Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу

Авторы патента:


Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу
Стабильные композиции, содержащие катионные целлюлозные полимеры и целлюлазу

 


Владельцы патента RU 2551653:

ДЗЕ ПРОКТЕР ЭНД ГЭМБЛ КОМПАНИ (US)

Изобретение относится к стабильным жидким композициям, которые обеспечивают хорошее удаление пятен и уход за цветом. Описаны жидкие композиции, содержащие катионный целлюлозный полимер и целлюлазный фермент, при этом жидкие композиции содержат менее чем приблизительно 20% по массе воды и заключены в водорастворимую или диспергируемую пленку. Технический результат - улучшенный полезный эффект при уходе за тканями. 2 н. и 14 з.п. ф-лы, 3 табл., 5 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к стабильным, легким для разливания, неводным жидким композициям, которые обеспечивают хорошее удаление пятен и уход за цветом. Настоящее изобретение также относится к способу повторного смешивания композиций, содержащих целлюлазу, в композиции, содержащие катионный целлюлозный полимер.

Уровень техники

В настоящее время потребители желают жидкие композиции для стирки с улучшенными полезными эффектами при уходе за тканями, такими как улучшенное ощущение от тканей и улучшенное сохранение цвета. Катионные целлюлозные полимеры известны в данной области техники для обеспечения полезных эффектов при уходе за тканями, в частности, мягкости, улучшенного сохранения тканей, и поэтому, улучшенного ухода за тканями. Целлюлазные ферменты улучшают ощущение от тканей и сохранение цвета путем удаления целлюлозных волоконец из волокон. Поскольку полезные эффекты катионных целлюлозных полимеров и целлюлазы являются комплиментарными, существует сильное желание включить их обоих в жидкие композиции для стирки. Однако объединение этих полезных эффектов в композиции одного моющего средства является чрезвычайно проблематичным, поскольку целлюлазы, как известно, разлагают катионные целлюлозные полимеры. Поэтому, жидкие композиции, в общем, составляют, чтобы избежать комбинаций целлюлозных полимеров и целлюлазного фермента. Например, WO2004/056958 описывает мешочки, содержащие катионную гуаровую камедь в комбинации с протеазными и амилазными ферментами.

WO 2004/069979 и WO 2007/120547 обе описывают, что ингибиторы ферментов могут быть использованы для составления катионных целлюлозных полимеров и целлюлазных ферментов в водные композиции моющих средств. Однако такие растворы повышают стоимость и сложность изготовления. Это вызвано стоимостью ингибитора целлюлаз, но также ввиду повторного смешивания таких композиций в другие составы, содержащие целлюлозные полимеры, приводит к распаду целлюлозного полимера, поскольку ингибитор целлюлаз разбавлен до неэффективного уровня во время повторного смешивания. Даже следовые количества целлюлазного фермента, как было найдено, разлагают целлюлозные полимеры.

Соответственно, сохраняется необходимость в средствах для составления жидких композиций с катионными целлюлозными полимерами и целлюлазным ферментом, без распада катионных целлюлозных полимеров, или усложняющего повторного смешивания продукта, содержащего целлюлазный фермент, в продукт, содержащий целлюлозный полимер.

Сущность изобретения

В соответствии с настоящим изобретением предлагается неводная жидкая композиция, содержащая: катионный целлюлозный полимер; и целлюлазный фермент; при этом неводная жидкая композиция содержит менее чем 20% по массе воды. Настоящее изобретение также относится к способу повторного смешивания таких неводных жидких композиций, характеризующемуся тем, что данный способ включает стадию объединения неводной композиции с другой неводной жидкой композицией, содержащей полимер на основе целлюлозы.

Подробное описание изобретения

Настоящее изобретение решает проблему обеспечения стабильной композиции, содержащей как катионный целлюлозный полимер, так и целлюлазный фермент. Было обнаружено, что путем ограничения уровня воды в композиции, целлюлазная активность ингибируется таким образом, что она неспособна разлагать катионный целлюлозный полимер.

Если даже следовые количества целлюлазы присутствуют в водной композиции, это приводит к распаду целлюлозных полимеров. Поэтому повторное смешивание композиций, содержащих целлюлазный фермент, либо невозможно, либо усложнено. Это в особенности так, поскольку любые ингибиторы целлюлаз, которые могли присутствовать, разбавлены до неэффективного уровня, если композицию, содержащую целлюлазу, повторно смешивают в "свежую" композицию. Путем ограничения уровня воды, предпочтительно как в повторно смешанной, так и в конечной композиции, риск распада целлюлозного полимера под действием целлюлазного фермента устраняется.

Все процентные содержания, соотношения и пропорции, используемые в данной заявке, являются массовыми процентами неводной жидкой композиции. Когда речь идет об изделиях стандартной дозы, все процентные содержания, соотношения и пропорции, используемые в данной заявке, являются массовыми процентами содержимого отделения стандартной дозы. То есть, без учета массы инкапсулирующего материала. Для изделий стандартной дозы с несколькими отделениями, процентные содержания, соотношения и пропорции, используемые в данной заявке, являются массовыми процентами содержимого индивидуального отделения стандартной дозы, если не указано иное.

Неводные жидкие композиции

Как используют в данной заявке, "неводная жидкая композиция" относится к любой жидкой композиции, содержащей менее чем 20%, предпочтительно менее чем 15%, более предпочтительно менее чем 12%, наиболее предпочтительно менее чем 8% по массе воды. Например, не содержащая дополнительную воду кроме той, которая захватывается другими составляющими ингредиентами. Термин «жидкость» также включает вязкие формы, такие как гели и пасты. Неводная жидкость может содержать другие твердые частицы или газы в приемлемой подразделенной форме, но исключает формы, которые являются не жидкими в целом, такие как таблетки или гранулы.

Неводная композиция в соответствии с настоящим изобретением может также содержать от 2% до 40%, более предпочтительно от 5% до 25% по массе неводного растворителя. Как используют в данной заявке, "неводный растворитель" относится к любому органическому растворителю, который не содержит никаких аминофункциональных групп. Предпочтительные неводные растворители включают одноатомные спирты, двухатомные спирты, многоатомные спирты, глицерин, гликоли, включая полиалкиленгликоли, такие как полиэтиленгликоль, и их смеси. Более предпочтительные неводные растворители включают одноатомные спирты, двухатомные спирты, многоатомные спирты, глицерин и их смеси. Высоко предпочтительными являются смеси растворителей, особенно смеси двух или более из следующих: низшие алифатические спирты, такие как этанол, пропанол, бутанол, изопропанол; диолы, такие как 1,2-пропандиол или 1,3-пропандиол и глицерин. Также предпочтительными являются пропандиол и его смеси с диэтиленгликолем, где смесь не содержит метанол или этанол. Таким образом, осуществления неводных жидких композиций в соответствии с настоящим изобретением могут включать осуществления, в которых используют пропандиолы, но метанол и этанол не используют.

Предпочтительные неводные растворители являются жидкими при температуре окружающей среды и давлении (т.е. 21°С и 1 атмосфера), и содержат углерод, водород и кислород. Неводные растворители могут присутствовать при получении премикса, или в конечной неводной композиции.

Катионный целлюлозный полимер

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать от 0,01% до 20%, предпочтительно от 0,1% до 15%, более предпочтительно от 0,6%о до 10% по массе катионного целлюлозного полимера.

Катионный целлюлозный полимер предпочтительно имеет плотность катионного заряда от 0,005 до 23, более предпочтительно от 0,01 до 12, наиболее предпочтительно от 0,1 до 7 миллиэквивалент/г, при pH неводной жидкой композиции. Плотность заряда рассчитывают путем деления количества суммарных зарядов в повторяющемся звене на молекулярную массу повторяющегося звена. Положительные заряды могут быть расположены на каркасе полимеров и/или боковых цепях полимеров. Термин "катионный целлюлозный полимер" включает также амфотерные целлюлозные полимеры, которые имеют суммарный положительный заряд при pH неводной жидкой композиции.

Приемлемые катионные целлюлозные полимеры включают катионную гидроксиэтилцеллюлозу и катионную гидроксипропилцеллюлозу. Предпочтительные катионные целлюлозы для использования в данной заявке включают те, которые могут быть или могут не быть гидрофобно модифицированы, включая те, которые имеют гидрофобные группы заместителей, имеющие молекулярную массу от 50000 до 2000000, более предпочтительно от 100000 до 1000000 и наиболее предпочтительно от 200000 до 800000. Эти катионные целлюлозные полимеры имеют повторяющиеся замещенные ангидроглюкозные звенья, которые соответствуют общей структурной формуле I, приведенной ниже:

где:

a. m означает целое число от 20 до 10000

b. каждый R представляет собой Н, и R1, R2, R3 каждый независимо выбран из группы, состоящей из: Н; С132 алкила; C1-C32 замещенного алкила, С532 или C5-C32 арила, C5-C32 или C6-C32 замещенного арила или C6-C32 алкиларила, или C6-C32 замещенного алкиларила, и . Предпочтительно, R1, R2, R3 каждый независимо выбран из группы, состоящей из: H; и C1-C4 алкила;

где:

n означает целое число, выбранное от 0 до 10 и Rx выбран из группы, состоящей из: R5;

где, по меньшей мере, один Rx в указанном полисахариде имеет структуру, выбранную из группы, состоящей из: ,

где А- представляет собой приемлемый анион. Предпочтительно, A- выбран из группы, состоящей из: Cl-, Br-, I-, метилсульфата, этилсульфата, толуол сульфоната, карбоксилата и фосфата;

Z выбран из группы, состоящей из карбоксилата, фосфата, фосфоната и сульфата;

q означает целое число, выбранное от 1 до 4;

каждый R5 независимо выбран из группы, состоящей из: H; C1-C32 алкила; C1-C32 замещенного алкила, C5-C32 или C3-C32 арила, C5-C32 или C6-C32 замещенного арила, C6-C32 алкиларила, C6-C32 замещенного алкиларила и ОН. Предпочтительно, каждый R5 выбран из группы, состоящей из: H, C1-C32 алкила и C1-C32 замещенного алкила. Более предпочтительно, R5 выбран из группы, состоящей из Н, метила и этила.

Каждый R6 независимо выбран из группы, состоящей из: Н, C1-C32 алкила, C1-C32 замещенного алкила, C5-C32 или C6-C32 арила, C5-C32 или C6-C32 замещенного арила, С632 алкиларила, и С632 замещенного алкиларила. Предпочтительно, каждый R6 выбран из группы, состоящей из: H, C1-C32 алкила и C1-C32 замещенного алкила.

Каждый Т независимо выбран из группы: Н,

где каждый v в указанном полисахариде означает целое число от 1 до 10. Предпочтительно, v означает целое число от 1 до 5. Сумма всех индексов v в каждом Rx в указанном полисахариде означает целое число от 1 до 30, более предпочтительно от 1 до 20, даже более предпочтительно от 1 до 10. В последней

группе в цепи Т всегда представляет собой Н. Алкильное замещение на ангидроглюкозных циклах полимера может варьироваться от 0,01% до 5% на глюкозное звено, более предпочтительно от 0,05% до 2% на глюкозное звено полимерного материала. Катионная целлюлоза может быть в небольшой степени поперечно сшитой с диальдегидом, таким, как глиоксил, чтобы предотвратить формирование комков, узелков или других агломераций при добавлении в воду при температурах окружающей среды. Катионные эфиры целлюлозы структурной формулы I также включают те, которые коммерчески доступны и дополнительно включают материалы, которые могут быть получены путем традиционной химической модификации коммерчески доступных материалов. Коммерчески доступные эфиры целлюлозы типа структурной формулы I включают имеющие INCI название Polyquaternium 10, такие, которые продаются под торговыми марками: Ucare Polymer JR 30М, JR 400, JR 125, LR 400 и LK 400 полимеры; Polyquaternium 67, такие, которые продаются под торговой маркой Softcat SK™, все из которых продаются Amerchol Corporation, Edgewater NJ; и Polyquaternium 4, такие, которые продаются под торговой маркой: Celquat Н200 и Celquat L-200, доступные от National Starch and Chemical Company, Bridgewater, NJ. Другие приемлемые полисахариды включают гидроксиэтилцеллюлозу или гидроксипропилцеллюлозу, кватернизованные глицидил C12-C22 алкил диметиламмоний хлоридом. Примеры таких полисахаридов включают полимеры с INCI названиями Polyquaternium 24, такие, которые продаются под торговой маркой Quaternium LM 200 от Amerchol Corporation, Edgewater NJ.

Катионный целлюлозный полимер может быть модифицирован таким образом, чтобы стать более устойчивым к распаду под действием целлюлазного фермента. Например, было найдено, что уменьшение количества незамещенных ангидроглюкозных звеньев приводит к получению катионного целлюлозного полимера, менее чувствительного к ферментному распаду. Как полагают, это вызвано обрывом ферментной цепи, происходящим главным образом между прилегающими незамещенными ангидроглюкозными звеньями. Таким образом, катионные целлюлозные полимеры, включая катионные гидроксиэтилцеллюлозы и катионные гидроксипропилцеллюлозы, имеющие высокую степень молярного замещения, как было найдено, являются более устойчивыми к распаду под действием целлюлазных ферментов.

Молярное замещение представляет собой среднее количество замещений на ангидроглюкозное повторяющееся звено в целлюлозном каркасе. Аналогично, для катионных гидроксиэтил и гидроксипропилцеллюлоз, молярное соотношение представляет собой среднее количество молей этиленоксида и/или пропиленоксида, которые прореагировали с каждым ангидроглюкозным повторяющимся звеном в целлюлозном каркасе. Каждое повторяющееся звено имеет три гидроксильные группы, доступные для реакции с этиленоксидом или пропиленоксидом. Однако полученные в результате гидроксиэтильные/гидроксипропильные группы также имеют гидроксильную группу, доступную для дальнейшей реакции с этиленоксидом или пропиленоксидом. Поэтому молярное замещение может быть выше 3.

Катионные целлюлозы, включая катионную гидроксиэтилцеллюлозу и гидроксипропилцеллюлозу, имеющие степень замещения более чем 1,34, также проявляют повышенную устойчивость к распаду под действием целлюлазного фермента. Степень замещения представляет собой среднее количество гидроксильных групп ангидроглюкозной повторяющейся единицы, в целлюлозном каркасе, имеющих замещения. Поэтому степень замещения может составлять максимум 3 для катионного целлюлозного полимера. Уменьшенная компактность так же, как было найдено, уменьшает ферментный распад. Компактность катионного целлюлозного полимера относится к тому, как неоднородно замещен катионный целлюлозный полимер. Например, для катионных гидроксиэтил или гидроксипропилцеллюлоз, то, как распределена неоднородность, представляют собой гидроксиэтильные и/или гидроксипропильные группы вдоль целлюлозного каркаса. Считают, что увеличение компактности увеличивает количество последовательных незамещенных ангидроглюкозных повторяющихся звеньев, доступных для атаки целлюлазным ферментом. Мерой данной неоднородности является соотношение незамещенных тримеров (U3R): соотношение незамещенных ангидроглюкозных триммеров и наиболее часто замещенных ангидроглюкозных тримеров. U3R рассчитывают при помощи метода масс-спектрометрии, описанного в US 2006/0182703 А1 (страница 4, параграфы 48-56). Для катионных гидроксиэтил и гидроксипропилцеллюлоз, гидроксиэтильное и/или гидроксипропильное молярное замещение составляет предпочтительно от 1,3 до 5, и соотношение незамещенных ангидроглюкозных триммеров и наиболее часто замещенных ангидроглюкозных тримеров составляет предпочтительно менее чем 0,235, более предпочтительно менее чем 0,21.

Устойчивость к распаду под действием целлюлазного фермента может также быть усилена путем увеличения замещения в С2 положении в ангидроглюкозном повторяющемся звене. Распределение заместителей в С2, С3 и С6 положениях в ангидроглюкозном повторяющемся звене для катионных целлюлозных полимеров, таких, как катионная гидроксиэтилцеллюлоза, катионная гидроксипропилцеллюлоза и их производные, может быть измерено при помощи способа Линдберга, описанного в Carbohydrate Research, 170 (1987) 207-214. Эти полимеры содержат восемь типов ангидроглюкозных повторяющихся звеньев, в терминах количества и расположения заместителей, сокращенно называющихся SO, S2, S3, S6, S23, S26, S36 и S236. Они определены как S0 - незамещенные ангидроглюкозные звенья; S2, S3, S6 -ангидроглюкозные звенья с одним заместителем в C2, C3 и С6, соответственно; S23, S26, S36 - ангидроглюкозные звенья с двумя заместителями в пронумерованных положениях; S236 - ангидроглюкозные звенья со всеми тремя замещенными положениями. Поскольку С3 относительно нереакционноспособен, мера увеличенного замещения в С2 положении дана при помощи процентного содержания С2-замещенных тримеров (т.е. сумма S2, S23, S26, S236) относительно процентного содержания С6-замещенных тримеров (сумма S6, S26, S36, S236). Для повышения ферментной устойчивости при помощи благоприятствующего замещения в С2, процентное содержание С2-замещенных тримеров составляет предпочтительно более чем в 0,8 раза, более предпочтительно более чем в 0,9 раза, процентного содержания С6-замещенных тримеров.

Для дальнейшего уменьшения любого распада под действием целлюлазного фермента, неводная жидкая композиция может содержать катионный целлюлозный полимер, присутствующий в форме частиц. То есть, катионный целлюлозный полимер нерастворим в неводной жидкой композиции, или не полностью растворим в неводной жидкой композиции. Приемлемые формы частиц включают твердые вещества, которые полностью не содержат воду и/или другой растворитель, но также включают твердые вещества, которые частично гидратированные и/или сольватированные. Частично гидратированные или сольватированные частицы являются такими, которые содержат воду и/или другой растворитель на уровнях, которые являются недостаточными, чтобы вызвать полную солюбилизацию частиц. Полезным свойством частичной гидратации и/или сольватации катионного целлюлозного полимера является то, что в любой форме агломератов они имеют низкую прочность фильтрационной корки и их легко повторно диспергировать. Такие гидратированные или сольватированные частицы в общем содержат от 0,5% до 50%, предпочтительно от 1% до 20% воды или растворителя. В то время как вода предпочтительна, любой растворитель, способный к частичной сольватации катионного целлюлозного полимера, может быть использован. Частицы катионного целлюлозного полимера предпочтительно настолько малы насколько возможно. Приемлемые частицы имеют средний диаметр площади D90 менее чем 300 микрон, предпочтительно менее чем 200 микрон, более предпочтительно менее чем 150 микрон. Средний диаметр площади D90 определяют как 90% частиц, имеющих площадь менее площади круга, имеющего диаметр D90. Способ измерения размеров частиц приведен в разделе Тестовые методы.

Целлюлазный фермент

Для полезных эффектов ощущения от тканей и ухода за цветом, неводная жидкая композиция может содержать от 0,000005% до 0,2%, предпочтительно от 0,00001 до 0,05%, более предпочтительно от 0,0001% до 0,02% по массе целлюлазного фермента. Однако катионные целлюлозные полимеры, как было найдено, распадаются даже при остаточных уровнях целлюлазного фермента, в водных композициях. Фактически, неводные жидкие композиции в соответствии с настоящим изобретением, как было найдено, обеспечивают полезный эффект, на уровнях целлюлазного фермента, по меньшей мере, 0,0000046% по массе. Даже на таком низком уровне целлюлазный фермент, как было найдено, разлагает катионные целлюлозные полимеры в водных композициях.

Приемлемые целлюлазы включают эндо-бета-1,4-глюканазы,

целлобиогидролазы и бета-1,4-глюкозидазы, бактериального или грибкового происхождения, из любого семейства гликозил гидролаз, показывающих целлюлазную активность. Включены химически модифицированные или сконструированные методом белковой инженерии мутанты. Приемлемые целлюлазы включают целлюлазы родов Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, например грибковые целлюлазы, вырабатываемые Humicola insolens, Myceliophthora thermophila и Fusarium oxysporum, описанные в US 4,435,307, US 5,648,263, US 5,691,178, US 5,776,757 и WO 89/09259.

Особо приемлемыми целлюлазами являются щелочные или нейтральные целлюлазы, имеющие полезные эффекты ухода за цветом. Примерами таких целлюлаз являются целлюлазы, описанные в ЕР 0 495 257, ЕР 0 531 372, WO 96/11262, WO 96/29397, WO 98/08940. Другими примерами являются целлюлазные варианты, например, описанные в WO 94/07998, ЕР 0531315, US 5,457,046, US 5,686,593, US 5,763,254, WO 95/24471 и WO 98/12307.

Коммерчески доступные целлюлазы включают Celluzyme® и Carezyme® (Novozymes A/S), Clazinase®, Puradax® EG-L и Puradax® HA (Genencor International Inc.) и KAC®-500(B) (Kao Corporation).

В одном аспекте, целлюлаза может включать эндоглюканазы микробного происхождения, проявляющие эндо-бета-1,4-глюканазную активность (Е.С.3.2.1.4), включая бактериальный полипептид, эндогенный к члену рода Bacillus, который имеет последовательность, по меньшей мере, 90%, 94%, 97% и даже 99% идентичности к аминокислотной последовательности SEQ ID NO:2 в US 7,141,403 и их смеси. Приемлемые эндоглюканазы продают под торговыми марками Celluclean® и Whitezyme® (Novozymes A/S, Bagsvaerd, Denmark).

Предпочтительно, композиция содержит очищающую целлюлазу, принадлежащую к семейству гликозильных гидролаз 45, имеющую молекулярную массу от 17 кДа до 30 кДа, например эндоглюканазы, которые продаются под торговой маркой Biotouch® NCD, DCC и DCL (АВ Enzymes, Darmstadt, Germany). Целлюлаза может быть намеренно сформулирована, или она может быть введена в композицию моющего средства в качестве примеси в другом сырье, особенно ферменте. Коммерческие ферменты многих классов, например протеаза, альфа-амилаза, бета-маннаназа, пектат лиаза и липаза, могут содержать дополнительную активность целлюлазы в результате выработки микроорганизмов, экспрессирующих целлюлазные ферменты, которые не полностью удаляются во время стадий очистки, либо посредством загрязнения от других продуктов во время процесса выработки ферментов. Коммерческая протеаза Purafect® Prime (Genencor Division, Danisco) является примером нецеллюлазного фермента, который типично содержит значительные примеси целлюлазы.

Другой источник непреднамеренного присутствия целлюлазы в композициях моющих средств происходит от перекрестного загрязнения на промышленных предприятиях, например, при изменении целлюлазасодержащей композиции на композицию, не содержащую намеренно составленной в композицию целлюлазы.

Добавки для стирки

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать традиционные моющие ингредиенты для стирки, выбранные из группы, состоящей из анионных и неионных поверхностно-активных веществ; дополнительных поверхностно-активных веществ; других ферментов; стабилизаторов ферментов; очищающих полимеров, включая: амфифильные алкоксилированные полимеры, очищающие жир, полимеры, очищающие глинистые загрязнения, полимеры, высвобождающие загрязнения, и полимеры, суспендирующие загрязнения; отбеливающих систем; оптических отбеливателей; оттеночных красителей; материала в виде частиц; отдушки и других средств контроля запаха; гидротропов; подавителей пенообразования; полезных агентов по уходу за тканями; агентов, регулирующих pH; агентов, ингибирующих перенос красителя; консервантов; прямых красителей не для тканей и их смесей. Некоторые из необязательных ингредиентов, которые могут быть использованы, более подробно описаны следующим образом.

Анионные и неионные поверхностно-активные вещества

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать от 1% до 70%, предпочтительно от 10% до 50%, и более предпочтительно от 15% до 45% по массе анионного и/или неионного поверхностно-активного вещества.

Неводные жидкие композиции в соответствии с настоящим изобретением предпочтительно содержат от 1 до 70%, более предпочтительно от 5 до 50% по массе одного или более анионных поверхностно-активных веществ. Предпочтительное анионное поверхностно-активное вещество выбирают из группы, состоящей из: C11-С18 алкилбензолсульфонатов, С10-С20 алкилсульфатов с разветвленной цепью и случайных алкилсульфатов, С10-С18 алкил этокси сульфатов, разветвленных в середине цепи алкилсульфатов, разветвленных в середине цепи алкил алкокси сульфатов, С10-С18 алкил алкокси карбоксилатов, содержащих 1-5 этокси звеньев, модифицированного алкилбензол сульфоната, С12-С20 сульфоната сложного метилового эфира, С10-С18 альфа-олефин сульфоната, С6-С20 сульфосукцинатов и их смесей. Тем не менее, по своей природе, каждое анионное поверхностно-активное вещество, известное в области композиций моющих средств, может быть использовано, например, описанные в "Surfactant Science Series", Vol.7, edited by W. M. Linfield, Marcel Dekker. Тем не менее, композиции в соответствии с настоящим изобретением предпочтительно содержат, по меньшей мере, одно поверхностно-активное вещество на основе сульфоновой кислоты, такое как линейная алкил бензол сульфоновая кислота, или растворимые в воде солевые формы.

Анионные сульфонатные поверхностно-активные вещества или поверхностно-активные вещества на основе сульфоновой кислоты, приемлемые для использования в данной заявке включают кислоту и солевые формы линейных или разветвленных С5-С20, более предпочтительно С10-С16, наиболее предпочтительно СП-СИ алкилбензолсульфонатов, С5-С20 алкилсульфонатов сложных эфиров, С6-С22 первичных или вторичных алкансульфонатов, С5-С20 сульфированных поликарбоновых кислот и их смесей. Указанные выше поверхностно-активные вещества могут широко варьироваться по содержанию 2-фенильного изомера. Анионные сульфатные соли, приемлемые для использования в композициях в соответствии с настоящим изобретением включают: первичные и вторичные алкилсульфаты, имеющие линейный или разветвленный алкильный или алкенильный фрагмент, имеющий от 9 до 22 атомов углерода, более предпочтительно от 12 до 18 атомов углерода; бета-разветвленные алкилсульфатные поверхностно-активные вещества, а также их смеси. Разветвленные в середине цепи алкил сульфаты или сульфонаты также являются приемлемыми анионными поверхностно-активными веществами для использования в композициях в соответствии с настоящим изобретением. Предпочтительными являются С5-С22, предпочтительно С10-С20 разветвленные в середине цепи алкильные первичные сульфаты. Если используют смеси, то приемлемое среднее общее количество атомов углерода в алкильных фрагментах находится предпочтительно в диапазоне от 14,5 до 17,5. Предпочтительные моно-метил-разветвленные первичные алкилсульфаты выбирают из группы, состоящей из 3-метил - 13-метил пентадеканол сульфатов, соответствующих гексадеканол сульфатов, и их смесей. Диметильные производные или другие биоразлагаемые алкил сульфаты, имеющие легкое разветвление, можно использовать аналогичным образом. Другие приемлемые анионные поверхностно-активные вещества для использования в данной заявке включают жирные метальные сложноэфирные сульфонаты и/или алкил этокси сульфаты (AES) и/или алкил полиалкоксилированные карбоксилаты (АЕС). Смеси анионных поверхностно-активных веществ могут быть использованы, например, смеси алкилбензолсульфонатов и AES.

Анионные поверхностно-активные вещества типично присутствуют в виде их солей с алканоламинами или щелочными металлами, такими как натрий и калий. Предпочтительно, анионные поверхностно-активные вещества нейтрализуют алканоламинами, такими, как моноэтаноламин или триэтаноламин, и они полностью растворимы в неводной жидкой композиции.

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать от 1 до 70%, предпочтительно от 5 до 50% по массе неионного поверхностно-активного вещества. Приемлемые неионные поверхностно-активные вещества включают, но не ограничиваясь приведенным, С12-С18 алкилэтоксилаты ("АЕ"), включая так называемые алкилэтоксилаты с узкими пиками, С6-С12 алкилфенол алкоксилаты (особенно этоксилаты и смешанные этоксилаты/пропоксилаты), блок алкиленоксидный конденсат С6-С12 алкил фенолов, алкиленоксидные конденсаты С8-С22 алканолов и блок-полимеры этиленоксида/пропиленоксида (Pluronic®-BASF Corp.), а также полуполярные неионные вещества (например, аминоксиды и фосфиноксиды). Широкое раскрытие информации о приемлемых неионных поверхностно-активных веществах можно найти в патенте США №3929678.

Алкилполисахариды, такие как описанные в патенте США №4565647, также являются полезными неионными поверхностно-активными веществами в композициях в соответствии с настоящим изобретением. Также приемлемыми являются алкильные полиглюкозидные поверхностно-активные вещества. В некоторых осуществлениях приемлемые неионные поверхностно-активные вещества включают неионные поверхностно-активные вещества формулы R1(OC2H4)nOH, где R1 представляет собой С10-С16 алкильную группу или С8-С12 алкил фенильную группу и n составляет от 3 до 80. В некоторых осуществлениях неионные поверхностно-активные вещества могут быть продуктами конденсации С12-С15 спиртов с от 5 до 20 моль этиленоксида на моль спирта, например С12-С13 спирта, конденсированного с 6,5 моль этиленоксида на моль спирта. Дополнительные приемлемые неионные поверхностно-активные вещества включают амиды полигидрокси жирных кислот формулы:

,

где R представляет собой С9-С17 алкил или алкенил, R1 представляет собой метальную группу и Z представляет собой глицидил, полученный из восстановленного сахара или его алкоксилированного производного. Примеры представляют собой N-метил N-1-дезоксиглицитил кокоамид и N-метил N-1-дезоксиглицитил олеамид.

Дополнительные поверхностно-активные вещества

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать дополнительное поверхностно-активное вещество, выбранное из группы, состоящей из: анионных, катионных, неионных, амфотерных и/или цвиттерионных поверхностно-активных веществ и их смесей.

Приемлемые катионные поверхностно-активные вещества могут быть водорастворимыми, диспергируемыми в воде или нерастворимыми в воде. Такие катионные поверхностно-активные вещества содержат, по меньшей мере, один кватернизованный атом азота и, по меньшей мере, одну длинноцепочечную гидрокарбильную группу. Также включены соединения, содержащие две, три или далее четыре длинноцепочечные гидрокарбильные группы. Примеры включают алкилтриметиламмониевые соли, такие, как С12 алкилтриметиламмоний хлорид, или их гидроксиалкилзамещенные аналоги. Настоящее изобретение может содержать 1% или более катионных поверхностно-активных веществ.

Амфотерные моющие поверхностно-активные вещества, приемлемые для использования в композиции, включают поверхностно-активные вещества, широко описанные как производные алифатических вторичных и третичных аминов, в которых алифатический радикал может быть неразветвленной или разветвленной цепью, и в которых один из алифатических заместителей содержит от 8 до 18 атомов углерода и один содержит анионную группу, такую как карбокси, сульфонат, сульфат, фосфат или фосфонат. Приемлемые амфотерные моющие поверхностно-активные вещества для использования в настоящем изобретении, включают, но не ограничиваясь приведенным: кокоамфоацетат, кокоамфодиацетат, лауроамфоацетат, лауроамфодиацетат и их смеси.

Цвиттерионные моющие поверхностно-активные вещества, приемлемые для использования в неводных жидких композициях, хорошо известны в данной области техники и включают поверхностно-активные вещества, широко описанные как производные алифатических соединений четвертичного аммония, фосфония и сульфония, в которых алифатические радикалы могут быть неразветвленной или разветвленной цепью и в которых один из алифатических заместителей содержит от 8 до 18 атомов углерода и один содержит анионную группу, такую как карбокси, сульфонат, сульфат, фосфат или фосфонат. Цвиттерионные вещества, такие как бетаины являются также приемлемыми для настоящего изобретения. Дополнительно, аминоксидные поверхностно-активные вещества, имеющие формулу: R(EO)x(PO)y(BO)zN(O)(CH2R')2·qH2O, также полезны в композициях в соответствии с настоящим изобретением. R представляет собой относительно длинноцепочечный гидрокарбильный фрагмент, который может быть насыщенным или ненасыщенным, линейным или разветвленным, а также может содержать от 8 до 20, предпочтительно от 10 до 16 атомов углерода, и представляет собой более предпочтительно С12-С16 первичный алкил. R' представляет собой короткоцепочечный фрагмент, предпочтительно выбранный из водорода, метила и -CH2OH. Если x+y+z отличается от 0, то ЕО является этиленокси, РО является пропиленокси и ВО является бутиленокси. Аминоксидные поверхностно-активные вещества проиллюстрированы С12-С14 алкилдиметил аминоксидом.

Неограничивающие примеры других анионных, цвиттерионных, амфотерных или необязательных дополнительных поверхностно-активных веществ, приемлемых для использования в композициях описаны в McCutcheon's, Emulsifiers and Detergents, 1989 Annual, опубликованной M. С.Publishing Co., и в патентах США №№3,929,678, 2,658,072; 2,438,091; 2,528,378.

Другие ферменты

Неводные жидкие композиции в соответствии с настоящим изобретением могут содержать от 0,0001% до 8% по массе других моющих ферментов, которые обеспечивают улучшенную эффективность очистки и/или полезные эффекты при уходе за тканями. Такие композиции предпочтительно имеют pH композиции от 6 до 10,5. Приемлемые ферменты могут быть выбраны из группы, состоящей из: липазы, протеазы, амилазы, маннаназы, пектат лиазы, ксилоглюканазы и их смесей, дополнительно к целлюлазному ферменту. Предпочтительная комбинация ферментов включает коктейль из традиционных моющих ферментов, таких как липаза, протеаза и амилаза. Моющие ферменты более подробно описаны в патенте США №6579839.

Стабилизаторы ферментов

Ферменты могут быть стабилизированы с помощью любой известной системы стабилизаторов, такой как соединения кальция и/или магния, соединения бора и замещенных борных кислот, ароматические боратные сложные эфиры, пептиды и пептидные производные, полиолы, низкомолекулярные карбоксилаты, относительно гидрофобные органические соединения [например, определенные сложные эфиры, диалкилгликольные эфиры, спирты или спиртовые алкоксилаты], алкил эфир карбоксилат в дополнение к источнику ионов кальция, гипохлорит бензамидина, низшие алифатические спирты и карбоновые кислоты, N,N-бис(карбоксиметил) сериновые соли; сополимер (мет)акриловой кислоты - сложного эфира (мет)акриловой кислоты и ПЭГ; соединение лигнина, полиамидный олигомер, гликолевая кислота или ее соли; полигексаметилен бигуанид или N,N-бис-3-амино-пропил-додецил амин или соль; и их смеси. Может быть использован любой приемлемый ингибитор целлюлаз. Примеры ингибиторов целлюлаз перечислены в Н. Zolter, Handbook of Enzyme Inhibitors, 3ed, Part A, pp.307-309. Такие ингибиторы целлюлаз предпочтительно присутствуют на уровне от 0,0001% до 3% по массе неводной композиции.

Полезные агенты по уходу за тканью

Неводная композиция может дополнительно содержать от 1% до 15%, более предпочтительно от 2% до 7% по массе полезного агента по уходу за тканью, дополнительно к катионному целлюлозному полимеру и целлюлазному ферменту. "Полезный агент по уходу за тканью", как используют в данной заявке, относится к любому материалу, который может обеспечить полезные эффекты при уходе за тканью. Неограничивающие примеры полезных эффектов при уходе за тканью, включают, но не ограничиваясь приведенным: смягчение ткани, защиту цвета, восстановление цвета, уменьшение сваливания/вспушивания, антиистирание и антисминание. Неограничивающие примеры полезных агентов по уходу за тканью включают: силиконовые производные, такие как полидиметилсилоксан и амино-функциональные силиконы; жирные производные сахара; диспергируемые полиолефины; полимерные латексы; катионные поверхностно-активные вещества и их комбинации.

Чистящие полимеры

Неводные жидкие композиции в данной заявке могут содержать от 0,01% до 10%, предпочтительно от 0,05% до 5%, более предпочтительно от 0,1%о до 2,0% по массе чистящих полимеров, которые обеспечивают широкий диапазон очистки поверхностей и тканей от загрязнений. Может быть использован любой приемлемый чистящий полимер. Полезные чистящие полимеры описаны в US 2009/0124528А1. Неограничивающие примеры полезных категорий чистящих полимеров включают: амфифильные алкоксилированные полимеры, очищающие жир; полимеры, очищающие глинистые загрязнения; полимеры, высвобождающие загрязнения и полимеры, суспендирующие загрязнения. Другие анионные полимеры, полезные для улучшения очистки от загрязнений, включают: не содержащие силикон полимеры природного происхождения, а также синтетического происхождения. Приемлемые анионные, не содержащие силикон полимеры могут быть выбраны из группы, состоящей из ксантановой камеди, анионного крахмала, карбоксиметилгуара, карбоксиметилгидроксипропилгуара, карбоксиметилцеллюлозы и модифицированной сложными эфирами карбоксиметилцеллюлозы, N-карбоксиалкилхитозана, N-карбоксиалкилхитозан амидов, пектина, каррагинановой камеди, хондроитин сульфата, галактоманнанов, полимеров на основе гиалуроновой кислоты и альгиновой кислоты и их производных и их смесей. Более предпочтительно, анионный, не содержащий силикон полимер может быть выбран из карбоксиметилгуара, карбоксиметилгидроксипропилгуара, карбоксиметилцеллюлозы и ксантановой камеди, и их производных и их смесей. Предпочтительные анионные, не содержащие силикон полимеры включают коммерчески доступные от CPKelco, продается под торговой маркой Kelzan® RD и от Aqualon, продается под торговой маркой Galactosol® SP722S, Galactosol® 60H3FD и Galactosol® 70H4FD.

Оптические отбеливатели

Они также известны как люминесцентные отбеливающие средства для текстиля. Предпочтительные уровни составляют от 0,001% до 2% по массе неводной жидкой композиции. Приемлемые отбеливатели описаны в ЕР 686691 В и включают как гидрофобные, так и гидрофильные типы. Отбеливатель 49 является предпочтительным для использования в настоящем изобретении.

Оттеночные красители

Оттеночные красители или оттеняющие красители для тканей являются полезными добавками для стирки в неводных жидких композициях. Приемлемые красители включают синие и/или фиолетовые красители, имеющие оттеночный или оттеняющий эффект. См., например, WO 2009/087524 А1, WO 2009/087034A1 и ссылки, приведенные в них. Недавние разработки, которые являются приемлемыми для настоящего изобретения, включают сульфированные фталоцианиновые красители, содержащие центральный атом цинка или алюминия. Неводные жидкие композиции в данной заявке могут содержать от 0,00003% до 0,1%, предпочтительно от 0,00008%) до 0,05% по массе оттеночного красителя для ткани.

Материал в виде частиц

Неводная композиция может содержать дополнительный материал в виде частиц, такой как глины, подавители пенообразования, инкапсулированные чувствительные к окислению и/или термически чувствительные ингридиенты, такие как отдушки (микрокапсулы отдушек), отбеливатели и ферменты, или эстетические добавки, такие как перламутровые агенты, включая слюду, пигментные частицы, или тому подобное. Приемлемые уровни составляют от 0,0001% до 10% или от 0,1% до 5% по массе неводной композиции.

Отдушка и другие агенты контроля запаха

В предпочтительных осуществлениях неводная композиция содержит свободную и/или микроинкапсулированную отдушку. Если присутствует, свободная отдушка, типично, включена на уровне от 0,001% до 10%, предпочтительно от 0,01% до 5%, более предпочтительно от 0,1% до 3% по массе неводной композиции.

Если присутствует, микрокапсула отдушки формируется, по меньшей мере, частично окружающим сырье отдушки материалом стенок. Предпочтительно, материал стенок микрокапсул содержит: меламин, поперечно сшитый с формальдегидом, полимочевину, мочевину, поперечно сшитую с формальдегидом, или мочевину, поперечно сшитую с глутаровым альдегидом. Приемлемые микрокапсулы отдушки и нанокапсулы отдушки включают описанные в следующих ссылках: US 2003215417 А1; US 2003216488 Al; US 2003158344 Al; US 2003165692 Al; US 2004071742 Al; US 2004071746 Al; US 2004072719 Al; US 2004072720 Al; EP 1393706 Al; US 2003203829 Al; US 2003195133 Al; US 2004087477 Al; US 20040106536 Al; US 6645479; US 6200949; US 4882220; US 4917920; US 4514461; US RE 32713; US 4234627.

В других осуществлениях, неводная композиция содержит агенты контроля запаха, такие как несвязанный в комплекс циклодекстрин, как описано в US 5942217.

Другие приемлемые агенты контроля запаха включают описанные в: US 5968404, US 5955093, US 6106738, US 5942217 и US 6033679.

Гидротропы

Неводная жидкая композиция в соответствии с настоящим изобретением типично содержит гидротроп в эффективном количестве, предпочтительно до 15%, более предпочтительно от 1% до 10%, наиболее предпочтительно от 3% до 6% по массе, так что композиции легко диспергируются в воде. Приемлемые гидротропы для использования в данной заявке включают гидротропы анионного типа, в частности, натрия, калия и аммония ксилол сульфонат, натрия, калия и аммония толуолсульфонат, натрия, калия и аммония кумол сульфонат и их смеси, как описано в US 3915903.

Поливалентный водорастворимый органический структурообразователъ и/или хелатообразующий агент

Неводные жидкие композиции в соответствии с настоящим изобретением могут одержать от 0,6% до 25%, предпочтительно от 1% до 20%, более предпочтительно от 2% до 7% по массе поливалентного водорастворимого органического структурообразователя и/или хелатообразующих агентов. Водорастворимые органические структурообразователи предоставляют широкий спектр преимуществ, включая поглощение кальция и магния (улучшенная очистка в жесткой воде), обеспечение щелочности, комплексообразование ионов переходных металлов, стабилизацию коллоидных оксидов металлов и обеспечение существенного поверхностного заряда для пептизации и суспендирования других загрязнений. Хелатообразующие агенты могут селективно связывать переходные металлы (например, железо, медь и марганец), что оказывает влияние на удаление пятен и стабильность отбеливающих ингредиентов, таких, как органические отбеливающие катализаторы, в моющем растворе. Предпочтительно, поливалентный водорастворимый органический структурообразователъ и/или хелатообразующие агенты в соответствии с настоящим изобретением, выбирают из группы, состоящей из: МЕА цитрата, лимонной кислоты, аминоалкиленполи(алкиленфосфонатов), щелочных металлов этан 1-гидроксидифосфонатов, и нитрилотриметилена, фосфонатов, диэтилентриамин пента(метиленфосфониевой кислоты) (DTPMP), этилендиамин тетра(метиленфосфониевой кислоты) (DDTMP), гексаметилендиамин тетра(метиленфосфониевой кислоты), гидроксиэтилен 1,1 дифосфониевой кислоты (HEDP), гидроксиэтан диметиленфосфониевой кислоты, этилендиамин диянтарной кислоты (EDDS), этилендиаминтетрауксусной кислоты (EDTA), гидроксиэтилэтилендиамин триацетата (HEDTA), нитрилотриацетата (NTA), метилглициндиацетата (MGDA), иминодисукцината (IDS), гидроксиэтилиминодисукцината (HIDS), гидроксиэтилиминодиацетата (HEIDA), глицин диацетата (GLDA), диэтилентриамин пентауксусной кислоты (DTPA) и их смесей.

Внешняя структурирующая система

Неводная жидкая композиция может также содержать внешний структурообразователь. Внешняя структурирующая система представляет собой соединение или смесь соединений, которые обеспечивают либо достаточную текучесть, либо низкую вязкость сдвига для стабилизации неводных жидких композиций, независимо от или внешне, от структурирующего влияния любых моющих поверхностно-активных веществ в композиции. Неводная жидкая композиция может содержать от 0,01% до 10%, предпочтительно от 0,1% до 4% по массе внешней структурирующей системы. Приемлемые внешние структурирующие системы включают неполимерные кристаллические, гидроксифункциональные структурообразователи, полимерные структурообразователи или их смеси.

Предпочтительно, внешняя структурирующая система придает высокую вязкость сдвига при 20 с-1, при 21°C, от 1 до 1500 сП, и вязкость при низком сдвиге (0,05 с-1 при 21°C) более чем 5000 сП. Вязкость измеряют с помощью реометра AR 550, от ТА instruments, используя шпиндель из стальной пластины с диаметром 40 мм и зазором размером 500 мкм. Высокая вязкость сдвига при 20 с-1 и низкая вязкость сдвига при 0,5 с-1, могут быть получены из логарифмической развертки скорости сдвига от 0,1 с-1 до 25 с-1 через 3 минуты при 21°C.

Внешняя структурирующая система может содержать неполимерный кристаллический, гидроксильный функциональный структурообразователь. Такие неполимерные кристаллические, гидроксильные функциональные

структурообразователи, как правило, содержат кристаллизирующийся глицерид, который может быть предварительно эмульгирован, чтобы способствовать дисперсии в конечной неводной композиции. Предпочтительные кристаллизующиеся глицериды включают гидрогенизированное касторовое масло или "НСО", и его производные, при условии, что они способны кристаллизоваться в неводной композиции. Другие осуществления приемлемых внешних структурирующих систем могут включать полученный природным путем и/или синтетический полимерный структурообразователь. Примеры приемлемых полученных природным путем полимерных структурообразователей включают: гидроксиэтилцеллюлозу, гидрофобно модифицированную гидроксиэтилцеллюлозу, карбоксиметилцеллюлозу, производные полисахаридов, и их смеси. Приемлемые производные полисахаридов включают: пектин, альгинат, арабиногалактан (гуммиарабик), каррагинан, геллановую камедь, ксантановую камедь, гуаровую камедь и их смеси. Примеры приемлемых синтетических полимерных структурообразователей включают: поликарбоксилаты, полиакрилаты, гидрофобно модифицированные этоксилированные уретаны, гидрофобно модифицированные неионные полиолы и их смеси. Изделие стандартной дозы

Неводные жидкие композиции в соответствии с настоящим изобретением могут размещаться в изделиях стандартной дозы, содержащих, по меньшей мере, одно заполненное жидкостью отделение. Заполненное жидкостью отделение относится к отделению изделия стандартной дозы, содержащему жидкость, способную смачивать ткани, например одежду. Такие изделия стандартной дозы содержат в одной, простой в использовании форме дозирования: катионный целлюлозный полимер и целлюлазный фермент, которые содержатся в неводной композиции, инкапсулированной в водорастворимую или диспергируемую пленку.

Изделие стандартной дозы может быть любого вида, формы и материала, которые приемлемы для удержания неводной композиции, т.е. не позволяя высвобождение неводной композиции, и любого дополнительного компонента, из изделия стандартной дозы до контакта изделия стандартной дозы с водой. Точное выполнение будет зависеть, например, от типа и количества композиций в изделии стандартной дозы, количества отделений в изделии стандартной дозы, и от характеристик, необходимых для того, чтобы изделие стандартной дозы удерживало, защищало и доставляло или высвобождало композиции или компоненты.

Изделие стандартной дозы содержит водорастворимую или диспергируемую пленку, которая полностью охватывает, по меньшей мере, один внутренний объем, содержащий неводную композицию. Изделие стандартной дозы может необязательно содержать дополнительные отделения, содержащие неводные жидкие и/или твердые компоненты. Альтернативно, любой дополнительный твердый компонент может быть суспендирован в заполненном жидкостью отделении. Стандартная форма дозирования с несколькими отделениями может быть желательной по таким причинам, как: разделение химически несовместимых ингредиентов; или если желательно, чтобы часть ингредиентов была высвобождена при мытье раньше или позже.

Может быть предпочтительным, чтобы любое отделение, которое содержит жидкий компонент, также содержало воздушный пузырь. Воздушный пузырь может иметь объем менее чем 50%, предпочтительно менее чем 40%, более предпочтительно менее чем 30%, более предпочтительно менее чем 20%, наиболее предпочтительно менее чем 10% объема пространства указанного отделения. Не будучи связанными теорией, считают, что присутствие воздушного пузыря повышает переносимость изделия стандартной дозы к движению жидкого компонента внутри отделения, тем самым снижая риск утечки жидкого компонента из отделения.

Водорастворимая или диспергируемая пленка

Водорастворимая или диспергируемая пленка типично имеет растворимость, по меньшей мере, 50%, предпочтительно, по меньшей мере, 75%, более предпочтительно, по меньшей мере, 95%. Способ определения водорастворимости пленки приведен в разделе Тестовые методы. Водорастворимая или диспергируемая пленка типично имеет время растворения менее чем 100 секунд, предпочтительно менее чем 85 секунд, более предпочтительно менее чем 75 секунд, наиболее предпочтительно менее чем 60 секунд. Способ определения времени растворения пленки приведен в разделе Тестовые методы.

Предпочтительными пленками являются полимерные материалы, предпочтительно полимеры, которые формируются в пленку или лист. Пленка может быть получена путем литья, выдувного формования, экструзии или экструзии с последущим раздувом полимерного материала, как известно в данной области техники. Предпочтительно, водорастворимая или диспергируемая пленка содержит: полимеры, сополимеры или их производные, в том числе поливиниловые спирты (PVA), поливинилпирролидон, полиалкиленоксиды, акриламид, акриловую кислоту, целлюлозу, эфиры целлюлозы, сложные эфиры целлюлозы, амиды целлюлозы, поливинилацетаты, поликарбоновые кислоты и соли, полиаминокислоты или пептиды, полиамиды, полиакриламид, сополимеры малеиновой/ акриловой кислот, полисахариды, включая крахмал и желатин, природные камеди, такие как ксантановая камедь и камедь карайи, и их смеси. Более предпочтительно, водорастворимая или диспергируемая пленка содержит: полиакрилаты и водорастворимые акрилатные сополимеры, метилцеллюлозу, карбоксиметилцеллюлозу, декстрин, этилцеллюлозу, гидроксиэтилцеллюлозу, гидроксипропилметилцеллюлозу, мальтодекстрин, полиметакрилаты и их смеси. Наиболее предпочтительно, водорастворимая или диспергируемая пленка содержит: поливиниловые спирты, сополимеры поливинилового спирта, гидроксипропилметилцеллюлозу (НРМС) и их смеси. Предпочтительно, уровень полимера или сополимера в пленке составляет, по меньшей мере, 60% по массе. Полимер или сополимер предпочтительно имеет средневзвешенную молекулярную массу от 1000 до 1000000, более предпочтительно от 10000 до 300000, даже более предпочтительно от 15000 до 200000 и наиболее предпочтительно от 20000 до 150000.

Также могут быть использованы сополимеры и смеси полимеров. Это может быть, в частности, полезно для контроля механических свойств и/или свойств растворения отделений или изделия стандартной дозы, в зависимости от их применения и целевой потребности. Например, может быть предпочтительным, чтобы смесь полимеров присутствовала в пленке, если один полимерный материал имеет более высокую растворимость в воде, чем другой полимерный материал, и/или один полимерный материал имеет более высокую механическую прочность, чем другой полимерный материал. Использование сополимеров и смесей полимеров может иметь другие преимущества, включая повышение долгосрочной устойчивости водорастворимой или диспергируемой пленки к моющим ингредиентам. Например, US 6,787,512 раскрывает сополимерные пленки поливинилового спирта, содержащие гидролизованный сополимер винилацетата и второй мономер сульфоновой кислоты, для улучшенной устойчивости к моющим ингредиентам. Пример такой пленки продается Monosol от Merrillville, Indiana, US, под торговой маркой: М8900. Может быть предпочтительным использовать смесь полимеров, имеющих разную средневзвешенную молекулярную массу, например смесь поливинилового спирта или его сополимера со средневзвешенной молекулярной массой от 10000 до 40000 и другого поливинилового спирта или сополимера со средневзвешенной молекулярной массой от 100000 до 300000.

Также полезными являются композиции полимерных смесей, например содержащие гидролитически разлагаемые и водорастворимые полимерные смеси, такие как полилактида и поливинилового спирта, получаемые путем смешивания полилактида и поливинилового спирта, типично содержащие от 1 до 35% по массе полилактида и от 65% до 99% по массе поливинилового спирта. Полимер, присутствующий в пленке, может гидролизоваться от 60% до 98% , более предпочтительно от 80% до 90%, для улучшения растворения/дисперсии материала пленки.

Водорастворимая или диспергируемая пленка в данной заявке может содержать добавочные ингредиенты, кроме полимерного или сополимерного материала. Например, может быть полезно добавить: пластификаторы, такие как глицерин, этиленгликоль, диэтиленгликоль, пропиленгликоль, сорбит и их смеси; дополнительную воду и/или агенты распада.

Другие приемлемые примеры коммерчески доступных водорастворимых пленок включают поливиниловый спирт и частично гидролизованный поливинилацетат, альгинаты, эфиры целлюлозы, такие как карбоксиметилцеллюлоза и метилцеллюлоза, полиэтиленоксид, полиакрилаты и их комбинации. Наиболее предпочтительными являются пленки со свойствами, похожими на свойства пленки, содержащей поливиниловый спирт, известной под торговой маркой М8630, которая продается Monosol, Merrillville, Indiana, US.

Способ получения и повторного смешивания

Предпочтительный способ получения неводной композиции в соответствии с настоящим изобретением включает стадии, на которых (i) обеспечивают неводное жидкое сырье; (ii) объединяют катионный целлюлозный полимер с неводным жидким сырьем; и (iii) объединяют целлюлазный фермент с объединенными неводным жидким сырьем и катионным целлюлозным полимером. Альтернативно, целлюлазный фермент может быть добавлен перед добавлением катионного целлюлозного полимера. Предпочтительно, катионный целлюлозный полимер и/или целлюлазный фермент могут быть добавлены как части премиксов или как дисперсии частиц. Если катионный целлюлозный полимер добавляют как часть премикса, или дисперсию частиц, премикс или дисперсия частиц предпочтительно содержит от 1% до 35%, более предпочтительно от 10% до 25% по массе катионного полимера. Целлюлазный фермент предпочтительно добавляют как премикс, в том числе как премикс с пропандиолом и/или водой. Целлюлазный премикс может содержать от 5 мг/г до 50 мг/г, предпочтительно от 10 мг/г до 20 мг/г катионной целлюлазы.

Неводное сырье может содержать некоторые или все остальные ингредиенты, в том числе анионные и/или неионные поверхностно-активные вещества. В другом осуществлении способ может включать стадию формирования внешнего структурообразующего премикса и объединения внешнего структурообразующего премикса с катионным целлюлозным полимером, или неводным сырьем, или объединенными дисперсией катионного целлюлозного полимера /целлюлазой/ неводным жидким сырьем.

Неводная жидкая композиция может содержаться в изделии стандартной дозы. Такое изделие стандартной дозы можно получить в соответствии со способами, известными в данной области техники. Например, водорастворимую или диспергируемую пленку разрезают до нужного размера, а затем складывают, чтобы сформировать необходимое количество и размер отделений. Края затем герметично запечатывают с использованием любой приемлемой технологии, например, тепловой сварки, влажной герметизации или герметизации под давлением. Предпочтительно, источник герметичного запечатывания приводят в контакт с указанной пленкой, прикладывают тепло или давление для герметичного запечатывания материала пленки.

Водорастворимую или диспергируемую пленку, типично, вводят в пресс-форму и применяют вакуум таким образом, что указанная пленка находится на одном уровне с внутренней поверхностью пресс-формы, образуя отступ или нишу в указанном материале пленки. Это называется вакуумным формованием. Другой приемлемый способ представляет собой термоформование. Термоформование типично включает стадию формования водорастворимой или диспергируемой пенки в пресс-форме под воздействием тепла, что позволяет указанной пленке деформироваться и принимать форму пресс-формы.

Типично более чем один кусок водорастворимого или диспергируемого материала пленки используют для изготовления изделия стандартной дозы. Например, первый кусок материала пленки может быть вакуумно втянут в пресс-форму таким образом, что указанный первый кусок материала пленки находится на одном уровне с внутренними стенками пресс-формы. Второй кусок материала пленки может быть расположен таким образом, что он полностью перекрывается с первым куском материала пленки. Первый кусок материала пленки и второй кусок материала пленки герметично запечатывают вместе. Первый и второй куски водорастворимой или диспергируемой пленки могут быть изготовлены из одного и того же материала или могут быть различными материалами.

В способе получения изделия стандартной дозы с несколькими отделениями кусок водорастворимого или диспергируемого материала пленки складывается, по меньшей мере, дважды, или, по меньшей мере, три куска материала пленки используют, или, по меньшей мере, два куска материала пленки используют, где, по меньшей мере, один кусок материала пленки складывают, по меньшей мере, один раз. Третий кусок материала пленки, или сложенный кусок материала пленки, создает барьерный слой, который, когда материалы пленки герметично запечатывают вместе, разделяет внутренний объем изделия стандартной дозы на два или более отделения.

Изделие стандартной дозы с несколькими отделениями также может быть получено путем подгонки первого куска материала пленки в пресс-форму. Композиция, или ее компонент, может быть затем вылита в пресс-форму. Предварительно сформированное отделение можно затем поместить над пресс-формой, содержащей композицию, или ее компонент. Предварительно сформированное отделение также предпочтительно содержит композицию или ее компонент. Предварительно сформированное отделение и указанный первый кусок водорастворимого или диспергируемого материала пленки герметично запечатывают вместе, чтобы сформировать изделие стандартной дозы с несколькими отделениями.

Настоящее изобретение также обеспечивает способ повторного смешивания неводной жидкой композиции в соответствии с настоящим изобретением со второй неводной композицией, характеризующийся тем, что вторая неводная композиция содержит полимер на основе целлюлозы, предпочтительно катионный целлюлозный полимер. Альтернативно полимер на основе целлюлозы второй неводной композиции может быть анионным целлюлозным полимером, таким как карбоксиметилцеллюлоза и/или карбоксиметилцеллюлоза, модифицированная сложным эфиром.

ТЕСТОВЫЕ МЕТОДЫ

1) Измерение pH:

pH измеряли в чистой композиции при 25°C с помощью Santarius РТ-10Р pH-метра с гелевым зондом (например, зонд Toledo, номер части 52 ООО 100), откалиброванным в соответствии с инструкцией.

2) Метод измерения размера частиц:

Occhio Flow Cell FC200-S (Angleur, Belgium) использовали для измерения распределения частиц по размерам. Пробу, содержащую частицы для анализа, разбавляли до 2% по массе, с помощью PEG200, чтобы обеспечить детекцию одной частицы. 2 мл разбавленной пробы анализировали в соответствии с инструкциями, прилагаемыми к устройству.

3) Метод измерения растворимости водорастворимых или диспергируемых пленок:

5,0 грамм±0,1 грамма водорастворимой или диспергируемой пленки добавляли в предварительно взвешенный стакан на 400 мл и добавляли 245 мл±1 мл дистиллированной воды. Смесь энергично перемешивали на магнитной мешалке, установленной на уровне 600 оборотов в минуту, в течение 30 минут. Затем смесь фильтровали через фильтр из спеченного стекла с размером пор максимум 20 микрон. Воду высушивали из собранного фильтрата любым традиционным способом, а массу оставшегося материала определяли (которая представляла собой растворенную или диспергированную фракцию). Затем может быть рассчитана растворимость в процентах или диспергируемость.

4) Метод измерения времени растворения водорастворимых или диспергируемых пленок:

Пленку вырезали и монтировали в складной рамке диапозитива для диапозитивной пленки 24 мм на 36 мм, без стекла (номер части 94.000.07, поставляется Else, The Netherlands, однако могут быть использованы пластиковые складные рамки от других поставщиков).

Стандартный стеклянный стакан на 600 мл наполняли 500 мл водопроводной воды при 10°C и перемешивали с помощью магнитной палочки для перемешивания, таким образом, что на дне находился вихрь на высоте градуировки 400 мл на стакане.

Рамку диапозитива закрепляли зажимами к вертикальному кронштейну и суспендировали в воде, 36 мм сторона по горизонтали, вдоль диаметра стакана, таким образом, что край рамки диапозитива на 5 мм выдавался за сторону стакана, и верхняя часть рамки диапозитива находилась на высоте градуировки 400 мл. Секундомер был запущен сразу же после размещения рамки диапозитива в воде, и остановлен, когда пленка была полностью растворена. Это время было зарегистрировано как "время растворения пленки".

5) Метод оценки полезного эффекта мягкости неводной жидкой композиции;

Характеристики мягкости оценивали при помощи следующей процедуры:

Махровую ткань и трикотажную хлопковую ткань, поставляемые Boechout "Beschutte Werkplaats" Company, Antwerp, Belgium, использовали в качестве тестовых тканей. Мытье осуществляли при стандартных западноевропейских условиях мытья с использованием стиральной машины Miele W467 с фронтальной загрузкой. Мытье осуществляли с использованием цикла "сминание-высвобождение" при 40°C, с использованием воды, имеющей жесткость 2,5 ммоль/л. Загрузка состояла из четырех образцов махровой ткани (прямые петли, без тканого узора, 20 см2, 300 г/м2), четырех образцов трикотажной хлопковой ткани (100% хлопок, ткань для нижнего белья, 20 см2, 40/45 оптическая белизна, 165-175 г/м2), и балласта из чехлов для подушек, футболок и трикотажных полотенец одинаковой массы с получением общей загрузки для мытья 2,5 кг. Тестовые образцы линейно высушивали в течение, по меньшей мере, 24 часов при контролируемой температуре/влажности 21°C и 50% относительной влажности.

Тестовые ткани оценивали по баллам два оценщика-эксперта по шкале от 0 до 4, по сравнению с контролем (ткани мыли в соответствии с тем же самым протоколом с использованием реперной композиции моющего средства). Использовали следующую шкалу оценок:

0 - разницы нет

1 - я полагаю, я вижу разницу

2 - я вижу разницу

3 - я вижу большую разницу

4 - я вижу очень большую разницу.

ПРИМЕРЫ

Примеры 1-3: Неводные жидкие композиции в соответствии с настоящим изобретением, содержащие катионный целлюлозный полимер (LK400, LR400 или JR30M) и целлюлазный фермент (Carezyme).

Пример 4: Неводная жидкая композиция в соответствии с настоящим изобретением, содержащая катионный целлюлозный полимер (JR30M), как суспензию в виде частиц (используя ПЭГ200 в качестве диспергатора), и целлюлазный фермент (Carezyme).

Пример 1 Пример 2 Пример 3 Пример 4
Название ингредиента МАС% МАС% МАС% МАС%
Линейная алкилбензолсульфоновая кислота 16,67 15,81 15,81 15,81
С12-14 алкил 3-этоксилированная серная кислота 9,72 9,4 9,4 9,4
С12-14 алкил 7-этоксилат 14,3 13,84 13,84 13,84
Лимонная кислота 0,68 0,66 0,66 0,66
С12-18 жирная кислота 8,94 8,65 8,65 8,65
DTPA (диэтилентриаминпентауксусная кислота) 1,18 1,18 1,18 1,18
Carezyme 0,0115 0,0115 0,0115 0,0115
Полимер LK4001 0,51 - - 0,5 Г
Полимер LR4001 - 0,51 - -
Полимер JR30M1 - - 0,51 -
Pluriol Е200 (полиэтиленгликоль 200) - - - 1,5*
Полиэтиленимин этоксилат PEI600 Е20 8 8 8 8
PEG6000-PVAc/полиэтиленгликоль 6000-поливинилацетат сополимер 4 4 4 4
Моноэтаноламин До pH 7,5 До pH 7,5 До pH 7,5 До pH 7,5
1,2-пропандиол 11 11 11 11
Глицерин 5 5 5 5
Краситель 0,01 0,01 0,01 0,01
Вода 9,5 10 10 10
Различные добавки/незначительные добавки До 100 До 100 До 100 До 100

1 Поставляется Dow Chemicals

2 LK400 в форме частиц, добавляют в виде суспензии в неводный диспергатор (Pluriol Е200)

Неводные жидкие композиции примеров 1-4 также инкапсулировали в поливинилспиртовую пленку (М8630, поставляется Monosol), с образованием изделий стандартной дозы, содержащих жидкость.

Неводные жидкие композиции примеров 1-4, и соответствующие изделия стандартной дозы все обеспечивают хороший полезный эффект смягчения и очистки, даже при длительном хранении (например, при хранении в течение 4 недель при 35°C).

Пример 5 представляет собой неводную жидкую композицию в соответствии с настоящим изобретением, содержащую катионный целлюлозный полимер (LK400) и целлюлазный фермент, которые получены в результате повторного смешивания сравнительного примера 1, содержащего премикс ферментов, загрязненный целлюлазным ферментом, в сравнительный пример 2, содержащий катионный целлюлозный полимер.

Сравнительный пример 1 Сравнительный пример 2 Пример 5
Название ингредиента МАС% МАС%
Линейная алкилбензолсульфоновая кислота 15,81 16,67 16,67
С12-14 алкил 3-этоксилированная серная кислота 9,4 9,72 9,72
С12-14 алкил 7-этоксилат 13,84 14,3 14,3
Лимонная кислота 0,66 0,68 0,68
С12-18 жирная кислота 8,65 8,94 8,94
DTPA (диэтилентриаминпентауксусная кислота) 1,18 1,18 1,18
Протеаза 0,16 - 0,0016
Маннаназа 0,0035 - 0,000035
Амилаза 0,0234 - 0,000234
Целлюлаза (как загрязнение) 0,0009 - 0,000009
LK4001 - 0,51 0,51
Полиэтиленимин этоксилат PEI600 Е20 8 8 8
PEG6000-PVAc/полиэтиленгликоль 6000-поливинилацетат сополимер 4 4 4
Моноэтаноламин До pH 7,5 До pH 7,5 До pH 7,5
1,2-пропандиол 11 11 11
Глицерин 5 5 5
Краситель 0,01 0,01 0,01
Вода 10 9,5 9,5
Различные добавки/незначительные добавки До 100 До 100 До 100

1 Поставляется Dow Chemicals

Полученную в результате композицию затем выдерживали в течение 5 недель при 35°C вместе с композицией сравнительного примера 2. Полезный эффект мягкости, полученный для обеих композиций, оценивали по сравнению со сравнительным примером 1. Из приведенной ниже таблицы можно увидеть, что пример 5 сохраняет полезный эффект мягкости после выдерживания, даже если он содержит 0,000009% по массе целлюлазного фермента.

Оценка PSU (по сравнению со сравнительным примером)
Сравнительный пример 2 +1,0
Пример 5 +0,9

Размеры и значения, указанные в данной заявке, не должны быть истолкованы как строго ограниченные точными численными указанными значениями. Вместо этого, если не указано иное, каждый такой размер должен означать как указанное значение, так и функционально эквивалентный диапазон, окружающий данное значение. Например, размер, описанный как "40 мм" предназначен для обозначения "приблизительно 40 мм".

1. Жидкая композиция для ухода за тканью, содержащая:
a) катионный целлюлозный полимер, который характеризуется структурной формулой I:

где:
a. m означает целое число от 20 до 10000;
b. каждый R4 представляет собой H; R2 и R3 каждый представляет собой H; каждый R1 независимо выбран из группы, состоящей из H и
где:
n означает целое число, выбранное от 0 до 10; и
каждый R5 представляет собой H;
Rx представляет собой
;
где A- представляет собой приемлемый анион; и
каждый R6 независимо выбран из C1-C32 алкила; и
b)целлюлазный фермент;
при этом жидкая композиция содержит менее чем приблизительно 20 % по массе воды.

2. Жидкая композиция по п.1, отличающаяся тем, что композиция содержит менее, чем приблизительно 15 % по массе воды.

3. Жидкая композиция по п.1, отличающаяся тем, что композиция содержит менее чем приблизительно 12 % по массе воды.

4. Жидкая композиция по п.1, отличающаяся тем, что композиция содержит менее чем приблизительно 8 % по массе воды.

5. Жидкая композиция по п.1, отличающаяся тем, что катионный целлюлозный полимер представляет собой катионный полисахарид.

6. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,01% до приблизительно 20% по массе катионного целлюлозного полимера.

7. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,1% до приблизительно 15% по массе катионного целлюлозного полимера.

8. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,6% до приблизительно 10% по массе катионного целлюлозного полимера.

9. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,000005% до приблизительно 0,2% по массе целлюлазного фермента.

10. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,00001 до приблизительно 0,05% по массе целлюлазного фермента.

11. Жидкая композиция по п.1, отличающаяся тем, что содержит от приблизительно 0,0001% до приблизительно 0,02% по массе целлюлазного фермента.

12. Жидкая композиция по п.1, отличающаяся тем, что представляет собой композицию моющего средства для стирки и дополнительно содержит ингибитор целлюлаз, который присутствует на уровне от приблизительно 0,0001% до приблизительно 3% по массе неводной композиции.

13. Жидкая композиция по п.1, отличающаяся тем, что катионный целлюлозный полимер присутствует в форме частиц.

14. Жидкая композиция по п.1, отличающаяся тем, что композиция заключена в водорастворимую или диспергируемую пленку.

15. Жидкая композиция по п.1, отличающаяся тем, что водорастворимая или диспергируемая пленка содержит смолу, выбранную из группы, состоящей из: поливиниловых спиртов, сополимеров поливиниловых спиртов, гидроксипропилметилцеллюлозы (НРМС) и их смесей.

16. Жидкая композиция для ухода за тканью, заключенная в водорастворимую или диспергируемую пленку, содержащая:
a) катионный целлюлозный полимер; и
b) целлюлазный фермент;
при этом неводная жидкая композиция содержит менее чем приблизительно 20% по массе воды и катионный целлюлозный полимер имеет структурную формулу I:

где:
i. m означает целое число от 20 до 10000;
ii. каждый R4 представляет собой Н; R2 и R3 каждый представляет собой H; каждый R1 независимо выбран из группы, состоящей из H и
где:
n означает целое число, выбранное от 0 до 10;
каждый R5 представляет собой H;
Rx представляет собой
;
где A- представляет собой приемлемый анион; и
каждый R6 независимо выбран из C1-C32 алкила; и
кроме того, при этом водорастворимая или диспергируемая пленка содержит смолу, выбранную из группы, состоящей из: поливиниловых спиртов, сополимеров поливиниловых спиртов, гидроксипропилметилцеллюлозы (НРМС) и их смесей.



 

Похожие патенты:

Изобретение относится к дисперсной детергентной композиции, где композиция содержит поверхностно-активное вещество и/или моющий компонент, протеазу и ингибитор протеазы.

Настоящее изобретение относится к биохимии и представляет собой детергентную композицию, которая включает вариант субтилизина, имеющий аминокислотную последовательность, которая приведена в SEQ ID NO 1, и по меньшей мере один дополнительный ингредиент, выбранный из: i) средств для отбеливания, которые выбраны из перкарбонатов, персульфатов и органических надкислот, ii) аминокарбоксилатов, или iii) сульфированных полимеров, или iv) фосфорорганических кислот или их солей и их смесей.

Группа изобретений относится к биотехнологии. Предложен вариант термолизина, обладающий повышенной эффективностью по сравнению с термолизином дикого типа.

Настоящее изобретение относится к дисперсной отбеливающей композиции, содержащей, в пересчете на общий вес композиции: a) от примерно 15% до примерно 80% кислородсодержащего отбеливателя; b) от примерно 0,01% до примерно 20% поверхностно-активного вещества; c) и от примерно 0,00005% до примерно 0,3% фермента, где указанный фермент: i.

Группа изобретений относится к биотехнологии. Предложена композиция для получения душистого сложного эфира.

Изобретение относится к пептидным альдегидам с тирозином в качестве C-концевого остатка, которые являются особенно эффективными для стабилизации протеаз типа субтилизина в жидких моющих средствах.

Изобретение относится к области биотехнологии и касается способа мытья посуды. Охарактеризованный способ заключается в обеспечении композиции для мытья посуды и посуды, нуждающейся в очистке, приведении указанной посуды в контакт с указанной композицией для мытья посуды при условиях, эффективно обеспечивающих очистку указанной посуды, где указанная композиция для мытья посуды содержит модифицированный субтилизин, где указанный модифицированный субтилизин, по меньшей мере, на 70% гомологичен последовательности AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR и содержит (i) замену G116V и, по меньшей мере, одну дополнительную мутацию или (ii) замену S126R.

Изобретение относится к области биотехнологии и биохимии. Предложено применение композиции, включающей фермент трансглюкозидазу (ЕС 2.4.1.24), для разложения полисахарида природной камеди, причем указанный полисахарид природной камеди является субстратом для указанного фермента трансглюкозидазы.

Настоящее изобретение относится к области биотехнологии и может быть использовано в производстве композиций, предназначенных для удаления крахмалсодержащих загрязнений.

Настоящее изобретение относится к жидкому моющему составу для мытья посуды ручным способом, содержащему: (a) от 0,001% до 10% по массе катионного полимера и (b) от 0,005% до 3% по массе активного неорганического перламутрового агента, при этом упомянутый неорганический перламутровый агент имеет размер частиц менее 50 мкм, и катионный полимер является солью гидроксиэтилцеллюлозы.

Изобретение относится к отбеливающим составам в виде мешочков с несколькими отделениями. Описан мешочек с несколькими отделениями, содержащий первое отделение и второе отделение, при этом первое отделение содержит твердый состав, причем твердый состав содержит источник кислородного отбеливателя, активатор отбеливания; поликарбоксилатный полимер, представляющий собой сополимер малеиновой кислоты/акриловой кислоты, а второе отделение содержит жидкий состав, причем жидкий состав содержит низкомолекулярный растворитель, материал мешочка выполнен в виде водорастворимой плёнки.

Изобретение относится к вариантам катионной полиэлектролитной композиции для применения в средствах личной гигиены и средствах бытовой химии и способу ее получения.

Изобретение относится к моющим средствам для стирки. Предложено моющее средство для стирки, содержащее гранулированную композицию для контроля пенообразования и анионное поверхностно-активное вещество, при этом гранулированная композиция для контроля пенообразования содержит агент контроля пенообразования, композицию органических добавок, водорастворимый неорганический носитель в форме частиц и заряженный катионный полимер.

Изобретение относится к области косметики, а именно к мягкому крем-мылу в аэрозольной упаковке, и может быть использовано в качестве детского мыла. Описано аэрозольное мыло, содержащее следующие компоненты, мас.%: мыльная основа, полученная омылением стеариновой кислоты триэтаноламином, 2,5-9,0, глицерин 2,0-6,0, Лаурет-23 0,5-3,0, углеводородный пропеллент 5,0-10,0, вода - остальное.

Изобретение относится к стабильным растворимым изделиям единичной дозы. Описано изделие для ухода за тканью, содержащее неводную жидкую композицию, содержащую катионный полимер - катионную целлюлозу, жирную кислоту или соль, воду и анионное поверхностно-активное вещество, при этом катионный полимер присутствует в форме частиц.

Изобретение относится к жидкой поверхностно-активной композиции, пригодной для использования в качестве уплотнения для контролирования перемещения жидкостей в изделиях, в качестве средства для мытья руки в качестве очищающего средства.

Изобретение относится к стабильным неводным жидким композициям, пригодным для ухода за тканями. Описана неводная жидкая композиция для ухода за тканью, содержащая катионный полимер в форме частиц, неводный диспергатор, выбранный из группы, состоящей из этанола, глицерина, полиэтиленгликоля с молекулярной массой от приблизительно 100 до приблизительно 400, и менее чем 20% воды; при этом катионный полимер стабильно диспергирован в неводной жидкой композиции, и неводная жидкая композиция инкапсулирована в водорастворимую или диспергируемую плёнку.

Настоящее изобретение относится к составу на водной основе, подходящему для применения в целях личной гигиены, в быту и в организациях, включающему: а) некоторое количество способного к ассоциации загустителя, включающего полимерную композицию, содержащую растворимую в воде или набухающую в воде основную цепочку синтетического полимера, которая содержит соединенные ковалентной связью концы и/или промежуточные блоки олигомерных гидрофобных соединений, выбранных из группы, включающей I) алкильные и арильные структуры, содержащие способный к полимеризации циклический мономер, II) способную к полимеризации двойную связь, III) производные соединений, перечисленных в I) и II), причем блоки представляют собой два или более звеньев одинаковых или различных гидрофобных соединений, б) некоторое количество поверхностно-активного вещества, в) некоторое количество физиологически переносимой соли, выбранной из группы, включающей сульфат натрия, хлорид калия и хлорид натрия, и г) воду; причем количество способного к ассоциации загустителя, содержащегося в составе на водной основе, составляет от 0,1 до 5 мас.%, количество поверхностно-активного вещества, содержащегося в составе на водной основе, составляет от 5 до 50 мас.%, и причем полимерная композиция, включающая растворимую в воде или набухающую в воде основную синтетическую полимерную цепочку, включает простой полиэфир полиацеталя, модифицированный этилгексилглицидиловым простым эфиром (ЭГГЭ).

Описан мешочек, имеющий, по меньшей мере, одно герметично скрепленное отделение, содержащее первый состав, при этом, по меньшей мере, одна стенка, по меньшей мере, одного герметично скрепленного отделения изготовлена из водорастворимой пленки любой приемлемой толщины, причем пленка содержит, по меньшей мере, 50 мас.% водорастворимой смолы поливинилового спирта(ПВС), при этом ПВС смола имеет среднюю вязкость от приблизительно 13,5 сПз до приблизительно 20 сПз и степень гидролиза в диапазоне от приблизительно 84% до 92%, и ПВС смола содержит смесь первого и второго ПВС полимеров, причем вязкость первого ПВС полимера меньше, чем вязкость второго ПВС полимера.

Изобретение относится к способу очистки субстрата, в качестве которого может выступать посуда или белье. Предлагаемый способ включает контактирование субстрата в цикле очистки с водным чистящим раствором, содержащим водный разбавитель и твердую композицию моющего средства.

Изобретение относится к стабильным растворимым изделиям единичной дозы. Описано изделие для ухода за тканью, содержащее неводную жидкую композицию, содержащую катионный полимер - катионную целлюлозу, жирную кислоту или соль, воду и анионное поверхностно-активное вещество, при этом катионный полимер присутствует в форме частиц.
Наверх