Новые композиции и их применение



Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение
Новые композиции и их применение

 


Владельцы патента RU 2604797:

ФОЛЛИКУМ АБ (SE)

Изобретение относится к области биотехнологии, конкретно к модифицированным полипептидам остеопонтина, и может быть использовано в косметологии и медицине. Получают модифицированный остеопонтин, в котором RGD домен инактивирован. Изобретение позволяет эффективно стимулировать рост волос у млекопитающего. 8 н. и 61 з.п. ф-лы, 6 ил., 9 табл., 4 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к агентам для стимулирования роста волос у млекопитающих. В частности, предлагаются композиции, содержащие модифицированный полипептид остеопонтин, и их применение в фармацевтике и косметологии для стимулирования роста волос у млекопитающих (включая человека).

Уровень техники

Рост волос представляет собой циклический процесс, который протекает в три стадии: анагена (фаза активного роста), катагена (фаза дистрофических изменений в волосе) и телогена (фаза функционального покоя). После фазы функционального покоя волокно старого волоса выпадает и на его месте растет новый волос как часть повторяющегося цикла.

Алопеция, или выпадение волос, наблюдается как у мужчин, так и у женщин и связана с многочисленными причинами включая старение, изменение гормонального фона, стресс, химиотерапию. При перечисленных состояниях все больше волос остаются в стадии телогена, что приводит к постепенному уменьшению длины и диаметра волосяного волокна и в конечном итоге к частичному или полному облысению.

Известны различные типы выпадения волос, включая гнездную алопецию, андрогенетическую алопецию, анагеновое выпадение волос, самоиндуцированное выпадение волос, телогеновое выпадение волос, рубцовую алопецию. Гнездная алопеция, которая, как полагают, является аутоиммунным заболеванием, начинается с выпадения волос, в результате чего на волосистой части головы образуются округлые участки. Гнездная алопеция включает умеренное очаговое выпадение волос на волосистой части головы, а также выпадение волос на всей волосистой части головы, которое известно как тотальная алопеция, и выпадение волос как на волосистой части головы, так и на других частях тела (универсальная алопеция). Андрогенетическая алопеция наблюдается как у мужчин, так и у женщин и обусловлена наследственной предрасположенностью, старением и изменением уровня андрогенных гормонов. Причиной андрогенетической алопеции является повышенная андрогенная стимуляция, которая отрицательно сказывается на состоянии волосяных фолликулов. Повышенная андрогенная стимуляция может быть связана, помимо прочих механизмов, с повышенной активностью 5-альфа-редуктазы, фермента, который превращает тестостерон в дигидротестостерон. Анагеновая алопеция представляет собой выпадение волос в результаты неблагоприятного действия химических веществ или иониздрующего излучения, например у больных, которые получают лучевую или химиотерапию по поводу онкологического заболевания. Самоиндуцированное выпадение волос обусловлено сознательным или неосознаваемым повреждением волос. К двум известным типам самоиндуцированного выпадения волос относятся трихотилломания, когда человек постоянно выдергивает у себя волосы, и тракционная алопеция, которая связана с определенной прической, например «конским хвостом» или косами, которые постоянно тянут волосы. Под телогеновой алопецией понимают стрессовое выпадение волос, обусловленное такими состояниями, как хирургическое вмешательство, рождение ребенка, прерывание беременности. К другим причинам телогеновой алопеции относятся прием пероральных контрацептивов и других рецептурных средств, нарушение функции щитовидной железы, сахарный диабет, системная красная волчанка и психоэмоциональный стресс. К рубцовой алопеции относится выпадение волос при инфекционных и воспалительных заболеваниях волосяных фолликулов и выпадение волос в результате ожогов и других травм.

Выпадение волос - это широко распространенное заболевание, которое рассматривается некоторыми как косметологическая патология, и часто вызывает подавленное эмоциональное состояние. В связи с этим лечение алопеции представляет важную проблему. Испытано множество композиций, созданных для стимулирования роста волос, например, способствующих наступлению или продлению анагена. Примеры таких композиций включают: активаторы калиевых каналов, такие, как миноксидил (Regaine RTM., Pharmacia Corp.) и диазоксид; ингибиторы 5-альфаредуктазы, например финастерид (Propecia RTM., Merkand Co.), и иммунодепрессант циклоспорин А.

Однако лечение известными композициями для стимулирования роста волос недостаточно эффективно и сопровождается нежелательными побочными эффектами. Например, к нежелательным побочным эффектам активаторов калиевых каналов, помимо прочих, относятся сердечнососудистые эффекты, финастерид небезопасен для беременных женщин или женщин, которые собираются забеременеть, а циклоспорин А подавляет иммунную систему. Кроме того, даже при местном применении для стимулирования роста волос, известные композиции для лечения алопеции часто вызывают нежелательный рост волос на других участках тела, например на лице у женщин. Эти недостатки известных композиций для лечения алопеции приводят к тому, что многие пациенты, страдающие алопецией, прибегают к ношению париков или накладных прядей волос, другие решаются на трансплантацию волос, которая является дорогостоящей операцией и не всегда дает желаемый эффект, а иногда, например у больных, получающих химиотерапию, просто невозможна.

В связи с изложенным выше необходимо искать новые способы стимулирования роста волос, применимые как с медицинской, так и с косметологической точки зрения.

Сущность изобретения

Первый объект настоящего изобретения касается композиции для стимулирования роста волос у млекопитающих, содержащей:

(a) модифицированный полипептид остеопонтин, в котором RGD-домен инактивирован; и

(b) фармацевтически и/или косметически приемлемый наполнитель, носитель или растворитель.

Таким образом, активный компонент композиции по изобретению является производным природного белка остеопонтина (то есть полипептид содержит аминокислотную последовательность, соответствующую модифицированному, например мутированному, варианту природного белка остеопонтина).

Остеопонтин, известный и как костный сиалопротеин I (BSP-1 или BNSP), протеин ранней активации Т-лимфоцитов (ЕТА-1),секретируемый фосфопротеин 1 (SPP1), 2аг и белок резистентности к риккетсиям, является продуктом экспрессии гена, который имеется в генетическом аппарате ряда млекопитающих.

Ген остеопонтина имеет семь экзонов, длину 5 тпо и у человека локализован на длинном плече хромосомы 4 в области 13 (4q13). Белок состоит примерно из 300 аминокислотных остатков и богат кислыми аминокислотами: 30-36% из них приходится на долю аспартата или глутамата. Остеопонтин имеет около 30 присоединенных углеводных остатков, включая 10 остатков сиаловой кислоты, которые присоединяются к белку в процессе посттрансляционной модификации в аппарате Гольджи.

Остеопонтин был впервые выявлен как новый сиалопротеин в остеокластах, заякоренных на минерализованном костном матриксе (Franzenand Heinegard, 1985, Biochem. J. 232(3)715-24). Название остеопонтин происходит от расположения белка в кости (osteo-) и от способности образовать мостик (-pons) между костными клетками и минеральной фазой. Секвенирование и последующее исследование структуры показало, что остеопонтин является гликопротеином с молекулярной массой 32 кДа, содержащим высококислую область, имеющую около десяти остатков аспартата, что, как полагают, обусловливает минералосвязывающие свойства остеопонтина. Кроме того, в средней части молекулы остеопонтина имеется домен прикрепления к клетке, содержащий последовательность R-G-D (Oldbergetal., 1986, Proc. Natl. Acad. Sci. USA 83(23):8819-23).

Остеопонтин постоянно экспрессируется в остеобластах и некоторых типах эпителиальных клеток, что обусловливает секрецию этого белка во многие жидкости организма. Кость является единственным типом ткани, в которой остеопонтин откладывается и из которой его можно получить в большом количестве. Экспрессию остеопонтина можно также индуцировать в гладкомышечных клетках сосудистой стенки, в различных типах раковых клеток и воспалительных клетках (в частности, в макрофагах и Т-лимфоцитах). Остеопонтину приписывают ряд важных клеточных функций, например функцию адгезии, пролиферации, миграции, анти-апоптоза и хемоаттрактации. Некоторые из перечисленных функций, как сейчас полагают, опосредуются RGD-доменом клеточной адгезии, который взаимодействует с различными интегринами, главным образом с αvβ3, но также αvβ1 и αvβ5 (см. обзор Scatena et al., 2007, Arterio. Thromb. Vasc. Biol. 27:2302-2309).

В последние годы обнаружено, что остеопонтин обладает сильно выраженной цитокиновой активностью и модулирует деятельность нескольких типов клеток, которые участвуют в воспалительном процессе и иммунном ответе. Целый ряд функций, приписываемых остеопонтину, остаются неизученными и не поддаются объяснению одиночной RGD-последовательностью, связывающей клетки. Объяснение было найдено, когда был идентифицирован и затем функционально промаркирован пептид из одиннадцати аминокислотных остатков в молекуле остеопонтина R145-G-D-S-L-A-Y-G-L-R-S155 (последовательность SEQ ID NO: 122), соответствующий аминокислотам 144-154 идентификационного кода Ρ10923 консорциума UniProt. Помимо известного R145-G-D147 сайта, опосредующего связывания с αvβ3 интегрином, были выявлены две дополнительные важные области в молекуле остеопонтина, а именно: высокоспецифичный сайт расщепления тромбина, то есть R154-S155, и скрытый сайт связывания интегрина, то есть S148-L-A-Y-G-L-R154 (SEQ ID NO: 123), которая связывается с α9β1 интегрином (см. работу Scatena et al, цитированную выше). Идентифицирована также дополнительная связывающая область для α4β1 (см. работу Scatena et al, цитированную выше).

Характерная особенность полипептида, производного остеопонтина, в композиции по изобретению состоит в том, что RGD домен, который присутствует в природном остеопонтине, инактивирован и не функционирует (во всяком случае частично). Например, инактивация RGD домена может предупредить связывание производного полипептида остеопонтина с одним или более интегрином, который связывается с природным белком остеопонтина.

Таким образом, «модифицированный полипептид остеопонтина» мы включаем в полипептид, соответствующий модифицированной форме природного белка остеопонтина, в котором RGD домен является нефункциональным (по меньшей мере частично), а также его фрагментам и вариантам, которые сохраняют способность стимулировать рост волос «полноразмерного» модифицированного остеопонтина. Например, нефункционирующий RGD домен модифицированного полипептида остеопонтина может быть неспособен связываться с αvβ3 интегрином (см. работу Scatena et al., цитированную выше).

Предпочтительно использовать природный белок остеопонтин млекопитающих, например человека.

Модифицированные полипептиды остеопонтина, присутствующие в композиции по изобретению, обладают способностью стимулировать рост волос млекопитающих.

В одном варианте осуществления изобретения полипептид способен стимулировать рост волос человека

В другом варианте осуществления изобретения полипептид способен стимулировать рост волос in vivo.

Еще в одном варианте осуществления изобретения полипептид способен более эффективно стимулировать рост волос in vivo, чем дикий тип остеопонтина человека. Под выражением «более эффективно» в данном контексте подразумеваем более быстрое начало действия и/или более выраженный эффект при меньшей дозе и/или более выраженный максимальный эффект (например, появление большего количества новых волосяных фолликулов или большая плотность волос). В одном варианте осуществления изобретения полипептид способен стимулировать рост волос in vivo с более ранним началом действия и более высоким максимальным эффектом на рост волос по сравнению с диким типом остеопонтина человека, вводимого в той же дозе (см. Пример В).

Понятно, что специалисты в данной области могут вызывать рост волос, стимулируя имеющиеся волосяные фолликулы и/или индуцируя образование новых волосяных фолликулов.

Таким образом, в одном варианте осуществления изобретения модифицированный полипептид остеопонтина способен стимулировать имеющиеся волосяные фолликулы (например, способствуя наступлению фазы анагена и/или сокращая стадию телогена, в результате чего остающиеся волосяные фолликулы становятся активными).

В еще другом варианте осуществления изобретения полипептид способен индуцировать образование новых волосяных фолликулов или индуцировать стволовые клетки, образующие такие фолликулы.

Природные белки остеопонтина в типичном случае содержат около 300 аминокислотных остатков. Однако для специалистов в данной области понятно, что модифицированные полипептиды остеопонтина, присутствующие в композициях по изобретению, могут иметь и другую длину цепи.

В типичном случае длина цепи полипептида меньше 500 аминокислотных остатков, например, меньше 400, 350, 340, 3330, 320, 310, 300, 290, 280, 270, 260, 250, 200, 150, 100, 50, 40, 30, 20, 15, 10 или менее аминокислотных остатков.

В одном варианте осуществления изобретения длина цепи полипептида составила между 250 и 350 аминокислотных остатков, например между 280 и 300 аминокислотных остатков (например, 293 аминокислотных остатка).

В другом варианте осуществления изобретения длина цепи полипептида составила между 10 и 20 аминокислотными остатками, например между 12 и 18 аминокислотными остатками (например, 15 аминокислотных остатков).

Как было рассмотрено раньше, модифицированные полипептиды остеопонтина не имеют активной трипептидной последовательности «аргинин-глицин-аспартат», которая в норме присутствует в природных белках остеопонтина. Понятно, что данный RGD домен можно инактивировать целым рядом способов.

В одном варианте осуществления изобретения RGD домен в модифицированном полипептиде остеопонтина мутирован по одному или более аминокислотному остатку так, что содержит одну или более делецию, замену или вставку либо их сочетание по сравнению с природным белок остеопонтина.

Например, RGD домен может быть делетирован, по меньшей мере частично, так что аргинин, и/или глицин, и/или аспартат могут отсутствовать.

При другом варианте или в сочетании с вышеуказанным вариантом осуществления изобретения в RGD домене может оказаться замещенной одна или более аминокислота. Например, аргинин, и/или глицин, и/или аспартат могут быть замещены другой аминокислотой. Такие замены могут быть консервативными или неконсервативными.

Аналогично RGD домен может быть инактивирован комбинацией замен и делеций, включая

(a) замену остатка аргинина и делецию глицина и аспартата;

(b) замену аргинина и глицина и делецию аспартата (например, трипептид -RGD- может быть заменен дипептидной последовательностью -DI-):

(c) замену аргинина и аспартата и делецию глицина;

(d) делецию аргинина и аспартата и замену глицина.

В одном варианте осуществления изобретения трипептидная последовательность -RGD- замещена дипептидной последовательностью -DI-.

Не желая быть связанными теорией, отметим, что инактивация RGD последовательности может вызвать конформационные изменения в полипептиде остеопонтина (по сравнению с соответствующим природным белком остеопонтина), которые приводят к образованию или экспонированию нового сайта окружающей среде.

В одном предпочтительном варианте осуществления изобретения модифицированный полипептид остеопонтина содержит или состоит из аминокислотной последовательности SEQ ID NO: 1 (в которой подчеркнута область, включающая инактивированный RGD домен):

или ее фрагмента, варианта, производного или из слившейся последовательности (слияние упомянутого фрагмента, варианта или производного), которая сохраняет (по меньшей мере частично) способность стимулировать рост волос аминокислотной последовательности SEQ ID NO: 1.

Термин «аминокислота», используемый в описании, включает стандартные двадцать генетически закодированных аминокислот и их соответствующие стереоизомеры в «D» форме (по сравнению с природными «L» формами), омега-аминокислоты и другие природные аминокислоты, нетрадиционные аминокислоты (например, α,α-дизамещенные аминокислоты, N-алкиламинокислоты и т.д.) и химические производные аминокислот (см. далее).

При специальном обозначении аминокислот, например, «аланин», «Ala» или «А» подразумевают как L-аланин, так и D-аланин, если особо не оговаривается иное. Другие, нетрадиционные, аминокислоты также могут быть подходящими компонентами полипептидов по изобретению, если полипептид сохраняет свои свойства и функциональную активность. Для продемонстрированных полипептидов каждый закодированный аминокислотный остаток там, где возможно, представлен одиночным буквенным символом, соответствующим тривиальному названию традиционной аминокислоты.

В соответствии с принятым соглашением аминокислотные последовательности, описываемые здесь, приводятся в направлении от N-конца к С-концу.

В типичных случаях модифицированные полипептиды остеопонтина, использованные в композициях по изобретению содержат L-аминокислоты или состоят из L-аминокислот.

В одном варианте осуществления изобретения полипептид может содержать или состоять из фрагмента аминокислотной последовательности SEQ ID NO: 1 или ее варианта.

Под словом «фрагмент» мы понимаем по меньшей мере шесть смежных аминокислот, принадлежащих аминокислотной последовательности SEQ ID NO: 1, например, по меньшей мере 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 100, 150, 200, 210, 220, 230, 240, 250, 255, 260, 265, 270, 275, 280, 285, 286, 287, 288, 289, 290, 291 или 292 последовательных аминокислотных остатка последовательности SEQ ID NO: 1.

Предпочтительно, чтобы фрагмент содержал или состоял из последовательности инактивированного RGD домена последовательности SEQ ID NO: 2, а именно:

DISLAYGLRS SEQ ID NO: 2

Например, фрагмент может содержать или состоять из аминокислотной последовательности, соответствующей любой из SEQ ID NO: от 5 до 62.

В частности, в одном варианте осуществления изобретения полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 5.

VDVPNGDISLAYGLR SEQ ID NO: 5 ["FOL-004"]

В другом варианте осуществления изобретения полипептид содержит или состоит из варианта аминокислотной последовательности SEQ ID NO: 1 или ее фрагмента.

Слово «вариант» означает, что в полипептиде не все 100% аминокислот такие же, как в последовательности SEQ ID NO: 1, то есть одна или более аминокислота последовательности SEQ ID NO: 1 должна быть мутированной. Например, полипептид может содержать или состоять из аминокислотной последовательности, которая по меньшей мере на 50% идентична аминокислотной последовательности SEQ ID NO: 1, более предпочтительно на 60%, 70%, или 80%, или 85%, или 90% идентична указанной последовательности и особенно предпочтительно на 95%, 96%, 97%, 98% или 99% идентична указанной последовательности.

Степень идентичности в процентах определяется способами, хорошо известными специалистам в данной области, например, с помощью программы LALIGN (Huangand Miller, Adv. Appl. Math. (1991) 12:337-357), приведенной на сайте ExPASy

(bttp://www.ch.embnet.org/software/LALIGNform.html),

где используются следующие параметры: система глобального выравнивания, матрица BLOSUM62 штраф за внесение делеции 14, за продление делеции - 4.

При другом варианте идентичность последовательностей при сравнении двух полипептидов можно определить с помощью подходящих компьютерных программ, например программы GAP, разработанной группой компьютерной обработки генетической информации Висконсинского университета, при этом степень идентичности в процентах рассчитывают по отношению к полипептидам, аминокислотная последовательность которых оптимально выровнена.

Под словом «мутированный» мы подразумеваем, что изменен аминокислотный остаток в конкретном положении по сравнению с аминокислотным остатком в полипептиде, соответствующем SEQ ID NO: 1. Например, в конкретном положении аминокислотной последовательности может произойти делеция, замена или вставка одной или более аминокислоты. Специалистом в данной области ясно, что замена аминокислоты может быть консервативной или неконсервативной.

В другом варианте осуществления изобретения или в дополнение к нему аминокислоту в конкретном положении можно подвергнуть химической модификации (то есть использовать ее производное), о чем будет сказано далее.

В одном варианте осуществления изобретения вариант полипептида содержит или состоит из аминокислотной последовательности SEQ ID NO: 1 или ее фрагмента, в котором имеется консервативная замена одного или более аминокислотного остатка. Под «консервативной заменой» мы понимаем замену одной аминокислоты другой с аналогичными свойствами (размер, гидрофобность и т.д.), при которой функция полипептида существенно не изменяется. Так, «консервативной заменой» считается взаимная замена следующих аминокислот: Gly, Ala; Val, Ile, Leu; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Тут.

В предпочтительном варианте изобретения использован вариант полипептида, содержащий или состоящий из инактивированного RGD домена последовательности SEQ ID NO: 2, а именно:

DISLAYGLRS SEQ ID NO: 2.

Вариант полипептида может также содержать одну или более дополнительную аминокислоту, вставленную на N- или С-конце и/или в самой аминокислотной последовательности SEQ ID NO: 1. Например, полипептид может содержать или состоять из по меньшей мере 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 или 20 дополнительных аминокислот на N-или С-конце или в самой последовательности.

В предпочтительном варианте изобретения этот вариант полипептида в естественных условиях не встречается.

В одном предпочтительном варианте изобретения модифицированный полипептид остеопонтина является видовым гомологом аминокислотной последовательности SEQ ID NO: 1.

Таким образом, полипептид может содержать или состоять из аминокислотной последовательности модифицированного белка человеческого остеопонтина или его фрагмента, в котором RGD домен инактивирован. Подходящая аминокислотная последовательность человеческого остеопонтина хорошо известна специалистам в данной области (см., например, номера поступлений ААА59974.1, ААС28619.1, ААА86886.1 в базе данных).

Например, модифицированный полипептид остеопонтина может содержать или состоять из аминокислотной последовательности SEQ ID NO: 3 (в которой подчеркнута область, содержащая инактивированный RGD домен,)

или ее фрагмента, варианта, производного или слитой последовательности (слитая последовательность указанного фрагмента, варианта или производного), которые сохраняют стимулирующую рост волос активность аминокислотной последовательности SEQ ID NO: 3.

В предпочтительном варианте осуществления изобретения фрагмент или вариант аминокислотной последовательности содержит или состоит из инактивированного RGD домена последовательности SEQ ID NO: 4, а именно:

DISVVYGLRS SEQ ID NO: 4.

Например, фрагмент или вариант полипептида могут содержать или состоять из аминокислотной последовательности, соответствующей любой из SEQ ID NO: от 63 до 120 (о чем подробнее говорится ниже).

В, частности, в одном варианте осуществления изобретения полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 63:

В еще одном варианте осуществления изобретения модифицированный пептид остеопонтина состоит из или содержит производное аминокислотной последовательности SEQ ID NO: 1 или 3 или фрагмент, вариант или слитую последовательность.

В предпочтительном варианте осуществления изобретения производная аминокислотная последовательность содержит или состоит из инактивированной последовательности RGD домена SEQ ID NO: 3 или 4.

Например, полипептид может содержать или состоит из производного аминокислотной последовательности SEQ ID NO: 5 или 63.

Химические производные одной или более аминокислоты можно получить в реакциях, воздействуя на боковую функциональную группу. Такие производные включают, например, молекулы, в которых к свободной аминогруппе присоединен гидрохлорид, р-толуолсульфонильные группы, карбоксибензоксигруппы, t-бутилоксикарбонильные группы, хлорацетильные группы или формильные группы. Можно получить производные за счет свободной карбоксильный группы путем образования солей, метилового или этилового сложного эфира либо других типов сложных эфиров и гидразидов. За счет свободных гидроксильных групп можно получить О-ацил или О-алкил производные. В качестве химических производных включаются и пептиды, которые содержат природные производные двадцати стандартных аминокислот. Например, 4-гидроксипролин может заменить пролин, 5-гидроксилизин может заменить лизин, 3-метилгистидин может заменить гистидин, гомосерин может заменить серин и орнитин может заменить лизин. Производные включают также пептиды, содержащие одну или более вставку или делецию, если необходимая функциональная активность пептида сохраняется. Другие производные включают модификации, полученные путем амидирования, ацилирования аминоконцевой группы (например, ацетилирования или амидирования тиогликолевой кислотой), амидирования концевой карбоксильной группы (например, в реакции с аммиаком или метиламином) и другие подобные модификации концевой группы.

Специалистам в данной области ясно, что можно использовать и пептидомиметики, которые имитируют конформацию и свойства модифицированных полипептидов остеопонтина, описанных выше. Таким образом, в понятие «полипептид» мы включаем пептидомиметики, которые обладают стимулирующей рост волос активностью полипептида SEQ ID NO: 1.

Например, полипептиды по изобретению включают только молекулы, в которых аминокислотные остатки соединены пептидной (-CO-NH-) связью, а также молекулы, в которых пептидная связь реверсирована. Такие ретроинвертированные пептидомиметики можно создать способами, известными специалистам в данной области, например способом, описанным в статье Meziere et al.(1997) J. Immunol.159, 3230-3237, включенной в настоящее описание путем ссылки. Этот способ позволяет создавать псевдопептиды, содержащие изменения, затрагивающие остов молекулы, а не ориентацию боковых цепей. Ретроинвертированные пептиды, содержащие вместо (-CO-NH-) пептидных связей (-NH-СО-) связи, значительно более устойчивы к протеолизу. В другом варианте осуществления изобретения полипептид по изобретению может быть пептидомиметиком, в котором один или более аминокислотный остаток связан -y(CH2NH)- связью вместо обычной амидной связи.

В еще другом варианте осуществления изобретения пептидная связь может вовсе отсутствовать при условии, что имеется линкерная часть, которая заполняет промежуток между атомами углерода аминокислотных остатков; предпочтительно, чтобы линкерная часть имела по существу такое же распределение заряда и по существу такую же планарность, как и пептидная группа.

Понятно, что полипептид можно традиционно блокировать у N- или С-конца, чтобы сделать его устойчивым к экзопротеолитическому перевариванию.

Различные некодируемые или модифицированные аминокислоты, такие, как D-аминокислоты и N-метиламинокислоты, также используются для модификации полипептидов млекопитающих. Кроме того, предполагаемую биоактивную конформацию можно стабилизировать путем ковалентной модификации, например циклизации, или путем встраивания лактамовых или другого типа мостиков (см., например, работы Veber et. al, 1978, Proc. Natl. Acad. Sci. USA75:2636 и Thursell et al, 1983, Biochem. Biophys. Res. Comm.Ill: 166, которые включены в описание в виде ссылки).

Частым вопросом при обсуждении многих методик синтеза является введение циклической части в пептид. Циклическая часть ограничивает конформационное пространство структуры пептида, что часто приводит к повышению специфичности пептида для конкретного биологического рецептора. Другое преимущество такой стратегии состоит в том, что введение циклической части в пептид может также привести к снижению чувствительности пептида к действию клеточных пептидаз.

Так, пример полипептида по изобретению содержит концевую аминокислоту цистеин. Такой полипептид может существовать в гетеродетной циклической форме за счет образования дисульфидной связи меркаптидными группами в концевых молекулах цистеина или в гомодетной форме при образовании амидной связи между концевыми аминокислотами. Как уже говорилось, циклизация небольших молекул пептидов с помощью дисульфидных или амидных связей между молекулами цистеина в N- и С-концевой области может преодолеть проблему низкой специфичности и короткого периода полужизни, иногда возникающую в случае линейных пептидов, за счет повышения устойчивости к протеолизу, а также повышения ригидности структуры, что может повысить специфичность соединения. Полипептиды, циклизованные за счет образования дисульфидных мостиков, имеют свободную амино- и карбоксильную группу, которая подвержена протеолитической деградации, в то время как пептиды, циклизованные за счет образования амидной связи между N-концевой аминогруппой и C-концевой карбоксильной группой, уже не содержат свободной амино- или карбоксильной группы. Таким образом, пептиды по изобретению могут связываться либо за счет пептидной C-N связи, либо за счет дисульфидной связи.

Настоящее изобретение никак не ограничивается способом циклизации пептидов, но охватывает пептиды, чья циклическая структура может быть достигнута любым подходящим способом синтеза. Так, гетеродетная связь может включать (но не ограничивается ими) дисульфидные, алкиленовые или сульфидные мостики. Способы синтеза циклических гомодетных пептидов и циклических гетеродетных пептидов включая дисульфидные, сульфидные и алкиленовые мостики описаны в патенте US 5643873, который включен в настоящее описание путем ссылки. Другие примеры способов циклизации включают циклизацию путем клик-химии, с помощью эпоксидов и реакции альдегид-амин, а также способов, описанных в патенте US 6008058, который включен в настоящее описание путем ссылки.

Такие концевые модификации применяются, как известно, для уменьшения подверженности протеиназному перевариванию и тем самым удлинения периода полужизни пептидов в растворах, особенно в биологических жидкостях, в которых могут присутствовать протеазы. Циклизация полипептидов выгодна и потому, что при ней образуются стабильные структуры и что циклические пептиды обладают биологической активностью.

Таким образом, в одном варианте осуществления изобретения первый объект изобретения касается циклических полипептидов.

Однако в другом варианте осуществления изобретения рассматриваются линейные полипептиды.

В одном предпочтительном варианте осуществления изобретения модифицированный полипептид остеопонтина содержит одну или более аминокислоту, модифицированную или производную, полученную путем пегилирования, амидирования, эстерификации, ацилирования, ацетилирования и/или алкилирования.

Специалистам в данной области понятно, что модифицированный полипептид остеопонтина можно гликозилировать по одной или более аминокислоте. Например, полипептид может сохранять одно или более место гликозилирования соответствующего «родительского» белка остеопонтина, к которому можно присоединить углеводную группу.

В еще одном варианте осуществления изобретения модифицированный полипептид остеопонтина содержит или состоит из слитых аминокислотных последовательностей SEQ ID NO: 1 или 3 или из их фрагмента.

Например, полипептид может содержать слитые аминокислотные последовательности SEQ ID NO: 5 или 63.

Под «слитым» пептидом мы понимаем аминокислотную последовательность, соответствующую SEQ ID NO: 1 или 3 (или фрагмент либо вариант этих последовательностей), слитую с любым другим полипептидом. Например, указанный полипептид может слиться с таким полипептидом, как глутатион-8-трансфераза (GST) или белок А с целью облегчения очистки указанного полипептида. Примеры такого слияния хорошо известны специалистам в данной области. Аналогично указанный полипептид можно слить с олигогистидиновой меткой, такой, как His6 или эпитопом, распознаваемый антителами, в частности хорошо известным эпитопом Мус. В настоящем изобретении рассматриваются также пептиды, образовавшиеся в результате слияния с любым вариантом или производным указанного полипептида.

Слитый пептид может содержать часть, которая придает пептиду по изобретению желаемое свойство; например, такая часть может усиливать способность пептида стимулировать рост волос. Например, в одном варианте осуществления изобретения слитый пептид содержит альбумин человеческой сыворотки или аналогичный ему белок (как описано в заявке US 2009/0005312, данные которой включены в настоящее описание путем ссылки).

В другом варианте осуществления изобретения часть, которую сливают с пептидом, может быть липофильной молекулой или полипептидным доменом, который способен стимулировать захват полипептида клеткой, что известно специалистам в данной области.

В еще другом варианте осуществления изобретения модифицированный полипептид остеопонтина содержит или состоит из тандемных повторов аминокислотной последовательности. Например, полипептид может содержать или состоять из тандемных повторов SEQ ID NO: 2 и/или 4 (или их комбинаций), которые могут быть связаны друг с другом непосредственно или через вставочные аминокислотные остатки.

В другом варианте осуществления изобретения полипептид может содержать или состоять из тандемных повторов SEQ ID NO: 5 или 63.

Однако в одном предпочтительном варианте осуществления изобретения модифицированный полипептид остеопонтина просто содержит или состоит из аминокислотной последовательности SEQ ID NO: 1 или 3. Например, полипептид может состоять из полипептида, соответствующего последовательности SEQ ID NO: 1 или 3.

В другом предпочтительном варианте осуществления изобретения модифицированный полипептид остеопонтина просто содержит или состоит из аминокислотной последовательности SEQ ID NO: 5 или 63. Например, полипептид может содержать или состоять из полипептида, соответствующего SEQ ID NO: 5 или 63.

Модифицированные полипептиды остеопонтина, подходящие для использования в композициях по изобретению, можно получить in vitro способами, основанными на экспрессии в клетках, хорошо известными специалистам в данной области (например, руководство см. Sambrook and Russell, 2000, Molecular Cloning, A Laboratory Manual, Third Edition, Cold Spring Harbor, New York, включенное в настоящее описание путем ссылки). Выбор вектора экспрессии и клетки-хозяина зависит от ряда факторов. Например, для гликозилирования модифицированного полипептида остеопонтина необходима экспрессирующая система млекопитающих.

Подходящие векторы экспрессии и клетки-хозяева имеются в продаже и доступны из многих источников.

Модифицированные полипептиды остеопонтина можно также синтезировать известными средствами, например, в виде жидко- и твердофазного синтеза (например, твердофазного синтеза t-Boc и BOB-SPPS).

Специалистам в данной области ясно, что настоящее изобретение также включает фармацевтически и косметически приемлемые соли присоединения кислоты или основания описанных выше модифицированных полипептидов остеопонтина. Для получения фармацевтически и/или косметически приемлемых солей присоединения кислоты упомянутых выше основных соединений по изобретению используются кислоты, которые образуют нетоксичные соли присоединения кислоты, то есть соли, содержащие фармацевтически и/или косметически приемлемые анионы, такие, как гидрохлорид, гидробромид, гидройодид, нитрат, сульфат, бисульфат, фосфат, кислый фосфат, ацетат, лактат, цитрат, кислый цитрат, тартрат, битартрат, сукцинат, малеат, фумарат, глюконат, сахарат, бензоат, метансульфонат, этансульфонат, бензолсульфонат, пара-толуолсульфонат и памоат [то есть 1,1′-метилен-бис-(2-гидрокси-3 нафтоат)] и пр.

Фармацевтически и/или косметически приемлемые соли добавления основания также можно использовать для получения фармацевтически и косметически приемлемых солей модифицированных полипептидов остеопонтина. Химические основания, которые можно использовать в качестве реагентов для получения фармацевтически и/или косметически приемлемых основных солей настоящих соединений, имеющих кислотную природу, - это основания, которые образуют нетоксичные основные соли с такими соединениями. Такие нетоксичные основные соли включают (но не ограничиваются ими) помимо прочих, соли, являющиеся производными таких фармацевтически и/или косметически приемлемых катионов, как катионы щелочных металлов (например, калия и натрия) и катионы щелочноземельных металлов (например, кальция и магния), соли добавления аммония или водорастворимого амина, такого, как N-метилглукамин-(меглумин) и низший алканоламмоний и другие основные соли фармацевтически приемлемых органических аминов.

Ясно также, что модифицированные полипептиды остеопонтина по изобретению можно лиофилизировать для хранения и развести в подходящем носителе перед применением. Можно применить любой подходящий способ лиофилизации (например, распылительной сушки, центробежной сушки) и/или любую методику разбавления. Специалистам в данной области ясно, что лиофилизация и разбавление могут привести к потере активности в той или иной степени, и для компенсации этой потери необходимо применять их в большем количестве. Предпочтительно, чтобы лиофилизованный (высушенный сублимацией) полипептид терял не более чем около 20%, около 25% или не более чем около 30%, или не более чем около 35%, или не более чем около 40%, или не более чем 45%, или не более чем около 50% своей активности (до лиофилизации) при регидрировании.

Предлагаются модифицированные полипептиды остеопонтина в форме композиции, содержащей полипептид и фармацевтически и/или косметически приемлемый наполнитель, носитель или растворитель, выбираемый в зависимости от пути введения и стандартной фармацевтической и косметологической практики (см., например, работу Remington: The Science and Practice of Pharmacy, 19th edition, 1995, Ed. Alfonso Gennaro, Mack Publishing Company, Pennsylvania, USA, включенную в настоящее описание в виде ссылки).

Под «фармацевтически приемлемой» понимаем композицию, которая стерильна и апирогенна. Подходящие фармацевтические носители в фармации хорошо известны. Носитель (носители) может быть «приемлемым» в том смысле, что совместим с соединением по изобретению и не оказывает вредного воздействия на реципиента. В типичном случае носителем является вода или физиологический раствор, которые должны быть стерильными и апирогенными. Однако можно использовать и другие носители. Так, «фармакологически приемлемый носитель» и «фармакологически приемлемый наполнитель» включают любые соединения, используемые для образования части композиции и призванные быть просто носителем, то есть сами по себе не обладают биологической активностью. Фармацевтически приемлемый носитель или наполнитель обычно безопасен, нетоксичен и не оказывает биологических и других нежелательных эффектов. Фармацевтически приемлемый носитель или наполнитель, использованный в изобретении, включает как один, так и более чем один носитель или наполнитель.

Аналогично выражение «косметически приемлемый» используется в описании для обозначения композиций, подходящих для применения в качестве косметических средств. Подходящие косметические носители хорошо известны специалистам в данной области и применяются при изготовлении шампуней, лосьонов, кремов и других средств.

Наполнителем может быть один или более углевод, полимеры, липиды и минеральные вещества. Примеры углеводов включают лактозу, сукрозу, маннитол и циклодекстрины, которые добавляют в композицию, например, для облегчения лиофилизации. Примеры полимеров включают крахмал, простые эфиры целлюлозы, целлюлозу карбоксиметилцеллюлозу, гидроксипропилметилцеллюлозу, гидроксиэтилцеллюлозу, альгинаты, каррагинаны, гиалуроновую кислоту и их производные, полиакриловую кислоту, полисульфонат, полиэтиленгликоль/полиэтиленоксид, полиэтиленоксид/полипропиленоксид сополимеры, поливинилалкоголь/поливинилацетат, подвергнутые в различной степени гидролизу, и поливинилпирролидон - все эти вещества с различной молекулярной массой, добавляемые в композицию, например для достижения нужной вязкости, биоадгезии или защиты липидов от химического или протеолитического разрушения. Примерами липидов являются жирные кислоты, фосфолипиды, моно-, ди- и триглицериды, церамиды, сфинголипиды и гликолипиды - все эти вещества имеют ацильную цепь различной длины и степени насыщения, лецитин яичного желтка, соевый лецитин, гидрогенированный яичный и соевый лецитин, которые добавляют в композиции из тех же соображений, что и полимеры. Примерами минеральных веществ являются тальк, оксид магния, оксид цинка и оксид титана, которые добавляют в композицию, чтобы она меньше накапливала влагу и для придания ей выгодных пигментных характеристик.

Термин «растворитель» означает водный или неводный раствор, необходимый для растворения пептида в фармацевтической композиции. Растворителем могут быть одно или несколько из следующих веществ: физиологический раствор, вода, полиэтиленгликоль, пропиленгликоль, этанол или масла (например, сафлоровое, кукурузное, ореховое, хлопковое, кунжутное).

Растворитель может действовать и как буфер. «Буфер» здесь означает водный раствор, содержащий кислотно-основную смесь для стабилизации pH. К примерам буфера относятся Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, трис-буфер, Нерез, HEPBS, MES, фосфатный, карбонатный, ацетатный, цитратный, гликолатный, лактатный, боратный, ACES, ADA, тартратный, AMP, AMPD, AMPSO, BES, CABS, кокадилатный, CHES, DIPSO, EPPS, этаноламиновый, глициновый, HEPPSO, имидазоловый, имидазоллактатный, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO и TES.

При необходимости в композицию можно добавить адъювант. Под термином «адъювант» мы понимаем любое соединение, добавляемое в композицию для усиления биологического эффекта пептида. Адьювантом могут быть одно или несколько из перечисленных веществ: соли цинка, меди или серебра с различными анионами, такими, как (но не только) фторид, хлорид, бромид, йодид, тиоцианат, сульфит, гидроксид, фосфат, карбонат, лактат, гликолат, цитрат, брат, тартрат и ацетат с различной ацильной композицией.

Фармацевтические композиции по изобретению могут быть также в форме биодеградирующих микросфер. Алифатические сложные эфиры, такие, как поли(молочная кислота) (PLA), поли(гликолевая кислота) (PGA), сополимеры PLA и PGA (PLGA) или поли(капролактон) (PLC) и полиангидриды широко использовались в качестве биодеградируемых биополимеров для получения микросфер. Препараты таких микросфер можно найти в патентах US 5851451 и EP 0213303.

Фармацевтические композиции по изобретению могут быть также в форме полимерных гелей, в которых в качестве полимеров используются крахмал, простые эфиры целлюлозы, целлюлоза карбоксиметилцеллюлоза, гидроксипропилметилцеллюлоза, гидроксиэтилцеллюлоза, этилгидроксиэтилцеллюлоза, альгинаты, каррагинаны, гиалуроновая кислота и ее производные, полиакриловая кислота, полисульфонат.

Модифицированные полипептиды остеопонтина могут иметь в композициях разную концентрацию в зависимости от эффективности и токсичности конкретного полипептида. Предпочтительно, чтобы концентрация модифицированного полипептида остеопонтина в композиции была равна между 1 нМ и 1 М, например, между 0,1 мкМ и 1 мМ, 1 мкМ и 100 мкМ, между 5 мкМ и 50 мкМ, между 10 мкМ и 50 мкМ, между 20 мкМ и 40 мкМ и желательно около 30 мкМ. Для применения ex vivo и in vivo композиция по изобретению может содержать небольшую концентрацию модифицированного полипептида остеопонтина, например между 0,0025 мкМ и 1 мкМ.

Специалистам в данной области ясно, что композиции по изобретению можно вводить различными путями, например применять местно, трансдермально, парентерально или орально.

Предпочтительно, чтобы композиции по изобретению можно было применять местно или внутрикожно.

Поэтому композиции по изобретению можно применять местно на кожу (например, на волосистую часть головы). Например, композиция может быть в форме мази, содержащей активный полипептид, взвешенный или растворенный, например, в смеси с одним или несколькими веществами из следующих: минеральное масло, вазелиновое масло, медицинский вазелин, пропиленгликоль, соединение полиоксиэтилена и полиоксипропилена, неионный эмульгированный воск и вода. В другом варианте осуществления изобретения полипептид может быть в форме подходящего лосьона или крема, взвешенным или растворенным, например, в смеси с одним или несколькими веществами из следующих: минеральное масло, моностеаратсорбитана, полиэтиленгликоль, жидкий парафин, полисорбат 60, воск цетиловых эфиров, цетеариловый спирт, 2-октилдодеканол, бензиловый спирт и вода.

При необходимости композиция для местного применения может содержать интенсификатор впитываемости (например, как описано в работах Osborne and Henke, 1997, Pharmaceutica ITechnology, November: 58-52 and Pathan and Setty, 2009, Tropical Journal of Pharmaceutical Research 8(2): 173-179, включенных в настоящее описание путем ссылки).

В другом варианте осуществления изобретения композиции по изобретению можно вводить парентерально, например внутрикожно. Такие композиции лучше применять в форме стерильного водного раствора, который может содержать другие вещества, например, достаточно солей или глюкозы, чтобы сделать раствор изотоничным по отношению к крови. Водные растворы при необходимости должны быть забуферены (предпочтительно, чтобы рН был в пределах от 3 до 9). Препарат подходящей композиции для парентерального применения в стерильных условиях готовят по стандартной фармацевтической методике, которая хорошо известна специалистам в данной области.

Композиции, подходящие для парентерального применения, включают водный и неводный стерильный раствор для инъекций, который может содержать антиоксиданты, буферы, бактериостатические вещества и вещества, которые делают композицию изотоничной по отношению к крови реципиента; водные и неводные стерильные суспензии, которые включают суспендирующие агенты и загустители. Композиция может содержаться в однодозовом или многодозовом контейнере, герметичных ампулах и флаконах и может храниться в лиофилизованном виде, требующем лишь добавления стерильного жидкого носителя, например воды для инъекций, перед самым употреблением. Для растворов и суспензий, которые готовят ex tempore используют ранее описанные стерильные порошки, гранулы и таблетки.

Может оказаться целесообразно использовать системы длительного высвобождения, например препаратов в форме микросфер, для доставки модифицированных полипептидов остеопонтина.

В другом варианте осуществления изобретения композиции можно вводить с помощью устройств, имплантируемых хирургическим путем, которые высвобождают активный полипептид прямо в требуемое место (то есть в эпидермис).

Композиции по изобретению можно также доставлять с помощью трансдермальных технологий.

Например, для введения белков и полипептидов можно применить электропорационную терапию (ЕРТ) и/или системы лекарственного электрофореза. При этих способах применяют устройство, которое воздействует на клетки импульсным электрическим полем, вызывая повышение проницаемости клеточных мембран для лекарственного препарата и значительное увеличение поступления его в клетку.

При альтернативном трансдермальном способе - электроинкорпорации - используются мелкие частицы диаметром до 30 мкм, наносимые на поверхность кожи и вводимые в нее с помощью электрических импульсов, идентичных или сходных с импульсами, наносимыми при электропорации. Частицы продвигаются через роговой слой эпидермиса в более глубокие слои кожи. Частицы можно нагрузить или покрыть лекарством или генами, или они могут быть просто «пулями», которые образуют поры в коже, через которые проникает лекарственное вещество.

Компанией PowderJect Pharmaceuticals (ныне собственность Novartis AG) разработана также другая трансдермальная методика введения препаратов.

Подходящие способы введения полипептидов и композиций по изобретению хорошо известны специалистам в данной области, например см. Therapeutic Protein and Peptide Formulation and Delivery, Zahra Shahrokh et al. (Eds), 1997, American Chemical Society, ISBN13:9780841235281.

Второй объект настоящего изобретения касается полипептида, содержащего или состоящего из аминокислотной последовательности SEQ ID NO: 63 или ее фрагмента, варианта или производного либо из слитой последовательности (или слитого указанного фрагмента, варианта или производного), которые сохраняют стимулирующую рост волос активность аминокислотной последовательности SEQ ID NO: 63.

В одном варианте осуществления изобретения полипептид изолирован (например, вне тела млекопитающего).

Значение терминов «фрагмент», «вариант», «производное» или «слитая последовательность» здесь такое же, как при описании первого аспекта изобретения.

В данном объекте полипептид представляет собой человеческий остеопонтин, содержащий инактивированный RGD домен (путем замены или делеции одной или более аминокислоты, входящей в RGD домен, и/или вставки одной или более аминокислоты в RGD домен). Например, три аминокислоты «R-G-D» домена белка человеческого остеопонтина дикого типа могут быть замещены двумя аминокислотами «D-I».

Предпочтительно, чтобы фрагмент имел длину от 5 до 30 аминокислот, например, от 10 до 20 аминокислот.

Например, полипептид может содержать или состоять из любой из аминокислотных последовательностей SEQ ID NO: от 5 до 62 или фрагмента, варианта, производного или из слитой последовательности.

Предпочтительные 15-аминокислотные пептиды:

VDVPNGDISLAYGLR ["FOL-004"] SEQ ID NO: 5
DVPNGDISLAYGLRS SEQ ID NO: 6

Предпочтительные 14-аминокислотные пептиды:

VDVPNGDISLAYGL SEQ ID NO: 7
DVPNGDISLAYGLR SEQ ID NO: 8
VPNGDISLAYGLRS SEQ ID NO: 9

Предпочтительные 13-аминокислотные пептиды:

VDVPNGDISLAYG SEQ ID NO: 10
DVPNGDISLAYGL SEQ ID NO: 11
VPNGDISLAYGLR SEQ ID NO: 12
PNGDISLAYGLRS SEQ ID NO: 13

Предпочтительные 12-аминокислотные пептиды:

VDVPNGDISLAY SEQ ID NO: 14
DVPNGDISLAYG SEQ ID NO: 15
VPNGDISLAYGL SEQ ID NO: 16
PNGDISLAYGLR SEQ ID NO: 17
NGDISLAYGLRS SEQ ID NO: 18

Предпочтительные 11-аминокислотные пептиды:

VDVPNGDISLA SEQ ID NO: 19
DVPNGDISLAY SEQ ID NO: 20
VPNGDISLAYG SEQ ID NO: 21
PNGDISLAYGL SEQ ID NO: 22
NGDISLAYGLR SEQ ID NO: 23
GDISLAYGLRS SEQ ID NO: 24

Предпочтительные 10-аминокислотные пептиды:

VDVPNGDISL SEQ ID NO: 25
DVPNGDISLA SEQ ID NO: 26
VPNGDISLAY SEQ ID NO: 27
PNGDISLAYG SEQ ID NO: 28
NGDISLAYGL SEQ ID NO: 29
GDISLAYGLR SEQ ID NO: 30
DISLAYGLRS SEQ ID NO: 31

Предпочтительные 9-аминокислотные пептиды:

VDVPNGDIS SEQ ID NO: 32
DVPNGDISL SEQ ID NO: 33
VPNGDISLA SEQ ID NO: 34
PNGDISLAY SEQ ID NO: 35
NGDISLAYG SEQ ID NO: 36
GDISLAYGL SEQ ID NO: 37
DISLAYGLR SEQ ID NO: 38
ISLAYGLRS SEQ ID NO: 39

Предпочтительные 8-аминокислотные пептиды:

VDVPNGDI SEQ ID NO: 40
DVPNGDIS SEQ ID NO: 41
VPNGDISL SEQ ID NO: 42
PNGDISLA SEQ ID NO: 43
NGDISLAY SEQ ID NO: 44
GDISLAYG SEQ ID NO: 45
DISLAYGL SEQ ID NO: 46
ISLAYGLR SEQ ID NO: 47

Предпочтительные 7-аминокислотные пептиды:

VDVPNGD SEQ ID NO: 48
DVPNGPJ SEQ ID NO: 49
VPNGDIS SEQ ID NO: 50
PNGDISL SEQ ID NO: 51
NGDISLA SEQ ID NO: 52
GDISLAY SEQ ID NO: 53
DISLAYG SEQ ID NO: 54
ISLAYGL SEQ ID NO: 55

Предпочтительные 6-аминокислотные пептиды:

DVPNGD SEQ ID NO: 56
VPNGDI SEQ ID NO: 57
PNGDIS SEQ ID NO: 58
NGDISL SEQ ID NO: 59
GDISLA SEQ ID NO: 60
DISLAY SEQ ID NO: 61
ISLAYG SEQ ID NO: 62

В предпочтительном варианте осуществления изобретения полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 5.

В другом варианте осуществления изобретения полипептид содержит или состоит из варианта аминокислотной последовательности SEQ ID NO: 5.

Например, полипептид может содержать или состоять из любой аминокислотной последовательности из SEQ ID NO: от 63 до 120 или ее фрагмента, варианта, производного либо из слитой последовательности.

Предпочтительные 15-аминокислотные пептиды:

VDTYDGDISVVYGLR ["FOL-005"] SEQ ID NO: 63
VDTYDGDISVVYGLS SEQ ID NO: 64

Предпочтительные 14-аминокислотные пептиды:

VDTYDGDISVVYGL SEQ ID NO: 65
DTYDGDISVVYGLR SEQ ID NO: 66
TYDGDISVVYGLRS SEQ ID NO: 67

Предпочтительные 13-аминокислотные пептиды:

VDTYDGDISVVYG SEQ ID NO: 68
DTYDGDISVVYGL SEQ ID NO: 69
TYDGDISVVYGLR SEQ ID NO: 70
YDGDISVVYGLRS SEQ ID NO: 71

Предпочтительные 12-аминокислотные пептиды:

VDTYDGDISWY SEQ ID NO: 72
DTYDGDISVVYG SEQ ID NO: 73
TYDGDISVVYGL SEQ ID NO: 74
YDGDISVVYGLR SEQ ID NO: 75
DGDISVVYGLRS SEQ ID NO: 76

Предпочтительные 11-аминокислотные пептиды:

VDTYDGDISVV SEQ ID NO: 77
DTYDGDISVVY SEQ ID NO: 78
TYDGDISVVYG SEQ ID NO: 79
YDGDISVVYGL SEQ ID NO: 80
DGDISVVYGLR SEQ ID NO: 81
GDISVVYGLRS SEQ ID NO: 82

Предпочтительные 10-аминокислотные пептиды:

VDTYDGDISV SEQ ID NO: 83
DTYDGDISVV SEQ ID NO: 84
TYDGDISVVY SEQ ID NO: 85
YDGDISVVYG SEQ ID NO: 86
DGDISVVYGL SEQ ID NO: 87
GDISVVYGLR SEQ ID NO: 88
DISVVYGLRS SEQ ID NO: 89

Предпочтительные 9-аминокислотные пептиды:

VDTYDGDIS SEQ ID NO: 90
DTYDGDISV SEQ ID NO: 91
TYDGDISVV SEQ ID NO: 92
YDGDISVVY SEQ ID NO: 93
DGDISVVYG SEQ ID NO: 94
GDISVVYGL SEQ ID NO: 95
DISVVYGLR SEQ ID NO: 96
ISVVYGLRS SEQ ID NO: 97

Предпочтительные 8-аминокислотные пептиды:

VDTYDGDI SEQ ID NO: 98
DTYDGDIS SEQ ID NO: 99
TYDGDISV SEQ ID NO: 100
YDGDISVV SEQ ID NO: 101
DGDISVVY SEQ ID NO: 102
GDISVVYG SEQ ID NO: 103
DISVVYGL SEQ ID NO: 104
ISVVYGLR SEQ ID NO: 105

Предпочтительные 7-аминокислотные пептиды:

VDTYDGD SEQ ID NO: 106
DTYDGDI SEQ ID NO: 107
TYDGDIS SEQ ID NO: 108
YDGDISV SEQ ID NO: 109
DGDISVV SEQ ID NO: 110
GDISVVY SEQ ID NO: 111
DISVVYG SEQ ID NO: 112
ISVVYGL SEQ ID NO: 113

Предпочтительные 6-аминокислотные пептиды:

DTYDGD SEQ ID NO: 114
TYDGDI SEQ ID NO: 115
YDGDIS SEQ ID NO: 116
DGDISV SEQ ID NO: 117
GDISVV SEQ ID NO: 118
DISVVY SEQ ID NO: 119
ISVVYG SEQ ID NO: 120

В предпочтительном варианте осуществления изобретения полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 63.

Полипептиды по изобретению могут применяться в медицине для лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос (о чем будет подробнее сказано ниже).

Предлагается также полипептид для стимулирования роста волос у млекопитающих, который применяется в косметике и на коммерческой основе (как описано подробно далее).

Третий объект настоящего изобретения касается композиций, которые в соответствии с первым объектом изобретения предназначены для стимулирования роста волос у млекопитающих.

Итак, композиции могут применяться для стимулирования существующих волосяных фолликулов и/или индуцирования роста новых волосяных фолликулов (или стволовых клеток, образующих такие фолликулы).

В одном варианте осуществления изобретения композиция предназначена для лечения и профилактики заболевания и состояния, ассоциированного с выпадением волос, в частности алопеции.

Алопеция, как правило, обусловлена анагеновым выпадением волос. Однако специалистам в данной области ясно, что композиции по изобретению могут применяться также для лечения состояний, ассоциированных с телогеновым выпадением волос.

В одном варианте осуществления изобретения алопеция выбрана из группы, состоящей из таких форм выпадения волос, как

(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу);.

(b) тракционная алопеция;

(c) анагеновое выпадение волос;

(d) телогеновое выпадение волос;

(e) гнездная алопеция;

(f) тотальная алопеция;

(g) универсальная алопеция;

(h) алопеция бороды;

(i) муцинозная алопеция;

(j) неопластическая алопеция;

(k) рубцующая алопеция;

(l) рубцовая алопеция.

В качестве примера может служить андрогенетическая алопеция.

Другим примером может быть анагеновая алопеция. Для этой формы характерно раннее наступление телогеновой стадии. Она может быть обусловлена рядом причин, включая нарушение пищеварения, лихорадка, роды, хронические заболевания, большие операции, анемия, тяжелые эмоциональные расстройства, строгая диета, гипотироз и прием некоторых препаратов.

Так, в одном варианте осуществления изобретения выпадение волос было вызвано лучевой терапией и/или приемом химиопрепаратов. Например, выпадение волос является частым и удручающим побочным эффектом химиотерапевтических препаратов, таких, как цисплатин, этопозид и паклитаксел.

В целях удобства в качестве млекопитающего выбран человек.

Четвертый объект настоящего изобретения касается применения лекарства, стимулирующего рост волос у млекопитающих, приготовленного из модифицированного полипептида остеопонтина, который был определен при описании первого объекта изобретения.

Это лекарство может стимулировать имеющиеся волосяные фолликулы и/или индуцировать рост новых волосяных фолликулов (или стволовых клеток, образующих такие фолликулы).

В одном варианте осуществления изобретения лекарство предназначено для лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос, такого, как алопеция (например, ассоциированного с анагеновым выпадением волос).

В одном варианте осуществления изобретения алопеция отобрана из группы, состоящей из таких форм выпадения волос, как

(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу;

(b) тракционная алопеция;

(c) анагеновое выпадение волос;

(d) телогеновое выпадение волос;

(e) гнездная алопеция;

(f) тотальная алопеция;

(g) универсальная алопеция;

(h) алопеция бороды;

(i) муцинозная алопеция;

(j) неопластическая алопеция;

(k) рубцующая алопеция;

(l) рубцовая алопеция.

В качестве примера может служить андрогенетическая алопеция.

Другим примером может быть анагеновая алопеция, например, алопеция, вызванная лучевой и/или химиотерапией (см. выше).

В целях удобства в качестве млекопитающего выбран человек.

Пятый объект настоящего изобретения касается способа стимулирования роста волос у млекопитающего путем введения эффективного количества модифицированного полипептида остеопонтина, который был определен при описании первого объекта изобретения.

Способ позволяет стимулировать как имеющиеся волосяные фолликулы, так и индуцировать рост новых волосяных фолликулов (или стволовых клеток, образующих такие фолликулы).

Полипептидную композицию по изобретению вводят больному в эффективном количестве. «Терапевтически эффективное количество» или «эффективное количество» означает такое количество, которое обеспечивает стимуляцию роста волос. Это заранее определенное количество активного вещества, рассчитанное так, чтобы оказать желаемый терапевтический эффект. Специалистам в данной области ясно, что количество вводимой композиции может варьироваться в зависимости от ее специфической активности. Подходящая доза содержит заранее определенное количество активной композиции, рассчитанной так, чтобы вызвать желаемый терапевтический эффект в сочетании с требуемым растворителем. В способах и их использовании для приготовления композиций по изобретению предлагается терапевтически эффективное количество активного компонента. Терапевтически эффективное количество может определить обычный медицинский или ветеринарный работник на основании данных пациента, таких как возраст, масса тела, пол, состояние, осложнения, другие заболевания и т.д., по методике, хорошо известной специалистам в данной области.

В одном варианте осуществления изобретения предлагается способ для лечения и профилактики заболевания или состояния, ассоциированного с выпадением волос, такого как алопеция (например, ассоциированного с анагеновой алопецией).

В одном варианте осуществления изобретения алопеция отобрана из группы, состоящей из таких форм выпадения волос, как

(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу;.

(b) тракционная алопеция;

(c) анагеновое выпадение волос;

(d) телогеновое выпадение волос;

(e) гнездная алопеция;

(f) тотальная алопеция;

(g) универсальная алопеция;

(h) алопеция бороды;

(i) муцинозная алопеция;

(j) неопластическая алопеция;

(k) рубцующая алопеция;

(l) рубцовая алопеция.

В качестве примера может служить андрогенетическая алопеция.

Другим примером может быть анагеновая алопеция, например, алопеция, вызванная лучевой и/или химиотерапией (см. выше).

В целях удобства в качестве млекопитающего выбран человек.

Специалистам в данной области ясно, что применение композиции, описанной при рассмотрении первого объекта изобретения, не ограничивается медицинскими показаниями, и ее можно применять и в качестве косметического средства (в том смысле, что они не вызывают улучшения физического здоровья, а просто улучшают эстетический вид млекопитающего).

Таким образом, шестой объект настоящего изобретения касается применения композиции по изобретению, соответствующей первому объекту изобретения, для стимулирования роста волос у млекопитающих, причем применения для косметических целей.

Таким образом, косметическая композиция может стимулировать рост имеющихся волосяных фолликулов и/или индуцировать рост новых волосяных фолликулов (или стволовых клеток, образующих такие фолликулы).

В одном варианте осуществления изобретения косметическую композицию применяют для лечения и профилактики облысения, которое связано с поредением волос и/или их утончением.

Такие композиции не ограничиваются применением только на область волосистой части головы, но их можно применять и в других частях тела, включая лицо (для стимулирования роста бороды, ресниц, бровей и т.д.).

В целях удобства в качестве млекопитающего выбран человек.

Специалистам в данной области ясно, что композиции по изобретению можно применять как сами по себе, так и в комбинации с другими терапевтическими или косметическими агентами. Например, композиции по изобретению можно применять для сочетанной терапии вместе с существующими средствами лечения для профилактики выпадения имеющихся волос и/или стимулирования роста новых волос, например с активаторами калиевых каналов, такими как миноксидил (Regain RTM., Pharmacia Corp.) и диазоксид; ингибиторами 5-альфа-редуктазы, такими как финастерид (Propecia RTM., Merk & Co.), и иммунодепрессантом циклоспорином А.

Специалистам в данной области ясно также, что композиции по изобретению можно использовать in vivo, ex vivo или in vitro.

Таким образом, помимо применения или введения непосредственно млекопитающим, композиции можно применять для стимулирования роста волос ex vivo, например на эксплантированной коже перед ее трансплантацией у млекопитающих.

В другом варианте осуществления изобретения композиции можно применять для стимулирования роста волосяных фолликулов in vitro, например, в культуре клеток, которые затем можно трансплантировать пациенту.

Соответственно другой объект настоящего изобретения касается применения полипептида, соответствующего первому объекту изобретения, для стимулирования роста волос in vitrovum ex vivo.

В одном варианте осуществления изобретения полипептид применяется для стимулирования роста волосяных фолликулов (или стволовых клеток, образующих такие фолликулы).

В еще другом варианте осуществления изобретения предлагается способ приготовления композиции в соответствии с первым объектом изобретения, способ, заключающийся в смешивании модифицированного полипептида остеопонтина, в котором RGD домен инактивирован, с фармацевтически приемлемым и/или косметически приемлемым наполнителем, носителем или растворителем.

Теперь будут описаны предпочтительные примеры (но не ограничивающиеся только приводимыми здесь), которые воплощают некоторые аспекты изобретения со ссылками на фигуры:

На фиг. 1 показана схема взятия образцов кожи у мыши.

На фиг. 2 представлена фотография поперечного разреза кожи мыши через 48 часов после введения модифицированного полипептида остеопонтина. Фолликулы, расположенные в эпидермисе, показаны стрелкой. Линейная плотность фолликулов составила 18,3 фолликула на 1 мм (598 фолликулов на 32,65 мм длины эпидермиса).

На фиг. 3 представлена фотография сечения кожи, сделанная у мыши через 48 часов после введения контрольной композиции (отрицательный контроль). Волосяные фолликулы, расположенные в эпидермисе, указаны стрелкой. Линейная плотность фолликулов составила 11,7 на 1 мм (379 фолликулов на 32,50 мм длины эпидермиса).

На фиг. 4 представлена фотография контрольного животного на 14-й день, у которого отмечена нулевая оценка роста волос (а), животного, которому вводили полипептид «Сх», имеющий полную длину молекулы (соответствует SEQ ID NO: 1, но без начальных 16 аминокислот сигнального пептида, 60 нМ), и у которого оценка роста волос на 14-й день составила 1,5 (b); животного, которому вводили короткий пептид "FOL-004" по изобретению (SEQ ID NO: 5, 60 нМ) и у которого на 5-й день после введения оценка роста волос составила 2,5 (с); и животного, которому вводили короткий пептид "FOL-005" по изобретению (SEQ ID NO: 5, 63 нМ) и у которого на 5-й день оценка роста волос составила 2,0 (d).

На фиг. 5 показан эффект полипептида по изобретению «Сх», имеющего полную длину молекулы, и полипептидов SEQ ID NO: 5 и 63 на рост волос.

На фиг. 6 показан эффект полипептида с аминокислотной последовательностью SEQ ID NO: 5 на рост волос по сравнению с эффектом соответствующего полипептида с аминокислотной последовательностью SEQ ID NO: 121 мышиного остеопонтина дикого типа.

Пример А - Исследование влияния мутированного мышиного остеопонтина на рост волос умышей in vivo

Материалы и методы

Создание и получение тестового полипептида

Модифицированную полипептидную последовательность SEQ ID NO: 1 остеопонтина клонировали с помощью вектора экспрессии рСЕР4, используя в сайтах рестрикции ферментов Xhol и BamHI. Плазмидный вектор экспрессии рСЕР4 содержит ген устойчивости к ампициллину для экспрессии в бактериях и ген устойчивости к гигромицину для экспрессии в эукариотических клетках EBNA. Векторы, содержащие полипептид, были трансформированы в компетентные бактериальные клетки XL-10, которые затем размножали и изолировали с помощью среднего набора Qiagen. Изолированные векторы затем трансфецировали в человеческие клетки EBNA с помощью трансфекционных реагентов Fugene в соответствии с протоколом производителя (Invitrogen).

Изолирование тестового полипептида

Среду культуры клеток EBNA, содержащую продуцированный ими полипептид, собирали после 3-4 дней культивирования. Полипептиды, продуцированные плазмидой рСЕР4, содержат метку His, которая используется для облегчения выделения с помощью хроматографии на Ni-сефарозном геле (Invitrogen). Собранную среду разводили связывающим буфером (20 мМ фосфата натрия, 500 мМ хлорида натрия, pH 7,8). Суспензию Ni-сефарозы добавляли перед тем, как инкубировать на шейкере в течение ночи при 4°C. Ni-сефарозный гель осаждали центрифугированием при 1000 g в течение 7 минут и вливали в одноразовую мини-колонку BioRad. Несвязавшиеся белки удаляли связыванием с буферным раствором и последующим отмыванием в буферном растворе (20 мМ фосфата натрия, 500 мМ хлорида натрия, pH 6,0). Полипептиды элюировали из колонки раствором, содержащим 500 мМ имидазола.

Общий дизайн исследования

Исследование проведено на четырех группах мышей, в каждой группе было 5 самцов линии wtC57BL/6N.

В - 1-й день на холке тщательно сбривали шерсть на квадратных участках размером около 1,5×1,0 см и оставляли небольшие участки, покрытие шерстью. На следующий день (0-й день) каждому животному выполняли четыре внутрикожные инъекции по 25 мкл в разные участки (размером примерно 0,5×0,5 см) в пределах выбритого прямоугольника на холке (фиг. 1).

Каждое животное получало две инъекции по 25 мкл композиции по изобретению, содержащей модифицированный полипептид остеопонтина, соответствующий последовательности SEQ ID NO: 1 («тестовый полипептид» или «Сх» в дозе 60 нмоль/л в фосфатно-буферном растворе (PBS), и две контрольные инъекции (отрицательный контроль) по 25 мкл фосфатно-буферного раствора (в соответствии со схемой, приведенной в табл. 1).

Животных группы 1-4, которым вводили лечебную композицию, умерщвляли соответственно через 24 ч (группа 1), 48 ч (группа 2), 96 ч (группа 3) и 336 ч (14 дней, группа 4) после введения композиции.

Во всех случаях промаркированные участки кожи иссекали, обрабатывали следующим образом: один из образцов кожи, в который был введен полипептид, и один из контрольных образцов, в который был введен только PBS, фиксировали в 4% растворе параформальдегида и заливали в парафин. Два других образца кожи (в которые были соответственно введены полипептид и только PBS) замораживали в жидком азоте и хранили при -80°C.

Срезы, приготовленные из залитых в парафин блоков, окрашивали гематоксилином.

а) Время экспозиции зависит от типа используемого гематоксилина и длится от 20 с до 10 мин и должно быть определено путем приготовления пробных препаратов.

b) Перед использованием фильтруют.

Результаты

Эффект лечения модифицированным полипептидом остеопонтина (SEQ ID NO: 1) на плотность волосяных фолликулов обобщен в табл. 1(a) и (b) ниже.

Итоговые результаты приведены в табл. 2

Репрезентативные тканевые срезы, показывающие волосяные фолликулы у животных опытной и контрольной группы, приведены на фиг. 2 и 3.

По сравнению с модифицированным полипептидом мышиный остеопонтин дикого типа не оказывал видимого эффекта на рост волос (данные не показаны).

Заключение

Полученные данные показали, что модифицированные полипептиды остеопонтина по изобретению, соответствующие SEQ ID NO: 1, увеличивают количество волосяных фолликулов на 1 мм длины эпидермиса примерно на 60%.

Эти данные подтверждают возможность и целесообразность применения полипептидов по изобретению, подобных остеопонтину, для стимулирования роста волос.

Пример В - Исследование влияния последовательностей SEQ ID NO: 5 и 63 на рост волос у мышей in vivo

Материалы и методы

Животные

Мыши (C57BL/6) в возрасте 6-8 нед.

Дизайн исследования

- Отбирают животных в телогеновой фазе роста волос.

- Сбривают шерсть на спине животных.

- Вводят подкожно тестовый полипептид или растворитель

- Визуально оценивают результат: индукция анагеновой фазы в процентном отношении; средняя оценка роста волос; визуальные признаки меланогенеза.

- Оценивают результат с помощью гистологического исследования: подсчитывают количество волосяных фолликулов в подкожной жировой ткани; морфометрическое определение толщины кожи.

- Опытная группа животных

Животных рандомизировали в опытные группы (см. табл. 3)

- Животным вводили полипептид в 1-й, 5-й и 9-й дни.

- Полипептид вводили подкожно в область спины после предварительного сбривания шерсти.

Критерии оценки

- Эффект лечения оценивали ежедневно и давали оценку в соответствии с критериями, приведенными в табл. 4.

Результаты

В табл. 5 показан эффект полипептидов по изобретению на рост волос.

На фиг. 4 приведены репрезентативные фотографии (а) животного контрольной группы на 14 день, у которого оценка роста волос составила О, (b) животного на 14-й день, которому вводили полноразмерный полипептид по изобретению «Сх» (SEQ ID NO: 1, 60 нМ) и у которого оценка роста волос составила 1,5, (с) животного на 5-й день, которому вводили короткий пептид по изобретению «FOL-004» (SEQ ID NO: 5, 60 нМ) и у которого оценка роста волос составила 2,5, и (d) животного на 5-й день, которому вводили короткий пептид по изобретению «FOL-005» (SEQ ID NO: 5, 63 нМ) и у которого оценка роста волос составила 2,0.

Результаты подытожены на фиг 5.

Оба пептида по изобретению FOL-004 (SEQ ID NO: 5) и FOL-005 (SEQ ID NO: 63) вызывали быстрый рост волос, который был очевиден на 5-й день и сохранялся до конца периода, в течение которого оценивались результаты (16 дней).

Полноразмерный полипептид по изобретению («Сх») также вызывал значительный рост волос, хотя и менее выраженный вначале, чем у FOL-004 (SEQ ID NO: 5) или F0L-005 (SEQ ID NO: 63).

У животных контрольной группы, которым вводили растворитель, рост волос за период проведения эксперимента был незначительным.

Ни один из опробованных пептидов не вызывал побочных эффектов у животных (не было случаев потери массы тела или других заметных патологических симптомов).

Заключение

Все опробованные мутированные полипептиды остеопонтина оказывали выраженный стимулирующий эффект на рост волос; особенно сильное стимулирующее действие оказали полипептиды по изобретению FOL-004 (SEQ ID NO: 5) и FOL-005 (SEQ ID NO: 63).

Пример С - Исследование влияния фрагмента остеопонтина дикого типа, эквивалентного последовательности SEQ ID NO: 5, на рост волос у мышей in vivo.

Материалы и методы

Животных, которых готовили, как описано в эксперименте В, обрабатывали, как показано в табл. 6.

Эта аминокислотная последовательность является фрагментом мышиного остеопонтина дикого типа и соответствует области в молекуле белка, производной которой является пептид «FOL-004» (то есть «FOL-004» является мутированным вариантом фрагмента «FOL-001» дикого типа).

Мероприятия по лечению животным проводили в 1-й, на 5-й и 9-й дни.

Лечение состояло в подкожной инъекции в области спины, где была сбрита шерсть.

Критерии оценки

Визуально и количественно оценивали эффект лечения, как описано в примере В.

Результаты

Оценка влияния полипептида «FOL-001» на рост волос приведена в табл. 7 и на фиг. 6.

Пептид FOL-001 (SEQ ID NO: 121) вызывал заметный рост волос, появляющийся с задержкой примерно на 9-й день и переходящий в фазу плато по достижении оценки 1,3.

Заключение

По сравнению с соответствующей мутированной аминокислотной последовательностью пептида по изобретению (FOL-004, SQEIDNO: 5) эквивалентная немутированная последовательность дикого типа вызывала отсроченное начало роста волос с максимальным эффектом, который был ниже 50% максимума, достигнутого при лечении полипептидом FOL-004.

Таким образом, полипептид по изобретению оказался значительно эффективнее эквивалентной немутированной последовательности дикого типа.

Пример D - in vivo исследование индукции анагеновой стадии в иссеченной коже

Материалы и методы

Животные и схема обработки были те же, что и в эксперименте В, описанном выше. Всех животных умерщвляли на 16-й день.

Оценка меланогенеза

По завершении оценки роста волос в эксперименте В животных умерщвляли эвтаназией и иссекали кожу спины для исследования ее внутренней поверхности. Гистологическое исследование

Срезы иссеченной кожи для гистологического исследования готовили так, как описано в эксперименте А. После приготовления препаратов подсчитывали количество волосяных фолликулов в подкожной жировой клетчатке и измеряли толщину кожи.

Результаты

Результаты экспериментов обобщены в табл. 8 и 9 (см. ниже).

Цикл роста волос состоит из трех стадий: стадии покоя, или телогеновой стадии (кожа мышей C57BL/6 имеет розовый цвет), стадии активного роста (когда кожа становится темно-серой или черной) и, наконец, катагеновой стадии (когда рост волос останавливается и кожа постепенно вновь приобретает бледно-розовый цвет).

Для настоящего исследования были отобраны животные, рост волос которых соответствовал телогеновой стадии (розовый цвет кожи), и им подкожно был введен полипептид по изобретению. Пептид с выраженным стимулирующим эффектом на рост волос вызывает переход из стадии телогена (стадия покоя) в стадию активного роста, то есть анагеновую стадию, что сопровождается переходом кожи из розового цвета в темный цвет. Темная пигментация кожи, может быть обусловлена с накоплением в волосяных фолликулах меланина в процессе роста новых волос в анагеновой стадии. Синтез меланина меланоцитами волосяных фолликулов строго соответствует анагеновой стадии, прекращается в катагеновой и отсутствует в телогеновой. Следовательно, эффективный стимулятор роста волос вызывает потемнение кожи спины животных. После прекращения роста кожу животных иссекали и исследовали обратную сторону, чтобы оценить процесс меланогенеза по потемнению кожи при визуальном исследовании. При гистологическом исследовании подсчитывали количество волосяных фолликулов в подкожной жировой клетчатке и измеряли толщину кожи.

В настоящем исследовании после трехкратного подкожного введения тестовых полипептидов отмечался рост густых волос (см. пример В, описанный выше). Было также отмечено, что у некоторых животных после полного роста волос кожа вновь из черной превращается в серую и розовую, что является характерным признаком катагеновой стадии. Исследование иссеченной кожи показало, что черный цвет, который кожа приобретала после введения пептидов по изобретению, соответствует анагеновой стадии (стадии активного роста волос) цикла и обусловлен секвестрацией меланоцитов. Результаты гистологического исследования показали, что у этих животных увеличивается количество волосяных фолликулов и толщина кожи. Но у некоторых животных, у которых наступала стадия катагена, иссеченная кожа имела розовый цвет, даже если изменения не затрагивали волосяной покров. Таким образом, исследование срезов из иссеченной кожи показало, что фолликулы в ней отсутствуют, но толщина увеличена.

Заключение

Мутированные полипептиды остеопонтина по изобретению вызывают выраженную индукцию анагеновой стадии, о чем свидетельствует увеличение количества волосяных фолликулов в подкожной жировой клетчатке и/или увеличение толщины кожи.

1. Композиция для стимулирования роста волос у млекопитающих, содержащая:
(a) эффективное количество модифицированного полипептида остеопонтина, в котором RGD домен инактивирован, или слитой последовательности, содержащей его; и
(b) фармацевтически приемлемый и/или косметически приемлемый наполнитель, носитель или растворитель,
где модифицированный полипептид остеопонтина состоит из аминокислотной последовательности, приведенной ниже:
(i) аминокислотной последовательности SEQ ID NO: 1; или
(ii) аминокислотной последовательности SEQ ID NO: 5; или
(iii) аминокислотной последовательности SEQ ID NO: 63;
и где слитая последовательность состоит из модифицированного полипептида остеопонина и дополнительного полипептида для облегчения очистки, усиления/пролонгирования стимуляции роста волос или для стимулирования клеточного поглощения.

2. Композиция по п. 1, в которой длина полипептида соответствует менее чем 200 аминокислотным остаткам, например, менее чем 150, 100, 50, 40, 30, 20 или менее аминокислотных остатков в длину.

3. Композиция по п. 2, в которой длина полипептида составляет менее чем 50 аминокислот.

4. Композиция по п. 1, в которой модифицированный полипептид остеопонтина содержит или состоит из аминокислотной последовательности SEQ ID NO: 1: MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAV SSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDES DETVTASTQADTFTPIVPTVDVPNGDISLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMK SGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSD VIDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN SEQ ID NO: 1 или слитой последовательности, сохраняющих свойство стимулировать рост волос, присущее аминокислотной последовательности SEQ ID NO: 1.

5. Композиция по п. 1, в которой полипептид содержит или состоит из слитой аминокислотной последовательности SEQ ID NO: 1.

6. Композиция по п. 1, в которой полипептид содержит или состоит из слитой аминокислотной последовательности SEQ ID NO: 5 или 63.

7. Композиция по п. 1, в которой полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 1.

8. Композиция по п. 1, в которой полипептид состоит из полипептида согласно SEQ ID NO: 1.

9. Композиция по п. 1, в которой полипептид состоит из аминокислотной последовательности SEQ ID NO: 5 или 63.

10. Композиция по п. 1, в которой полипептид гликозилирован.

11. Композиция по п. 1 для местного применения.

12. Композиция по п. 1 для трансдермального введения.

13. Композиция по п. 1 для внутрикожного введения.

14. Композиция по любому из предыдущих пунктов, в которой млекопитающим является человек.

15. Композиция по п. 1 для применения с целью стимулирования роста волос у млекопитающего.

16. Композиция по п. 15 для стимулирования имеющихся волосяных фолликулов.

17. Композиция по п. 15 для индуцирования роста новых волосяных фолликулов или стволовых клеток, образующих такие фолликулы.

18. Композиция по п. 15 для применения с целью лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос.

19. Композиция по п. 15 для применения с целью лечения или профилактики алопеции.

20. Композиция по п. 19, где алопеция ассоциирована с выпадением волос на стадии анагена.

21. Композиция по п. 19, где алопеция ассоциирована с выпадением волос на стадии телогена.

22. Композиция по п. 19, где алопеция выбрана из группы, состоящей из таких форм выпадения волос, как
(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу);
(b) тракционная алопеция;
(c) анагеновое выпадение волос;
(d) телогеновое выпадение волос;
(e) гнездная алопеция;
(f) тотальная алопеция;
(g) универсальная алопеция;
(h) алопеция бороды;
(i) муцинозная алопеция;
(j) неопластическая алопеция;
(k) рубцующая алопеция;
(l) рубцовая алопеция.

23. Композиция по п. 22, где алопеция является андрогенной алопецией.

24. Композиция по п. 22, где алопеция является выпадением волос в анагеновой стадии.

25. Композиция по п. 18, где выпадение волос индуцировано лучевой терапией и/или химиотерапевтическими агентами.

26. Композиция по любому из пп. 15-25, где пациентом является человек.

27. Полипептид, способный стимулировать рост волос у млекопитающих, состоящий из аминокислотной последовательности, определенной ниже, или из содержащей их слитой последовательности:
(i) аминокислотной последовательности SEQ ID NO: 1;
(ii) аминокислотной последовательности SEQ ID NO: 5; или
(iii) аминокислотной последовательности SEQ ID NO: 63;
и где слитая последовательность состоит из модифицированного полипептида остеопонина и дополнительного полипептида для облегчения очистки, усиления/пролонгирования стимуляции роста волос или для стимулирования клеточного поглощения.

28. Полипептид по п. 27, где полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 5.

29. Полипептид по п. 28, где полипептид состоит из аминокислотной последовательности SEQ ID NO: 5.

30. Полипептид по п. 27, где полипептид содержит или состоит из аминокислотной последовательности SEQ ID NO: 63.

31. Полипептид по п. 30, где полипептид состоит из аминокислотной последовательности SEQ ID NO: 63.

32. Применение полипептида по любому из пп. 27-31 для лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос.

33. Применение полипептида по любому из пп. 27-31 для стимулирования роста волос у млекопитающего, где его применяют в косметологии.

34. Применение модифицированного полипептида остеопонтина согласно любому из пп. 27-31 для приготовления препарата для стимулирования роста волос у млекопитающего.

35. Применение по п. 34, в котором препарат стимулирует имеющиеся волосяные фолликулы.

36. Применение по п. 34, в котором препарат предназначен для индукции роста новых волосяных фолликулов или стволовых клеток, образующих такие фолликулы.

37. Применение по п. 34, в котором препарат предназначен для лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос.

38. Применение по п. 34, в котором препарат предназначен для лечения или профилактики алопеции.

39. Применение по п. 38, в котором алопеция ассоциирована с выпадением волос на стадии анагена.

40. Применение по п. 38, в котором алопеция ассоциирована с выпадением волос на стадии телогена.

41. Применение по п. 38, в котором алопеция выбрана из группы, состоящей из таких форм выпадения волос, как
(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу);
(b) тракционная алопеция;
(c) анагеновое выпадение волос;
(d) телогеновое выпадение волос;
(e) гнездная алопеция;
(f) тотальная алопеция;
(g) универсальная алопеция;
(h) алопеция бороды;
(i) муцинозная алопеция;
(j) неопластическая алопеция;
(k) рубцующая алопеция;
(l) рубцовая алопеция.

42. Применение по п. 41, в котором алопеция является андрогенетической.

43. Применение по п. 41, в котором алопеция является выпадением волос на стадии анагена.

44. Применение по п. 37, в котором выпадение волос индуцировано лучевой терапией и/или химиотерапевтическими агентами.

45. Применение по любому из пп. 34-44, в котором пациентом является человек.

46. Способ стимулирования роста волос у млекопитающего, при котором вводят эффективное количество композиции по пп. 1-6.

47. Способ по п. 46 для стимулирования имеющихся волосяных фолликулов.

48. Способ по п. 46 для индукции роста новых волосяных фолликулов или стволовых клеток, образующих такие фолликулы.

49. Способ по п. 46 для лечения или профилактики заболевания или состояния, ассоциированного с выпадением волос.

50. Способ по п. 46, в котором композиция предназначена для лечения или профилактики алопеции.

51. Способ по п. 50, в котором алопеция ассоциирована с выпадением волос на стадии анагена.

52. Способ по п. 50, в котором алопеция ассоциирована с выпадением волос на стадии телогена.

53. Способ по п. 50, в котором алопеция выбрана из группы, состоящей из таких форм выпадения волос, как
(a) андрогенная алопеция (известна также как андрогенетическая алопеция, alopecia androgenetica, облысение по мужскому типу, облысение по женскому типу);
(b) тракционная алопеция;
(c) анагеновое выпадение волос;
(d) телогеновое выпадение волос;
(e) гнездная алопеция;
(f) тотальная алопеция;
(g) универсальная алопеция;
(h) алопеция бороды;
(i) муцинозная алопеция;
(j) неопластическая алопеция;
(k) рубцующая алопеция;
(l) рубцовая алопеция.

54. Способ по п. 53, в котором алопеция является андрогенетической алопецией.

55. Способ по п. 53, в котором алопеция является выпадением волос на стадии анагена.

56. Способ по п. 49, в котором выпадение волос индуцировано лучевой терапией и/или химиотерапевтическими агентами.

57. Способ по любому из пп. 46-56, в котором пациентом является человек.

58. Применение композиции по любому из пп. 1-6 для стимулирования роста волос у млекопитающего, где ее применяют в косметологии.

59. Применение по п. 58 для стимулирования роста имеющихся волосяных фолликулов.

60. Применение по п. 58 для индукции роста новых волосяных фолликулов или стволовых клеток, образующих такие фолликулы.

61. Применение по п. 58 для лечения или профилактики облысения.

62. Применение по п. 61, в котором облысение ассоциировано с рецессией линии роста волос.

63. Применение по п. 61, в котором облысение ассоциировано с поредением волос на линии их роста.

64. Применение по п. 58 для стимулирования роста бороды, ресниц или бровей.

65. Применение по любому из пп. 58-64, в котором млекопитающим является человек.

66. Применение модифицированного полипептида остеопонтина согласно любому из пп. 27-31 формулы изобретения в условиях ex vivo или in vitro для стимулирования роста волос у млекопитающего.

67. Применение по п. 66 для стимулирования роста волос на эксплантированной коже, перед тем как пересадить эксплантат млекопитающему.

68. Применение по п. 66 для стимулирования роста волосяных фолликулов (или стволовых клеток, являющихся их предшественниками) in vitro.

69. Способ приготовления композиции по любому из пп. 1-6, причем способ этот включает смешивание полипептида по любому из пп. 27-31 с фармацевтически приемлемым и/или косметически приемлемым наполнителем, носителем или растворителем.



 

Похожие патенты:

Настоящее изобретение относится к биохимии, в частности к циклическому пептиду, обладающему антинеопластической и антиангиогенной активностями, имеющему одну из SEQ ID NO:1-76.

Изобретение относится к области биотехнологии, конкретно к новым пептидам на основе лактоферрина человека, и может быть использовано в медицине. Синтезируют пептиды, характеризующиеся последовательностью CFLWRRLMRKLR (SEQ ID NO: 74);CWLWRRAMRKVW (SEQ ID NO: 76); LRLWRRLMRKVW (SEQ ID NO: 77);RRLWRRWMRKVL (SEQ ID NO: 78); CRLWRRRMRKVW (SEQ ID NO: 79); LRLWRRSMRKVW (SEQ ID NO: 81); KKLWRRWWRKVL (SEQ ID NO: 90); RWCKLWRRLMRKVRRL (SEQ ID NO: 85);RWCFLWRRLMRKHRRL(SEQ ID NO: 86); WCKLWRRLMRKVRR(SEQ ID NO: 87); WRRWLRKSVKRL(SEQ ID NO: 93); WCRWLRKMVKAL(SEQ ID NO: 94) или WRRWLRKMVKRL(SEQ ID NO: 95).

Изобретение относится к генной инженерии. Описан способ доставки нуклеиновой кислоты в митохондрию и генетической модификации клетки, включающий воздействие на клетку композицией, содержащей по меньшей мере одну нуклеиновую кислоту и по меньшей мере один органоидно-направленный наноноситель, где наноноситель доставляет по меньшей мере одну нуклеиновую кислоту сквозь клеточную мембрану в митохондрию.

Изобретение относится к новым пептидам, сконструированным на основании аминокислотной последовательности, соответствующей последовательности зрелого человеческого лактоферрина с 13 по 30 аминокислотный остаток, обладающим улучшенной противомикробной и/или противовоспалительной активностью, и их применению, в частности для лечения и/или предотвращения инфекций, воспалений, ран или рубцов.

Изобретение относится к биотехнологии и представляет собой пептид, который имеет аминокислотную последовательность, состоящую из смежных аминокислот, полученных из белка WT1, и индуцирует WT1-специфические хелперные Т-клетки связыванием с молекулой МНС класса II.

Изобретение относится к области биотехнологии, конкретно к синтетическим пептидам с иммуностимулирующими свойствами, и может быть использовано в медицине. Синтезирован ряд пептидов, отличающихся по химической структуре от известных биологически активных пептидов Аллоферонов и Аллостатинов.

Изобретение относится к области иммунологии и медицины. Предложено пептидное производное для выработки в организме специфических антител, взаимодействующих с изоформой 2 фактора элонгации трансляции 1A (eEF1A2), но не взаимодействующих с изоформой 1 фактора элонгации трансляции 1A (eEF1A1), содержащее фрагмент аминокислотной последовательности eEF1A2 с 330 по 343 положения.

Настоящее изобретение относится к области биотехнологии. Предложено терапевтическое антитело и терапевтический фрагмент антитела для повышения продукции тромбоцитов, включающие пептид-миметик тромбопоэтина (ТРО), содержащий последовательность IEGPTLRQWLAARA и встроенный как дополнение к С-концу константной области легкой цепи и/или в положении менее 20 аминокислот ниже С-конца шарнирной области тяжелой цепи.

Изобретение касается применения композиции, включающей гидролизат горохового белка и/или пептид для получения композиции для лечения и/или профилактики инфекции Helicobacter pylori (варианты), а также таких композиций (варианты).

Изобретение относится к области биотехнологии, конкретно к пептидным терапевтическим средствам, и может быть использовано в медицине. Получен биологически активный пептид, обладающий лечебным действием против болезни Альцгеймера и состоящий из последовательности аминокислот Ala-Trp-Lys-Val-Leu-Ser-Pro-Gln-Gly-Gly-Gly-Pro-Trp-Asp-Ser-Val-Ala.
Группа изобретений относится к области средств для ухода за полостью рта и способов их применения. Предлагаемая композиция средства для чистки зубов содержит: 1-5 мас.% комплексной глины, содержащей силикат магния и щелочного металла; перорально приемлемый анионный полимер, который представляет собой сополимер метилвинилового эфира/малеинового ангидрида, в основе средства для чистки зубов в количестве 1-5 % от массы композиции; эффективное количество фторида, который представляет собой соль, выбранную из фторида олова, фторида натрия, фторида калия, монофторфосфата натрия или их комбинаций; нитрат калия или хлорид калия в количестве, эффективном для снижения чувствительности дентина; причем в композиции после включения в средство для чистки зубов глина остается по существу негидратированной.
Изобретение относится к области косметологии и представляет собой косметический крем на основе гиалуронидазы, содержащий косметическую основу, отличающийся тем, что в качестве фермента используют иммобилизованную гиалуронидазу, ковалентно связанную с полимерным носителем и обладающую гиалуронидазной активностью, при этом в качестве косметической основы используют липодерм 4/1 и воду, причем компоненты в креме находятся в определенном соотношении, в мас.%.
Группа изобретений относится к области средств для ухода за полостью рта и их применения. Предлагаемая композиция для ухода за полостью рта содержит: источник фторид-ионов; от 2 до 10 мас.% сополимера поли(пропиленоксид)/поли(этиленоксид); фумаровую кислоту в количестве, эффективном для увеличения доставки фторида в эмаль, а именно в количестве от 0,01 до 0,25 % в расчете на полную массу композиции.

Изобретение относится к косметической промышленности и представляет собой косметическую композицию для ухода за кожей, содержащую в физиологически приемлемой водной среде соединение формулы I, где R1 обозначает радикал COOR3, где R3 обозначает атом водорода или С1-С4алкильный радикал, необязательно замещенный одной или несколькими гидроксильными группами, R2 обозначает насыщенный или ненасыщенный линейный углеводородный радикал, содержащий от 1 до 18 атомов углерода, или разветвленный или циклический, содержащий от 3 до 18 атомов углерода, а также их оптические изомеры и соответствующие соли, гомополимер мономера, содержащего сульфоновую группу, и сшитый гомополимер акриловой кислоты.

Группа изобретений относится к области косметологии и касается композиции для окрашивания кератиновых волокон, содержащей i) по меньшей мере один субстантивный краситель, содержащий дисульфидную, тиольную или тиол-защищенную функцию, и ii) по меньшей мере один загущающий органический полимер не на основе целлюлозы, iii) по меньшей мере один щелочной агент, iv) по меньшей мере один восстанавливающий агент и необязательно v) по меньшей мере одно поверхностно-активное вещество.

Изобретение относится к фармацевтической промышленности и косметологии и представляет собой лекарственную композицию для ухода за стареющей кожей с целью поддерживания барьерной функции кожи, содержащую комбинацию активных ингредиентов для ухода за стареющей кожей и состоящую из следующих компонентов: миндального масла, жирных кислот льняного масла, аминокислот, креатина и формообразующих компонентов, причем компоненты в композиции находятся в определенном соотношении, мас.%, или состоящую из следующих компонентов: миндального масла, жирных кислот растительного происхождения с соотношением омега-6 и омега-3 жирных кислот 1 к >1, аминокислот, выбранных из одной или нескольких аминокислот, к которым относятся аргинин, глутамин, гистидин и серин, и/или как минимум одного натурального увлажняющего фактора, предпочтительно пирролидинкарбоновой кислоты РСА и/или урокановой кислоты UCA, креатина и формообразующих компонентов, причем компоненты в композиции находятся в определенном соотношении, мас.%, при этом лекарственная композиция для защиты кожи предусмотрена в форме эмульсии типа «вода в масле» или эмульсии типа «вода в масле в воде» Изобретение обеспечивает восстановление барьерной функции кожи, уменьшение сухости, зуда и раздражения кожи.

Изобретение относится к зубной пасте, содержащей загуститель, наполнитель, увлажняющий компонент, абразив и основу - воду очищенную, причем в качестве увлажняющего компонента используют глицерин, в качестве загустителя - целлюлозу монокристаллическую, в качестве наполнителя - цинка оксид, в качестве абразива - наноалмазы, при этом компоненты взяты в следующем соотношении, мас.%: загуститель - целлюлоза микрокристаллическая 17,91-17,56; наполнитель - цинка оксид 17,91-17,56; увлажняющий компонент - глицерин 11,94-11,70; основа - вода очищенная 51,74-50,68; абразив - наноалмазы 0,5-2,5.

Изобретение относится к области косметологии и представляет собой способ восстановления эластической структуры кожи индивидуума, включающий следующие этапы: обеспечение присутствия индивидуума, нуждающегося в восстановлении эластической структуры; определение участка обработки на коже индивидуума, где участок обработки представляет собой участок кожи, в котором необходимо восстановить эластическую структуру; инъекции тропоэластиновой композиции в ткань кожи в пределах участка обработки, чтобы создать количество тропоэластина в пределах участка обработки, которое увеличено по сравнению с кожей, находящейся за пределами участка обработки; где тропоэластиновую композицию инъецируют в ткань кожи в пределах участка обработки в соответствии с предварительно установленным графиком обработки, определяющим заданное количество обработок, при котором каждую обработку в виде инъекции осуществляют в заданный момент времени; и где, по меньшей мере, одна обработка из графика обработки включает многократные инъекции, причем каждую инъекцию в обработке осуществляют в месте инъекции, отстоящем от других мест инъекции на предварительно установленное расстояние, тем самым поддерживая количество тропоэластина в участке обработки в течение предварительно установленного периода времени в соответствии с графиком обработки для восстановления эластической структуры кожи индивидуума.

Изобретение относится к области косметологии и представляет собой косметическое средство в составе крема, геля или косметического молочка, характеризующееся повышенными успокаивающим, регенерирующим, противоожоговым и обезболивающим эффектами, включающее основную композицию, состоящую из смеси 2-гидроксиэтилаллилового эфира с экстрактом ромашки при их массовом соотношении от 90:10 до 60:40, активную субстанцию местного анестетика тримекаина, вспомогательные вещества, такие как: PPG 15 стеариловый эфир; глицерин; эмульгатор либо загуститель; цетеариловый спирт; диметикон; консервант гермабен 2; отдушки, а также дистиллированную воду, причем компоненты в средстве находятся в определенном соотношении в мас.

Изобретение относится к косметической промышленности и представляет собой красящий пенный состав для волос, состоящий из двух фаз - Фазы А и Фазы Б, размещенных отдельно друг от друга и смешиваемых непосредственно перед использованием, где Фаза Б представляет собой окислительный агент в виде водного раствора, содержащий пероксид водорода, а Фаза А представляет собой эмульсию, содержащую неионогенный поливинилпирролидон (ПВП), обладающий высокой растворяющей способностью по отношению к красителям различных классов, способностью образовывать с ними лабильные комплексы пониженной токсичности и быстро транспортировать их к поверхности кератина волос, к которому проявляет повышенное сродство, и композицию ПАВ анионного, неионогенного и амфотерного типа, обеспечивающую возможность вспенивания красящего состава, получаемого после смешения с Фазой Б, с образованием устойчивой в течение длительного времени пены и обладающей большой растворяющей способностью, что позволяет вводить в красящий состав большие концентрации красителей (оксидационных и/или их солей или смесь их с красителями прямого действия), а также содержащую эмолиент, кондиционирующий агент, восстановители, комплексон, парфюмерную композицию и воду, а в качестве щелочного агента - гидроксид аммония, 25% раствор и нелетучий аминометилпропанол, поддерживающие постоянную щелочность состава рН 9,2-10,8 на протяжении всего времени окрашивания.

Настоящее изобретение относится к соединению со структурой Формулы (I) или его фармацевтически приемлемой соли или энантиомеру; где R1 является водородом или RlaC(O)-; R2 является водородом или R2aC(O)-; R3 является водородом или R3aC(O)-; Rla, R2a и R3a независимо являются незамещенным C1-С10 алкилом; и R4 и R5 независимо являются водородом или незамещенным С1-С10 алкилом; однако при условии, что по меньшей мере один из R1, R2 и R3 не является водородом.
Наверх