорид; микофенольная кислота; нокодазол; ногаломицин; ормаплатин; оксизуран; паклитаксел; пэгаспаргаза; пелиомицин; пентамустин; пепломицин сульфат; перфосфамид; пипоброман; пипосульфан; пироксантрон гидрохлорид; пликамицин; пломестан; порфимер натрия; порфиромицин; преднимустин; прокарбазин гидрохлорид; пуромицин; пуромицин гидрохлорид; пуразофурин; рибоприн; роглетимид; сафингол; сафингол гидрохлорид; семустин; симтразен; спарфозат натрия; спарзомицин; спирогерманий гидрохлорид; спиромустин; спироплатин; стрептонигрин; стрептозоцин; сулофенур; тализомицин; текогалан натрия; тегафур; телоксантрон гидрохлорид; темопорфин; тенипозид; тероксирон; тестолактон; тиамиприн; тиогуанин; тиотепа; тиазофурин; тирапазамин; торимифен цитрат; трестолон ацетат; трицирибин фосфат; триметрексат; триметрексат глюкуронат; трипторелин; тубулозол гидрохлорид; урацил горчицы; уредепа; вапреотид; вертепорфин; винбластин сульфат; винкристин сульфат; виндезин; виндезин сульфат; винепидин сульфат; винглицинат сульфат; винлеурозин сульфат; винорелбин тартрат; винрозидин сульфат; винзолидин сульфат; ворозол; зениплатин; зиностатин; зорубицин гидрохлорид. Другие противоопухолевые лекарственные средства включают, но не ограничиваются: 20-эпи-1,25 дигидроксивитамин D3; 5-этинилурацил; абиратерон; акларубицин; ацилфульвен; адеципенол; адозелезин; альдеслейкин; ALL-TK антагонисты; альтретамин; амбамустин; амидакс; амифостин; аминолевуленовая кислота; амрубицин; амсакрин; анагрелид; анастрозол; ирографолид; ингибиторы ангиогенеза; антагонист D; антагонист G; антареликс; портиво дорсализирующий морфогенетический белок-1; антиандроген, карцинома предстательной железы; антиэстроген; антинеопластон; антисмысловые олигонуклеотиды; афидиколин глицинат; модуляторы гена апоптоза; регуляторы апоптоза; апуриновая кислота; ара-CDP-DL-PTBA; аргинин диаминаза; азулакрин; атаместан; атримустин; аксинастин 1; аксинастин 2; аксинастин 3; азасетрон; азатоксин; азатирозин; баккатин III производные; баланол; батимастат; BCR/ABL антагонисты; бензохолины; бензоилстауроспорин; производные бета лактама; бета-алетин; бетакламицин B; бетулиновая кислота; bFGF ингибитор; бикалутамид; бизантрен; бизазиридинилспермин; бизнафид; бистратен A; бизелезин; брефлат; бропиримин; будотитан; бутионин сульфоксимин; кальципотриол; калфостин С; производные камптотецина; канарипокс IL-2; капецитабин; карбоксамид-амино-триазол; карбоксиамидотриазол; CaRest M3; CARN 700; ингибитор, полученный из хряща; карзелезин; ингибиторы казеинкиназы (ICOS); кастаноспермин; цекропин В; цетрореликс; хлорины; хлорхиноксалин сульфонамид; цикапрост; цис-порфирин; кладрибин; аналоги кломифена; клотримазол; коллимицин А; коллимицин В; комбретастатин А4; аналог комбретастатин; конагенин; крамбесцидин 816; криснатол; криптофицин 8; производные криптофицина А; курацин А; циклопентантрахиноны; циклоплатам; ципемицин; цитарабин окфосфат; цитолитический фактор; цитостатин; дакликсимаб; децитабин; дегидродидемнин В; деслорелин; дексаметазон; дексифосфамид; дексразоксан; дексверапамил; диазихион; дидемнин В; дидокс; диэтилнорспермин; дигидро-5-азацитидин; дигидротаксол 9-; диоксамицин; дифенилспиромустин; доцетаксел; докозанол; долазетрон; доксифлуридин; дролоксифен; дронабинол; дуокармицин SA; эбселен; экомустин; эделфозин; эдреколомаб; эфлорнитин; элемен; эмитефур; эпирубицин; эпристерид; аналог эстрамустина; агонисты эстрогена; антагонисты эстрогена; этанидазол; этопозид фосфат; эксеместан; фадрозол; фазарабин; фенретинид; филграстим; финастерид; флавопиридол; флезеластин; флуастерон; флударабин; фтордауноруницин гидрохлорид; форфенимекс; форместан; фостриецин; фотемустин; гадолиний тексафирин; галлий нитрат; галоцитабин; ганиреликс; ингибиторы желатиназы; гемцитабин; ингибиторы глутитиона; гепсульфам; герегилин; гексаметилен бисацетамид; гиперицин; иба