Стабильные антитела, связывающиеся с несколькими антигенами

Изобретение относится к области биохимии, в частности к применению способа модификации двух доменов легкой цепи для получения антитела с повышенной стабильностью, по сравнению с антителом, не содержащей указанных замен. Изобретение позволяет получать антитела с повышенной стабильностью, по сравнению с антителами, не содержащей указанных замен. 21 з.п. ф-лы, 14 табл., 4 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ НА РОДСТВЕННЫЕ ПУБЛИКАЦИИ

В настоящей заявке испрашивается приоритет согласно 35 Своду законов США, параграф 119, на предварительную заявку на патент Соединенных Штатов Америки с №61/549482, поданную 20 октября 2011 г., полное содержание которой включено в настоящую заявку посредством ссылки на ее полную версию и для любых целей.

Область техники

Настоящее изобретение относится к стабильным антителам, связывающимся с несколькими антигенами, содержащим по меньшей мере два домена легкой цепи антитела, два домена тяжелой цепи антитела и не содержащим константных доменов, причем каждый вариабельный домен легкой цепи связан с вариабельным доменом тяжелой цепи, образуя конструкцию VH/VL, и причем по меньшей мере один из доменов VH содержит конкретную аминокислоту в положении АНо 12, 103 и/или 144, и по меньшей мере один из доменов VL содержит конкретную аминокислоту в положении АНо 47 и/или 50. Также настоящее изобретение относится к способам получения таких антител и фармацевтическим композициям, содержащим такие антитела.

Уровень техники

Молекулы антител, которые способны связываться с более чем одним антигеном, желательны в качестве потенциальных терапевтических агентов для лечения заболеваний, в развитии которых участвует несколько белков. Например, часто желательны направленное действие на два белка в одном и том же сигнальном пути или модуляция активности в двух разных путях посредством направленного воздействия на белок в каждом из путей. Примеры таких антител включают мультиспецифические антитела (например, биспецифические антитела, которые связываются с двумя разными молекулами-мишенями) и мультивалентные антитела (например, бивалентные антитела, которые связываются с двумя разными сайтами связывания одной молекулы-мишени). В области терапевтических антител было разработано несколько подходов, направленных на сочетание двух терапевтических антител с образованием одной молекулы, чтобы пользоваться преимуществами аддитивного или синергического действия при сохранении стабильности и других желательных свойств. Такие подходы включают рекомбинантные формы, такие как тандемный одноцепочечный вариабельный фрагмент (TdscFv) (Hagemeyer et al., 2009, Thromb Haemost 101:1012-1019; Robinson et al., 2008, Br J Cancer 99:1415-1425), диатела (Hudson et al., 1999, J Immunol Methods 231:177-189), тандемные диатела (Kipriyanov, 2009, Methods Mol Biol 562:177-193), антитела «два-в-одном» (Bostrom et al., 2009, Science 323:1610-1614) и антитела с двойными вариабельными доменами (Wu et al., 2007, Nat Biotechnol 25:1290-1297).

Одним примером заболевания, при котором привлекательным кажется двухкомпонентный терапевтический подход, является неоваскуляризация хороидеи. Сосудистый компонент неоваскуляризации хороидеи представляют клетки эндотелия сосудов, предшественники эндотелиоцитов и перициты. Внесосудистый компонент, который согласно гистопатологическим данным, по-видимому, служит источником ангиогенных стимулов и часто является наиболее выраженным компонентом в объемном выражении, представляют воспалительные, глиальные клетки, клетки пигментного эпителия сетчатки и фибробласты. Повреждение ткани может быть вызвано любым из указанных компонентов. Можно направленно воздействовать на каждый компонент по отдельности посредством разных средств монотерапии. Однако биспецифическое антитело против фактора роста эндотелия сосудов (VEGF) и фактора некроза опухоли (TNF) дает возможность воздействовать на оба компонента одновременно.

Распространенной проблемой, ассоциированной с мультиспецифическими и мультивалентными антителами является низкая стабильность, а также проблемы с промышленным выходом, чистотой и сродством. Были разработаны разные подходы для борьбы с указанными проблемами, включая рациональный дизайн и направленную эволюцию (Mabry and Snavely, 2010, IDrugs 13:543-549). Однако такие подходы занимают время и еще не дали результатов, которые были бы применимы повсюду.

Следовательно, в технике существует потребность в мультиспецифических и мультивалентных формах антител, которые стабильны и растворимы, и лишены недостатков традиционных мультиспецифических и мультивалентных форм антител.

Сущность изобретения

Согласно настоящему изобретению предложено антитело, которое связывается с несколькими антигенами, такое как биспецифические и бивалентные антитела, содержащее остатки определенных аминокислот в конкретных положениях в вариабельной области тяжелой и/или легкой цепи, которое является молекулой с высокой стабильностью.

Согласно одному аспекту настоящего изобретения предложены молекулы антител, связывающихся с несколькими антигенами, содержащие:

a) два вариабельных домена тяжелой цепи, один со специфичностью к антигену A (VH-A), а другой со специфичностью к антигену В (VH-B), и

b) два вариабельных домена легкой цепи, один со специфичностью к антигену A (VL-A), а другой со специфичностью к антигену В (VL-B),

причем по меньшей мере один из указанных двух вариабельных доменов тяжелой цепи содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103, и серии или треонин в положении АНо 144; и/или причем по меньшей мере один из двух вариабельных доменов легкой цепи содержит аргинин в положении АНо 50.

Согласно определенным аспектам, указанный VH-A соединен с VL-A, и вместе они образуют одноцепочечное антитело со специфичностью к антигену A (scFv A), a VH-B соединен с VL-B, и вместе они образуют одноцепочечное антитело со специфичностью к антигену В (scFv В).

Согласно одному аспекту настоящего изобретения предложена молекула антитела, связывающегося с несколькими антигенами, содержащая: вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-A), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 1, и вместе они образуют конструкцию VH-A/VL-B; вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-B), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 2, и вместе они образуют конструкцию VH-B/VL-A; причем указанное антитело, связывающееся с несколькими антигенами, лишено константных доменов, по меньшей мере один из VL-A и VL-B содержит аргинин в положении АНо 50, и по меньшей мере один из VH-A и VH-B содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103, и серии или треонин в положении АНо 144.

Согласно определенным аспектам конструкция VH-A/VL-B находится в ориентации VH-А-(линкер 1)-VL-B или в ориентации VH-В-(линкер 1)-VL-A. Согласно другим аспектам конструкция VH- В /VL- А находится в ориентации VH-В-(линкер 2)-VL-A или в ориентации VH-А-(линкер 2)-VL-B.

Согласно еще одному аспекту по меньшей мере один из VL-A или VL-B содержит каркасную последовательность, которая по меньшей мере на 65% идентична последовательности SEQ ID №: 6.

Согласно еще одному аспекту по меньшей мере один из VH-A или VH-B содержит каркасную последовательность, которая по меньшей мере на 80% идентична последовательности SEQ ID №:7.

Согласно еще одному аспекту по меньшей мере одна из конструкций VL-A/VH-B и VH-B/VL-A содержит вариабельную область легкой цепи человека из семейства Vkappal, вариабельную область легкой цепи человека из семейства Vlambda 1 или вариабельную область легкой цепи человека из семейства Vkappa3.

Согласно еще одному аспекту по меньшей мере одна из конструкций VL-A/VH-B и VH-B/VL-A содержит вариабельную область тяжелой цепи человека из семейства VH3, вариабельную область тяжелой цепи человека из семейства VH1a или вариабельную область тяжелой цепи человека из семейства VH1b.

Согласно еще одному аспекту домены VH и домены VL содержат CDR (гипервариабельные области) из антитела зайцеобразных.

Согласно еще одному аспекту настоящего изобретения также предложено антитело, связывающееся с несколькими антигенами, содержащее:

a) одноцепочечное антитело, содержащее вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-A), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 3, которые вместе образуют scFv-A;

b) одноцепочечное антитело, содержащее вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-B), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 3, которые вместе образуют scFv-B;

причем scFv-A соединен с scFv-B пептидным линкером 1, и по меньшей мере один из VL-A и VL-B содержит аргинин в положении АНо 50, и по меньшей мере один из VH-А и VH-B содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103, и серии или треонин в положении АНо 144.

Согласно одному аспекту антитело, связывающееся с несколькими антигенами, согласно настоящему изобретению, содержит одноцепочечное антитело со специфичностью к антигену А и одноцепочечное антитело со специфичностью к антигену В в следующей форме: VH-A/VL-A - линкер - VH-B/VL-B. Согласно предпочтительному аспекту указанный линкер состоит из 20 аминокислот. Согласно другому предпочтительному аспекту указанный линкер содержит последовательность SEQ ID №: 4.

Согласно еще одному аспекту настоящего изобретения предложена молекула антитела, связывающегося с несколькими антигенами, содержащая: CDR из антитела зайцеобразных; вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-А), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 1, и вместе они образуют конструкцию VH-A/VL-B; вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-B), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 2, и вместе они образуют конструкцию VH-B/VL-A; причем по меньшей мере один из указанных вариабельных доменов тяжелой цепи содержит по меньшей мере три из следующих остатков: треонин (Т) в положении АНо 24, валин (V) в положении АНо 25, аланин (А) или глицин (G) в положении АНо 56, лизин (К) в положении АНо 82, треонин (Т) в положении АНо 84, валин (V) в положении АНо 89 и аргинин (R) в положении АНо 108. Согласно определенным аспектам такие антитела также содержат глутаминовую кислоту (Е) в положении АНо 1, валин (V) в положении АНо 3, лейцин (L) в положении АНо 4, серии (S) в положении АНо 10; аргинин (R) в положении АНо 47, серии (S) в положении АНо 57, фенилаланин (F) в положении АНо 91 и/или валин (V) в положении АНо 103 по меньшей мере в одном из указанных вариабельных доменов легкой цепи.

Специфические предпочтительные варианты реализации настоящего изобретения станут очевидны из следующего более подробного описания конкретных предпочтительных вариантов реализации и пунктов формулы изобретения.

Подробное описание

Подробные сведения, которые приводятся в настоящей заявке, даны только для примера и для иллюстрированного обсуждения предпочтительных вариантов реализации, ради представления в таком виде, который считается наиболее полезным и легко понятным описанием принципов и концептуальных аспектов разных вариантов реализации настоящего изобретения. В этой связи не совершается попыток показать структурные подробности настоящего изобретения более подробно, чем требуется для фундаментального понимания изобретения, и описание в совокупности с чертежами и/или примерами делает понятным специалистам в данной области техники, как несколько форм настоящего изобретения могут реализовываться на практике.

Чтобы настоящее изобретение могло быть более понятным, конкретные термины имеют определения, как указано далее, в подробном описании. Предполагается, что определения и объяснения должны контролироваться при любом последующем построении, если они явно и недвусмысленно не модифицированы в следующих примерах, или когда применение значения делает какое-либо построение лишенным смысла или в существенной степени лишенным смысла. В случаях, когда построение термина может делать его лишенным смысла или в существенной степени лишенным смысла, определение следует брать из Webster's Dictionary, 3-е издание, или словаря, известного специалистам в данной области техники, такого как Oxford Dictionary of Biochemistry and Molecular Biology (Ed. Anthony Smith, Oxford University Press, Oxford, 2004).

Основная цель настоящего изобретения состоит в том, чтобы предложить антитела, способные связываться с несколькими антигенами, которые применимы для терапевтических целей. Как впервые описано в настоящей заявке, свойства таких антител могут быть улучшены, когда определенные аминокислоты присутствуют в определенных положениях вариабельного домена легкой цепи и вариабельного домена тяжелой цепи. Такие улучшенные свойства включают, например, повышенную стабильность, выход продукции и чистоту.

Следовательно, согласно настоящему изобретению предложены антитела, которые связываются с несколькими антигенами, антитела, содержащие:

a) вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-А), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 1, и вместе они образуют конструкцию VH-A/VL-B;

b) вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-В), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 2, и вместе они образуют конструкцию VH-B/VL-A;

причем по меньшей мере один из VL-A и VL-B содержит аргинин в положении АНо 47 и/или 50, и по меньшей мере один из VH-A и VH-B содержит серии в положении АНо 12, серии или треонин в положении АНо 103, и/или серии или треонин в положении АНо 144. Согласно одному варианту реализации VL содержит аргинин в положении АНо 50, a VH содержит серии в положении АНо 12, треонин в положении АНо 103, и треонин в положении АНо 144.

Согласно предпочтительному варианту реализации антитело согласно настоящему изобретению является антителом, связывающимся с несколькими антигенами, которое лишено константных доменов, такое как антитело scFv.

Термин «scFv» относится к молекуле, содержащей вариабельный домен тяжелой цепи антитела (или область; VH) и вариабельный домен легкой цепи антитела (или область; VL), соединенные линкером, и лишенной константных доменов. Такие молекулы scFv могут обладать общей структурой: NH2-VL-линкер-VH-COOH или NH2-VH-линкер-VL-COOH. Подходящие линкеры описаны в настоящей заявке и известны специалистам в данной области техники, включая линкеры, описанные, например, в международной заявке на патент WO 2010/006454.

В настоящей заявке термин «антитело, связывающееся с несколькими антигенами» описывает антитело, которое содержит по меньшей мере четыре вариабельных домена и может связываться с двумя или более антигенами разных молекул-мишеней (например, биспецифические антитела) или двумя или более антигенами одной и той же молекулы-мишени (например, бивалентное антитело). Формы антител, связывающихся с несколькими антигенами, согласно настоящему изобретению включают без ограничений диатело, одноцепочечное диатело и тандемное диатело, которые известны специалистам в данной области техники.

В настоящей заявке термин «биспецифическое антитело» обозначает антитело, которое может связываться с двумя разными молекулами-мишенями.

В настоящей заявке термин «бивалентное антитело» обозначает антитело, которое может связываться с двумя разными сайтами одной молекулы-мишени.

Согласно определенным вариантам реализации, VL антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению содержит по меньшей мере одну конкретную аминокислоту по меньшей мере в одном конкретном положении, что, как было показано в настоящей заявке, повышает стабильность формы антитела, связывающегося с несколькими антигенами, a VH антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению содержит по меньшей мере одну из трех конкретных аминокислот по меньшей мере в одном из трех конкретных положений, что, как было показано в настоящей заявке, повышает стабильность формы антитела, связывающегося с несколькими антигенами. Согласно конкретному варианту реализации указанное положение в VL является положением АНо 50 и/или положением АНо 47, а аминокислота в указанном положении(ях) является аргинином. Согласно другому конкретному варианту реализации указанные положения в VH являются положениями АНо 12, 103 и 144, а предпочтительные аминокислоты в указанных положениях следующие: серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144. Согласно предпочтительному варианту реализации указанными аминокислотами в VH являются серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144. Согласно определенным вариантам реализации указанные предпочтительные аминокислоты можно вводить в VL и/или VH путем замены существующей в природе аминокислоты в идентифицированном положении(ях).

Система нумерации АНо более подробно описана у Honegger, А. и Pluckthun, А. (2001) J. Mol. Biol. 309:657-670). В качестве альтернативы можно применять систему нумерации Кабата, описанную более подробно у Kabat et al. (Kabat, Ε. Α., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). Таблицы перевода для двух разных систем нумераций, применяемых для идентификации положений остатков аминокислот в областях легких и тяжелых цепей антитела, приведены в A. Honegger, 2001, J.Mol.Biol. 309:657-670. Соответствующий номер по Кабату для положения АНо 47 в VL равен 39. Соответствующий номер по Кабату для положения АНо 50 в VL равен 42. Соответствующий номер по Кабату для положения АНо 12 в VH равен 11. Соответствующий номер по Кабату для положения АНо 103 в VH равен 89. Соответствующий номер по Кабату для положения АНо 144 в VH равен 108.

Согласно другому варианту реализации настоящего изобретения предложены антитела, связывающиеся с несколькими антигенами, содержащие одну или более предпочтительных аминокислот в предпочтительных положениях, раскрываемых в настоящей заявке, и которые обладают специфичностью связывания в отношении по меньшей мере двух антител, или фрагменты таких антител, включая, например, Fab, Fab', F(ab')2, Fv или одноцепочечный Fv. Также такие антитела могут быть димером легких или тяжелых цепей, или любым их минимальным фрагментом, таким как Fv или одноцепочечная конструкция, описанные в Ladner et al. Патент США №4946778, содержание которого в явном виде включено посредством ссылки. Согласно определенным вариантам реализации такие антитела, связывающиеся с несколькими антигенами, содержат по меньшей мере один VL, содержащий аргинин в положении АНо 50, и по меньшей мере один VH, содержащий серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144.

Линкеры и конструкции VH/VL

В настоящей заявке термины «пептидный линкер 1» и «пептидный линкер 2» относятся к линкерным пептидам, которые соединяют вариабельные домены в конструкции VH/VL друг с другом, или одну или более конструкций scFv вместе. «Конструкцией VH/VL» может быть: конструкция VH-A/VL-B или конструкция VH-B/VL-A, которая содержит домен VH с CDR, которые связываются с конкретным антигеном, и домен VL с CDR, которые связываются с другим антигеном; или конструкция VH-A/VL-A или конструкция VH-B/VL-B, которая содержит домен VH с CDR, которые связываются с конкретным антигеном, и домен VL с CDR, которые связываются с тем же антигеном. Формой таких конструкций может быть VH-L-VL или VL-L-VH, где L обозначает пептидный линкер 1 или 2. Такие пептидные линкеры обладают длиной предпочтительно 20 или менее аминокислот. В частности, такие пептидные линкеры обладают длиной 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислот. Согласно определенным вариантам реализации пептидные линкеры обладают длиной 3-7 аминокислот. Предпочтительная линкерная последовательность для пептидного линкера 1 и/или пептидного линкера 2 - это GGGGS (SEQ ID №: 1). Другие линкерные последовательности, применимые в качестве пептидного линкера 1 и/или пептидного линкера 2 в антителе, связывающемся с несколькими антигенами, согласно настоящему изобретению включают: GGS и GGGGGGS (SEQ ID №: 2). Согласно определенным вариантам реализации конструкцией VH/VL может быть одноцепочечное антитело. Линкеры в одноцепочечных антителах известны в технике. Предпочтительно линкер для одноцепочечного антитела, который связывает домен VH и домен VL, которые связываются с предпочтительным антигеном в антителе согласно настоящему изобретению, может быть до 20 аминокислот длиной, например, может содержать последовательность SEQ ID №: 4, показанную ниже.

Согласно определенным вариантам реализации конструкция VH/VL соединена с другой конструкцией VH/VL пептидным линкером 3. Согласно другим вариантам реализации вариабельные домены в конструкции VH/VL соединены друг с другом пептидным линкером 3. Пептидный линкер 3 предпочтительно обладает длиной более чем приблизительно 10 аминокислот и менее чем приблизительно 30 аминокислот. В частности, пептидный линкер 3 обладает длиной 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 аминокислот. Согласно определенным вариантам реализации пептидный линкер 3 обладает длиной 10-15 аминокислот. Предпочтительная линкерная последовательность для пептидного линкера 3 - это GSDSNAGRASAGNTS (SEQ ID №: 3). Другая линкерная последовательность для пептидного линкера 3 - это (GGGGS)4 (SEQ ID №: 4). Специалист в данной области техники должен понимать, что в последовательность линкера можно вносить консервативные изменения (например, замены), не влияющие на активность и предпочтительные свойства антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению.

Согласно определенным вариантам реализации, конструкция VH/VL может быть в одной из следующих форм: VH-А-(линкер 1 или 2)-VL-B; VH-В-(линкер 1 или 2)-VL-A; VH-А-(линкер 1 или 2)-VL-A; VH-В-(линкер 1 или 2)-VL-B; VL-А-(линкер 1 или 2)-VH-A; VL-В-(линкер 1 или 2)-VH-B. Специалисты в данной области техники могут предложить другие ориентации доменов VH и VL в конструкции VH/VL. Например, VL-А-(линкер 1 или 2)-VH-B, VL-B-(линкер 1 или 2)-VH-A, VL-А-(линкер 1 или 2)-VH-A, VL-В-(линкер 1 или 2)-VH-B. Согласно конкретным вариантам реализации, где конструкции VH/VL соединены пептидным линкером 3, может быть создана одна из следующих форм: VH-A-(линкер-1)-VL-А-(линкер 3)-VH-В-(линкер 2)-VL-B; VH-А-(линкер-1)-VL-В-(линкер 3)-VH-В-(линкер 2)-VL-A; VL-А-(линкер-1)-VH-В-(линкер 3)-VL-В-(линкер 2)-VH-A, VL-A-(линкер-1)-VH-А-(линкер 3)-VL-В-(линкер 2)-VH-B. Указанные в настоящей заявке формы являются неограничивающими примерами, и следует ясно понимать, что специалисты в данной области техники могут расположить домены VH и VL в разных других ориентациях, при условии, что достигается связывание целевых антигенов, когда указанные конструкции образуются и должным образом сворачиваются.

Согласно одному варианту реализации антитело, связывающееся с несколькими антигенами, согласно настоящему изобретению содержит одноцепочечное антитело со специфичностью к антигену А и одноцепочечное антитело со специфичностью к антигену В в следующей форме: VH-A/VL-A - линкер 3 - VH-B/VL-B, причем линкер 3 обладает последовательностью SEQ ID №: 4.

Согласно одному варианту реализации предпочтительной формой антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению является: VH-A-SEQ ID №: 1-VL-B-SEQ ID №: 4-VH-B-SEQ ID №: 1-VL-A.

В качестве альтернативы, конструкции VH/VL согласно настоящему изобретению могут быть функционально связаны (например, химической связью, генетическим слиянием, нековалентной связью или другим образом) с другой конструкцией с образованием антитела, связывающегося с несколькими антигенами.

Согласно настоящему изобретению предложены антитела, которые связываются с несколькими антигенами. Как описано в настоящей заявке, такие антитела могут связываться с разными молекулами-мишенями (например, биспецифическое антитело, обладающее специфичностью по меньшей мере в отношении двух разных белков) или связывающиеся с разными эпитопами на одной молекуле-мишени (например, бивалентное антитело, обладающее специфичностью в отношении одного белка, но связывающееся с двумя или более сайтами связывания на указанном белке). Специалист в данной области техники может выбрать конкретные молекулы-мишени в зависимости от потребности.

В качестве примера, но не с целью ограничения, согласно настоящему изобретению предложено биспецифическое антитело, которое обладает специфичностью в отношении VEGF и TNFα, как описано в разделе «Примеры» в настоящей заявке. Такое антитело применимо при лечении заболеваний, при которых желательно ингибировать VEGF и TNFα.

Согласно определенным вариантам реализации анти-VEGF/TNFα антитело можно применять при лечении возрастной макулярной дегенерации, неоваскуляризации хороидеи, неоваскулярной глаукомы, диабетической ретинопатии, ретинопатии недоношенных, ретролентальной фиброплазии, рака молочной железы, рака легких, рака желудка, карцином пищевода, рака толстой и ободочной кишки, карцином печени, карцином яичника, комы, арренобластомы, рака шейки матки, карциномы эндометрия, гиперплазии эндометрия, эндометриоза, фибросарком, хориокарциномы, рака головы и шеи, носоглоточной карциномы, карциномы глотки, гепатобластомы, саркомы Капоши, меланомы, карциномы кожи, гемангиомы, кавернозной гемангиомы, гемангиобластомы, карцином поджелудочной железы, ретинобластомы, астроцитомы, глиобластомы, невриномы, олигодендроглиомы, гранулобластомы, остеобластической саркомы, лейомиосаркомы, карцином мочевыводящих путей, рака щитовидной железы, опухоли Вильма, почечно-клеточной карциномы, рака предстательной железы, пролиферации сосудов в брюшной полости, ассоциированной с факоматозом, отеков (таких как отеки, ассоциированные с опухолями головного мозга), синдрома Мейгса, ревматоидного артрита, псориаза, атеросклероза, хронических и/или аутоиммунных состояний воспаления при общих, иммуно-опосредованных воспалительных расстройствах в целом, воспалительных заболеваний ЦНС, воспалительных заболеваний, поражающих глаз, суставы, кожу, слизистые оболочки, центральную нервную систему, желудочно-кишечный тракт, мочевыводящие пути или легкие, состояний увеита в целом, ретинита, HLA-B27+ увеита, синдрома Бехчета, синдрома сухого глаза, глаукомы, синдрома Шегрена, сахарного диабета (включая диабетическую невропатию), резистентности к инсулину, состояний артрита в целом, ревматоидного артрита, остеоартрита, реактивного артрита и синдрома Рейтера, ювенильного артрита, анкилозирующего спондилита, множественного склероза, острого первичного идиопатического полирадикулоневрита, тяжелой миастении, бокового амиотрофического склероза, саркоидоза, гломерулонефрита, хронических заболеваний почек, цистита, псориаза (включая псориатический артрит), гнойного гидраденита, панникулита, гангренозной пиадермии, синдрома SAPHO (синовиит, акне, пустулез, гиперостоз и остеит), акне, синдрома Свита, пузырчатки, болезни Крона (включая внекишечные проявления), язвенного колита, бронхиальной астмы, пневмонита гиперчувствительности, аллергий в целом, аллергического ринита, аллергического синусита, хронической обструктивной болезни легких (ХОБЛ), фиброза легких, грануломатоза Вегенера, синдрома Кавасаки, гигантоклеточного артериита, васкулита Чарг-Стросса, узелкового полиартериита, ожогов, болезни «трансплантат против хозяина», реакций «трансплантат против хозяина», эпизодов отторжения после трансплантации органов или костного мозга, системных и местных состояний васкулитов в целом, системной и дисковидной красной волчанки, полимиозита и дерматомиозита, склеродермии, преэклампсии, острого и хронического панкреатита, вирусного гепатита, алкогольного гепатита, послеоперационного воспаления, такого как после операции (например, операция по удалению катаракты (замена хрусталика глаза) или по борьбе с глаукомой), операции на суставах (включая артроскопическую операцию), операции на связанных с суставом структурах (например, связки), стоматологических операций или операций в полости рта, минимально инвазивных сердечно-сосудистых процедур (например, ЧТКА (чрескожная транслюминальная коронарная ангиопластика), атерэктомия, установка стента), лапароскопических и/или внутрибрюшных и гинекологических процедур, эндоскопических урологических процедур (например, операции на предстательной железе, уретероскопия, цистоскопия, интерстициальный цистит) или периоперационного воспаления (профилактика) в целом, болезни Альцгеймера, болезни Паркинсона, болезни Хантингтона, паралича Белла, болезни Крейцфельда-Якоба, связанного с раком остеолиза, связанного с раком воспаления, связанной с раком боли, связанного с раком истощения, метастазов в костях, острой и хронической формы боли, независимо от того, вызвана она центральными или периферическими эффектами TNFα, и классифицируется ли она как воспалительная, ноцитептивная или невропатическая форма боли, ишиалгии, боли в нижнем отделе спины, синдрома канала запястья, рефлекторной симпатической дистрофии (CRPS), подагры, постгерпетической невралгии, фибромиалгии, состояний местной боли, хронических болевых синдромов в связи с метастазами опухоли, дисменореи, бактериального, вирусного или грибкового сепсиса, туберкулеза, СПИДа, атеросклероза, ишемической болезни сердца, артериальной гипертензии, дислипидемии, сердечной недостаточности и хронической сердечной недостаточности.

Связывание антител согласно настоящему изобретению с их специфическими антигенами-мишенями можно подтвердить, например, при помощи твердофазного иммуноферментного анализа (ELISA), градиоиммуноанализа (РИА), анализа FACS (флуоресцентной сортировки клеток), биологического анализа (например, ингибирование роста) или при помощи иммуноблоттинга. Каждый из указанных способов анализа в целом позволяет выявить присутствие комплексов белок-антитело, представляющих интерес, путем применения меченных реагентов (например, антитела), специфичных в отношении рассматриваемого комплекса. В качестве альтернативы, комплексы можно выявлять при помощи применения любого из разнообразных способов иммунного анализа. Например, к указанному антителу можно присоединить радиоактивную метку и применять его при радиоиммуноанализе (RIA) (см., например, Weintraub, В., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, которая включена в настоящую заявку посредством ссылки). Радиоактивный изотоп можно определить такими средствами, как применение γ-счетчика или сцинтилляционного счетчика, или посредством авторадиографии.

Антитела согласно настоящему изобретению применимы для целого ряда целей, включая терапевтические и диагностические цели.

Характеристики доменов VL и VH

Согласно определенным вариантам реализации VL и VH антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению содержат CDR из антитела человека, нечеловеческого антитела (такого как антитело, которое образовалось в организме грызуна, низшего примата, зайцеобразного или любого другого подходящего животного), химерного антитела, гуманизированного антитела и подобного. Согласно конкретному варианту реализации указанные CDR получены из антитела зайцеобразных.

Термин «зайцеобразные» относится к членам таксономического отряда Зайцеобразных, включающего семейства Leporidae (например, зайцевые) и Ochotonidae (пищухи). Согласно наиболее предпочтительному варианту реализации указанным зайцеобразным является кролик. В настоящей заявке термин «кролик» относится к животному, принадлежащему к семейству Leporidae.

Термин «CDR» относится к одному из шести гипервариабельных областей в вариабельных доменах антитела, который вносит главный клад в связывание с антигеном. Одно из наиболее часто применяемых определений для шести CDR было предложено Kabat Ε.A. et al. (1991, Sequences of proteins of immunological interest. NIH Publication 91-3242). В некоторых случаях определение CDR Кабата может применяться только к CDR1, CDR2 и CDR3 вариабельного домена легкой цепи (CDR LI, CDR L2, CDR L3 или L1, L2, L3), а также к CDR2 и CDR3 вариабельного домена тяжелой цепи (CDR Н2, CDR Н3 или Н2, Н3), тогда как CDR1 вариабельного домена тяжелой цепи (CDR H1 or H1) определяется по следующим остаткам (нумерация Кабата): CDR1 тяжелой цепи начинается с положения 26 и заканчивается перед положением 36. Данное определение в основе является сочетанием CDR H1, которые по разному определяются у Кабата и Хотиа.

Согласно одному варианту реализации VL в антителе scFv, связывающемся с несколькими антигенами, согласно настоящему изобретению содержит последовательность, которая по меньшей мере на 65% идентична, более предпочтительно по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98%, более предпочтительно на 99% идентична следующей последовательности (SEQ ID №: 5):

EIVMTQSPSTLSASVGDRVIITC (X)n=1-50 WYQQKPGRAPKLLIY (X)n=1-50

GVPSRFSGSGSGAEFTLTISSLQPDDFATYYC(X)n=1-50 FGQGTKLTVLG

Согласно другому варианту реализации VH антитела scFv, связывающегося с несколькими антигенами, согласно настоящему изобретению содержит последовательность, которая по меньшей мере на 80% идентична, более предпочтительно по меньшей мере на 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, более предпочтительно на 99% идентична следующей последовательности (SEQ ID №: 6):

ΕVQLVESGGGLVQPGGSLRLSCTAS (X)n=1-50 WVRQAPGKGLEWVG (X)n=1-50

RFTISRDTSKNTVYLQMNSLRAEDTAVYYCAR (X)n=1-50 WGQGTLVTVSS

В настоящей заявке под Х-остатками понимают сайты встраивания CDR. X может быть существующей в природе аминокислотой; по меньшей мере могут присутствовать три и до 50 аминокислот. Подразумевается, что каркасные последовательности SEQ ID №: 5 и SEQ ID №: 6 - это последовательности без Х-остатков.

Подходящие каркасные области антител, применимые для антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению включают без ограничений: вариабельную область легкой цепи человека из семейства Vkappal, вариабельную область легкой цепи человека из семейства Vlambda 1, вариабельную область легкой цепи человека из семейства Vkappa3, вариабельную область тяжелой цепи человека из семейства VH3, вариабельную область тяжелой цепи человека из семейства VH1a и вариабельную область тяжелой цепи человека из семейства VH1b, причем указанная вариабельная область легкой цепи содержит или разработана так, чтобы содержать (например, путем замены существующей в природе аминокислоты) аргинин в положении АНо 47 и/или 50, а указанная вариабельная область тяжелой цепи содержит или разработана так, чтобы содержать (например, путем замены существующей в природе аминокислоты) серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144.

Неограничивающие примеры каркасных областей, которые можно применять для генерирования антитела, связывающегося с несколькими антигенами, согласно настоящему изобретению, включают каркасные области, раскрываемые в международной заявке на патент WO 2008/004834, международной заявке на патент WO 2009/155726 и в международной заявке на патент WO 03/097697, полное содержание которых включено в настоящую заявку посредством ссылки. В таких примерах вариабельная область легкой цепи может быть модифицирована с включением аргинина в положении АНо 47 и/или 50, а вариабельная область тяжелой цепи может быть модифицирована с включением серина в положении АНо 12, серина или треонина в положении АНо 103, и/или серина или треонина в положении АНо 144.

В настоящей заявке термин «каркасная область антитела» или «каркасная область» относится к части вариабельного домена, VL или VH, которые служат каркасом для антиген-связывающих петель (CDR) данного вариабельного домена. По существу это вариабельный домен без CDR.

В настоящей заявке термин «идентичность» относится к соответствию последовательностей двух полипептидов, молекул или нуклеиновых кислот. Когда определенное положение в обеих из двух сравниваемых последовательностей занято мономером одного и того же основания или аминокислоты (например, если положение в двух молекулах ДНК занято аденином или положение в каждом из двух полипептидов занято лизином), то соответствующие молекулы идентичны по данному положению. «Процент идентичности» между двумя последовательностями является функцией числа соответствующих положений, общих для двух последовательностей, разделенного на число сравниваемых положений ×100. Например, если 6 из 10 положений в двух последовательностях соответствуют друг другу, то такие две последовательности обладают идентичностью 60%. В качестве примера последовательности ДНК CTGACT и CAGGTT идентичны на 50% (3 из полных 6 положений соответствуют друг другу). Как правило, сравнение проводят, когда две последовательности выровнены для получения максимальной идентичности. Такого выравнивания можно достичь, например, при помощи способа Needleman et al. (1970) J. Mol. Biol. 48: 443-453, который традиционно реализуется при помощи компьютерных программ, таких как программа Align («DNAstar, Inc.»). Процент идентичности между двумя последовательностями аминокислот также можно определять при помощи алгоритма Е. Meyers и W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)), который был включен в программу ALIGN (версия 2.0), при помощи таблицы весов остатков РАМ120, штрафа за удлинение разрыва 12 и штрафа за разрыв 4. Кроме того, процент идентичности между двумя последовательностями аминокислот можно определять при помощи алгоритма Needleman и Wunsch (J. Mol. Biol. 48:444-453 (1970)), который был включен программу GAP в программный пакет GCG (доступен на сайте www.gcg.com), с применением либо матрицы Blossum 62, либо матрицы РАМ250, штрафа за разрыв 16, 14, 12, 10, 8, 6 или 4 и штрафа за удлинение разрыва 1, 2, 3, 4, 5 или 6.

Согласно одному варианту реализации антитело, связывающееся с несколькими антигенами, согласно настоящему изобретению содержит CDR зайцеобразных и один или более вариабельных доменов тяжелой цепи, которые содержат три, четыре, пять, шесть или семь из следующих остатков: треонин (Т) в положении АНо 24, валин (V) в положении АНо 25, аланин (A) or глицин (G) в положении АНо 56, лизин (К) в положении АНо 82, треонин (Т) в положении АНо 84, валин (V) в положении АНо 89 и аргинин (R) в положении АНо 108.

Согласно другому варианту реализации антитело, связывающееся с несколькими антигенами, согласно настоящему изобретению содержит CDR зайцеобразных и глутаминовую кислоту (Е) в положении АНо 1, валин (V) в положении АНо 3, лейцин (L) в положении АНо 4, серии (S) в положении АНо 10; аргинин (R) в положении АНо 47, серии (S) в положении АНо 57, фенилаланин (F) в положении АНо 91 и/или Валин (V) в положении АНо 103 по меньшей мере в одном из вариабельных доменов легкой цепи.

Молекулы нуклеиновых кислот и векторы

Согласно одному варианту реализации настоящее изобретение включает молекулы нуклеиновых кислот для получения антитела scFv, связывающегося с несколькими антигенами, согласно настоящему изобретению.

Термин «молекула нуклеиновой кислоты» относится к молекулам ДНК или молекулам РНК. Молекула нуклеиновой кислоты может быть одноцепочечной или двухцепочечной, но предпочтительно является двухцепочечной ДНК. Нуклеиновая кислота функционально связана, когда она находится в функциональной взаимосвязи с другой последовательностью нуклеиновой кислоты. Например, промотор или энхансер является функционально связанным с кодирующей последовательностью, если он влияет на транскрипцию указанной последовательности. Согласно определенным вариантам реализации настоящего изобретения предложены молекулы нуклеиновых кислот, которые кодируют антитело согласно настоящему изобретению, вариабельный домен легкой цепи согласно настоящему изобретению, и/или вариабельный домен тяжелой цепи согласно настоящему изобретению.

Согласно одному варианту реализации молекула нуклеиновой кислоты согласно настоящему изобретению кодирует одну или более конструкций VH/VL, описанных выше. Например, молекула нуклеиновой кислоты согласно настоящему изобретению кодирует конструкцию VH/VL в одной из следующих форм: VH-А-(линкер 1 или 2)-VL-B; VH-В-(линкер 1 или 2)-VL-A; VH-А-(линкер-1)-VL-В-(линкер 3)-VH-В-(линкер 2)-VL-A; VH-А-(линкер 1 или 2)-VL-A; VH-В-(линкер 1 или 2)-VL-B; VH-А-(линкер-1)-VL-А-(линкер 3)-VH-В-(линкер 2)-VL-B; VL-А-(линкер 1 или 2)-VH-B, VL-В-(линкер 1 или 2)-VH-A; VL-А-(линкер-1)-VH-В-(линкер 3)-VL-В-(линкер 2)-VH-A; VL-А-(линкер 1 или 2)-VH-A, VL-В-(линкер 1 или 2)-VH-B; VL-А-(линкер-1)-VH-А-(линкер 3)-VL-В-(линкер 2)-VH-B; или в любой другой ориентации, предусматриваемой специалистами в данной области техники.

Согласно другому варианту реализации настоящее изобретение включает вектор, содержащий молекулу нуклеиновой кислоты согласно настоящему изобретению.

Термин «вектор» относится к молекуле нуклеиновой кислоты, способной транспортировать другую нуклеиновую кислоту, с которой она была связана. Одним типом вектора является «плазмида» - термин, который относится к кольцевой двухцепочечной петле ДНК, в которую можно вшивать дополнительные сегменты ДНК. Другим типом вектора является вирусный вектор, в котором дополнительные сегменты ДНК можно вшивать в геном вируса. Определенные векторы способны к автономной репликации в клетке-хозяине, в которую они были введены (например, бактериальные векторы, обладающие репликацией бактериального происхождения, и эписомные векторы млекопитающих). Другие векторы (например, неэписомные векторы млекопитающих) могут интегрироваться в геном клеток-хозяев при введении в клетку-хозяин, и, как следствие, они реплицируются вместе с геномом хозяина. Такие векторы экспрессии и способы выделения продуктов экспрессии в целом известны специалистам в данной области техники и описаны, например, в Sambrook J. et al., Molecular Cloning, A Laboratory Handbook 2nd Ed., Cold Spring Harbor Laboratory Press, 1989.

Термин «клетка-хозяин» относится к клетке, в которую можно вводить вектор экспрессии. Клетки-хозяева могут включать клетки бактерий, микроорганизмов, растений или животных. Бактерии, которые восприимчивы к трансформации, включают членов энтеробактерий, таких как штаммы Escherichia coli или сальмонелла; палочки, такие как Bacillus subtilis; пневмококки; стрептококки и Haemophilus influenzae. Подходящие микроорганизмы включают Saccharomyces cerevisiae и Pichia pastoris. Подходящие линии клеток-хозяев животных включают клетки СНО (линии клеток яичника китайского хомячка) и NS0.

Описаны определенные способы получения антител, которые связываются с несколькими антигенами, например, в Патенте США №7838637 и Патенте США №7129330, полное содержание которых в явном виде включено посредством ссылки.

Антитела согласно настоящему изобретению можно получить при помощи стандартных технологий в области рекомбинантной генетики. Если знать последовательности полипептидов, кДНК, кодирующие их, можно получить путем синтеза генов при помощи способов, хорошо известных в технике. Указанные кДНК можно клонировать в подходящие векторы на основе плазмиды.

Следует понимать, что антитела согласно настоящему изобретению включают раскрываемые последовательности, а не состоят из них. Например, стратегии клонирования могут требовать, чтобы была создана конструкция, в которой присутствует антитело с одним или несколькими дополнительными остатками на Ν-конце. Более конкретно, метионин, полученный с инициирующего кодона, может присутствовать в конечном белке в тех случаях, когда после трансляции он не отщепился. Большинство конструкций для антител scFv содержат дополнительный аланин на Ν-конце.

Фармацевтические композиции

Согласно определенным вариантам реализации настоящего изобретения предложены фармацевтические композиции, содержащие одно или более антител, связывающихся с несколькими антигенами согласно настоящему изобретению, вместе по меньшей мере с одной физиологически приемлемой основой или вспомогательным веществом. Фармацевтические композиции могут содержать, например, один или более из следующих компонентов: вода, буферы (например, нейтральный буферный физиологический раствор или фосфатно-солевой буфер), этанол, минеральное масло, растительное масло, диметилсульфоксид, углеводы (например, глюкозу, маннозу, сахарозу или декстраны), маннитол, белки, адъюванты, полипептиды или аминокислоты, такие как глицин, антиоксиданты, хелатирующие агенты, такие как EDTA или глутатион, и/или консерванты.

Основой является вещество, которое может быть связано с антителом до введения пациенту, часто в целях контроля стабильности или биодоступности соединения. Основы для применения в таких лекарственных формах обычно биосовместимы, и также могут быть биоразрушаемыми. Основы, например, включают, одновалентные или мультивалентные молекулы, такие как сывороточный альбумин (например, человека или быка), яичный альбумин, пептиды, полилизин и полисахариды, такие как аминодекстран и полиамидоамины. Также основы включают материалы твердых подложек, такие как сферы и микрочастицы, содержащие, например, полилактат полигликолят, поли(лактид-ко-гликолид), полиакрилат, латекс, крахмал, целлюлозу или декстран. Основа может переносить соединения разными способами, включая ковалентное связывание (либо прямое, либо через линкерную группу), нековалентное взаимодействие или их смесь.

Фармацевтические композиции могут быть составлены для любого подходящего пути введения, включая, например, глазной, интраназальный, ушной, сублингвальный, чрескожный, местный, оральный, назальный, ректальный или парентеральный путь введения. Согласно определенным вариантам реализации предпочтительны композиции в форме, применимой для орального применения. Такие формы, например, включают пилюли, таблетки, пастилки, таблетки для рассасывания, водные и масляные суспензии, диспергируемые порошки или гранулы, эмульсии, твердые или мягкие капсулы или сиропы, или эликсиры. Согласно некоторым другим вариантам реализации композиции, предложенные в настоящей заявке, могут быть составлены в форме лиофилизата. В настоящей заявке термин «парентеральный» включает подкожный, внутрикожный, внутрисосудистый (например, внутривенный), внутримышечный, спинномозговой, внутричерепной, интратекальный и внутрибрюшинный тип инъекций, а также любой похожий тип инъекций или инфузий.

Согласно определенным вариантам реализации антитело согласно настоящему изобретению можно доставлять непосредственно в глаз путем инъекции в ткани глаза, такой как окологлазничная, конъюнктивальная, субтеноновая, внутрикамерная, интравитреальная, субретинальная, субконъюнктивальная, ретробульбарная или внутриканальная инъекции; путем прямого нанесения в глаз при помощи катетера или другого устройства для нанесения, такого как ретинальные гранулы, внутриглазные вкладыши, суппозитории или имплантаты, содержащие пористый, непористый или гелеобразный материал; путем местного нанесения глазных капель или мазей; или устройства замедленного высвобождения в своде конъюнктивы или имплантируемое рядом со склерой (транссклеральное введение), или в склеру (чрезсклеральное введение) или в глаз. Внутрикамерную инъекцию можно проводить через роговицу в переднюю камеру, чтобы агент мог достичь трабекулярной сети. Внутриканальную инъекцию можно проводить в венозные коллекторные канальцы, которые собирают кровь из канала Шлемма или вливаются в канал Шлемма.

Для доставки к тканям глаза антитело согласно настоящему изобретению соединяют с офтальмологически приемлемыми консервантами, сопутствующими растворителями, поверхностно-активными веществами, загустителями, веществами, способствующими проникновению, буферами, хлоридом натрия или водой для образования водной, стерильной офтальмологической суспензии или раствора. Препараты для местного офтальмологического применения можно упаковывать, например, в виде лекарственной формы для многократного дозирования. Таким образом, могут потребоваться консерванты для предотвращения микробного заражения во время применения. Подходящие консерванты включают: хлорбутанол, метилпарабен, пропилпарабен, фенилэтиловый спирт, двунатриевый эдетат, сорбиновую кислоту, поликватерниум-1 и другие агенты, известные специалистам в данной области техники. Такие консерванты, как правило, применяют в количестве от 0,001 до 1,0% объем/масса. Композиции для одноразового дозирования согласно настоящему изобретению должны быть стерильны, но обычно без консервантов. Следовательно, такие композиции, как правило, не содержат консервантов.

Согласно определенным вариантам реализации композиции, предназначенные для местного введения в ткани глаза, составляют в форме глазных капель или мазей, причем общее содержание антитела может быть приблизительно 0,001-1,0% (массовые проценты), предпочтительно приблизительно от 0,01 до приблизительно 1,0% (массовые проценты).

Фармацевтические композиции согласно настоящему изобретению в определенных обстоятельствах можно вводить в форме растворов для местного применения. Как правило, предпочтительны водные растворы, вследствие простоты такой лекарственной формы, а также вследствие возможности простого введения таких композиций пациентом путем нанесения одной или двух капель раствора в больной глаз. Однако указанные композиции могут также быть суспензиями, вязкими или полувязкими гелями или другими типами твердых или полужидких композиций.

Фармацевтические композиции, предназначенные для орального применения, можно получить в соответствии с любым из способов, известных специалистам в данной области техники, подходящих для производства фармацевтических композиций, и могут содержать один или более агентов, таких как подсластители, ароматизаторы, красители и консерванты, с целью получения привлекательных и приятных на вкус препаратов. Таблетки содержат активный ингредиент в смеси с физиологически приемлемыми вспомогательными веществами, которые подходят для производства таблеток. Такие вспомогательные вещества, например, включают инертные растворители (например, карбонат кальция, карбонат натрия, лактозу, фосфат кальция или фосфат натрия), гранулирующие вещества и разрыхлители (например, кукурузный крахмал или альгиновую кислоту), связующие вещества (например, крахмал, желатин или аравийскую камедь) и смазывающие вещества (например, стеарат магния, стеариновая кислота или тальк). Таблетки могут быть без покрытия, или они могут быть покрыты при помощи известных технологий для замедления распада и всасывания в желудочно-кишечном тракте, что позволяет достичь замедленного действия в течение более длительного времени. Например, можно применять вещество для замедленного действия, такое как глицерил моностеарат или глицерил дистеарат.

Масляные суспензии можно составить путем суспендирования активных ингредиентов в растительном масле (например, арахисовом масле, оливковом масле, кунжутном масле или кокосовом масле) или в минеральном масле, таком как жидкий парафин. Масляные суспензии могут содержать загуститель, такой как пчелиный воск, твердый парафин или цетиловый спирт. Можно добавлять подсластители, такие как упоминались выше, и/или ароматизаторы, для получения приятных на вкус препаратов для орального введения. Такие суспензии можно готовить для длительного хранения путем добавления антиоксиданта, такого как аскорбиновая кислота.

Диспергируемые порошки и гранулы, пригодные для приготовления водных суспензий путем добавления воды, позволяют получить активный ингредиент в смеси с диспергирующим или смачивающим веществом, суспендирующим агентом и одним или более консервантами. Примеры подходящих диспергирующих или смачивающих веществ и суспендирующих агентов уже упоминались выше. Также могут присутствовать дополнительные вспомогательные вещества, например, подсластители, ароматизаторы и красители.

Также фармацевтические композиции могут быть в форме эмульсий типа «масло-в-воде». Масляной фазой может быть растительное масло (например, оливковое или арахисовое масло), минеральное масло (например, жидкий парафин) или их смесь. Подходящие эмульгирующие агенты включают существующие в природе камеди (например, аравийская камедь или трагакантовая камедь), существующие в природе фосфатиды (например, соевые бобы, лецитин и эфиры или частичные эфиры, полученные из жирных кислот и гекситола), ангидриды (например, сорбитан моноолеат) и продукты конденсации частичных эфиров, полученных из жирных кислот и гекситола с этиленоксидом (например, полиоксиэтилен сорбитан моноолеат). Также эмульсия может содержать один или более подсластителей и/или ароматизаторов.

Указанную фармацевтическую композицию можно получить в форме стерильной водной или масляной суспензии для инъекций, в которой модулятор, в зависимости от применяемой основы и концентрации, либо суспендирован, либо растворен в основе. Такую композицию можно составить в соответствии со способами, известными в технике, с применением подходящих диспергирующих, смачивающих агентов и/или суспендирующих агентов, таких как упоминались выше. Среди приемлемых основ и растворителей, которые можно применять, можно назвать воду, 1,3-бутандиол, раствор Рингера и изотонический раствор хлорида натрия. Кроме того, в качестве растворителя или суспендирующей среды можно применять стерильные, фиксированные масла. Для данной цели можно применять масла с мягкой фиксацией, включая синтетические моно- или диглицериды. Кроме того, при приготовлении композиций для инъекций можно применять жирные кислоты, такие как олеиновая кислота, и в указанной основе можно растворять адъюванты. такие как местные анестетики, консерванты и/или буферные агенты.

Фармацевтические композиции можно составлять в виде лекарственных форм с замедленным высвобождением (т.е., такая лекарственная форма, как капсула, которая вызывает медленно высвобождение модулятора после введения). Такие лекарственные формы можно, как правило, получить при помощи хорошо известной технологии и вводить, например, оральным, ректальным путем или посредством подкожных имплантатов, или путем имплантации в желаемый целевой участок. Носители для применения таких лекарственных форм должны быть биосовместимы, и также могут быть биоразрушаемыми; предпочтительно такая лекарственная форма обеспечивает относительно постоянный уровень высвобождения модулятора. Количество антитела, содержащегося в лекарственной форме с замедленным высвобождением, зависит, например, от участка имплантации, скорости и ожидаемой продолжительности высвобождения и природы заболевания/расстройства, которое требуется лечить или предотвратить.

Фармацевтические композиции, предложенные в настоящей заявке, предпочтительно вводят в таком количестве, чтобы достичь концентрации в жидких средах организма (например, крови, плазме, сыворотке, СМЖ (спинномозговой жидкости), синовиальной жидкости, лимфе, межклеточной жидкости, слезной жидкости или моче), которая достаточна для определимого связывания с молекулой(ами)-мишенью и для предотвращения или подавления заболеваний/расстройств, ассоциированных с молекулой(ами)-мишенью. Доза считается эффективной, если она приводит к заметной пользе для пациента.

Соответствующая дозировка («терапевтически эффективное количество») антитела согласно настоящему изобретению будет зависеть, например, от патологического состояния, которое требуется лечить, тяжести и течения указанного состояния, вводится антитело в целях профилактики или лечения, предшествующей терапии, анамнеза пациента и реакции на указанное антитело, типа применяемого антитела и решения лечащего врача. Указанное антитело подходит для введения пациенту за один раз или в несколько лечебных подходов, и его можно вводить пациенту в любое время с момента диагностики и далее. Указанное антитело можно вводить как единственное средство лечения или в сочетании с другими лекарственными препаратами или средствами, применимыми при лечении рассматриваемого патологического состояния.

В качестве общей нормы терапевтически эффективное количество вводимого антитела может варьировать в диапазоне от приблизительно 0,1 до приблизительно 100 мг/кг массы тела пациента, либо в один этап, либо в несколько этапов введения, причем типичный диапазон количества применяемого антитела составляет от приблизительно 0,3 до приблизительно 20 мг/кг, более предпочтительно от приблизительно 0,3 до приблизительно 15 мг/кг, вводимых, например, раз в день. Однако могут быть применимы другие режимы дозирования. Успешность такой терапии можно четко отслеживать при помощи традиционных способов.

Согласно другому варианту реализации настоящего изобретения предложено готовое изделие, включающее контейнер, который содержит водные лекарственные формы фармацевтической композиции согласно настоящему изобретению и не обязательно включает инструкцию по ее применению. Подходящие контейнеры включают, например, бутыли, флаконы и шприцы. Указанный контейнер может быть выполнен из разных материалов, таких как стекло или пластик. Пример контейнера включает стеклянный одноразовый флакон 3-20 см3. В качестве альтернативы, для лекарственной формы для многократного дозирования контейнером может быть стеклянный флакон 3-100 см3. Указанный контейнер содержит лекарственную форму и этикетку на нем или ассоциированную с контейнером, где может быть приведена инструкция по применению. Указанное готовое изделие также может включать другие материалы, желательные с коммерческой точки зрения или точки зрения пользователя, включая другие буферы, фильтры, иглы, шприцы и листок-вкладыш с инструкцией по применению.

Согласно определенным вариантам реализации настоящего изобретения предложены:

1. Молекула антитела, связывающегося с несколькими антигенами, содержащая:

a) вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-А), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 1, и вместе они образуют конструкцию VH-A/VL-B;

b) вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-В), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 2, и вместе они образуют конструкцию VH-B/VL-A;

причем указанное антитело, связывающееся с несколькими антигенами, лишено константных доменов, и по меньшей мере один из VL-A и VL-B содержит аргинин в положении АНо 50, и/или по меньшей мере один из VH-A и VH-B содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144.

2. Антитело, связывающееся с несколькими антигенами, по п.1, отличающееся тем, что по меньшей мере один из VL-A и VL-B содержит каркасную последовательность, которая по меньшей мере на 65% идентична последовательности SEQ ID №: 5.

3. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что по меньшей мере один из VH-A и VH-B содержит каркасную последовательность, которая по меньшей мере на 80% идентична последовательности SEQ ID №: 6.

4. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что по меньшей мере одна из указанных конструкций VL-A/VH-B и указанных конструкций VH-B/VL-A содержит вариабельную область легкой цепи человека из семейства Vkappal, вариабельную область легкой цепи человека из семейства Vlambda 1 или вариабельную область легкой цепи человека из семейства Vkappa3.

5. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что по меньшей мере одна из конструкций VL-A/VH-B и VH-B/VL-A содержит вариабельную область тяжелой цепи человека из семейства VH3, вариабельную область тяжелой цепи человека из семейства VH1a или вариабельную область тяжелой цепи человека из семейства VH1b.

6. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что указанные домены VH и указанные домены VL содержат CDR из антител зайцеобразных.

7. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что VH-A и/или VH-B содержит серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144.

8. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что аргинин в положении АНо 50 VL-A и/или VL-B вводят посредством замены.

9. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что по меньшей мере один из перечисленных остатков - серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144 VH-A и/или VH-B вводят посредством замены.

10. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что и пептидный линкер 1, и пептидный линкер 2 обладают длиной 1-10 аминокислот.

11. Антитело, связывающееся с несколькими антигенами, по п. 1, дополнительно содержащее пептидный линкер 3, который связывает конструкцию VH-A/VL-B с конструкцией VH-B/VL-A, причем указанный пептидный линкер 3 содержит 10-30 аминокислот.

12. Антитело, связывающееся с несколькими антигенами, по п. 11, отличающееся тем, что и пептидный линкер 1, и пептидный линкер 2 содержат 3-7 аминокислот, а пептидный линкер 3 содержит 15-20 аминокислот.

13. Антитело, связывающееся с несколькими антигенами, по п. 12, отличающееся тем, что и пептидный линкер 1, и пептидный линкер 2 содержат 5 аминокислот, а пептидный линкер 3 содержит 20 аминокислот.

14. Антитело, связывающееся с несколькими антигенами, по п. 13, отличающееся тем, что пептидный линкер 1 содержит последовательность GGGGS (SEQ ID №: 1), пептидный линкер 2 содержит последовательность GGGGS (SEQ ID №: 1), а пептидный линкер 3 содержит последовательность (GGGGS)4 (SEQ ID №: 4).

15. Антитело, связывающееся с несколькими антигенами, по п. 14, в форме VH-A-SEQ ID №: 1-VL-B-SEQ ID №: 4-VH-B-SEQ ID №: 1-VL-A.

16. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что указанное антитело является бивалентным.

17. Антитело, связывающееся с несколькими антигенами, по п. 1, отличающееся тем, что указанное антитело является биспецифическим.

18. Фармацевтическая композиция, содержащая антитело, связывающееся с несколькими антигенами, по п. 1.

19. Применение антитела, связывающегося с несколькими антигенами, по п. 1 для диагностики и/или лечения заболевания.

20. Молекула нуклеиновой кислоты, кодирующая конструкцию VH-A/VL-B и/или конструкцию VH-B/VL-A по п. 1.

21. Вектор, содержащий молекулу нуклеиновой кислоты по п. 20.

22. Изолированная клетка-хозяин, содержащая вектор по п. 21.

23. Молекула нуклеиновой кислоты, кодирующая антитело по п. 11.

24. Вектор, содержащий молекулу нуклеиновой кислоты по п. 23.

25. Изолированная клетка-хозяин, содержащая вектор по п. 24.

26. Антитело, связывающееся с несколькими антигенами, содержащее:

a) одноцепочечное антитело, содержащее вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-A), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 3, и вместе они образуют scFv-A;

b) одноцепочечное антитело, содержащее вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-B), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 3, и вместе они образуют scFv-B;

отличающееся тем, что scFv-A соединен с scFv-B пептидным линкером 1, и по меньшей мере один из VL-A и VL-B содержит аргинин в положении АНо 50, и по меньшей мере один из VH-A и VH-B содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103, и серии или треонин в положении АНо 144.

27. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что VH-A и/или VH-B содержит серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144.

28. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что аргинин в положении АНо 50 VL-A и/или VL-B вводят посредством замены.

29. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что по меньшей мере один из перечисленных остатков: серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144 of VH-A и/или VH-B вводят посредством замены.

30. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что пептидный линкер 1 содержит 1-10 аминокислот.

31. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что пептидный линкер 3 содержит 10-30 аминокислот.

32. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что пептидный линкер 1 содержит 3-7 аминокислот, а пептидный линкер 3 содержит 15-20 аминокислот.

33. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что пептидный линкер 1 содержит 5 аминокислот, а пептидный линкер 3 содержит 15 аминокислот.

34. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что по меньшей мере один из VL-A или VL-B содержит каркасную последовательность, которая по меньшей мере на 65% идентична последовательности SEQ ID №: 6.

35. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что по меньшей мере один из VH-A или VH-B содержит каркасную последовательность, которая по меньшей мере на 80% идентична последовательности SEQ ID №: 7.

36. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что по меньшей мере один из scFv-A и scFv-B содержит вариабельную область легкой цепи человека из семейства Vkappal, вариабельную область легкой цепи человека из семейства Vlambda 1 или вариабельную область легкой цепи человека из семейства Vkappa3.

37. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что по меньшей мере один из scFv-A и scFv-B содержит вариабельную область тяжелой цепи человека из семейства VH3, вариабельную область тяжелой цепи человека из семейства VH1a или вариабельную область тяжелой цепи человека из семейства VH1b.

38. Антитело, связывающееся с несколькими антигенами, по п. 26, отличающееся тем, что указанные домены VH и указанные домены VL содержат CDR из антител зайцеобразных.

39. Молекула антитела, связывающегося с несколькими антигенами, содержащая:

a) CDR из антител зайцеобразных;

b) вариабельный домен тяжелой цепи со специфичностью к антигену A (VH-А), связанный с вариабельным доменом легкой цепи со специфичностью к антигену В (VL-B) пептидным линкером 1, и вместе они образуют конструкцию VH-A/VL-B;

c) вариабельный домен тяжелой цепи со специфичностью к антигену В (VH-В), связанный с вариабельным доменом легкой цепи со специфичностью к антигену A (VL-A) пептидным линкером 2, и вместе они образуют конструкцию VH-B/VL-A; и

d) пептидный линкер 3, содержащий 10-30 аминокислот, связывающий конструкцию VH-A/VL-B с конструкцией VH-B/VL-A;

отличающаяся тем, что по меньшей мере один из указанных вариабельных доменов тяжелой цепи содержит по меньшей мере три из следующих остатков: треонин (Τ) в положении АНо 24, валин (V) в положении АНо 25, аланин (A) or глицин (G) в положении АНо 56, лизин (К) в положении АНо 82, треонин (Т) в положении АНо 84, валин (V) в положении АНо 89 и аргинин (R) в положении АНо 108, а также пептидный линкер 1 и пептидный линкер 2, каждый из которых содержит 1-10 аминокислот.

40. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что по меньшей мере один из VL-A и VL-B содержит каркасную последовательность, которая по меньшей мере на 85% идентична последовательности SEQ ID №: 5.

41. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что по меньшей мере один из VH-A и VH-B содержит каркасную последовательность, которая по меньшей мере на 90% идентична последовательности SEQ ID №:6.

42. Антитело, связывающееся с несколькими антигенами, по п. 39, дополнительно содержащее глутаминовую кислоту (Е) в положении АНо 1, валин (V) в положении АНо 3, лейцин (L) в положении АНо 4, серии (S) в положении АНо 10; аргинин (R) в положении АНо 47, серии (S) в положении АНо 57, фенилаланин (F) в положении АНо 91 и/или валин (V) в положении АНо 103 по меньшей мере один в одном из вариабельных доменов легкой цепи.

43. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что по меньшей мере один из вариабельных доменов тяжелой цепи содержит по меньшей мере один из следующих остатков: серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144.

44. Антитело, связывающееся с несколькими антигенами, по п. 43, отличающееся тем, что по меньшей мере один перечисленных остатков: серии в положении АНо 12, серии или треонин в положении АНо 103 и серии или треонин в положении АНо 144 VH-A и/или VH-B вводят посредством замены.

45. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что и пептидный линкер 1, и пептидный линкер 2 содержат по 5 аминокислот.

46. Антитело, связывающееся с несколькими антигенами, по п. 45, отличающееся тем, что пептидный линкер 3 содержит 15-20 аминокислот.

47. Антитело, связывающееся с несколькими антигенами, по п. 46, отличающееся тем, что пептидный линкер 1 содержит последовательность GGGGS (SEQ ID №: 1), пептидный линкер 2 содержит последовательность GGGGS (SEQ ID №: 1), а пептидный линкер 3 содержит последовательность (GGGGS)4 (SEQ ID №: 4).

48. Антитело, связывающееся с несколькими антигенами, по п. 47 в форме VH-A-SEQ ID №: 1-VL-B-SEQ ID №: 4-VH-B-SEQ ID №: 1-VL-A.

49. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что указанное антитело является бивалентным.

50. Антитело, связывающееся с несколькими антигенами, по п. 39, отличающееся тем, что указанное антитело является биспецифическим.

51. Фармацевтическая композиция, содержащая антитело, связывающееся с несколькими антигенами, по п. 39.

52. Применение антитела, связывающегося с несколькими антигенами, по п. 39 для диагностики и/или лечения заболевания.

53. Молекула нуклеиновой кислоты, кодирующая конструкцию VH-A/VL-B и/или конструкцию VH-B/VL-A по п. 39.

54. Вектор, содержащий молекулу нуклеиновой кислоты по п. 53.

55. Изолированная клетка-хозяин, содержащая вектор по п. 54.

Содержание патентов, заявок на патенты и литературных источников, цитируемых на протяжении настоящего описания, включены в нее посредством ссылки на их полную версию.

Если контекст не требует иного, термины в единственном числе в настоящей заявке включают множества, а термины во множественном числе должны включать единственное число.

ПРИМЕРЫ

Настоящее раскрытие позволяют более подробно проиллюстрировать следующие примеры, которые не должны рассматриваться как дополнительное ограничение. Содержание всех фигур и всех ссылок, патентов и опубликованных заявок на патенты, цитируемых в данной заявке, в явном виде включены в настоящую заявку посредством ссылки на их полную версию.

Пример 1

Молекулярное проектирование, клонирование и экспрессия биспецифических и бивалентных антител, полученных из антител кролика.

Последовательности ДНК, кодирующие биспецифические и бивалентные антитела, генерировали посредством синтеза олигонуклеотидов на основании цифровых генетических последовательностей и последующего отжига полученных фрагментов с применением технологий расширенного перекрывания. Все последовательности оптимизировали для применения кодона Е. coli, по содержанию GC, вторичной структуре мРНК, по повторам кодонов и мотивов и по сайтам рестрикции. Для соединения гуманизированных доменов VL и доменов VH из антитела кролика с разной специфичностью применяли линкеры из аминокислот, см. Таблицу 1.

Таблица 1
Линкер 1 и 2
3аа GGS
5аа GGGGS (SEQ ID №: 1)
7аа GGGGGGS (SEQ ID №: 2)
Линкер 3
15аа GSDSNAGRASAGNTS (SEQ ID №: 3)
20аа (GGGGS)4 (SEQ ID №: 4)

Молекулы антител, связывающихся с несколькими антигенами, получали таким образом, чтобы они биспецифически и бивалентно связывались с молекулами-мишенями. Все молекулы клонировали в векторы экспрессии для стойкой экспрессии в E.coli, которые содержали промотор T7lac, сайт связывания рибосом бактерий, а затем -молекулу антитела. Ε. coli BL21(DE3), трансформированную соответствующими плазмидами экспрессии на основе внутриклеточных телец, выращивали при 37°С в среде dYT, содержащей соответствующие антибиотики. Экспрессию белка инициировали путем добавления 1 мМ изопропил-1-тио-D-галактопиразина (конечная концентрация) при поглощении (А600) приблизительно 2,0. Через три часа после индукции клетки Е. coli собирали и разрушали путем воздействия ультразвука, и внутриклеточные тельца выделяли путем многократных этапов отмывки и центрифугирования.

Внутриклеточные тельца растворяли при концентрации 10 мг/мл в присутствии 6М Gdn-HCl и восстанавливали путем добавления 20 мМ дитиотреитола. Для выбора наилучшего значения рН, редокс-системы (цистин/цистеин) и концентраций солей из всего диапазона тестируемых условий проводили скрининг на основной рефолдинг. Для процесса рефолдинга в лабораторном масштабе применяли наилучшие условия для каждого конкретного антитела. Белки - биспецифические или бивалентные антитела ренатурировали путем быстрого разбавления в 50-кратном объеме буфера для рефолдинга. После повышения концентрации и диализа с ФСБ (фосфатно-солевым буфером), рН 6,0, белки очищали при помощи эксклюзионной хроматографии.

Пример 2

Генерирование бивалентных антител

Бивалентные антитела, связывающиеся с интерлейкином-23 (IL-23), генерировали на основе вариабельных доменов каркасной области rFW1.4 матрицы из антитела человека для прививки антител кролика (как раскрывается в международной заявке на патент №WO 2009/155726), и которая по существу совместима со всеми антителами кролика. Получали три формы, включая диатела, одноцепочечные антитела и тандемные одноцепочечные антитела. CDR брали из антитела, которое, как было показано, связывается с IL-23 человека. Диатела (Db) получали путем экспрессии двух фрагментов в форме VHA-линкер 1-VLB и VHB-линкер 2-VLA в одной и той же клетке, что приводило к образованию гетеродимеров, причем перед каждой из кодирующих последовательностей шел сайт связывания с рибосомами (RBS). В указанных молекулах линкеры 1 и 2 состояли из 5 аминокислот (GGGGS, SEQ ID №: 1). В соответствии с другой формой две полипептидных цепи соединяли дополнительным средним линкером (линкер 3), в результате получая один ген, кодирующий одноцепочечное антитело (scDb): VHA-линкер 1-VLB-линкер 3-VHB-линкер 2-VLA, причем линкер 3 состоял из 15 аминокислот (GSDSNAGRASAGNTS, SEQ ID №: 3) (Volkel et al., 2001, Protein Eng 14:815-823). Третья форма - тандемное scFv (TdscFv) получали путем соединения двух scFvs коротким средним линкером (GGGGS, SEQ ID №: 1) и длинным линкером 3 ((GGGGS)4, SEQ ID №: 4, в результате чего получали порядок доменов VL-A-линкер 3-VH-A-линкер 1-VL-В-линкер3-VH-В, и, таким образом, генерировали бивалентную молекулу, в которой VH-A и VH-B были идентичны, также как и VL-A и VL-B.

Эффекты разных особенностей на каркасные области, в форме scDb, оценивали с точки зрения продуктивности, стабильности и склонности к образованию олигомеров. Указанные формы описаны в Таблице 2. Если кратко, молекула №1 состояла из вариабельных доменов rFW1.4 в scDb без каких-либо дополнительных замен. Молекула №2 была вариантом молекулы №1, в котором аргинин в положении АНо 50 был введен в обоих доменах VL (VL-A/-B). Молекула №3 также была основана на молекуле №1, но содержала три замены, которые были введены в оба домена VH (VH-A/-B), а именно серии в положении АНо 12, треонин в положении АНо 103, и треонин в положении АНо 144. Молекула №14 состояла из молекулы №1 со следующими заменами: аргинин в положении АНо 50 в обоих доменах VL (VL- А/-В), и серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144 в обоих доменах VH (VH-A/-B). В целях сравнения генерировали дополнительное scDb (№5) с применением консенсусных последовательностей из репертуара антител человека эмбрионального типа (Knappik et al., 2000, J. Mol. Biol. 296:57-86). Каркасные области соответствуют консенсусной последовательности подтипов VH3 и VL каппа 1, обозначаемой HuCal. Указанное гуманизированное scDb генерировали с теми же CDR, которые применяли в других бивалентных scDb, описанных в настоящей заявке, и таким образом различия были локализованы только в каркасных областях.

Таблица 2
№1 rFW1.4
№2 rFW1.4, VL-A/-B: аргинин в положении АНо 50
№3 rFW1.4,VH-A/-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№4 rFWl.4, VL-A/-B: аргинин в положении АНо 50, серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№5 HuCal FW с привитыми CDR

Пример 3

Генерирование биспецифических антител

Биспецифические одноцепочечные диатела конструировали таким образом, чтобы в одной молекуле были заключены две разных специфичности. Домены VH и VL из двух разных антител scFv, первоначально сгенерированных путем гуманизации антител кролика к VEGF165 и TNFα, применяли в качестве исходного материала для генов вариабельных областей для конструирования единого фрагмента в форме VHA-линкер 1-VLB-линкер 3-VHB-линкер 2-VLA, где вариабельные домены, помеченные буквой А, связываются с VEGF165, а фрагменты, помеченные буквой В, связываются с TNFα. Антитело, связывающееся с VEGF165, обладает следующей последовательностью VL:

EIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSG

SGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLG, SEQ ID №: 7;

И следующей последовательностью VH:

EVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWA

KGRFΤISRDNSKNTLYLQMNSLRAEDTAVΥYCAGGDHNSGWGLDIWGQGTLVTVSS, SEQ ID №: 8.

Последовательность указанного домена VH, содержащего серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144, была следующей:

EVQLVESGGGSVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWA

KGRFTISRDNSKNTLYLQMNSLRAEDTATYYCAGGDHNSGWGLDIWGQGTTVTVSS, SEQ ID №: 9.

Антитело, связывающееся с TNFα, обладало следующей последовательностью VL:

EIVMTQSPSTLSASVGDRVIITCQSSQSVYGNIWMAWYQQKPGRAPKLLIYQASKLASGVPSRF

SGSGSGAEFTLTISSLQPDDFATYYCQGNFNTGDRYAFGQGTKLTVLG, SEQ ID №: 10;

И следующей последовательностью VH:

EVQLVESGGGSVQPGGSLRLSCTASGFTISRSYWICWVRQAPGKGLEWVGCIYGDNDITPLYAN

WAKGRFTISRDTSKNTVYLQMNSLRAEDTATYYCARLGYADYAYDLWGQGTTVTVSS, SEQ ID №: 11.

Биспецифические антитела разрабатывали и конструировали с применением стандартных способов манипуляции с ДНК, описанных в Примере 1. Эффекты разных особенностей каркаса, введенных в каркасные области, а также разных комбинаций линкеров оценивали у разных биспецифических scDb, описанных в Таблице 3.

Таблица 3
№6 FW1.4, линкер (5аа-15аа-5аа)
№7 rFW1.4, линкер (5аа-15аа-5аа)

№8 rFW1.4, линкер (5aa-15aa-5aa), VL-A: аргинин в положении АНо 50
№9 rFW1.4, линкер (5аа-15аа-5аа), VL-A: аргинин в положении АНо 50, VH-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№10 rFW1.4, линкер (5аа-15аа-5аа), VL-A: аргинин в положении АНо 50, VH-A/-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№11 rFW1.4, линкер (5аа-20аа-5аа), VL-A: аргинин в положении АНо 50, VH-A/-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№12 rFW1.4, линкер (7аа-20аа-7аа), VL-A: аргинин в положении АНо 50, VH-A/-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144
№13 rFW1.4, линкер (3аа-20аа-3аа), VL-A: аргинин в положении АНо 50, VH-A/-B: серии в положении АНо 12, треонин в положении АНо 103, треонин в положении АНо 144

Последовательность указанной экспрессируемой конструкции содержала сочетание линкеров 5-20-5 и серии в положении АНо 12, треонин в положении АНо 103 и треонин в положении АНо 144, была следующей:

MEVQLVESGGGSVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATW

AKGRFTISRDNSKNTLYLQMNSLRAEDTATYYCAGGDHNSGWGLDIWGQGTTVTVSSGGGGSEI VMTQSPSTLSASVGDRVIITCQSSQSVYGNIWMAWYQQKPGRAPKLLIYQASKLASGVPSRFSG SGSGAEFTLTISSLQPDDFATYYCQGNFNTGDRYAFGQGTKLTVLGGGGGSGGGGSGGGGSGGG GSEVQLVESGGGSVQPGGSLRLSCTASGFTISRSYWICWVRQAPGKGLEWVGCIYGDNDITPLY ANWAKGRFTISRDTSKNTVYLQMNSLRAEDTATYYCARLGYADYAYDLWGQGTTVTVSSGGGGS ΕΙVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSG SGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLG (SEQ ID №: 12).

Пример 4

Описание свойств биспецифических и бивалентных антител.

Продуктивность

Белки, экспрессируемые в нерастворимой форме, подвергали рефолдингу и очищали при помощи препаративной эксклюзионной высокоэффективной жидкостной хроматографии (Э-ВЭЖХ). Образующиеся в результате белки были охарактеризованы по выходу очищенного белка, в мг на литр питательной среды. Указанное значение давало характеристическую меру продуктивности для соответствующей молекулы. Чистоту определяли как содержание мономера, исключая растворимые агрегаты, образцов после очищения белка, подвергнутого рефолдингу. Чистоту определяли посредством препаративной эксклюзионной хроматографии. Пики мономеров и растворимые агрегаты отделяли от немономерных компонентов при помощи колонки TSKgel Super SW2000 («TOSOH Bioscience))). Процент мономерного белка рассчитывали как площадь пика мономера, деленную на общую площадь пиков всех продуктов.

Измерения термостабильности (FT-IR, DSC)

Молекулы концентрировали до уровня 3 мг/мл, и фильтрат собирали для измерений в пустой пробе. Для измерения термостабильности проводили FT-IR (инфракрасная спектроскопия с Фурье-преобразованием) для считывания и DSC (капиллярная дифференциальная сканирующая калориметрия). Спектры FT-IR получали при помощи кюветы FT-IR Bio-ATR (нарушенного полного отражения) в тензорном приборе Брюкера. Профили денатурации, демонстрирующие изменения во вторичной структуре, получали посредством термического воздействия на молекулы с градиентом температур с шагом 5°С (от 25°С до 95°С). Все манипуляции со спектрами проводили с применением программы OPUS. Нормировку проводили на временный (СО2 и Н2О) атмосферный фон и на пустые пробы. Полученные спектры белков затем корректировали на нулевую линию, и спектр амида белка I определяли на основании ширины самого широкого разрешаемого пика в ожидаемой области. Для спектра полосы амида I брали вторую производную с применением функции-многочлена третьей степени с функцией сглаживания. Изменения в структуре белка оценивали путем анализа второй производной спектра амида I с применением линейной калибровки для расчета формы начальной кривой, в предположении 0% денатурированных белков для измерений при 3 низких температурах, и 100% денатурированных белков для измерений при 3 самых высоких температурах. Профили денатурации применяли для приблизительной оценки средней точки температурного конформационного перехода в состояние без скрученности (Tm) для каждой вариации, с применением сигмовидной модели Больцмана. Измерения DSC также проводили для проб после температурного раскручивания. В дифференциальном сканирующем калориметре («MicroCal», капиллярный VP-DSC) применяли градиент температур 200°С/ч. Анализ данных проводили посредством эталонного снижения сигнала буфера и нормировки на соответствующую концентрацию белка в мкМ с последующей коррекцией на нулевую линию, все манипуляции проводили в программе MicroCal, прилагающейся к DSC. Tm показывала температуру, равную точке, в которой происходит наибольшее поглощение энергии, что соответствует температуре раскручивания.

Испытание краткосрочной стабильности

Белок оценивали перед инкубацией и после двухнедельной инкубации при 40°С на наличие растворимых агрегатов и продуктов распада. Белки концентрировали до следующих желаемых концентраций: 10 мг/мл, 20 мг/мл, 40 мг/мл и 60 мг/мл. В случае, когда белок не был достаточно растворим для достижения желаемой концентрации, анализировали максимально возможную концентрацию. Максимальная концентрация достигалась тогда, когда дальнейшее концентрирование приводило только к осаждению без повышения концентрации. Указанные образцы анализировали в день 0 и день 14. Анализ чистоты и возможное появление полос продуктов распада проводили в оба момента времени посредством электрофореза в полиакриламидном геле с 12,5% додецилсульфата натрия (SDS-PAGE). Растворимые олигомеры и агрегаты оценивали посредством эксклюзионной высокоэффективной жидкостной хроматографии (Э)-ВЭЖХ, до периода инкубации и после него. Мономеры отделяли от немономерных компонентов при помощи колонки TSKgel Super SW2000 («TOSOH Bioscience))), и процент мономерного белка рассчитывали как площадь пика мономера, деленную на общую площадь пиков всех продуктов. Общую концентрацию определяли путем измерения поглощения в УФ области на длине волны 280 нм, при помощи устройства для анализа нанокапель. Таким образом, данное испытание краткосрочной стабильности позволяло оценить такие свойства, как растворимость, стабильность, агрегацию и олигомеризацию.

Результаты

Бивалентные молекулы, связывающиеся с IL23:

Оценивали разные scFv-подобные формы, бивалентно связывающиеся с IL-23. Указанные молекулы содержали домены VH и VL, связывающиеся с IL-23, как описано в Примере 2, выше. Все молекулы были охарактеризованы по их свойствам продуктивности, термостабильности и краткосрочной стабильности, как описано в разделе «Методы».

Тестируемые формы, в частности, включали:

Молекула №14: диатело (Db): VHA-линкер 1-VLB и VHB-линкер 2-VLA; (линкер 1 и 2=SEQ ID №: 1);

Молекула №15: одноцепочечное диатело (scDb): VHA-линкер 1-VLB-линкер 3-VHB-линкер 2-VLA; (линкер 1 и 2=SEQ ID №: 1; линкер 3=SEQ ID №: 4);

Молекула №16: тандемное scFv (TdscFv): VLA-линкер 3-VHA-линкер 1-VLB-линкер 3-VHB; (линкер 3=SEQ ID №: 4; линкер 1=SEQ ID №: 1).

Во всех указанных формах VL-A и -В были идентичны, вследствие чего образовывалось бивалентное антитело, связывающееся с IL-23.

Продуктивность антител scDb и TdscFv в бактериальных системах часто ограничена их относительно низким выходом и склонностью к образованию агрегатов. Однако все оцениваемые формы эффективно вырабатывались при рефолдинге из очищенных внутриклеточных телец. Подвергнутые рефолдингу белки были главным образом мономерными после последующей очистки посредством препаративной эксклюзионной хроматографии, см. Таблицу 4. TdscFv №16 демонстрировало максимальный выход, но самую низкую степень чистоты 89%. Db №15 и scDb №14 демонстрировали аналогичный выход, и scDb демонстрировало максимальную степень чистоты, измеряемую по содержанию мономеров методом Э-ВЭЖХ.

Таблица 4
выход [мг/л] Чистота - Э-ВЭЖХ [%]
№14 83,5 98
№15 88 92
№16 158 89

Все три формы демонстрировали аналогичную Tm, приблизительно 73°С, при ее измерении посредством дифференциальной сканирующей калориметрии (DSC). Результаты показаны в Таблице 5.

Таблица 5
Tm арр. [°С]
№14 73,8
№15 73,1
№16 73,2

В Tm, измеренной посредством FT-IR наблюдались небольшие различия, см. Таблицу 6. В соответствии с показателями DSC данные результаты подтвердили, что все три формы термостабильны.

Таблица 6
Tm [°С]
№14 70,3
№15 68,9
№16 67,1

Растворимость и стабильность оценивали в испытании краткосрочной стабильности, когда образцы инкубировали при 40°С в течение 14 дней, см. Таблицу 7. Db №15 и scDb №14 были растворимы только в концентрациях приблизительно до 20 мг/мл, но в день 14 они все еще демонстрировали высокое содержание мономеров, приблизительно 95%. Это указывает на высокую стабильность в течение данного короткого периода времени. TdscFv №16 было растворимо до концентрации 40 мг/мл, но в течение 14-дневного периода содержание мономеров падало, достигая 66%. Следовательно, данный эксперимент продемонстрировал, что scDb №14 и Db №15 при указанных условиях обладают более низкой склонностью к агрегации, чем TdscFv №16.

Таблица 7
Чистота -Э-ВЭЖХ [%] Конц. [мг/мл]
№14 95,6 23
№15 93,3 26
№16 66,1 40

Бивалентные молекулы, связывающиеся с IL23, форма scDb с особенностями каркаса:

В Таблице 2 описаны разные варианты scDb, бивалентно связывающиеся с IL-23, которые затем подвергали тестированию. Все молекулы были охарактеризованы по их свойствам продуктивности, термостабильности и краткосрочной стабильности, как описано в разделе «Методы».

Все молекулы бивалентных scDb были получены со следующим порядком доменов: VHA -линкер 1-VLB-линкер 3-VHB-линкер 2-VLA (линкер 1 и 2=SEQ ID №: 1; и линкер 3=SEQ ID №: 4), тогда как VL-A и -В были идентичны, и VH-A и -В были идентичны, со специфическими заменами, представленными в обобщенном виде в Примере 2, Таблица 2.

Все бивалентные молекулы на основе каркаса rFW1.4 обладали высокой продуктивностью, и образцы были главным образом мономерными после очистки посредством препаративной эксклюзионной хроматографии, см. Таблицу 8. scDb №5 на основе консенсусной каркасной последовательности эмбрионального типа демонстрировало самый низкий выход продукции и содержание мономеров в очищенном образце.

Таблица 8
выход [мг/л] Чистота - Э-ВЭЖХ [%]
№5 19 61,6
№1 65 98
№3 65 99
№2 101 98
№4 40 98

Все бивалентные молекулы на основе каркаса rFW1.4 демонстрировали высокую Tm, приблизительно 73°С, при ее измерении посредством дифференциальной сканирующей калориметрии (DSC). scDb на основе консенсусной каркасной последовательности эмбрионального типа демонстрировало самую низкую Tm 66°С, см. Таблицу 9.

Таблица 9
Tm арр. [°С]

№5 66
№1 74,5
№3 73,6
№2 73,2
№4 73,4

Между разными версиями молекул, бивалентно связывающихся с IL-23, наблюдались явные различия в стабильности и максимальной достигаемой концентрации, см. Таблицу 10. scDb №5 на основе консенсусной каркасной последовательности эмбрионального типа демонстрировало более низкое содержание мономеров 44% после двухнедельной инкубации при 40°С. Молекулы на основе каркаса rFW1.4 в основном сохраняли содержание мономеров после двухнедельной инкубации при 40°С, и содержание мономеров у них составляло 87-95%.

Вариант №2, в котором аргинин вводили в положение остатка АНо 50 в обоих доменах VL, демонстрировал максимальное содержание мономеров после двухнедельной инкубации при 40°С по сравнению с вариантом №1, в котором в положении остатка 50 в обоих доменах VL был лизин. Также вариант №3, который содержал серии в положении АНо 12, треонин в положении АНо 103, и треонин в положении АНо 144 в обоих доменах VH, демонстрировал более высокое содержание мономеров, чем вариант №1 после двухнедельной инкубации при 40°С. Также сочетание указанных замен - scDb №4 -приводило к повышению способности к концентрированию белка, что означало дополнительное увеличение растворимости, см. Таблицу 10.

Таблица 10
Чистота -Э-ВЭЖХ [%] Конц. [мг/мл]
№5 44,4 2
№1 87,5 2.1
№3 95,7 1.9
№2 90,1 35
№4 94,9 41

Биспецифические молекулы, связывающиеся с VEGF и TNFα:

Оценивали разные варианты scDb, биспецифически связывающиеся с VEGF и TNFα. См. Пример 3, Таблица 3, где указаны различия между молекулами. Все молекулы были охарактеризованы по их свойствам продуктивности, термостабильности и краткосрочной стабильности.

Все молекулы бивалентных scDb содержали фрагменты в следующем порядке: VHA-линкер 1-VLB-линкер 3-VHB-линкер 2-VL-A. Домены VL-A и VH-A составляли фрагмент антитела, связывающий TNFα. Домены VL-B и VH-B составляли фрагмент антитела, связывающий VEGF. Введенные замены и изменения в линкерной последовательности специфически обобщены в Примере 3, Таблица 3.

Все биспецифические молекулы обладали продуктивностью, но достигали разного выхода и содержания мономеров, см. Таблицу 11, по сравнению с версией scDb №11, которая содержала линкер 3, состоящий из 20 аминокислот (SEQ ID №: 4), версия №9 содержала такие же замены, но отличалась линкером 3 (SEQ ID №: 3). Версия scDb №11 демонстрировала повышенный выход и чистоту -61 мг/мл и 75%, а scDb №9 демонстрировало выход только 7 мг/мл с чистотой 34%. Дополнительные замены в №10 значительно повышали чистоту по сравнению с версией scDb без каких-либо замен (№6).

Таблица 11
выход [mg/L] Чистота - Э-ВЭЖХ [%]
№6 13 19
№7 6 72
№8 25 71
№9 7 34
№10 4 96
№11 62 75
№12 34 74
№13 11 69

Все биспецифические молекулы scDb с заменами демонстрировали высокую Tm, выше 72°С, при измерении DSC для оценки термостабильности. В особенности по сравнению с версией №: 6 - без каких-либо замен, у которой Tm достигала только 57,2°С, см. Таблицу 12. Замена структуры линкера не приводила к изменению термостабильности. Указанные варианты scDb - №11, №12 и №13 также демонстрировало Tm 74°С.

Таблица 12
Tm арр. [°С]
№6 57,2
№7 72,1
№8 72,5
№9 74,2
№10 74,8
№11 74,8
№12 74,6
№13 75,4

Варианты биспецифических scDb - №11, №12 и №13, которые содержали линкер 3, состоящий из 20 аминокислот (SEQ ID №: 4), демонстрировали Tm приблизительно 69°С, когда ее измеряли посредством FT-IR. Указанные значения сравнивали с Tm варианта №9 - 66.2°С, который содержал линкер 3 из 15 аминокислот (SEQ ID №: 3). Указанные результаты оценки термостабильности демонстрируют, что замена линкера 3 с состоящего из 15 ак на состоящий из 20 ак приводит к увеличению Tm молекулы scDb, как показано в Таблице 13.

Таблица 13
Tm арр. [°С]
№9 66,2
№11 69,8
№12 68,9
№13 69,5

Явные различия растворимости и стабильности версий биспецифических scDb отмечались во время процесса концентрирования и после инкубации в течение 14 дней при 40°С. Замены, введенные в каркасные области, приводили к повышению растворимости и стабильности белков scDb, см. Таблицу 14. Версия №10, которая содержала дополнительную замену в VH-B, демонстрировала содержание мономеров 88% в 14-ый день. Указанные значения сравнивали с №9 с содержанием мономеров 53%, и с №6 с содержанием мономеров 19% в 14-ый день. Указанные результаты показали, что стабильность при введении замен повышалась. Когда чистота была выше в 14-ый день, чем в 0-ой день, такие молекулы исключали из сравнения.

Замена линкера 3 с состоящего из 15 ак (SEQ ID №: 3) на состоящий из 20 ак (SEQ ID №: 4) приводила к увеличению растворимости и стабильности молекулы scDb, см. Таблицу 14. Различия растворимости и стабильности молекул №9 по сравнению с молекулами №11, №12 и №13 подтверждают данный вывод. Варианты scDb №9, а также №11, №12 и №13 содержали одни и те же замены, но разные последовательности линкеров, см. Пример 3, Таблица 3. Версия scDb №11 с линкером 3, 20 ак (SEQ ID №: 4) и линкером 1 и 2, 5 ак (SEQ ID №: 1) демонстрировала содержание мономеров 81% при концентрации 40 мг/мл, тогда как версия №9 достигала только 10 мг/мл при содержании мономеров 53%, см. Таблицу 14.

Таблица 14
Чистота - Э-ВЭЖХ [%] Конц. [мг/мл]
№6 19,3 5,5
№7 99,1 1,5
№8 92,5 8,7
№9 53,2 10
№10 88,8 1,5
№11 81,2 40
№12 83,7 40
№13 43,0 40

Следует понимать, что вышеизложенное раскрытие подчеркивает специфические варианты реализации согласно настоящему изобретению, и что все модификации или альтернативы, эквивалентные ему, входят в дух и область настоящего изобретения, как указано в прилагаемой формуле изобретения.

1. Применение способа модификации, заключающегося во вводе замены на серин в положении AHo 12, серин или треонин в положении AHo 103, и серин или треонин в положении AHo 144 в одном из двух вариабельных доменов тяжелой цепи и аргинин в положении AHo 50 в одном из двух вариабельных доменов легкой цепи для получения антитела, связывающегося с двумя антигенами с повышенной стабильностью по сравнению с антителом, не содержащих каких-либо замен, причем антитело содержит:

a. два вариабельных домена тяжелой цепи, один из которых характеризуется специфичностью к антигену А (VH-A), а другой - специфичностью к антигену B (VH-B), и

b. два вариабельных домена легкой цепи, один из которых характеризуется специфичностью к антигену A (VL-A), а другой - специфичностью к антигену B (VL-B),

где антитело представляет собой диатело, одноцепочечное диатело или тандемное антитело.

2. Применение по п. 1, отличающееся тем, что в указанном антителе VH-A соединен с VL-B посредством пептидного линкера 1 с образованием конструкции VH-A/VL-B, и VH-B соединен с VL-A посредством пептидного линкера 2 с образованием конструкции VH-B/VL-A, где пептидный линкер 1 и пептидный линкер 2, каждый содержат 1-10 аминокислот.

3. Применение по п. 2, отличающееся тем, что указанная конструкция VH-A/VL-B находится в ориентации VH-A-(линкер 1)-VL-B.

4. Применение по п. 2, отличающееся тем, что указанная конструкция VH-B/VL-A находится в ориентации VH-B-(линкер 2)-VL-A.

5. Применение по п. 2, отличающееся тем, что пептидный линкер 1 и пептидный линкер 2, каждый содержат 5-10 аминокислот.

6. Применение по п. 5, отличающееся тем, что пептидный линкер 1 содержит последовательность GGGGS (SEQ ID №: 1), а пептидный линкер 2 содержит последовательность GGGGS (SEQ ID №: 1).

7. Применение по п. 2, отличающееся тем, что конструкция VH-A/VL-B дополнительно связана с конструкцией VH-B/VL-A пептидным линкером 3, где пептидный линкер 3 содержит 10-30 аминокислот.

8. Применение по п. 7, отличающееся тем, что пептидный линкер 3 содержит 10-20 аминокислот.

9. Применение по п. 8, отличающееся тем, что пептидный линкер 3 содержит последовательность (GGGGS)4 (SEQ ID №: 4).

10. Применение по п. 1, отличающееся тем, что антитело представлено в форме VH-A-SEQ ID №: 1-VL-B-SEQ ID №: 4-VH-B-SEQ ID №: 1-VL-A.

11. Применение по п. 1, отличающееся тем, что в указанном антителе VH-A соединен с VL-A, и вместе они образуют одноцепочечное антитело со специфичностью к антигену A (scFv A), а VH-B соединен с VL-B, и вместе они образуют одноцепочечное антитело со специфичностью к антигену B (scFv B).

12. Применение по п. 11, отличающееся тем, что указанный scFv-A соединен с scFv-B в следующей форме: VH-A/VL-A – линкер 3 – VH-B/VL-B.

13. Применение по п. 12, отличающееся тем, что указанный линкер 3 содержит последовательность SEQ ID №: 4.

14. Применение по п. 1, отличающееся тем, что в указанном антителе по меньшей мере один из двух вариабельных доменов легкой цепи является или получен из вариабельного домена легкой цепи человека из семейства Vkappa1.

15. Применение по п. 1, отличающееся тем, что в указанном антителе по меньшей мере один из двух вариабельных доменов тяжелой цепи является или получен из вариабельного домена тяжелой цепи человека из семейства VH3.

16. Применение по п. 1, отличающееся тем, что в указанном антителе домены VH и VL содержат CDR из антитела зайцеобразных.

17. Применение по п. 1, отличающееся тем, что серин в положении AHo 12, треонин в положении AHo 103, и треонин в положении AHo 144 содержатся в обеих VH-A и VH-B.

18. Применение по п. 1, отличающееся тем, что аргинин в положении AHo 50 of VL-A и VL-B вводят посредством замены.

19. Применение по п. 1, отличающееся тем, что по меньшей мере один из перечисленных остатков - серин в положении AHo 12, серин или треонин в положении AHo 103, и серин или треонин в положении AHo 144 вводят посредством замены.

20. Применение по п. 1, отличающееся тем, что указанное антитело является бивалентным.

21. Применение по п. 1, отличающееся тем, что указанное антитело является биспецифическим.

22. Применение по п. 1, отличающееся тем, что в указанном антителе по меньшей мере один из указанных вариабельных доменов тяжелой цепи содержит по меньшей мере три из следующих остатков: треонин (T) в положении AHo 24, валин (V) в положении AHo 25, аланин (A) или глицин (G) в положении AHo 56, лизин (K) в положении AHo 82, треонин (T) в положении AHo 84, валин (V) в положении AHo 89 и аргинин (R) в положении AHo 108.



 

Похожие патенты:

Изобретение относится к биохимии. Описано рекомбинантное антитело или его антигенсвязывающий фрагмент.

Изобретение относится к биохимии. Описано рекомбинантное антитело или его антигенсвязывающий фрагмент.

Изобретение относится к биохимии. Описано антитело, которое специфично связывается с IL-6, где это антитело включает аминокислотные последовательности SEQ ID NO: 9 и SEQ ID NO: 10.

Изобретение относится к биохимии. Описано антитело, которое специфично связывается с IL-6, где это антитело включает аминокислотные последовательности SEQ ID NO: 9 и SEQ ID NO: 10.

Представленные изобретения касаются варианта исходного антитела против TNF-α или исходного связывающего фрагмента антитела против TNF-α, молекулы нуклеиновой кислоты, клетки-хозяина, фармацевтической композиции и способа лечения.

Представленные изобретения касаются варианта исходного антитела против TNF-α или исходного связывающего фрагмента антитела против TNF-α, молекулы нуклеиновой кислоты, клетки-хозяина, фармацевтической композиции и способа лечения.

Изобретение относится к биотехнологии. Представлено одноцепочечное антитело для лечения или диагностики, содержащее один полипептид, содержащий следующие домены, расположенные относительно друг друга в направлении от N-конца к С-концу следующим образом: VL1-CL1-CLH линкер1-VH1-CH11-шарнир1-CH21-CH31-HD линкер-VL2-CL2-CLH линкер2-VH2-CH12-шарнир2-CH22-CH32, где каждый из CLH линкера1, CLH линкера2 и HD линкера содержит аминокислотную последовательность, расщепляемую эндопептидазой на N- и C-концах.

Настоящее изобретение относится к биохимии, в частности нанотелам против сывороточного альбумина человека, а также к полипептидам против сывороточного альбумина человека, содержащим одно или более таких нанотел.

Изобретение относится к области биохимии. Заявлены связывающие белки, представляющие собой иммуноглобулины с двойными вариабельными доменами, которые связывают IL-1α и IL-1β.

Представленные изобретения касаются способов получения гетеромультимерного белка, обладающего способностью специфически связываться более чем с одной мишенью (варианты), а также способов создания комбинаторных библиотек таких гетеромультимерных белков (варианты).

Изобретение относится к области биохимии, в частности к выделенной молекуле нуклеиновой кислоты, кодирующей рекомбинантное антитело или его фрагмент, где рекомбинантное антитело или его фрагмент нейтрализует VEGF человека, а также к экспрессирующему вектору и клетке-хозяину, ее содержащей.

Настоящее изобретение относится к биотехнологии и фармацевтике, в частности к фармацевтической композиции для применения в ингибировании роста опухоли, резистентной к анти-VEGF-средствам.

Настоящее изобретение относится к области биотехнологии и генетической инженерии, в частности к способу получения ранибизумаба с применением новых сигнальных последовательностей для лёгкой и тяжёлой цепи ранибизумаба, соответственно.

Изобретение относится к биотехнологии. Представлено одноцепочечное антитело для лечения или диагностики, содержащее один полипептид, содержащий следующие домены, расположенные относительно друг друга в направлении от N-конца к С-концу следующим образом: VL1-CL1-CLH линкер1-VH1-CH11-шарнир1-CH21-CH31-HD линкер-VL2-CL2-CLH линкер2-VH2-CH12-шарнир2-CH22-CH32, где каждый из CLH линкера1, CLH линкера2 и HD линкера содержит аминокислотную последовательность, расщепляемую эндопептидазой на N- и C-концах.

Настоящее изобретение относится к иммунологии. Предложено антитело, которое связывается с фактором роста сосудистого эндотелия А (VEGF-А) человека и мыши, а также антигенсвязывающий фрагмент такого антитела.

Настоящее изобретение относится к биотехнологии, в частности к способу получения антител, подходящих для применения у собаки, которые специфично связываются с собачьим фактором роста нервов (NGF) и нейтрализуют способность собачьего NGF связываться с рецептором собачьего NGF р75 или TrkA, и соответствующим антителам.

Изобретение относится к биохимии. Описано антитело для снижения концентрации антигена в плазме, содержащее антигенсвязывающий домен и FcRn-связывающий домен человека, активность связывания антигена которого отличается в двух различных условиях концентрации кальция и является более низкой в условиях низкой концентрации кальция, чем в условиях высокой концентрации кальция, где низкая концентрация кальция представляет собой концентрацию ионизированного кальция от 0,1 до 30 мкМ, а высокая концентрация кальция представляет собой концентрацию ионизированного кальция от 100 мкМ до 10 мМ, где указанное антитело содержит по крайней мере четыре аминокислоты, выбранные из группы, включающей аминокислоты в положениях 30, 31, 32, 50 и 92 в соответствии с нумерацией по Kabat в легкой цепи, которые обладают хелатирующей активностью в отношении металла.

Группа изобретений относится к области биотехнологии. Предложен полипептид, обладающий цитотоксической активностью, содержащий Fc-область IgG, которая состоит из гетеродимера, содержащего первый полипептид и второй полипептид, в аминокислотных последовательностях которых произведены серии мутаций.

Настоящее изобретение относится к биотехнологии, в частности к способу получения антител, подходящих для применения у кошки, которые специфично связываются с кошачьим фактором роста нервов (NGF) и нейтрализуют способность кошачьего NGF связываться с рецептором кошачьего NGF р75 или TrkA, и соответствующим антителам.

Изобретение относится к области биохимии, в частности к биспецифическому антителу, специфически связывающемуся с фактором роста сосудистого эндотелия человека - VEGF и ангиопоэтином-2 человека - ANG-2, фармацевтической композиции его содержащей, а также к способу его получения.

Настоящее изобретение относится к иммунологии. Предложено антитело и его фрагмент, способные связываться с рецептором эпидермального фактора роста (EGFR) и содержащие гипервариабельные участки из антитела панитумумаб и константную область IgG1 человека.

Изобретение относится к области биохимии, в частности к применению способа модификации двух доменов легкой цепи для получения антитела с повышенной стабильностью, по сравнению с антителом, не содержащей указанных замен. Изобретение позволяет получать антитела с повышенной стабильностью, по сравнению с антителами, не содержащей указанных замен. 21 з.п. ф-лы, 14 табл., 4 пр.

Наверх