Применение долгодействующих пептидов glp-1

Группа изобретений относится к медицине, а именно к терапии и эндокринологии, и касается применения долгодействующих пептидов GLP-1 для лечения ожирения. Для этого вводят семаглутид в дозе 0,7 мг в неделю в качестве монотерапии. Это обеспечивает наиболее эффективное снижение массы тела в сравнении с действием других агонтистов рецептора GLP-1. 4 н. и 18 з.п. ф-лы, 5 ил., 1 табл., 1 пр.

 

Изобретение относится к улучшенным применениям пептидов GLP-1 в терапии.

Сущность изобретения

В одном из вариантов воплощения настоящее изобретение относится к способу: а) снижения HbA1c; b) предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета; или с) предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи или стимулирования насыщения; где указанный способ включает введение агониста GLP-1 нуждающемуся в этом субъекту, где указанный агонист GLP-1: i) имеет время полужизни, по меньшей мере, 72 часа, где указанное время полужизни необязательно определяют с помощью анализа (II); ii) вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю; и iii) вводят один раз в неделю или реже.

В одном из вариантов воплощения настоящее изобретение относится к агонисту GLP-1 для применения для: а) снижения HbA1c; b) предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета; или с) предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи или стимулирования насыщения, где указанное применение включает введение указанного агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю, и где указанный агонист GLP-1 и/или введение необязательно представляют собой такой агонист и/или такое введение, как определено в настоящем документе.

В одном из вариантов воплощения настоящее изобретение относится к композиции, включающей агонист GLP-1, для применения для: а) снижения HbA1c; b) предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета; или с) предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи или стимулирования насыщения; где указанный агонист GLP-1 i) имеет время полужизни, по меньшей мере, 72 часа, где указанный время полужизни необязательно определяют с помощью анализа (II); и ii) вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю; и где указанную композицию вводят один раз в неделю или реже, и где указанный агонист GLP-1 и/или введение необязательно необязательно представляют собой такой агонист и/или такое введение, как определено в настоящем документе.

Краткое описание графических материалов

На Фиг. 1 показано изменение уровня HbA1c после подкожного введения плацебо, семаглутида или лираглутида людям. * р<0,05 в сравнении с плацебо; ** р<0,001 в сравнении с плацебо (на основе скорректированных средних величин). Исходные значения приведены только для информации: данные скорректированы с помощью модели с учетом исходного значения HbA1c. Данные представляют собой скорректированные с помощью модели средние значения LS, FAS LOCF. Оценки получены из модели ANOVA с лечением, где страна и предшествующее лечение выступали в качестве фиксированных эффектов, и исходное значение HbA1c служило в качестве ковариата.

На Фиг. 2 показано среднее изменение HbA1c со временем по сравнению с исходным значением; данные представляют собой средние значения (1.96SE), FAS LOCF. Варианты лечения представляют собой плацебо (А); семаглутид, 0,1 мг (В, пунктирная линия), 0,2 мг (С), 0,4 мг (D), 0,8 мг (Е), 0,8 мг Т (F, пунктирная линия), 1,6 мг Т (G); лираглутид, 1,2 мг (Н), 1,8 мг (I).

На Фиг. 3 приведены субъекты, удовлетворяющие АСЕ или ADA критериям для гликемического контроля. Количество пациентов, удовлетворяющих критерию для каждого варианта лечения, указано в каждой строке. Варианты лечения представляют собой плацебо (А); семаглутид, 0,1 мг (В), 0,2 мг (С), 0,4 мг (D), 0,8 мг (Е), 0,8 мг Т (F), 1,6 мг Т (G); лираглутид, 1,2 мг (Н), 1,8 мг (I). * р<0,05 в сравнении с плацебо; ** р<0,001 в сравнении с плацебо; *** р<0,0001 в сравнении с плацебо (на основе скорректированных средних величин). Данные представляют собой FAS LOCF. Оценки получены из регрессионной логистической модели с лечением, где страна и предшествующее лечение выступали в качестве фиксированных эффектов, и исходное значение HbA1c служило в качестве ковариата. ADA, Американская диабетическая ассоциация; ААСЕ, Американская ассоциация клинических эндокринологов.

На Фиг. 4 показано изменение веса тела со временем; данные представляют собой средние значения (1.96SE), FAS LOCF. Варианты лечения представляют собой плацебо (А); семаглутид, 0,1 мг (В, пунктирная линия), 0,2 мг (С), 0,4 мг (D), 0,8 мг (Е), 0,8 мг Т (F, пунктирная линия), 1,6 мг Т (G); лираглутид, 1,2 мг (Н), 1,8 мг (I).

На Фиг. 5 показано изменение веса тела на 12 неделе по сравнению с исходным значением. ** р<0,001 в сравнении с плацебо; *** р<0,0001 в сравнении с плацебо (на основе скорректированных средних величин), f: исходные значения приведены только для информации: данные скорректированы с помощью модели с учетом исходного веса тела. Данные представляют собой скорректированные с помощью модели средние значения LS, FAS LOCF. Оценки получены из модели ANOVA с лечением, где страна и предшествующее лечение выступали в качестве фиксированных эффектов, и исходное значение веса тела служило в качестве ковариата.

SE: стандартная ошибка. FAS: набор данных для полного анализа. LOCF: перенос данных последнего наблюдения вперед.

Описание

Настоящее изобретение относится к улучшенному применению агонистов GLP-1 в терапии. В одном из вариантов воплощения настоящее изобретение относится к конкретному режиму дозирования агонистов GLP-1, который обеспечивает улучшенный эффект при заболеваниях или состояниях, такой как предотвращение и/или лечение диабета 2 типа и ожирения. В одном из вариантов воплощения способы настоящего изобретения неожиданно обеспечивают улучшенное снижение HbA1c и снижение веса тела. В одном из вариантов воплощения агонист GLP-1 вводят в количестве, которое обеспечивает улучшенное а) снижение HbA1c или b снижение веса тела по сравнению с введением 1,8 мг лираглутида в день или менее, например 0,8 мг лираглутида в день или менее.

В одном из вариантов воплощения настоящее изобретение относится к способу снижения HbA1c или предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, где указанный способ включает введение нуждающемуся в этом субъекту агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения способ представляет собой способ снижения HbA1c. В одном из вариантов воплощения способ представляет собой способ предотвращения или лечения диабета 2 типа. В одном из вариантов воплощения способ представляет собой способ предотвращения или лечения гипергликемии. В одном из вариантов воплощения способ представляет собой способ предотвращения или лечения нарушения толерантности к глюкозе. В одном из вариантов воплощения способ представляет собой способ предотвращения или лечения инсулиннезависимого диабета. В одном из вариантов воплощения способ настоящего изобретения включает замедление или предотвращение прогрессирования диабетического заболевания. В одном из вариантов воплощения достигается уровень HbA1c ниже 7%. В одном из вариантов воплощения уровень HbA1c определяют в соответствии со способом, определенным Исследованием по контролю диабета и его осложнений (DCCT). В одном из вариантов воплощения уровень HbA1c определяют в соответствии со способом, определенным Международной федерацией клинической химии (IFCC).

В одном из вариантов воплощения настоящее изобретение относится к способу лечения или предотвращения ожирения, снижения веса тела и/или потребления пищи или стимулирования насыщения, где указанный способ включает введение нуждающемуся в этом субъекту агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения способ представляет собой способ предотвращения или лечения ожирения. В одном из вариантов воплощения способ представляет собой способ снижения веса тела и/или потребления пищи. В одном из вариантов воплощения способ представляет собой способ стимулирования насыщения.

В одном из вариантов воплощения агонист GLP-1 имеет время полужизни, по меньшей мере, 24 часа, например, по меньшей мере, 48 часов, по меньшей мере, 60 часов, или, по меньшей мере, 72 часа, или, например, по меньшей мере, 84 часа, по меньшей мере, 96 часов, или, по меньшей мере, 108 часов, или, необязательно, по меньшей мере, 120 часов, по меньшей мере, 132 часа, или, по меньшей мере, 144 часов, где указанный время полужизни необязательно определяют с помощью анализа (II).

В одном из вариантов воплощения агонист GLP-1 вводят дважды в неделю или реже, один раз в неделю или реже, или один раз в неделю или реже. В одном из вариантов воплощения агонист GLP-1 вводят один раз в две недели или реже, один раз в три недели или реже либо один раз в месяц или реже.

В одном из вариантов воплощения агонист GLP-1 вводят в количестве, составляющем, по меньшей мере, 0,8 мг в неделю, по меньшей мере, 0,9 мг в неделю, или, по меньшей мере, 1,0 мг в неделю. В одном из вариантов воплощения агонист GLP-1 вводят в количестве, составляющем, по меньшей мере, 1,1 мг в неделю, по меньшей мере, 1,2 мг в неделю, или, по меньшей мере, 1,3 мг в неделю. В одном из вариантов воплощения агонист GLP-1 вводят в количестве, составляющем, по меньшей мере, 1,4 мг в неделю, по меньшей мере, 1,5 мг в неделю, или, по меньшей мере, 1,6 мг в неделю.

В одном из вариантов воплощения агонист GLP-1 вводят в количестве, эквивалентном, по меньшей мере, 0,8 мг семаглутида в неделю, по меньшей мере, 0,9 мг семаглутида в неделю, или, по меньшей мере, 1,0 мг семаглутида в неделю. В одном из вариантов воплощения агонист GLP-1 вводят в количестве, эквивалентном, по меньшей мере, 1,1 мг семаглутида в неделю, по меньшей мере, 1,2 мг семаглутида в неделю, или, по меньшей мере, 1,3 мг семаглутида 6 неделю. В одном из вариантов воплощения агонист GLP-1 вводят в количестве, эквивалентном, по меньшей мере, 1,4 мг семаглутида в неделю, по меньшей мере, 1,5 мг семаглутида в неделю, или, по меньшей мере, 1,6 мг семаглутида в неделю.

В одном из вариантов воплощения агонист GLP-1 выбирают из группы, состоящей из семаглутида, эксенатида, албиглутида и дулаглутида.

В одном из вариантов воплощения агонист GLP-1 вводят путем парентерального введения, такого как подкожная инъекция.

В одном из вариантов воплощения агонист GLP-1 представляет собой пептид GLP-1. В одном из вариантов воплощения пептид GLP-1 включает не больше чем 5, например, не больше чем 4 или не больше чем 3 аминокислотных остатка, которые были замещены, вставлены или удалены по сравнению с GLP-1 (7-37). В одном из вариантов воплощения пептид GLP-1 включает не больше чем 4 аминокислотных остатка, которые не кодируются генетическим кодом.

В одном из вариантов воплощения пептид GLP-1 представляет собой защищенный от DPPIV пептид GLP-1. В одном из вариантов воплощения пептид GLP-1 является стабилизированным по отношению к DPPIV.

В одном из вариантов воплощения агонист GLP-1 имеет ЕС50, составляющую 3000 пМ или меньше, например 500 пМ или меньше или 100 пМ или меньше, где ЕС50 необязательно определяют с помощью анализа (I).

В одном из вариантов воплощения настоящее изобретение относится к агонисту GLP-1 для применения для снижения HbA1c или для применения для предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, включающего введение агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения агонист GLP-1 и/или введение представляют собой такой агонист GLP-1 и/или такое введение, как определено в настоящем документе.

В одном из вариантов воплощения настоящее изобретение относится к агонисту GLP-1 для применения для предотвращения или лечения ожирения, для снижения веса тела и/или потребления пищи, или для стимулирования насыщения, включающего введение агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения агонист GLP-1 и/или введение представляют собой такой агонист GLP-1 и/или такое введение, как определено в настоящем документе.

В одном из вариантов воплощения настоящее изобретение относится к композиции, включающей агонист GLP-1 и один или несколько фармацевтически приемлемых эксципиентов, для применения для снижения HbA1c или для предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, где указанный агонист GLP-1 вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения агонист GLP-1 и/или введение представляют собой такой агонист GLP-1 и/или такое введение, как определено в настоящем документе.

В одном из вариантов воплощения настоящее изобретение относится к композиции, включающей агонист GLP-1 и один или несколько фармацевтически приемлемых эксципиентов для применения для предотвращения или лечения ожирения, для снижения веса тела и/или потребления пищи, или для стимулирования насыщения, где указанный агонист GLP-1 вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю. В одном из вариантов воплощения агонист GLP-1 и/или введение представляют собой такой агонист GLP-1 и/или такое введение, как определено в настоящем документе.

В одном из вариантов воплощения агонист GLP-1 вводят с другим терапевтическим агентом. Введение с другим терапевтическим агентом может быть осуществлено как введение агониста GLP-1 и другого терапевтического агента в одном и том же терапевтическом окне (например, в течение двух недель, одной недели, или в течение 96, 72, или 48 часов, и т.п.). Лечение с помощью агониста GLP-1 в соответствии с настоящим изобретением может быть комбинировано с одним или несколькими дополнительными терапевтическими агентами, например, выбранными из антидиабетических агентов, агентов против ожирения, агентов, регулирующих аппетит, антигипертензивных агентов, агентов для лечения и/или предотвращения осложнений, вызванных диабетом или ассоциированных с диабетом, и агентов для лечения и/или предотвращения осложнений и расстройств, вызванных или ассоциированных с ожирением; примерами таких терапевтических агентов являются сульфонилмочевины, тиазолидиндионы, бигуаниды, меглитиниды, ингибиторы глюкозидазы, антагонисты глюкагона и ингибиторы DPPIV (дипептидил пептидаза-IV).

В одном из вариантов воплощения в настоящем документе выражение "эквивалентное количество", когда оно используется по отношению к агонистам GLP-1, относится к количествам первого агониста GLP-1 и второго агониста GLP-1, имеющим активность к рецептору GLP-1 (т.е. ЕС50) в пределах ±30%, например в пределах ±20% или в пределах ±10% друг от друга, где активность необязательно определяют с помощью анализа (I), описанного в настоящем документе, и имеющим время полужизни в пределах ±30%, например, где время полужизни необязательно определяют с помощью анализа (II), описанного в настоящем документе.

В одном из вариантов воплощения в настоящем документе "эффективное количество" агониста GLP-1 означает количество, достаточное для лечения, облегчения или частичного купирования клинических проявлений данного заболевания или стадии и их осложнений. Количество, достаточное для этой цели, определяется как "эффективное количество". Эффективные количества для каждой цели будут зависеть от тяжести заболевания или повреждения, а также от веса и общего состояния здоровья субъекта. Следует иметь в виду, что определение подходящей дозы можно осуществить с использованием рутинного экспериментирования, путем построения матрицы значений и тестирования различных точек в матрице, все это находится в пределах компетентности врача или ветеринара.

В одном из вариантов воплощения использованный в настоящем документе термин "лечение" означает ведение и уход за пациентом с целью борьбы с состоянием, таким как заболевание или расстройство. В одном из вариантов воплощения термин "лечение" предназначен для включения полного спектра видов лечения данного состояния, от которого страдает пациент, например, введение активного соединения для облегчения симптомов или осложнений; для замедления прогрессирования заболевания, расстройства или состояния; для облегчения или снятия симптомов и осложнений; и/или для излечения или устранения заболевания, расстройства или состояния, а также для предотвращения состояния. В одном из вариантов воплощения предотвращение следует понимать как ведение и уход за пациентом с целью борьбы с заболеванием, состоянием или расстройством, и оно включает введение активных соединений для предотвращения появления симптомов или осложнений.

В одном из вариантов воплощения использованный в настоящем документе термин "гидрофильный спейсер" означает спейсер, который разделяет пептид и связывающий альбумин остаток химическим фрагментом, который включает, по меньшей мере, 5 атомов, отличающихся от водорода, 30-50% из которых представляют собой N или О.

В одном из вариантов воплощения использованный в настоящем документе термин "аналог" по отношению к полипептиду означает модифицированный пептид, где один или несколько аминокислотных остатка пептида были замещены другими аминокислотными остатками, и/или где один или несколько аминокислотных остатков были удалены из пептида, и/или где один или несколько аминокислотных остатка были добавлены к пептиду. Такое добавление или удаление аминокислотных остатков может быть осуществлено на N-конце пептида и/или на С-конце пептида. Для описания аналогов используется простая система: например Arg34GLP-1 (7-37) Lys обозначает аналог GLP-1, в котором встречающийся в природе лизин в позиции 34 был замещен на аргинин и остаток лизина был добавлен к С-концу (позиция 38).

В одном из вариантов воплощения использованный в настоящем документе термин "пептид GLP-1" означает GLP-1 (7-37), аналог GLP-1, производное GLP-1 или производное аналога GLP-1.

В одном из вариантов воплощения использованный в настоящем документе термин "эксендин-4 пептид" означает эксендин-4 (1-39), аналог эксендина-4, производное эксендина-4 или аналог производного эксендина-4.

В одном из вариантов воплощения использованный в настоящем документе термин "защищенный от DPP-IV" по отношению к полипептиду означает полипептид, который был химически модифицирован, чтобы сделать указанное соединение устойчивым к пептидазе плазмы дипептидиламинопептидазе-4 (DPP-IV). Известно, что фермент DPP-IV в плазме участвует в деградации некоторых пептидных гормонов, например, GLP-1, эксендина-4 и т.п. Поэтому были приложены значительные усилия для разработки агонистов GLP-1, менее чувствительных к гидролизу, опосредованному DPP-IV, чтобы снизить скорость деградации в результате действия DPP-IV.

Настоящее изобретение также относится к агонисту GLP-1 по настоящему изобретению для применения в качестве лекарственного средства. В конкретных вариантах воплощения, агонист GLP-1 по настоящему изобретению может применяться для следующих видов терапевтического лечения:

(i) для предотвращения и/или лечения всех форм диабета, таких как гипергликемия, диабет 2 типа, нарушение толерантности к глюкозе, диабет 1 типа, инсулиннезависимый диабет, MODY (диабет взрослого типа у молодых), гестационный диабет, и/или для снижения HbA1c;

(ii) для замедления или предотвращения прогрессирования диабетического заболевания, например прогрессирования диабета 2 типа, замедления прогрессирования нарушения толерантности к глюкозе (IGT) до инсулинозависимого диабета 2 типа и/или замедления прогрессирования инсулиннезависимого диабета 2 типа до инсулинозависимого диабета 2 типа;

(iii) для предотвращения и/или лечения расстройств, таких как ожирение, например, путем уменьшения потребления пищи, снижения веса тела, подавления аппетита, стимулирования насыщения; для лечения или предотвращения компульсивного переедания, нервной булимии и/или ожирения, вызванного введением антипсихотика или стероида; снижения двигательной функции желудка; и/или замедления опорожнения желудка.

В другом конкретном варианте воплощения показанием является (i). В еще одном конкретном варианте воплощения показанием является (ii). В еще одном варианте воплощения показанием является (iii). В одном из вариантов воплощения показанием является диабет 2 типа и/или ожирение.

В одном из вариантов воплощения способ включает предотвращение, лечение, снижение и/или индукционную терапию одного или нескольких заболеваний или расстройств, определенных в настоящем документе. В одном из вариантов воплощения показаниями являются (i) и (iii). В одном из вариантов воплощения показаниями являются (ii) и (iii). В одном из вариантов воплощения способ включает предотвращение, лечение, снижение и/или индукционную терапию одного или нескольких заболеваний или расстройств, выбранных из а) и b), а) и с), b) и с) или а), b) и с), как определено в пункте 1 формулы изобретения.

В одном из вариантов воплощения настоящее изобретение относится к введению эффективного количества агониста GLP-1.

В одном из вариантов воплощения использованные в настоящем документе конкретные значения, приведенные в отношении чисел или интервалов, можно понимать как конкретное значение или как примерно конкретное значение.

Функциональные свойства

В первом функциональном аспекте, агонисты GLP-1 по настоящему изобретению имеют высокую активность. Также, или альтернативно, во втором функциональном аспекте, агонисты GLP-1 по настоящему изобретению имеют продолжительный фармакокинетический профиль. Также, или альтернативно, в третьем функциональном аспекте, агонисты GLP-1 по настоящему изобретению являются стабильными по отношению к деградации пищеварительными ферментами.

Биологическая активность (активность)

В соответствии с первым функциональным аспектом, агонисты GLP-1 по настоящему изобретению являются биологически активными, или активными. В конкретном варианте воплощения, "активность" относится к активности in vitro, т.е. эффективности в анализе функциональных свойств рецептора GLP-1, более конкретно к способности стимулировать образование цАМФ в клеточной линии, экспрессирующей клонированный человеческий рецептор GLP-1.

Стимулирование образования цАМФ в среде, содержащей человеческий рецептор GLP-1, можно предпочтительно определить с использованием стабильной трансфицированной клеточной линии, такой как ВНК467-12А (tk-ts13), и/или, используя для определения цАМФ анализ функциональных свойств рецептора, например, на основе конкуренции между эндогенно образованным цАМФ и экзогенно добавленным цАМФ, меченным биотином, где анализ цАМФ предпочтительно осуществлен с использованием специфичных антител, и/или где более предпочтительным анализом является анализ цАМФ AlphaScreen, такой как описанный в анализе (I).

В одном из вариантов воплощения термин полумаксимальная эффективная концентрация (ЕС50) обычно относится к концентрации, которая индуцирует ответ, составляющий половину между исходным значением и максимумом в соответствии с кривой доза-ответ.ЕС50 используется в качестве меры активности соединения и представляет собой концентрацию, при которой наблюдается 50% от максимального эффекта соединения.

Активность агонистов GLP-1 по настоящему изобретению in vitro можно определить, как описано выше, и ЕС50 исследуемых агонистов GLP-1 были определены. Чем ниже ЕС50, тем лучше активность.

В конкретном варианте воплощения среда имеет следующий состав (конечные концентрации в анализе): 50 мМ Трис-HCl; 5 мМ HEPES; 10 мМ MgCl2 × 6H2O; 150 мМ NaCl; 0,01% Tween; 0,1% BSA; 0,5 мМ IBMX; 1 мМ АТФ; 1 мкМ ГТФ; рН 7,4.

В другом конкретном варианте воплощения агонист GLP-1 по настоящему изобретению имеет активность in vitro, соответствующую ЕС50, равной 3000 пМ или меньше, например, 2000 пМ или меньше, 1000 пМ или меньше или 500 пМ или меньше, или, например, меньше 200 пМ или меньше 100 пМ.

В другом конкретном варианте воплощения агонист GLP-1 по настоящему изобретению является активным in vivo, что можно определить, как известно в данной области техники, в любой подходящей модели на животных, а также в клинических исследованиях.

Мышь диабетической линии db/db являются примером подходящей модели на животных, и эффект снижения уровня глюкозы в крови можно определить в таких мышах in vivo, например, как описано в анализе (III), или как описано в Примере 43 в WO 09/030738.

Также, или альтернативно, влияние на потребление пищи in vivo можно определить в фармакологических исследованиях на свиньях, например, как описано в анализе (IV).

Увеличение продолжительности действия - время полужизни in vivo в карликовых свиньях

В соответствии со вторым функциональным аспектом, агонисты GLP-1 по настоящему изобретению имеют увеличенную продолжительность действия. В конкретном варианте воплощения увеличение продолжительности действия можно определить как время полужизни (Т½) in vivo в карликовых свиньях после внутривенного введения. В дополнительных вариантах воплощения время полужизни составляет, по меньшей мере, 24 часа, например, по меньшей мере, 48 часов, по меньшей мере, 60 часов, по меньшей мере, 72 часа, или например, по меньшей мере, 84 часа, по меньшей мере, 96 часов, или, по меньшей мере, 108 часов.

Подходящий анализ для определения времени полужизни in vivo в карликовых свиньях после внутривенного введения раскрыт в анализе (II).

Деградация пищеварительными ферментами

В соответствии с третьим функциональным аспектом, агонисты GLP-1 по настоящему изобретению являются стабильными или стабилизированными по отношению к деградации одним или несколькими пищеварительными ферментами.

Пищеварительные ферменты включают, без ограничения, экзо- и эндопептидазы, такие как пепсин, трипсин, химотрипсин, эластазы и карбоксипептидазы. Стабильность можно тестировать по отношению к этим пищеварительным ферментам в форме очищенных ферментов или в форме экстрактов из желудочно-кишечного тракта.

В конкретном варианте воплощения, агонист GLP-1 по настоящему изобретению имеет время полужизни (Т½) in vitro в экстракте тонкого кишечника крысы, деленное на соответствующее время полужизни (Т½) GLP-1(7-37), составляющее, по меньшей мере, 1, например, выше 1,0, по меньшей мере, 1,2, по меньшей мере, 2,0, или, например, по меньшей мере, 3,0, или, по меньшей мере, 4,0. Другими словами, соотношение (SI) можно определить для каждого агониста GLP-1, а именно как время полужизни (Т½) in vitro исследуемого агониста GLP-1 в экстракте тонкого кишечника крысы, деленное на соответствующее время полужизни (Т½) GLP-1(7-37).

Подходящий анализ для определения времени полужизни in vitro в экстрактах тонкого кишечника крысы раскрыт в анализе (V).

Агонисты GLP-1

В одном из вариантов воплощения пептид GLP-1 включает остаток Aib в позиции 8.

В одном из вариантов воплощения аминокислотный остаток в позиции 7 указанного пептида GLP-1 выбран из группы, состоящей из D-гистидина, дезамино-гистидина, 2-амино-гистидина, β-гидрокси-гистидина, гомогистидина, Nα-ацетил-гистидина, α-фторметил-гистидина, α-метил-гистидина, 3-пиридилаланина, 2-пиридилаланина и 4-пиридилаланина.

В одном из вариантов воплощения пептид GLP-1 присоединен к гидрофильному спейсеру через аминокислотный остаток в позиции 23, 26, 34, 36 или 38 в соответствии с аминокислотной последовательностью GLP-1 (7-37).

В одном из вариантов воплощения пептид GLP-1 представляет собой эксендин-4, аналог эксендина-4 или производное эксендина-4.

В одном из вариантов воплощения пептидный агонист GLP-1 включает аминокислотную последовательность в соответствии со следующей формулой:

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.

В одном из вариантов воплощения агонист GLP-1 включает связывающий альбумин остаток, присоединенный через гидрофильный спейсер к С-концевому аминокислотному остатку указанного пептида GLP-1.

В одном из вариантов воплощения агонист GLP-1 включает второй связывающий альбумин остаток, присоединенный к аминокислотному остатку, который не является С-концевым аминокислотным остатком.

В одном из вариантов воплощения пептид GLP-1 выбран из группы, состоящей из смаглутида, албиглутида и дулаглутида.

В одном из вариантов воплощения пептид GLP-1 имеет следующую структуру:

His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-

Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Aib-Arg.

В одном из вариантов воплощения пептид GLP-1 имеет следующую структуру:

(His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-

Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg)2-

генетически слитый с человеческим альбумином.

В одном из вариантов воплощения пептид GLP-1 представляет собой дулаглутид.

В одном из вариантов воплощения агонисты GLP-1 по настоящему изобретению имеют активность GLP-1. В одном из вариантов воплощения термин "агонист GLP-1" следует понимать, как относящийся к любому соединению, включая пептидные и непептидные соединения, которые полностью или частично активируют человеческий рецептор GLP-1. В одном из вариантов воплощения "агонист GLP-1" представляет собой любое пептидное или непептидное низкомолекулярное соединение, которое связывается с рецептором GLP-1, предпочтительно с аффинной константой (KD) или активностью (ЕС50), составляющей меньше 1 мкМ, например, меньше 100 нМ, как измерено способами, известными в данной области техники (см., например, WO 98/08871). В одном из вариантов воплощения способы для идентификации агонистов GLP-1 описаны в WO 93/19175 (Novo Nordisk A/S), и примеры подходящих агонистов GLP-1, которые могут применяться в соответствии с настоящим изобретением, включают агонисты GLP-1, которые приведены в WO 2005/027978 (Novo Nordisk A/S), где раскрытия обеих заявок включены в настоящий документ посредством ссылки. "Активность GLP-1" относится к способности связываться с рецептором GLP-1 и инициировать путь передачи сигнала, приводящий к инсулинотропному действию или другим физиологическим эффектам, как это известно в данной области техники. Например, агонисты GLP-1 по настоящему изобретению можно протестировать на активность GLP-1 с использованием анализа, описанного в анализе (I) в настоящем документе.

В еще одном другом варианте воплощения агонист GLP-1 представляет собой стабильный агонист GLP-1. Использованный в настоящем документе термин "стабильный агонист GLP-1" означает агонист GLP-1, который имеет время полувыведения в плазме in vivo, составляющее, по меньшей мере, 24 часа для человека, где время полувыведения необязательно определяют с помощью способа, описанного ниже. Примеры стабильных агонистов GLP-1 можно найти в WO 2006/097537.

В одном из вариантов воплощения способ определения времени полувыведения соединения в плазме человека можно осуществить, как указано далее: соединение растворяют в изотоническом буфере, рН 7,4, PBS или любом другом подходящем буфере. Дозу инъецируют на периферии, предпочтительно в абдоминальную область или верхнюю часть бедра. Образцы крови для определения активного соединения забирают через определенные промежутки времени и в течение достаточного времени для достижения терминальной части элиминации (например, перед введением дозы, через 1, 2, 3, 4, 5, 6, 7, 8, 10, 12, 24 (2 день), 36 (3 день), 48 (3 день), 60 (3 день), 72 (4 день) и 84 (4 день) часов после введения дозы). Определение концентрации активного соединения осуществляют, как описано в Wilken et ai, Diabetologia 43 (51), 2000. Получаемые фармакокинетические параметры рассчитывают из данных зависимости концентрации от времени для каждого отдельного субъекта с применением некомпартментных способов с использованием коммерчески доступного программного обеспечения WinNonlin Version 2.1 (Pharsight, Сагу, NC, USA). Константу скорости терминальной элиминации оценивают с помощью логарифмической регрессии на терминальной логарифмической части кривой зависимости концентрации от времени и используют для расчета времени полувыведения.

В одном из вариантов воплощения агонист GLP-1 составлен в виде лекарственной формы таким образом, чтобы иметь время полужизни для человека, составляющее, по меньшей мере, 48 часов. Этого можно добиться с помощью препаратов с замедленным высвобождением, известных в данной области техники.

В одном из вариантов воплощения агонист GLP-1 представляет собой пептид GLP-1. В одном из вариантов воплощения пептид GLP-1 выбран из GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-амида, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40), GLP-1 (7-41) или их аналогов или производных. В одном из вариантов воплощения пептид GLP-1 включает не больше 15, например, не больше 10 или не больше 6 аминокислотных остатков, которые были замещены, вставлены или удалены по сравнению с GLP-1 (7-37). В одном из вариантов воплощения пептид GLP-1 включает не больше 4 аминокислотных остатков, которые не кодируются генетическим кодом. В еще одном варианте воплощения агонист GLP-1 представляет собой эксендин-4 или эксендин-3, аналог эксендина-4 или эксендина-3, или производное любого из них.

В одном из вариантов воплощения пептид GLP-1 выбран из группы, состоящей из семаглутида, эксенатида, албиглутида и дулаглутида. В одном из вариантов воплощения пептид GLP-1 представляет собой семаглутид. WO 06/097537 раскрывает семаглутид (Пример 4), моноацилированный агонист GLP-1 для введения один раз в день. В одном из вариантов воплощения пептид GLP-1 представляет собой эксенатид. В одном из вариантов воплощения пептид GLP-1 включает аминокислотную последовательность, соответствующую формуле: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.

Эксенатид представляет собой синтетический вариант эксендина-4, гормона, обнаруженного в слюне ящерицы-ядозуба. Эксенатид имеет биологические свойства, аналогичные GLP-1. В некоторых вариантах воплощения композиция представляет собой BYDUREON® (препарат эксенатида с длительным высвобождением в частицах PLGA). В одном из вариантов воплощения "композиция Bydureon®" относится к порошку, содержащему эксенатид, поли(D,L-лактид-когликолид) и сахарозу, который непосредственно перед инъекцией восстанавливают в растворителе, включающем натриевую соль кармеллозы, хлорид натрия, полисорбат 20, одноосновный фосфат натрия (например, его моногидрат), двухосновный фосфат натрия (например, его гептагидрат) и воду для инъекций. В одном из вариантов воплощения пептид GLP-1 имеет структуру (His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg)2-генетически слитый с человеческим альбумином. Албиглутид представляет собой гибридный белок рекомбинантный человеческий сывороточный альбумин(HSA)-GLP-1, вероятно, димер GLP-1, слитый с HSA. Входящий в состав пептид GLP-1 представляет собой аналог, в котором Ala в позиции 8 был замещен на Glu. В одном из вариантов воплощения пептид GLP-1 представляет собой дулаглутид. Дулаглутид представляет собой конструкцию GLP-1-Fc (GLP-1-линкер-Fc из IgG4). В одном из вариантов воплощения пептид GLP-1 имеет структуру His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Aib-Arg. Лираглутид, представляющий собой моноацилированный агонист GLP-1 для введения один раз в день, который продается с 2009 компанией Novo Nordisk A/S, раскрыт в WO 98/08871, Пример 37.

В одном из вариантов воплощения настоящее изобретение включает фармацевтически приемлемые соли агонистов GLP-1. Такие соли включают фармацевтически приемлемые соли присоединения кислоты, фармацевтически приемлемые соли металлов, аммонийные соли и соли алкиламмония. Также фармацевтически приемлемые соли присоединения кислоты включают гидраты, которые могут образовывать агонисты GLP-1.

В одном из вариантов воплощения способ введения агонистов GLP-1 может представлять собой любой способ, который эффективно транспортирует активное соединение к соответствующему или нужному месту действия, такой как парентеральное введение. В одном из вариантов воплощения лекарственные средства или фармацевтические композиции, включающие агонист GLP-1, такой как семаглутид, можно вводить нуждающемуся в этом пациенту парентерально. В одном из вариантов воплощения парентеральное введение можно осуществить путем подкожной, внутримышечной или внутривенной инъекции с помощью шприца, необязательно, шприца-ручки.

Альтернативно, парентеральное введение можно осуществить с помощью инфузионной помпы. Еще один вариант представляет собой композицию, которая может представлять собой порошок или жидкость для введения агониста GLP-1 в форме назального или легочного спрея. В еще одном варианте, агонист GLP-1 также можно вводить трансдермально, например, из пластыря, необязательно, ионтофоретического пластыря, или трансмукозально, например, буккально. Вышеупомянутые возможные способы введения агонистов GLP-1 не рассматриваются как ограничивающие объем данного изобретения.

В одном из вариантов воплощения агонист GLP-1 вводят совместно с дополнительным терапевтически активным агентом, применяемым в способах лечения, определенных в настоящем документе.

В одном из вариантов воплощения пептид GLP-1 включает последовательность аминокислот формулы (I):

где Хаа7 представляет собой L-гистидин, D-гистидин, дезамино-гистидин, 2-амино-гистидин, β-гидрокси-гистидин, гомогистидин, Nα-ацетил-гистидин, α-фторметил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1-аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Хаа16 представляет собой Val или Leu;

Xaa18 представляет собой Ser, Lys или Arg;

Хаа19 представляет собой Tyr или Gin;

Хаа20 представляет собой Leu или Met;

Хаа22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gin, Glu, Lys или Arg;

Хаа25 представляет собой Ala или Val;

Хаа26 представляет собой Lys, Glu или Arg;

Хаа27 представляет собой Glu или Leu;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа33 представляет собой Val или Lys;

Хаа34 представляет собой Lys, Glu, Asn или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg, Gly или Lys;

Хаа37 представляет собой Gly, Ala, Glu, Pro, Lys, амид или отсутствует;

Хаа38 представляет собой Lys, Ser, амид или отсутствует;

Хаа39 представляет собой Ser, Lys, амид или отсутствует;

Хаа40 представляет собой Gly, амид или отсутствует;

Хаа41 представляет собой Ala, амид или отсутствует;

Хаа42 представляет собой Pro, амид или отсутствует;

Хаа43 представляет собой Pro, амид или отсутствует;

Хаа44 представляет собой Pro, амид или отсутствует;

Хаа45 представляет собой Ser, амид или отсутствует;

Хаа46 представляет собой амид или отсутствует;

при условии, что, если Хаа38, Хаа39, Хаа40, Хаа41, Хаа42, Хаа43, Хаа44, Хаа45 или Хаа46 отсутствует, то каждый аминокислотный остаток после них также отсутствует.

В одном из вариантов воплощения пептид GLP-1 включает последовательность аминокислот формулы (II):

где Хаа7 представляет собой L-гистидин, D-гистидин, дезамино-гистидин, 2-амино-гистидин, β-гидрокси-гистидин, гомогистидин, Nα-ацетил-гистидин, α-фторметил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, lie, Lys, Aib, (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1-аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Хаа18 представляет собой Ser, Lys или Arg;

Xaa22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gin, Glu, Lys или Arg;

Хаа26 представляет собой Lys, Glu или Arg;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа34 представляет собой Lys, Glu или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg или Lys;

Хаа37 представляет собой Gly, Ala, Glu или Lys;

Хаа38 представляет собой Lys, амид или отсутствует.

В одном из вариантов воплощения пептид GLP-1 представляет собой защищенный от DPPIV пептид GLP-1.

В одном из вариантов воплощения пептид GLP-1 является стабилизированным по отношению к DPPIV.

В одном из вариантов воплощения пептид GLP-1 включает остаток Aib в позиции 8.

В одном из вариантов воплощения аминокислотный остаток в позиции 7 указанного пептида GLP-1 выбран из группы, состоящей из D-гистидина, дезамино-гистидина, 2-амино-гистидина, β-гидрокси-гистидина, гомогистидина, Nα-ацетил-гистидина, α-фторметил-гистидина, α-метил-гистидина, 3-пиридилаланина, 2-пиридилаланина и 4-пиридилаланина.

В одном из вариантов воплощения пептид GLP-1 включает Arg34GLP-1 (7-37) или [Aib8,Arg34]GLP-1-(7-37).

В одном из вариантов воплощения агонист GLP-1 включает связывающий альбумин остаток, который присоединен ковалентно, необязательно, через гидрофильный спейсер. В одном из вариантов воплощения указанный связывающий альбумин остаток присоединен ковалентно, необязательно, через гидрофильный спейсер, к С-концевому аминокислотному остатку указанного пептида GLP-1 или к аминокислотному остатку, который не является С-концевым аминокислотным остатком. В одном из вариантов воплощения пептид GLP-1 присоединен к гидрофильному спейсеру через аминокислотный остаток в позиции 23, 26, 34, 36 или 38 в соответствии с аминокислотной последовательностью GLP-1 (7-37).

Человеческий глюкагоноподобный пептид-1 представляет собой GLP-1(7-37) и имеет последовательность HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 1). GLP-1 (7-37) также может называться "нативным" GLP-1. В перечне последовательностей первый аминокислотный остаток SEQ ID NO: 1 (гистидин) обозначен номером 1. Тем не менее, в дальнейшем, в соответствии с установившейся практикой в данной области техники, этот остаток гистидина обозначается как номер 7, и последующие аминокислотные остатки нумеруются соответственно, заканчиваясь глицином под номером 37. Поэтому, обычно, любая ссылка в настоящем документе на номер аминокислотного остатка или номер позиции последовательности GLP-1(7-37) дается по отношению к последовательности, начинающейся с His в позиции 7 и заканчивающейся Gly в позиции 37. Не имеющим ограничительного характера примером подходящей номенклатуры аналога является [Aib8,Arg34,Lys37]GLP-1(7-37), что обозначает аналог GLP-1(7-37), в котором аланин в позиции 8 был замещен на а-аминоизомасляную кислоту (Aib), лизин в позиции 34 был замещен на аргинин и глицин в позиции 37 был замещен на лизин.

В одном из вариантов воплощения агонист GLP-1 имеет, по меньшей мере, 60%, 65%, 70%, 80% или 90% идентичности последовательностей с GLP-1(7-37) по всей длине GLP-1(7-37). В качестве примера способа определения идентичности последовательностей между двумя аналогами выравнивают два пептида [Aib8]GLP-1(7-37) и GLP-1(7-37). Идентичность последовательностей [Aib8]GLP-1(7-37) по отношению к GLP-1(7-37) определяется как число идентичных выровненных остатков минус число различающихся остатков, деленное на общее число остатков в GLP-1(7-37). Соответственно в указанном примере идентичность последовательностей составляет (31-1)/31. В одном из вариантов воплощения непептидный фрагмент агониста GLP-1 не учитывается при определении идентичности последовательностей.

В одном из вариантов воплощения агонист GLP-1 представляет собой производное. В одном из вариантов воплощения использованный в настоящем документе термин "производное" в контексте агониста GLP-1, пептида или аналога означает химически модифицированный агонист GLP-1, пептид или аналог, в которых к агонисту, пептиду или аналогу были ковалентно присоединены один или несколько заместителей. Заместитель также может относиться к боковой цепи. Типичные модификации представляют собой модификации амидными группами, углеводами, алкильными группами, ацильными группами, сложноэфирными группами и тому подобное. Примером производного GLP-1(7-37) является Nε26-(γ-Glu(Nα-гексадеканоил))- [Arg34, Lys25])GLP-1(7- 37).

В конкретном варианте воплощения, боковая цепь может образовывать нековалентные агрегаты с альбумином, тем самым способствуя циркуляции агониста GLP-1 в кровяном русле, и также увеличивая продолжительность действия агониста GLP-1 по причине того, что агрегат агониста GLP-1 и альбумина медленно разрушается с высвобождением активного фармацевтического ингредиента. Таким образом, заместитель или боковая цепь, в целом, могут называться связывающим альбумин фрагментом.

В конкретных вариантах воплощения, боковая цепь имеет, по меньшей мере, 10 атомов углерода, или, по меньшей мере, 15, 20, 25, 30, 35, или, по меньшей мере, 40 атомов углерода. В другом конкретном варианте воплощения, боковая цепь также может включать, по меньшей мере, 5 гетероатомов, в частности, О и N, например, по меньшей мере, 7, 9, 10, 12, 15, 17, или, по меньшей мере, 20 гетероатомов, например, по меньшей мере, 1, 2 или 3 N-атомов и/или, по меньшей мере, 3, 6, 9, 12 или 15 О-атомов.

В другом конкретном варианте воплощения связывающий альбумин фрагмент включает часть, которая в особенности отвечает за связывание альбумина и, тем самым, увеличивает продолжительность действия, такая часть может соответственно называться фрагментом, обеспечивающим увеличение продолжительности действия. Фрагмент, обеспечивающий увеличение продолжительности действия, может находиться на противоположном конце связывающего альбумин фрагмента по отношению к точке присоединения пептида или вблизи него.

В еще одном варианте воплощения связывающий альбумин фрагмент включает часть между фрагментом, обеспечивающим увеличение продолжительности действия, и точкой присоединения к пептиду, которая может называться линкером, линкерным фрагментом, спейсером или тому подобным. Линкер может быть необязательным, и, таким образом, в этом случае, связывающий альбумин фрагмент может быть идентичен фрагменту, обеспечивающему увеличение продолжительности действия.

В конкретных вариантах воплощения, связывающий альбумин фрагмент и/или фрагмент, обеспечивающий увеличение продолжительности действия, являются липофильными и/или отрицательно заряженными при физиологическом рН (7,4).

Связывающий альбумин фрагмент, фрагмент, обеспечивающий увеличение продолжительности действия, или линкер могут быть ковалентно присоединены к остатку лизина пептида GLP-1 путем ацилирования. Дополнительные или альтернативные химические реакции конъюгации включают алкилирование, образование сложного эфира или образование амида, или связывание с остатком цистеина, такое как связывание с помощью малеимида или галогенацетамида (такого, как бром-/фтор-/иод-).

В одном из вариантов воплощения активный сложный эфир связывающего альбумин фрагмента, например, включающего фрагмент, обеспечивающий увеличение продолжительности действия, и линкер, ковалентно связан с аминогруппой остатка лизина, например, его эпсилон аминогруппой, с образованием амидной связи (этот процесс называется ацилированием).

Если не указано иное, когда дается ссылка на ацилирование остатка лизина, понятно, что ацилирование осуществляется по эпсилон аминогруппе.

Для целей настоящего документа, термины "связывающий альбумин фрагмент", "фрагмент, обеспечивающий увеличение продолжительности действия" и "линкер" могут включать как не вступившие в реакцию, так и вступившие в реакцию формы этих молекул. Какая из форм подразумевается в каждом случае, ясно из контекста, в котором используется данный термин.

Для присоединения к агонисту GLP-1 кислотная группа жирной кислоты или одна из кислотных групп жирных дикарбоновых кислот образует амидную связь с эпсилон аминогруппой остатка лизина в пептиде GLP-1, например, через линкер.

В одном из вариантов воплощения термин "жирная кислота" относится к алифатическим монокарбоновым кислотам, имеющим от 4 до 28 атомов углерода, она необязательно является неразветвленной и/или иметь четное число атомов, и она может быть насыщенной или ненасыщенной.

В одном из вариантов воплощения термин "жирная дикарбоновая кислота" относится к жирным кислотам, как определено выше, но имеющим дополнительную карбоксильную кислотную группу в омега позиции. Таким образом, жирные дикарбоновые кислоты представляют собой дикарбоновые кислоты.

Каждый из двух линкеров агониста GLP-1 по настоящему изобретению может включать следующий первый линкерный элемент:

Chem. 5:

где k представляет собой целое число в диапазоне 1-5, и n представляет собой целое число в диапазоне 1-5.

В конкретном варианте воплощения, где k=1 и n=1, этот линкерный элемент может быть обозначен OEG или ди-радикал 8-амино-3,6-диоксаоктановой кислоты, и/или может быть представлен следующей формулой:

Chem. 5а:

В другом конкретном варианте воплощения, каждый линкер агониста GLP-1 по настоящему изобретению может также включать, независимо, второй линкерный элемент, например ди-радикал Glu, такой, как Chem. 6 и/или Chem. 7:

Chem. 6:

Chem. 7:

где ди-радикал Glu может быть включен p раз, где p представляет собой целое число в диапазоне 1-3.

Chem. 6 также может называться гамма-Glu или кратко gGlu, поскольку в данном случае гамма карбоксильная группа аминокислоты глутаминовой кислоты используется для соединения с другим линкерным элементом или с эпсилон-аминогруппой лизина. Как указывалось выше, другой линкерный элемент, например, может представлять собой другой остаток Glu или другую молекулу OEG. Аминогруппа Glu, в свою очередь, образует амидную связь с карбоксильной группой фрагмента, обеспечивающего увеличение продолжительности действия, или с карбоксильной группой, например, молекулы OEG, если она присутствует, или с гамма-карбоксильной группой, например, другого Glu, если он присутствует.

Chem. 7 также может называться альфа-Glu или кратко aGlu, или просто Glu, поскольку в данном случае альфа карбоксильная группа аминокислоты глутаминовой кислоты используется для соединения с другим линкерным элементом или с эпсилон-аминогруппой лизина.

Вышеприведенные структуры Chem. 6 и Chem. 7 относятся как к L-форме, так и к D-форме Glu. В конкретных вариантах воплощения, Chem. 6 и/или Chem. 7 независимо находится(находятся) а) в L-форме или b) в D-форме.

В еще одном конкретном варианте воплощения линкер имеет: а) от 5 до 41 С-атомов и/или b) от 4 до 28 гетероатомов.

Концентрацию агонистов GLP-1 по настоящему изобретению в плазме можно определить с использованием любого подходящего способа. Например, можно использовать LC-MS (жидкостная хроматография-масс-спектрометрия) или иммуноанализы, такие как RIA (радиоиммуноанализ), ELISA (твердофазный иммуноферментный анализ) и LOCI (люминесцентный иммуноанализ с каналированием кислорода (Luminescent Oxygen Channeling Immunoassay)). Общие протоколы для подходящих анализов RIA и ELISA можно найти, например, в WO 09/030738 на с. 116-118. Предпочтительным анализом является LOCl (люминесцентный иммуноанализ с каналированием кислорода), который обычно осуществляют, как описано для определения инсулина Poulsen and Jensen в Journal of Biomolecular Screening 2007, vol. 12, p. 240-247, - кратко, образцы крови можно собрать через определенные промежутки времени, отделить плазму, немедленно заморозить и хранить при -20°С до того, как будет анализироваться концентрация соответствующего агониста GLP-1 в плазме; донорные шарики покрыты стрептавидином, тогда как акцепторные шарики конъюгированы с моноклональным антителом, распознающим срединный-/С-концевой эпитоп пептида; другое моноклональное антитело, специфичное к N-концу, является биотинилированным; три реагента объединяют с аналитом, и они образуют трехслойный иммунокомплекс; в результате освещения комплекса из донорных шариков высвобождаются атомы синглетного кислорода, которые направляются к акцепторным шарикам и вызывают хемилюминесценцию, которая может быть измерена в планшетном сканере Envision; количество света пропорционально концентрации соединения.

В одном из вариантов воплощения использованный в настоящем документе термин "Aib" относится к α-аминоизомасляной кислоте.

Фармацевтические композиции

Вводимая доза может содержать 5 мг - 100 мг агониста GLP-1, или 5-50 мг, или 5-20 мг, или 5-10 мг агониста GLP-1.

В одном из вариантов воплощения композиция представляет собой BYDUREON® (препарат эксенатида с длительным высвобождением в частицах PLGA).

Фармацевтические композиции, которые включают агонист GLP-1 по настоящему изобретению или их фармацевтически приемлемую соль, амид или сложный эфир и фармацевтически приемлемый эксципиент, могут быть получены, как известно в данной области техники.

В одном из вариантов воплощения термин "эксципиент" в широком смысле относится к любому компоненту, отличному от активного терапевтического ингредиента (ингредиентов). Эксципиент может представлять собой инертное вещество, неактивное вещество и/или не терапевтически активное вещество. Лекарственные формы фармацевтически активных ингредиентов с различными эксципиентами известны в данной области техники, см., например, Remington: The Science and Practice of Pharmacy (например, 19-е издание (1995) и любые более поздние издания). Примерами эксципиентов, не имеющими ограничительного характера, являются: растворители, разбавители, буферы, консерванты, регуляторы тоничности (например, изотонические агенты), хелатирующие агенты, стабилизаторы (например, антиоксиданты, ингибиторы агрегации, сурфактанты и/или ингибиторы протеаз).

Примеры лекарственных форм включают жидкие лекарственные формы, т.е. водные препараты, включающие воду. Жидкая лекарственная форма может представлять собой раствор или суспензию. Водная лекарственная форма, как правило, включает, по меньшей мере, 50% вес/вес воды, или, по меньшей мере, 60%, 70%, 80% или даже, по меньшей мере, 90% воды.

Альтернативно, фармацевтическая композиция может представлять собой твердую лекарственную форму, например, лиофилизированную или высушенную распылением композицию, которую можно применять в таком виде, как она есть, или в которую врач или пациент перед применением добавляет растворители и/или разбавители.

рН в водном препарате может быть любым в диапазоне между рН 3 и рН 10, например, от примерно 7,0 до примерно 9,5; или от примерно 3,0 до примерно 7,0.

Более того, фармацевтическая композиция может быть составлена в виде лекарственной формы, как это известно в области пероральных лекарственных форм инсулинотропных соединений, например, с использованием любой одной или нескольких лекарственных форм, описанных в WO 2008/145728.

Композицию можно вводить в нескольких лекарственных формах, например, в виде раствора; суспензии; эмульсии; микроэмульсии; множественной эмульсии; пены; крема; пасты; пластыря; мази; таблетки; таблетки, покрытой оболочкой; жевательной резинки; ополаскивателя; капсулы, такой как твердая или мягкая желатиновая капсула; суппозитория; ректальной капсулы; капель; геля; спрея; порошка; аэрозоля; средства для ингаляций; глазных капель; офтальмологической мази; жидкости для промывания глаз; вагинального пессария; влагалищного кольца; вагинальной мази; раствора для инъекций; раствора, трансформирующегося in situ, например, претерпевающего гелеобразование in situ, застывание, преципитацию и кристаллизацию in situ; раствора для инфузий; или в виде имплантата.

Композиция может быть далее объединена с носителем лекарства или системой доставки лекарства, например, чтобы улучшить стабильность, биодоступность и/или растворимость. В конкретном варианте воплощения композиция может быть присоединена к такой системе посредством ковалентных, гидрофобных и/или электростатических взаимодействий. Целью такого объединения может быть, например, уменьшение нежелательных эффектов, достижение хронотерапии и/или повышение удобства для пациента.

Композицию также можно применять в лекарственной форме с контролируемым, пролонгированным, длительным, замедленным высвобождением и/или в системе доставки лекарства с замедленным высвобождением.

Композиция может быть введена путем парентерального введения. Парентеральное введение можно осуществить путем подкожной, внутримышечной, внутрибрюшинной или внутривенной инъекции с помощью шприца, необязательно шприца-ручки, или с помощью инфузионной помпы.

Способы получения

В одном из вариантов воплощения пептиды GLP-1 могут быть получены путем соответствующей дериватизации соответствующего пептидного остова, который был получен с помощью технологии рекомбинантных ДНК или с помощью пептидного синтеза (например, твердофазный синтез по Меррифилду), как это известно в области пептидного синтеза и химии пептидов.

В одном из вариантов воплощения получение пептидов, подобных GLP-1(7-37) и аналогам GLP-1, хорошо известно в данной области техники. Фрагмент GLP-1 пептида GLP-1 по настоящему изобретению (или его фрагменты), например, может быть получен с помощью классического пептидного синтеза, например, твердофазного пептидного синтеза с использованием t-Boc или Fmoc или с помощью других надежно отработанных методов; см., например, Greene and Wuts, "Protective Groups in Organic Synthesis", John Wiley & Sons, 1999, Florencio Zaragoza Dorwald, "Organic Synthesis on solid Phase", Wiley-VCH Verlag GmbH, 2000 и "Fmoc Solid Phase Peptide Synthesis", под редакцией W.C. Chan and P.D. White, Oxford University Press, 2000.

В одном из вариантов воплощения агонисты GLP-1 могут быть получены рекомбинантными способами, а именно путем культивирования клеток-хозяев, содержащих последовательность ДНК, кодирующую агонист GLP-1, и способных экспрессировать пептид в подходящую питательную среду в условиях, делающих возможной экспрессию пептида. Примерами клеток-хозяев, подходящих для экспрессии этих пептидов, не имеющими ограничительного характера, являются: Escherichia coli, Saccharomyces cerevisiae, а также клеточные линии млекопитающих ВНК или СНО.

В одном из вариантов воплощения агонисты GLP-1 по настоящему изобретению, которые включают неприродные аминокислоты и/или ковалентно присоединенный N-концевой моно- или дипептидомиметик, могут быть получены, например, как описано в экспериментальной части. Или см., например, Hodgson et al: "The synthesis of peptides and proteins containing non-natural amino acids", Chemical Society Reviews, vol. 33, no. 7 (2004), p. 422-430; и WO 2009/083549 A1, озаглавленную "Semi-recombinant preparation of GLP-1 analogues".

Варианты воплощения изобретения

Ниже приведены варианты воплощения настоящего изобретения, не имеющие ограничительного характера.

1. Способ снижения HbA1c или предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, где указанный способ включает введение агониста GLP-1 нуждающемуся в этом субъекту в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

2. Способ лечения или предотвращения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где указанный способ включает введение агониста GLP-1 нуждающемуся в этом субъекту в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

3. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный способ включает замедление или предотвращение прогрессирования диабетического заболевания.

4. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 имеет время полужизни, составляющее, по меньшей мере, 24 часа, например, по меньшей мере, 48 часов, по меньшей мере, 60 часов, или, по меньшей мере, 72 часа, или например, по меньшей мере, 84 часа, по меньшей мере, 96 часов, или, по меньшей мере, 108 часов, или, необязательно, по меньшей мере, 120 часов, по меньшей мере, 132 часа, или, по меньшей мере, 144 часа, где указанное время полужизни необязательно определено с помощью анализа (II).

5. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят два раза в неделю или реже, один раз в неделю или реже, например, реже, чем один раз в неделю, или один раз в две недели или реже, или например, один раз в три недели или реже, или один раз в месяц или реже.

6. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят в количестве, по меньшей мере, 0,8 мг, по меньшей мере, 1,0 мг, или, по меньшей мере, 1,2 мг, например, по меньшей мере, 1,4 мг или, по меньшей мере, 1,6 мг в неделю.

7. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят в количестве, эквивалентном, по меньшей мере, 0,8 мг, по меньшей мере, 1,0 мг, или, по меньшей мере, 1,2 мг, например, по меньшей мере, 1,4 мг или, по меньшей мере, 1,6 мг, семаглутида в неделю.

8. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят в количестве, которое обеспечивает улучшенное а) снижение HbA1c или b) снижение веса тела по сравнению с введением 1,8 мг лираглутида в день или меньше, например, 0,8 мг лираглутида в день или меньше.

9. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 выбран из группы, состоящей из семаглутида, эксенатида, албиглутида и дулаглутида.

10. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят путем парентерального введения, такого как подкожная инъекция.

11. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 вводят одновременно или последовательно с другим терапевтически агентом.

12. Способ в соответствии с любым из предыдущих вариантов воплощения, где агонист GLP-1 представляет собой пептид GLP-1.

13. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 включает аминокислотную последовательность формулы (I):

Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa16-Ser-Xaa18-

Xaa19Xaa20GluXaa22-Xaa23-Ala-Xaa25-Xaa26-Xaa27-Prie-Ile-Xaa3o-Trp-Leu-

Хаа33-Хаа34-Xaa35-Хаа36-Xaa37-Хаа38-Хаа39-Xaa40-Хаа41-Хаа42-Хаа43-Xaa44-Xaa45-Xaa46

Формула (I),

где Хаа7 представляет собой L-гистидин, D-гистидин, дезамино-гистидин, 2-амино-гистидин, β-гидрокси-гистидин, гомогистидин, Nα-ацетил-гистидин, α-фторметил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, lie, Lys, Aib, (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1-аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Xaa16 представляет собой Val или Leu;

Xaa18 представляет собой Ser, Lys или Arg;

Xaa19 представляет собой Tyr или Gin;

Хаа20 представляет собой Leu или Met;

Хаа22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gin, Glu, Lys или Arg;

Хаа25 представляет собой Ala или Val;

Хаа26 представляет собой Lys, Glu или Arg;

Xaa27 представляет собой Glu или Leu;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа33 представляет собой Val или Lys;

Хаа34 представляет собой Lys, Glu, Asn или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg, Gly или Lys;

Хаа37 представляет собой Gly, Ala, Glu, Pro, Lys, амид или отсутствует;

Хаа38 представляет собой Lys, Ser, амид или отсутствует;

Хаа39 представляет собой Ser, Lys, амид или отсутствует;

Хаа40 представляет собой Gly, амид или отсутствует;

Хаа41 представляет собой Ala, амид или отсутствует;

Хаа42 представляет собой Pro, амид или отсутствует;

Хаа43 представляет собой Pro, амид или отсутствует;

Хаа44 представляет собой Pro, амид или отсутствует;

Хаа45 представляет собой Ser, амид или отсутствует;

Хаа46 представляет собой амид или отсутствует;

при условии, что, если Хаа38, Хаа39, Xaa40, Xaa41, Хаа42, Хаа43, Хаа44, Хаа45 или Хаа46 отсутствует, то каждый аминокислотный остаток после них также отсутствует.

14. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный полипептид представляет собой пептид GLP-1, включающий аминокислотную последовательность формулы (II):

где Хаа7 представляет собой L-гистидин, D-гистидин, дезамино-гистидин, 2-амино-гистидин, β-гидрокси-гистидин, гомогистидин, Nα-ацетил-гистидин, α-фторметил-гистидин, α-метил-гистидин, 3-пиридилаланин, 2-пиридилаланин или 4-пиридилаланин;

Хаа8 представляет собой Ala, Gly, Val, Leu, He, Lys, Aib, (1-аминоциклопропил)карбоновую кислоту, (1-аминоциклобутил)карбоновую кислоту, (1-аминоциклопентил)карбоновую кислоту, (1-аминоциклогексил)карбоновую кислоту, (1-аминоциклогептил)карбоновую кислоту или (1-аминоциклооктил)карбоновую кислоту;

Xaa18 представляет собой Ser, Lys или Arg;

Хаа22 представляет собой Gly, Glu или Aib;

Хаа23 представляет собой Gin, Glu, Lys или Arg;

Хаа26 представляет собой Lys, Glu или Arg;

Хаа30 представляет собой Ala, Glu или Arg;

Хаа34 представляет собой Lys, Glu или Arg;

Хаа35 представляет собой Gly или Aib;

Хаа36 представляет собой Arg или Lys;

Хаа37 представляет собой Gly, Ala, Glu или Lys;

Хаа38 представляет собой Lys, амид или отсутствует.

15. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 выбран из группы GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-амид, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40), GLP-1 (7-41) или их аналогов или производных.

16. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 включает не больше 15, например, не больше 10 или не больше 6 аминокислотных остатков, которые были замещены, вставлены или удалены по сравнению с GLP-1 (7-37).

17. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 включает не больше 5 аминокислотных остатков, которые были замещены, вставлены или удалены по сравнению с GLP-1 (7-37).

18. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 включает не больше 4 аминокислотных остатков, которые не кодируются генетическим кодом.

19. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 представляет собой защищенный от DPPIV пептид GLP-1.

20. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 является стабилизированным по отношению к DPPIV.

21. Способ в соответствии с любым из предыдущих вариантов воплощения, где указанный пептид GLP-1 включает остаток Aib в позиции 8.

22. Способ в соответствии с любым из предыдущих вариантов воплощения, где аминокислотный остаток в позиции 7 указанного пептида GLP-1 выбран из группы, состоящей из D-гистидина, дезамино-гистидина, 2-амино-гистидина, β-гидрокси-гистидина, гомогистидина, Nα-ацетил-гистидина, α-фторметил-гистидина, α-метил-гистидина, 3-пиридилаланина, 2-пиридилаланина и 4-пиридилаланина.

23. Способ в соответствии с любым из вариантов воплощения от 7 до 16, где указанный пептид GLP-1 присоединен к указанному гидрофильному спейсеру посредством аминокислотного остатка в позиции 23, 26, 34, 36 или 38 в соответствии с аминокислотной последовательностью GLP-1 (7-37).

24. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 представляет собой эксендин-4, аналог эксендина-4 или производное эксендина-4.

25. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 включает аминокислотную последовательность, соответствующую формуле:

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu

Phe-lle-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.

26. Способ в соответствии с любым из предыдущих вариантов воплощения, где один связывающий альбумин остаток присоединен к С-концевому аминокислотному остатку указанного пептида GLP-1 через указанный гидрофильный спейсер.

27. Способ в соответствии с любым из предыдущих вариантов воплощения, где второй связывающий альбумин остаток присоединен к аминокислотному остатку, которые не является С-концевым аминокислотным остатком.

28. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 выбран из группы, состоящей из семаглутида, албиглутида и дулаглутида.

29. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 имеет следующую структуру:

His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Aib-Arg.

30. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 имеет следующую структуру:

(His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg)2-генетически слитый с человеческим альбумином.

31. Способ в соответствии с любым из предыдущих вариантов воплощения, где пептид GLP-1 представляет собой дулаглутид.

32. Способ в соответствии с любым из предыдущих вариантов воплощения, где агонист GLP-1 имеет ЕС50, равную 3000 пМ или меньше, например, 500 пМ или меньше, или 100 пМ или меньше, где ЕС50 необязательно определяют с помощью анализа (I).

33. Агонист GLP-1 для применения для снижения НЬА1 с или для применения для предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, включающего введение агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

34. Агонист GLP-1 для применения для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, включающего введение агониста GLP-1 в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

35. Агонист GLP-1 для применения в соответствии с вариантом воплощения 33 или 34, где указанный агонист GLP-1 и/или введение представляют собой такой агонист и/или такое введение, как определено в любом из вариантов воплощения 1-32 или 40.

36. Композиция, включающая агонист GLP-1 и один или несколько фармацевтически приемлемых эксципиентов, для применения для снижения НЬА1 с или для предотвращения или лечения диабета 2 типа, гипергликемии, нарушения толерантности к глюкозе или инсулиннезависимого диабета, где указанный агонист GLP-1 вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

37. Композиция, включающая агонист GLP-1 и один или несколько фармацевтически приемлемых эксципиентов для применения для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где указанный агонист GLP-1 вводят в количестве, по меньшей мере, 0,7 мг в неделю, где такое количество эквивалентно, по меньшей мере, 0,7 мг семаглутида в неделю.

38. Композиция для применения в соответствии с любым из предыдущих вариантов воплощения, где указанный агонист GLP-1 и/или введение представляют собой такой агонист и/или такое введение, как определено в любом из вариантов воплощения 1-32 или 40.

39. Композиция для применения в соответствии с любым из предыдущих вариантов воплощения, где указанная композиция включает композицию Bydureon®.

40. Способ в соответствии с любым из предыдущих пунктов, где способ включает предотвращение, лечение, снижение или индукционную терапию одного или нескольких заболеваний или состояний, определенных в любом из предыдущих вариантов воплощения.

ПРИМЕРЫ

Аббревиатуры

Ниже используются следующие аббревиатуры, приведены в алфавитном порядке.

ADA: Американская диабетическая ассоциация.

Пример 1: пептид GLP-1 семаглутид обеспечивает снижение HbA1c и веса тела

Семаглутид представляет собой уникальный ацилированный пептид GLP-1 с временем полужизни, составляющим 160 часов. Задачей было исследовать зависимость доза-ответ для HbA1c в зависимости от разных доз семаглутида один раз в неделю (пять уровней доз) у субъектов с диабетом 2 типа. Также были проведены исследования безопасности, переносимости и фармакодинамики семаглутида в сравнении с плацебо и немаскированным введением лираглутида один раз в день.

Материалы и способы

Лираглутид может быть получен, как описано в Примере 37 в WO 98/08871. Семаглутид может быть получен, как описано в Примере 4 в WO 2006/097537. Вводимая композиция агонистов GLP-1 может быть составлена виде изотонических водных растворов с фосфатным буфером, таким как буфер на основе дигидрофосфата натрия, имеющий рН в диапазоне 7,0-9,0, например, рН 7,4 или рН 8,15, например, дополнительно содержащий эксципиенты пропиленгликоль и фенол. Вводимая композиция агонистов GLP-1 может представлять собой композицию, описанную в WO 2003/002136 или WO 2005/049061. Композиция плацебо может быть идентична композиции агонистов GLP-1, но не содержит агонист GLP-1.

В 12-недельном, рандомизированном, двойном слепом, плацебо-контролируемом исследовании приняли участие 411 пациентов (n=43-50 в группе) с диабетом 2 типа. Участникам (мужчины/женщины 65/35%; исходный HbA1c (среднее значение ±80) 8,1±0,8%; исходный вес тела 87,5±13,8 кг; продолжительность диабета 2,6±3,1 лет; только метформин/только диета и упражнения 80/20%) делали подкожные инъекции одной из пяти доз семаглутида (0,1-1,6 мг) один раз в неделю, немаскированное введение лираглутида (1,2 мг, 1,8 мг) один раз в день или введение плацебо один раз в неделю. Две из доз семаглутида титровали (Т) с еженедельным шагом 0,4 мг. Первичной конечной точкой было изменение уровня HbA1c по сравнению с исходным значением. Вторичные конечные точки эффективности включали долю субъектов, достигших целевых значений HbA1c по ADA (<7%) и изменение веса тела. Указанное изменение и процент целевых значений были проанализированы с помощью ANOVA и логистической регрессии, соответственно. Для сравнений между семаглутидом и лираглутидом не делалась поправка на множественность. Исходные характеристики субъектов приведены в Таблице 1.

Данные представляют собой средние значения (SD), если не указано иное. * Количество субъектов, подвергнутых данному лечению. D&E: диета и упражнения. FPG: уровень глюкозы в плазме натощак. BMI: индекс массы тела.

Результаты

В наборе данных для полного анализа семаглутид (>0,2 мг) приводил к дозозависимому снижению HbA1c по сравнению с исходным значением (Фиг. 1) и увеличивал вероятность достижения HbA1c <7% (р<0,05 в сравнении с плацебо для доз ≥0,2 мг). Эти результаты для изменения HbA1c показаны на Фиг. 1. Изменения HbA1c на Фиг. 1 даны по сравнению с исходным значением на 12 неделю. На Фиг. 2 показано изменение HbA1c с течением времени для разных видов лечения. В случае лечения с помощью £0,8 мг семаглутида численно больше пациентов достигают целевых показателей по сравнению с применением 1,8 мг лираглутида (0,8 мгТ, 69%, 0,8 мг, 73%, 1,6 мгТ, 81%, в сравнении с лираглутидом, 1,8 мг, 57%). Результаты (см., например, Фиг. 1) показывают, что лечение с помощью 0,8 мг, 0,8 мг Т или 1,6 мг Т семаглутида характеризуется улучшенным снижением HbA1c по сравнению с лечением с помощью 1,2 мг или 1,8 мг лираглутида; более того, результаты лечения с помощью 1,6 мг Т семаглутида были статистически лучше по сравнению с лечением с помощью 1,2 мг или 1,8 мг лираглутила в отношении снижения HbA1c (на основании нескорректированных средних значений). На Фиг. 3 приведены процент и количество субъектов, удовлетворяющих критериям ААСЕ или ADA, для разных видов лечения. Эти результаты (см. Фиг. 3) показывают, что лечение с помощью 0,8 мг, 0,8 мг Т или 1,6 мг Т семаглутида увеличивает процент и количество субъектов, удовлетворяющих критериям ААСЕ или ADA для гликемического контроля, по сравнению с лечением с помощью 1,2 мг или 1,8 мг лираглутида.

Вес тела дозозависимо снижался по сравнению с исходным значением вплоть до 4,8 кг в сравнении с 1,2 кг при введении плацебо (р<0,01 для доз ≥0,8 мг). На Фиг. 4 и 5 приведено среднее изменение веса тела с течением времени и изменение веса тела по сравнению с исходным значением на 12 неделю, соответственно, для разных видов лечения. Результаты (см., например, Фиг. 5) показывают, что лечение с помощью 0,8 мг, 0,8 мг Т или 1,6 мг Т семаглутида увеличивает снижение веса тела по сравнению с лечением с помощью 1,2 мг или 1,8 мг лираглутида. Более того, результаты (см., например, Фиг. 5) показывают, что лечение с помощью 0,8 мг Т или 1,6 мг Т семаглутида давало статистически лучшие результаты снижения веса по сравнению с 1,8 мг лираглутида; и что результаты лечения с помощью 0,8 мг, 0,8 мг Т или 1,6 мг Т семаглутида были статистически лучше по сравнению с 1,2 мг лираглутида в отношении снижения веса тела (на основании нескорректированных средних значений).

Не было отмечено случаев панкреатита или изменения уровня кальцитонина в крови, связанных с лечением. Доля субъектов, у которых наблюдались тошнота и рвота, увеличивалась с дозой, но они обычно были слабыми или умеренными и облегчались титрованием. Клиническое исследование было прекращено по причине желудочно-кишечных нежелательных явлений для 4,7%-27,7% случаев для семаглутида и для 2,2%-10% случаев для лираглутида. У нескольких субъектов наблюдалась небольшая гипогликемия (семаглутид n=5, лираглутид n=3); серьезная гипогликемия не наблюдалась. Реакции в месте инъекции наблюдались у 7 субъектов: семаглутид n=2; лираглутид n=5. У одного субъекта (семаглутид, 1,6 мг Т) были обнаружены не нейтрализующие антитела против семаглутида с низким титром (нет перекрестной реакции с нативным GLP-1).

Заключение

За 12 недель семаглутид приводил к дозозависимому снижению HbA1c и веса тела. Эффект 0,4 мг семаглутида на гликемический контроль и вес тела был сравним с эффектом 1,2 мг лираглутида, тогда как в случае ≥0,8 мг семаглутида больше субъектов достигли целевых показателей, и у них наблюдалось лучшее снижение веса, чем в случае 1,8 мг лираглутида. Не было выявлено проблем с безопасностью семаглутида. Повышение дозы не было основной целью этого исследования, и оно будет оптимизировано в будущих клинических исследованиях.

Фармакологические методики

Анализ (I): активность in vitro

Цель этого примера - протестировать активность агонистов GLP-1 in vitro. Активность агонистов GLP-1 можно определить, как описано ниже, т.е., по стимулированию образования циклического АМФ (цАМФ) в среде, содержащей мембраны, экспрессирующие человеческий рецептор GLP-1.

Принцип

Очищенные плазматические мембраны из стабильной трансфицированной клеточной линии, ВНК467-12А (tk-ts13), экспрессирующей человеческий рецептор GLP-1, стимулируют исследуемым агонистом GLP-1, и активность образования цАМФ измеряют с использованием набора для анализа цАМФ AlphaScreen™ от Perkin Elmer Life Sciences. Основной принцип анализа AlphaScreen заключается в конкуренции между эндогенным цАМФ и экзогенно добавленным биотин-цАМФ. Захват цАМФ достигается использованием специфичного антитела, конъюгированного с акцепторными шариками.

Клеточная культура и получение мембран

Для скрининга выбирают стабильную трансфицированную клеточную линию и клон с высокой экспрессией. Клетки выращивают при 5% CO2 в DMEM, 5% FCS, 1% Pen/Strep (пенициллин/стрептомицин) и 0,5 мг/мл селективного маркера G418.

Клетки при достижении приблизительно 80%-ной плотности промывают 2 раза PBS и собирают, используя раствор Версена (водный раствор тетранатриевой соли этилендиаминтетрауксусной кислоты), центрифугируют в течение 5 мин при 1000 об/мин и супернатант удаляют.Все дополнительные стадии проводят на льду. Клеточный осадок гомогенизируют с помощью Ultrathurax в течение 20-30 секунд в 10 мл буфера 1 (20 мМ Na-HEPES, 10 мМ ЭДТА, рН=7,4), центрифугируют 15 мин при 20000 об/мин и осадок ресуспендируют в 10 мл буфера 2 (20 мМ Na-HEPES, 0,1 мМ ЭДТА, рН=7,4). Суспензию гомогенизируют в течение 20-30 секунд и центрифугируют 15 мин при 20000 об/мин. Суспендирование в буфере 2, гомогенизацию и центрифугирование повторяют еще один раз и мембраны ресуспендируют в буфере 2. Определяют концентрацию белка и мембраны хранят при -80°С до применения.

Анализ осуществляют в плоскодонных 96-луночных планшетах с половинным объемом лунок (например, Costar, номер по каталогу: 3693). Конечный объем на лунку составляет 50 мкл.

Растворы и реагенты

Примеры растворов и реагентов приведены ниже.

Набор для анализа цАМФ AlphaScreen от Perkin Elmer Life Sciences (номер по каталогу: 6760625М) содержит анти-цАМФ акцепторные шарики (10 ЕД/мкл), стрептавидиновые донорные шарики (10 ЕД/мкл) и биотинилированный цАМФ (133 ЕД/мкл).

Буфер AlphaScreen, рН=7,4: 50 мМ Трис-HCl (Sigma, номер по каталогу: Т3253); 5 мМ HEPES (Sigma, номер по каталогу: Н3375); 10 мМ MgCl2, 6H2O (Merck, номер по каталогу: 5833); 150 мМ NaCl (Sigma, номер по каталогу: S9625); 0,01% Tween (Merck, номер по каталогу: 822184). Перед применением в буфер AlphaScreen были добавлены (указаны конечные концентрации): БСА (Sigma, номер по каталогу А7906): 0,1%; IBMX (Sigma, номер по каталогу I5879): 0,5 мМ; АТФ (Sigma, номер по каталогу А7699): 1 мМ; ГТФ (Sigma, номер по каталогу G8877): 1 мкМ.

Стандарт цАМФ (коэффициент разведения в анализе=5): раствор цАМФ: 5 мкл исходного 5 мМ раствора цАМФ+495 мкл буфера AlphaScreen.

Готовят подходящие серии разведений стандарта цАМФ в буфере AlphaScreen, а также агониста GLP-1, который должен быть протестирован, например, готовят следующие восемь концентраций агониста GLP-1: 10-7, 10-8, 10-9, 10-10, 10-11, 10-12, 10-13 и 10-14 М, и серии разведении цАМФ, например, от 10-6 до 3×10-11.

Мембраны/акцепторные шарики

Использовать мембраны hGLP-1/BHK 467-12А; 6 мкг/лунку соответствуют 0,6 мг/мл (количество мембран на лунку может варьировать).

"Без мембран": акцепторные шарики (конечная концентрация 15 мкг/мл) в буфере AlphaScreen.

"6 мкг/лунку мембран": мембраны + акцепторные шарики (конечная концентрация 15 мкг/мл) в буфере AlphaScreen.

Добавить 10 мкл образца "без мембран" к стандарту цАМФ (на лунку в двух повторах) и положительному и отрицательному контролям.

Добавить 10 мкл образца "6 мкг/лунку мембран" к GLP-1 и агонистам GLP-1 (на лунку в двух/трех повторах)

Положительный контроль: 10 мкл образца "без мембран" +10 мкл буфера AlphaScreen

Отрицательный контроль: 10 мкл образца "без мембран" +10 мкл исходного раствора цАМФ (50 мкМ)

Поскольку шарики чувствительны к прямому свету, манипулирование с ними осуществляют в темноте (в как можно более темных условиях) или при зеленом свете. Все разведения делают на льду.

Методика

1. Приготовить буфер AlphaScreen.

2. Растворить и разбавить агонисты GLP-1/стандарт цАМФ в буфере AlphaScreen.

3. Приготовить раствор донорных шариков и инкубировать 30 мин при комнатной температуре.

4. Добавить цАМФ/агонисты GLP-1 в планшет: 10 мкл в лунку.

5. Приготовить раствор мембран/акцепторных шариков и добавит его в планшет: 10 мкл в лунку.

6. Добавить донорные шарики: 30 мкл в лунку.

7. Обернуть планшет алюминиевой фольгой и инкубировать на шейкере в течение 3 часов (очень медленно) при комнатной температуре.

8. Измерить на AlphaScreen - каждый планшет предварительно инкубировать в AlphaScreen в течение 3 минут перед измерением.

Значения ЕС50 [пМ] можно рассчитать, используя программное обеспечение Graph-Pad Prism (версия 5). При необходимости, кратность изменения параметра по отношению к GLP-1 можно рассчитать, как ЕС50 (GLP-1)/ ЕС50 (аналог) - 3693,2.

Анализ (II): время полужизни в карликовых свиньях

Цель этого исследования - определить увеличение продолжительности действия in vivo для агонистов GLP-1 после внутривенного введения карликовым свиньям, т.е. увеличение продолжительности их действия. Это осуществляется в фармакокинетическом (РК) исследовании, в котором определяют терминальное время полужизни исследуемого агониста GLP-1. Терминальное время полужизни обычно означает период времени, который требуется для уменьшения вдвое некоторой концентрации в плазме, измеренной после начальной фазы распределения.

В исследованиях используют самцов карликовых свиней Gottingen, полученных из Ellegaard Gottingen Minipigs (Dalmose, Denmark), в возрасте приблизительно 7-14 месяцев и имеющих вес тела приблизительно 16-35 кг. Карликовых свиней размещают по-отдельности и кормят ограниченно один или два раза в день согласно диете SDS для карликовых свиней (Special Diets Services, Essex, UK). После, по меньшей мере, 2 недель акклиматизации каждому животному имплантируют два постоянных центральных венозных катетера в краниальную или каудальную полую вену. Животным дают 1 неделю на восстановление после операции и далее их используют для повторных фармакокинетических исследований с подходящим периодом выведения между введениями.

Животных не кормят в течение приблизительно 18 ч перед введением и в течение, по меньшей мере, 4 ч после введения, но они имеют ad libitum доступ к воде в течение всего этого периода.

Агонист GLP-1 растворяют в 50 мМ фосфате натрия, 145 мМ хлорида натрия, 0,05% Tween 80, рН 7,4 до концентрации обычно 20-60 нмоль/мл. Внутривенные инъекции (объем соответствует обычно 1-2 нмоль/кг, например, 0,033 мл/кг) соединений делают через один катетер, и образцы крови забирают в определенные моменты времени на протяжении 13 дней после введения (предпочтительно через другой катетер). Образцы крови (например, 0,8 мл) отбирают в буфер с ЭДТА (8 мМ) и далее центрифугируют при 4°С и 1942 G в течение 10 минут.Плазму распределяют в пробирки Micronic на сухом льду и хранят при -20°С до того, как будет проанализирована концентрация соответствующего GLP-1 соединения в плазме с использованием ELISA или другого аналогичного анализа на основе антител или LC-MS. Индивидуальные профили зависимости концентрации в плазме от времени анализируют с помощью некомпартментной модели с использованием WinNonlin v. 5.0 (Pharsight Inc., Mountain View, CA, USA), и определяют полученные терминальные времена полужизни (среднее гармоническое).

Анализ (III): влияние на уровень глюкозы в крови и вес тела

Цель этого исследования заключается в проверке влияния агонистов GLP-1 на уровень глюкозы в крови (BG) и вес тела (BW) в условиях диабета. Агонисты GLP-1 могут быть протестированы в исследовании зависимости доза-ответ в модели на мышах с ожирением и диабетом (мыши db/db), как описано ниже.

Пятьдесят мышей db/db (Taconic, Denmark), которых с рождения кормят согласно диете NIH31 (NIH 31М Rodent Diet, коммерчески доступна от Taconic Farms, Inc., US, см. www.taconic.com), включают в исследование в возрасте 7-9 недель. Мышам обеспечен свободный доступ к стандартному корму (например, Altromin 1324, Brogaarden, Gentofte, Denmark) и питьевой воде, их держат при 24°С. После 1-2 недель акклиматизации базальный уровень глюкозы оценивают два раза в течение двух последовательных дней (в 9 часов утра). 8 мышей с самыми низкими уровнями глюкозы в крови можно исключить из эксперимента. Основываясь на средних значениях уровней глюкозы в крови, остальные 42 мыши могут быть выбраны для дальнейших экспериментов и разделены на 7 групп (n=6) с совпадающими уровнями глюкозы в крови. Мышей можно использовать в экспериментах длительностью 5 дней до 4 раз. После последнего эксперимента мышей умерщвляют.

Семь групп могут получать лечение по следующей схеме:

1: Носитель, подкожно

2: агонист GLP-1, 0.3 нмоль/кг, подкожно

3: агонист GLP-1, 1,0 нмоль/кг, подкожно

4: агонист GLP-1, 3.0 нмоль/кг, подкожно

5: агонист GLP-1, 10 нмоль/кг, подкожно

6: агонист GLP-1, 30 нмоль/кг, подкожно

7: агонист GLP-1, 100 нмоль/кг, подкожно

Носитель: 50 мМ фосфата натрия, 145 мМ хлорида натрия, 0,05% Tween 80, рН 7,4.

Агонист GLP-1 растворяют в носителе, например, до концентраций 0,05, 0,17, 0,5, 1,7, 5,0 и 17,0 нмоль/мл. Животным подкожно вводят дозу объемом 6 мл/кг (т.е. 300 мкл на 50 г мышь).

В день введения уровень глюкозы в крови оценивают во время -А ч (8.30 часов утра), после чего мышей взвешивают. Дозу агониста GLP-1 вводят приблизительно в 9 часов утра (время 0). В день введения уровень глюкозы в крови оценивают, например, через 1, 2, 4 и 8 ч (в 10 часов утра, 11 часов утра, час дня и 5 часов вечера).

В последующие дни уровень глюкозы в крови оценивают, например, через 24, 48, 72 и 96 ч после введения (т.е. в 9 часов утра во 2, 3, 4, 5 день). Каждый день мышей взвешивают после забора образца крови.

Мышей взвешивают по отдельности на цифровых весах.

Образцы для измерения уровня глюкозы в крови получают из капилляров кончика хвоста мышей (мыши при этом в сознании). Кровь в объеме 10 мкл отбирают в гепаринизированные капилляры и переносят в 500 мкл глюкозного буфера (EKF system solution, Eppendorf, Germany). Концентрацию глюкозы измеряют с помощью глюкооксидазного метода (анализатор глюкозы Biosen 5040, EKF Diagnostic, GmbH, Barleben, Germany). Образцы оставляют при комнатной температуре на 1 ч до анализа. Если анализ должен быть отложен, образцы хранят при 4°С в течение максимум 24 ч.

ED50 представляет собой дозу, которая приводит к половине максимального эффекта, в нмоль/кг. Это значение рассчитывают на основе способности агонистов GLP-1 снижать вес тела, а также способности снижать уровень глюкозы в крови, как описано ниже.

ED50 для веса тела рассчитывают как дозу, которая приводит к половине максимального эффекта изменения веса тела через 24 часа после подкожного введения агонистов GLP-1. Например, если максимальное снижение веса тела через 24 часа составляет 4,0 г, то ED50 для веса тела будет представлять собой дозу в нмоль/кг, которая приводит к снижению веса тела на 2,0 г через 24 часа. Эту дозу (ED50 веса тела) можно определить по кривой зависимости доза-ответ.

ED50 для уровня глюкозы в крови рассчитывают как дозу, которая приводит к половине максимального эффекта изменения AUC глюкозы в крови через 8 часов после подкожного введения агониста GLP-1.

Значение ED50 может быть рассчитано, только если существует надлежащая сигмовидная зависимость доза-ответ с четко определяющимся максимальным ответом. Таким образом, если это не наблюдается в случае исследуемого агониста GLP-1, проводят повторное тестирование с другим диапазоном доз, пока не будет получена сигмовидная зависимость доза-ответ.

Анализ (IV): влияние на потребления пищи

Цель этого эксперимента - исследовать влияние агонистов GLP-1 на потребление пищи свиньями. Это осуществляется в фармакодинамическом (PD) исследовании, как описано ниже, в котором потребление пищи измеряют через 1, 2, 3, и 4 дня после введения однократной дозы агониста GLP-1 по сравнению с контрольной группой, получающей носитель.

Используют самок свиней Landrace Yorkshire Duroc (LYD) в возрасте приблизительно 3 месяцев, имеющих вес приблизительно 30-35 кг (n=3-4 в группе). Животных держат в группе в течение 1-2 недель в процессе акклиматизации к виварию. В ходе эксперимента животных помещают в индивидуальные клетки на срок с утра понедельника до вечера пятницы для измерения индивидуального потребления пищи. Животных кормят ad libitum кормом для свиней (Svinefoder, Antonio) все время как в процессе акклиматизации, так и в ходе эксперимента. Потребление пищи контролируют непрерывно, вес корма регистрируется каждые 15 минут.Используется система Mpigwin (Ellegaard Systems, Faaborg, Denmark).

Агонисты GLP-1 растворяют в фосфатном буфере (50 мМ фосфата, 0,05% Tween 80, рН 8), например, в концентрациях 12, 40, 120, 400 или 1200 нмоль/мл, соответствующих дозам 0,3, 1, 3, 10 или 30 нмоль/кг. Фосфатный буфер служит носителем. Животным подкожно вводят однократную дозу агониста GLP-1 или носителя (объем дозы 0,025 мл/кг) утром в 1 день, и потребление пищи измеряют в течение 4 дней после введения. В последний день каждого исследования, на 4 день после введения, из сердца анестезированных животных отбирают образец крови для измерения содержания агониста GLP-1 в плазме. Животных после этого умерщвляют введением в сердце смертельной дозы пентобарбитона. Содержание в плазме агониста GLP-1 анализируют, используя ELISA или другой аналогичный анализ на основе антител.

Потребления пищи рассчитывают в виде среднего значения потребления пищи ± SEM в течение 24 ч за 4 дня. Статистические сравнения потребления пищи в течение 24 часов между группой, получающей носитель, и группой, получающей агонист GLP-1, за 4 дня выполняют с использованием однофакторных или двухфакторных повторных анализов ANOVA с последующим применением критерия Бонферрони.

Анализ (V): стабильность по отношению к деградации пищеварительными ферментами

Цель этого примера - протестировать стабильность по отношению к деградации пищеварительными ферментами. GLP-1(7-37) можно использовать в анализе в качестве соединения для сравнения. Самая сильная протеолитическая активность в кишечнике имеет панкреатическое происхождение и включает эндопептидазы трипсин, химотрипсин и эластазу, а также несколько типов карбоксипептидаз. Анализ с экстрактом тонкого кишечника крыс был разработан и использован, как описано ниже.

Экстракты из тонкого кишечника крыс

Тонкий кишечник получают из крыс и промывают 8 мл 150 мМ NaCl, 20 мМ Hepes рН 7,4. Растворы центрифугируют в течение 15 мин при 4,600 об/мин в центрифуге Heraeus Multifuge 3 S-R с ротором 75006445. Супернатанты отбирают и фильтруют через 0,22 мкм мембрану Millipore Millex GV PVDF. Фильтраты из нескольких животных объединяются, чтобы нивелировать индивидуальные различия.

Содержание белка в полученных экстрактах определяют с помощью метода Бредфорда (см., например, Analytical Biochemistry (1976), vol. 72, p. 248-254 и Analytical Biochemistry (1996), vol. 236 p. 302-308).

Анализ деградации

2,5 нмоль агонистов GLP-1, которые должны быть протестированы, инкубируют с экстрактом кишечника в объеме 250 мкл при 37°С в течение одного часа. Образцы из кишечника анализируют в присутствии 20 мМ Hepes при рН 7,4. Концентрацию экстракта кишечника титруют в пилотном эксперименте, так что время полужизни (VA) GLP-1 (7-37) находится в диапазоне 10-20 минут. Экстракт тонкого кишечника используют в концентрации 1,4 мкг/мл. Все компоненты за исключением экстракта кишечника смешивают и предварительно нагревают в течение 10 минут при 37°С. Сразу после добавления экстракта кишечника отбирают 50 мкл образца и смешивают с таким же объемом 1% трифторуксусной кислоты (TFA). Остальные образцы отбирают, соответственно, через 15, 30 и 60 минут.

Анализ образцов

СВЭЖХ анализ: 10 мкл образцов анализируют с помощью СВЭЖХ, используя систему Waters Acquity с колонкой ВЕН С18, 1,7 мкм, 2,1 х 50 мм и 30-65% градиент 0,1% TFA и 0,07% TFA в ацетонитриле в течение 5 минут при скорости потока 0,6 мл/мин. После вычитания базовой линии определяют интегралы пиков интактных соединений в СВЭЖХ хроматограмме, записанной при длине волны 214 нм.

MALDI-TOF анализ: 1 мкл каждого образца наносят на мишень Bruker/Eppendorf РАС НССА 384 MALDI. Анализ осуществляют с помощью времяпролетного масс-спектрометра Bruker Autoflex с матрично-активированной лазерной десорбцией/ионизацией (MALDI-TOF), используя заранее определенный метод "PACjneasure" с расширенным диапазоном измерения от 500 до 5000 Да и заранее определенный метод калибровки "PAC_calibrate".

Анализ данных. Интегралы пиков ВЭЖХ хроматограмм откладывают на графике в зависимости от времени. Время полужизни соответствующего соединения рассчитывают путем аппроксимации данных, используя программное обеспечение SigmaPlot 9.0 и уравнение для 2-параметрического экспоненциального распада. Для каждого тестируемого агониста GLP-1 относительное время полужизни (относительное Т½) рассчитывают как время полужизни (Т½) указанного соединения, деленное на время полужизни (Т½) GLP-1(7-37), определенное тем же способом.

Некоторые признаки изобретения были проиллюстрированы и описаны в настоящем документе, и многие модификации, замены, изменения и эквиваленты будут очевидны специалистам в данной области техники. Таким образом, следует понимать, что прилагаемая формула изобретения предназначена для охвата всех таких модификаций и изменений, которые соответствуют истинной сущности изобретения.

1. Применение агониста GLP-1 для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где:

a) указанный агонист GLP-1 представляет собой семаглутид,

b) указанное применение включает введение указанного агониста GLP-1 в количестве по меньшей мере 0,7 мг в неделю, и

c) указанный семаглутид вводят без другого терапевтического агента.

2. Применение агониста GLP-1 для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где:

a) указанный агонист GLP-1 представляет собой семаглутид,

b) указанное применение включает введение указанного агониста GLP-1 в количестве по меньшей мере 0,7 мг в неделю в форме композиции, состоящей из указанного агониста GLP-1 и одного или более фармацевтически приемлемых эксципиентов, и

c) указанная композиция содержит изотонический агент.

3. Применение агониста GLP-1 для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где:

a) указанный агонист GLP-1 представляет собой семаглутид,

b) указанное применение включает введение указанного агониста GLP-1 в количестве по меньшей мере 0,7 мг в неделю в форме композиции, состоящей из указанного агониста GLP-1 и одного или более фармацевтически приемлемых эксципиентов, и

c) указанная композиция имеет форму водного препарата, содержащего по меньшей мере 80% вес/вес воды.

4. Применение агониста GLP-1 для предотвращения или лечения ожирения, снижения веса тела и/или потребления пищи, или стимулирования насыщения, где:

a) указанный агонист GLP-1 представляет собой семаглутид,

b) указанное применение включает введение указанного агониста GLP-1 в количестве по меньшей мере 0,7 мг в неделю в форме композиции, состоящей из указанного агониста GLP-1 и одного или более фармацевтически приемлемых эксципиентов, и

с) указанная композиция имеет форму водного препарата, имеющего рН от 3 до 10.

5. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят два раза в неделю или реже.

6. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят один раз в неделю или реже.

7. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят в количестве по меньшей мере 0,8 мг, по меньшей мере 1,0 мг или по меньшей мере 1,2 мг, например по меньшей мере 1,4 мг или по меньшей мере 1,6 мг, в неделю.

8. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят в количестве по меньшей мере 0,8 мг, по меньшей мере 0,9 мг или по меньшей мере 1,0 мг в неделю.

9. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят в количестве по меньшей мере 1,0 мг в неделю.

10. Применение по любому из пп. 1-4, где указанный агонист GLP-1 вводят путем парентерального введения, такого как подкожная инъекция.

11. Применение по любому из пп. 1-4, где указанное введение осуществляют пациенту, страдающему от диабета 2 типа.

12. Применение по любому из пп. 1-4, где указанное введение предназначено для предотвращения или лечения ожирения.

13. Применение по любому из пп. 1-4, где указанное введение предназначено для снижения веса тела и/или потребления пищи.

14. Применение по любому из пп. 1-4, где указанное введение предназначено для снижения веса тела.

15. Применение по любому из пп. 1-4, где указанное введение предназначено для снижения потребления пищи.

16. Применение по любому из пп. 1-4, где указанное введение предназначено для стимулирования насыщения.

17. Применение по п. 1, где указанный агонист GLP-1 вводят в составе композиции.

18. Применение по любому из пп. 2, 3 и 17, где указанная композиция имеет форму водного препарата, имеющего рН от 3 до 10.

19. Применение по п. 18, где рН указанного водного препарата составляет от 7,0 до 9,5.

20. Применение по любому из пп. 2-4 и 17, где указанная композиция представляет собой раствор.

21. Применение по любому из пп. 2, 4 и 17, где указанная композиция имеет форму водного препарата, содержащего по меньшей мере 80% вес/вес воды.

22. Применение по любому из пп. 2-4 и 17, где указанная композиция содержит один или более выбранных из группы, состоящей из растворителей, разбавителей, буферов, консервантов, регуляторов тоничности, хелатирующих агентов, стабилизаторов.



 

Похожие патенты:

Группа изобретений относится к медицине, а именно к терапии и эндокринологии, и может быть использована для предотвращения тяжелой симптоматической гипогликемии, связанной с концентрацией глюкозы в плазме ниже 50 мг/дл, при сахарном диабете 2 типа.

Настоящая группа изобретений относится к медицине, а именно к эндокринологии, и касается лечения сахарного диабета 2 типа. Для этого вводят терапевтически эффективное количество средства, ингибирующего активацию или сигнализацию NKG2D, или блокирующего взаимодействие связывания лиганда NKG2D.

Изобретение относится к медицине и касается композиции, содержащей эффективное количество эксенатида, ингибитор протеазы, ЭДТА, омега-3 жирную кислоту и покрытие, которое ингибирует расщепление эксенатида в желудке субъекта, причем указанная композиция представляет собой фармацевтическую композицию для перорального применения при лечении заболеваний, при которых агонистическое действие в отношении глюкагоноподобного пептида (GLP-1) является благоприятным.

Изобретение относится к области биотехнологии, конкретно к получению аналогов инсулина, и может быть использовано в медицине в качестве лекарственного средства для снижения уровня глюкозы в крови у пациента.

Группа изобретений относится к способам лечения диабета 2 типа, резистентности к инсулину, пониженной продукции инсулина, ожирения, гипергликемии и гиперинсулинемии, включающим введение субъекту эффективного количества антитела к IL-1β или его фрагмента, а также к применению антитела к IL-1β или его фрагмента в производстве композиции, предназначенной для лечения вышеуказанных заболеваний или состояний.

Изобретение относится к области органической химии, а именно к соединению формулы (I), или его таутомеру, или фармацевтически приемлемой соли, где каждый из Ζ1 и Ζ2: N и CR, где по меньшей мере, один из Ζ1 и Ζ2 представляет собой CR, а каждый R: Н, C1-C4 алкил и -N(R3)(R3); W: -O-, -N(C1-C4) алкил и -C(R6)(R6) -, а каждый R6: Н и C1-C4 алкил, или два R6, связанные с одним и тем же атомом углерода, взяты вместе с образованием =O, R1: фенил и гетероцикл, который представляет собой насыщенное или ненасыщенное 5-6-членное моноциклическое кольцо, содержащее 1-3 гетероатома, выбранных из атомов N, S и О, или 8-12-членное бициклическое кольцо, каждый цикл которого выбран из насыщенного, ненасыщенного и ароматического цикла, содержащее 1-2 атома азота, где R1 необязательно замещен одним или более заместителями, независимо выбранными из галогена, C1-C4 алкила, =O, фторзамещенного C1-C2 алкила, -O-R3, -(C1-C4 алкил)-N(R3)(R3), -N(R3)(R3) и -С(О)-N(R3)(R3), R2: фенил и гетероцикл, который представляет собой ненасыщенное 5-6-членное моноциклическое кольцо, содержащее 1-2 гетероатома, выбранных из атомов N и О, или представляет собой дигидробензофуранил, где R2 необязательно замещен 1-2 заместителями, независимо выбранными из галогена, -C≡N, С1-С4 алкила, С1-С2 фторзамещенного алкила, -O-R3, -(C1-C4 алкил)-N(R3)(R3) и -N(R3)(R3); каждый R3: -С1-С4 алкил; или два R3 взяты вместе с атомом азота, с которым они связаны, с образованием 4-8-членного насыщенного гетероцикла, необязательно содержащего один дополнительный гетероатом, выбранный из N и О, где в случае, когда R3 представляет собой алкил, данный алкил необязательно замещен двумя -ОН группами, а когда два R3 взяты вместе с атомом азота, с которым они связаны с образованием 4-8-членного насыщенного гетероцикла, данный насыщенный гетероцикл необязательно замещен по любому атому углерода фтором; и замещен по любому способному к замещению атому азота водородом; p равен 1, 2 или 3; X2 выбирают из -С(=O)-♣, -С(=O)-O-♣, -C(=O)-NH-♣, -S(=O)2-NH-♣ и -С(=O)-NH-CR4R5-♣, где: ♣ представляет собой место, по которому X2 связан с R1; а каждый R4 и R5 представляет собой водород.

Группа изобретений относится к медицине и касается набора для лечения диабета, включающего первую фармацевтическую композицию и вторую фармацевтическую композицию, где первая фармацевтическая композиция включает Gly(А21)-Arg(В31)-Arg(В32) инсулин человека и вторая фармацевтическая композиция включает Gly(А21)-Arg(В31)-Arg(В32) инсулин человека и desPro36эксендин-4(1-39)-Lys6-NH2; применения набора для изготовления медицинского продукта для лечения пациента с диабетом, для регулирования концентрации глюкозы в крови натощак, после приема пищи и/или после всасывания или для улучшения толерантности глюкозы.

Изобретение относится к области биотехнологии, конкретно к новым аналогам инсулина, и может быть использовано в медицине. Указанный аналог инсулина характеризуется одной из следующих структур: Arg(A0), His(A8), Gly(A21), Arg(В31), Arg(В32)-NH2-инсулин; His(A8), Gly(A21), Arg(В31), Arg(В32)-NH2-инсулин; Arg(А0), Glu(A15), His(A8), Gly(A21), Arg(В31), Arg(В32)-NH2-инсулин.

Изобретение относится к области биотехнологии, конкретно к новым аналогам инсулина, и может быть использовано в медицине. Получают аналог инсулина, в котором по меньшей мере две гидрофобные аминокислоты заменены гидрофильными аминокислотами по сравнению с родительским инсулином и где A-цепь аналога инсулина содержит по меньшей мере одну мутацию и B-цепь содержит по меньшей мере одну мутацию по сравнению с родительским инсулином, при этом по меньшей мере одна мутация в А-цепи находится в одном или более сайтах расщепления, выбранных из группы, состоящей из A13-14, A14-15 и A19-20, и по меньшей мере одна мутация в В-цепи находится в одном или более сайтах расщепления, выбранных из группы, состоящей из B2-3, B6-7, B9-10, B10-11, B13-14, B14-15, B16-17, B22-23, B24-25, B25-26, и где аминокислота в положении B30 удалена.

Изобретение относится к фармации и медицине. Предложено применение лекарственного средства, содержащего соединение общей формулы (I) совместно с по меньшей мере одним другим лекарственным средством, выбранным из бигуанида и ингибитора α-глюкозидазы, для лечения диабета 2 типа, осложнений диабета, нарушения толерантности к глюкозе, устойчивости к инсулину или ожирения, а также лекарственное средство на основе указанной комбинации того же назначения.

Настоящее изобретение относится к производным эксендина-4, которые активируют рецептор глюкагоноподобного пептида 1 (GLP-1) и глюкозозависимого инсулинотропного полипептида (GIP) и необязательно рецептор глюкагона (GCG), их использованию для лечения нарушений метаболического синдрома, включая диабет и ожирение, а также для снижении избыточного потребления пищи.

Изобретение относится к медицине и касается способа улучшения гликемического контроля у пациентов с сахарным диабетом 2 типа, у которых диабет 2 типа неадекватно контролируется лечением одним глитазоном, включающего введение нуждающемуся в этом пациенту комбинации, содержащей (a) desPro36Exendin-4(1-39)-Lys6-NH2 и/или его фармацевтически приемлемую соль в суточной дозе 10-20 мкг и (b) глитазон и/или его фармацевтически приемлемую соль в суточной дозе 10-20 мг.

Группа изобретений относится к области фармакологии и медицины и касается жидкой композиции, содержащей комбинацию длительно действующего инсулина в форме, в которой инсулин связан с Fc-областью иммуноглобулина и инсулинотропного пептида, который находится в форме, в которой пептид связан с Fc-областью иммуноглобулина.

Настоящее изобретение относится к области биотехнологии, конкретно к композициям на основе конъюгата производного оксинтомодулина, и может быть использовано в медицине для снижения уровней липидов в крови при предупреждении или лечении гиперлипидемии, жировой болезни печени или артериосклероза.

Группа изобретений относится к области фармацевтики и медицины и касается фармацевтической композиции для лечения диабета или ожирения, содержащей первый тип гранул и второй тип гранул, в которых указанный первый тип гранул содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты и не содержит пептид GLP-1, и в которых указанный второй тип гранул содержит пептид GLP-1 и не содержит соль N-(8-(2-гидроксибензоил)амино)каприловой кислоты, а также относится к способам получения композиции и к их применению в медицине.

Настоящее изобретение относится к биохимии и медицине, в частности к средству для стимуляции дифференцировки панкреатических предшественников бета-клеток в продуцирующие и секретирующие инсулин бета-клетки при инсулинзависимом сахарном диабете.

Изобретение относится к новым соединениям формулы I-R или I-S, его фармацевтически приемлемому изомеру, энантиомеру, рацемату или фармацевтически приемлемой соли. Соединения обладают активностью в отношении глюкагонподобного пептида 1 (GLP-1R) и могут найти применение для лечения заболеваний, для которых показано модулирование или потенцирование GLP-1R, в частности для лечения диабета.

Настоящее изобретение относится к области биотехнологии, конкретно к сайт-специфически монопегилированному аналогу эксендина, и может быть использовано в медицине.

Группа изобретений относится к медицине и касается фармацевтической комбинации для снижения уровня глюкагона в плазме у пациентов с диабетом типа 2, содержащей desPro36эксендин-4(1-39)-Lys6-NH2 и/или его фармацевтически приемлемую соль, метформин и/или его фармацевтически приемлемую соль и сульфонилмочевину.

Группа изобретений относится к медицине, а именно к неврологии, и относится к фармацевтической композиции, предназначенной для применения при предупреждении и/или лечении нейродегенеративного заболевания.

Группа изобретений относится к области медицины, а именно к ветеринарии, и предназначена для лечения бактериальных инфекций и/или бактериальной интоксикации. Соединение 5-(бензотиофен-3-илиден)-2-тиоксотиазолидин-4-он или его фармацевтически приемлемую соль, гидрат или сольват применяют для получения фармацевтической композиции для лечения и/или предупреждения развития бактериальной инфекции и/или бактериальной интоксикации.

Группа изобретений относится к медицине, а именно к терапии и эндокринологии, и касается применения долгодействующих пептидов GLP-1 для лечения ожирения. Для этого вводят семаглутид в дозе 0,7 мг в неделю в качестве монотерапии. Это обеспечивает наиболее эффективное снижение массы тела в сравнении с действием других агонтистов рецептора GLP-1. 4 н. и 18 з.п. ф-лы, 5 ил., 1 табл., 1 пр.

Наверх