Композиция и способ для получения душистого сложного эфира



Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира
Композиция и способ для получения душистого сложного эфира

 


Владельцы патента RU 2511409:

ДАНИСКО ЮЭс ИНК. (US)

Группа изобретений относится к биотехнологии. Предложена композиция для получения душистого сложного эфира. Композиция содержит SGNH-ацилтрансферазу, спиртовой субстрат, содержащий 2-10 атомов углерода, и донор ацила, представляющий собой сложноэфирный субстрат, содержащий ацильную цепь из 2-10 атомов углерода. Спиртовой субстрат и донор ацила выбирают так, чтобы они продуцировали душистый сложный эфир. Указанная SGNH-ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистого сложного эфира в водной среде. Также предложен способ получения душистого сложного эфира, согласно которому объединяют SGNH-ацилтрансферазу, спиртовой субстрат и донор ацила в условиях ацилтрансферазной реакции. Также предложен способ одновременного получения отбеливателя, представляющего собой перкислоту, и душистого сложного эфира. Для этого объединяют SGNH-ацилтрансферазу, спиртовой субстрат, донор ацила и водный раствор пероксида водорода в условиях ацилтрансферазной реакции. Композицию по изобретению используют в моющих средствах для выведения пятен, содержащих по меньшей мере один триглицерид, и уменьшения неприятного запаха. 3 н. и 16 з.п. ф-лы, 18 ил., 9 табл., 14 пр.

 

Область, к которой относится изобретение

Настоящее изобретение относится к композициям, содержащим ацилтрансферазу и спиртовой субстрат для ацилтрансферазы. В некоторых особенно предпочтительных вариантах изобретения указанная композиция может быть использована для получения душистого сложного эфира. В некоторых других вариантах изобретения, указанная композиция может быть использована в моющих средствах для выведения пятен, содержащих по меньшей мере один триглицерид. В некоторых других вариантах изобретения такие композиции используют для получения соединений, обладающих очищающими свойствами (например, сложноэфирного поверхностно-активного вещества).

Предшествующий уровень техники

Если одежду, а в частности одежду, на которой имеются пятна, происходящие от молочных продуктов (например, молока, мороженого или масла), стирают в моющих средствах, содержащих липазу, то после сушки такой одежды на ее ткани часто появляется неприятный запах, напоминающий запах детской «отрыжки» или прогорклого масла. Очевидно, что такой неприятный запах возникает в результате катализируемого липазой гидролиза короткоцепочечных триглицеридов (например, С412-содержащих триглицеридов), которые присутствуют в тканях и/или в выстиранных изделиях. Такая реакция гидролиза продуцирует короткоцепочечные жирные кислоты (например, масляную кислоту), которые являются летучими и дают устойчивый неприятный запах. Несмотря на то, что было проведено множество крупномасштабных исследований, направленных на устранение неприятного запаха и/или придание выстиранному изделию приятного запаха, однако необходимость в получении моющих композиций, отвечающих нужным требованиям, остается актуальной.

Описание сущности изобретения

Настоящее изобретение относится к композициям, содержащим ацилтрансферазу и спиртовой субстрат для ацилтрансферазы. В некоторых особенно предпочтительных вариантах изобретения указанная композиция может быть использована для получения душистого сложного эфира. В некоторых других вариантах изобретения указанная композиция может быть использована в моющих средствах для выведения пятен, содержащих по меньшей мере один триглицерид. В некоторых других вариантах изобретения такие композиции используют для получения соединений, обладающих очищающими свойствами (например, сложноэфирного поверхностно-активного вещества).

Настоящее изобретение относится к композициям для получения душистого сложного эфира, где указанные композиции включают нижеследующие компоненты: SGNH-ацилтрансферазу, спиртовой субстрат для SGNH-ацилтрансферазы и донор ацила, где указанная SGNH-ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистого сложного эфира в водной среде. В некоторых вариантах изобретения указанной композицией является водная композиция, также содержащая душистый сложный эфир. В некоторых других вариантах изобретения спиртовой субстрат и донор ацила выбирают так, чтобы они продуцировали конкретный душистый сложный эфир. В некоторых предпочтительных вариантах изобретения донором ацила является донор С110-ацила. В некоторых альтернативных вариантах изобретения SGNH-ацилтрансфераза иммобилизована на твердом носителе. В некоторых других вариантах изобретения указанной композицией является дегидратированная композиция, а душистый сложный эфир продуцируется после регидратации данной композиции. В некоторых дополнительных вариантах изобретения указанной композицией является пищевой продукт. В других вариантах изобретения указанной композицией является очищающая композиция, содержащая по меньшей мере одно поверхностно-активное вещество. В некоторых дополнительных вариантах изобретения указанными композициями являются очищающие композиции, содержащие пероксид водорода.

Настоящее изобретение также относится к способам получения по меньшей мере одного душистого сложного эфира, где указанные способы включают объединение SGNH-ацилтрансферазы, спиртового субстрата для SGNH-ацилтрансферазы и донора ацила, где указанная SGNH-ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием по меньшей мере одного душистого сложного эфира. В некоторых вариантах изобретения спиртовой субстрат и донор ацила выбирают так, чтобы они продуцировали конкретный душистый сложный эфир. В некоторых других вариантах изобретения донором ацила является донор С210-ацила. В дополнительных вариантах изобретения указанные способы включают регидратацию компонентов после их объединения. В некоторых альтернативных вариантах изобретения регидратация происходит в процессе отверждения. В других вариантах изобретения SGNH-ацилтрансферазу, спиртовой субстрат и донор ацила объединяют в водной среде. В некоторых альтернативных вариантах изобретения SGNH-ацилтрансфераза иммобилизована на твердом носителе.

Настоящее изобретение также относится к способам одновременного получения отбеливателя и душистого вещества, где указанные способы включают объединение SGNH-ацилтрансферазы, спиртового субстрата для SGNH-ацилтрансферазы и донора ацила, где указанная SGNH-ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистого вещества и отбеливателя. В некоторых вариантах изобретения указанным отбеливателем является перкислота. В некоторых особенно предпочтительных вариантах изобретения указанной перкислотой является перуксусная кислота. В некоторых других предпочтительных вариантах изобретения SGNH-ацилтрансферазой является ацилтрансфераза M. smegmatis. В некоторых других предпочтительных вариантах изобретения указанным душистым веществом является сложный эфир. В некоторых других вариантах изобретения указанным сложным эфиром является сложный C2-C6-эфир первичного спирта. В других вариантах изобретения нанесение отбеливателя на пятно приводит к удалению данного пятна.

Настоящее изобретение относится к очищающим композициям, содержащим ацилтрансферазу (например, SGNH-ацилтрансферазу) и спиртовой субстрат для ацилтрансферазы.

В некоторых таких вариантах ацилтрансфераза и спиртовой субстрат присутствуют в количествах, которые являются эффективными для продуцирования детектируемого сложного эфира после контактирования очищающей композиции с объектом, содержащим донор ацила. В некоторых вариантах изобретения очищающая композиция также включает объект, содержащий донор ацила, и сложный эфир, который продуцируется в результате реакции взаимодействия спиртового субстрата с донором ацила, катализируемой ацилтрансферазой. В некоторых предпочтительных вариантах изобретения донором ацила является донор C1-C10-ацила.

В некоторых других вариантах изобретения очищающая композиция также включает добавленный донор ацила (например, триглицерид, сложный эфир жирной кислоты или т.п.), который взаимодействует со спиртовым субстратом. В некоторых особенно предпочтительных вариантах изобретения сложным эфиром, получаемым из такой композиции, является душистый сложный эфир, сложный эфир, представляющий собой поверхностно-активное вещество; поверхностно-активное вещество, или средство для ухода за тканью, или их комбинации.

В некоторых вариантах изобретения объект, содержащий донор ацила, содержит донор ацила в качестве загрязняющего вещества. В некоторых предпочтительных вариантах изобретения указанным донором ацила является маслянистое вещество, такое как животный жир, растительный жир, молочный продукт или т.п. В некоторых других предпочтительных вариантах изобретения в результате объединения донора ацила и спиртового субстрата получают душистый сложный эфир, сложный эфир в виде поверхностно-активного вещества; водорастворимый сложный эфир, или средство для ухода за тканью, или любые их комбинации. Фактически, в настоящем изобретении рассматривается комбинация благоприятных эффектов.

В некоторых вариантах изобретения очищающая композиция также содержит по меньшей мере одну липазу. В некоторых дополнительных вариантах изобретения очищающая композиция также содержит по меньшей мере одно поверхностно-активное вещество и/или по меньшей мере один источник пероксида. В некоторых вариантах изобретения поверхностно-активное вещество или эмульгирующий агент данной очищающей композиции действует на спиртовой субстрат, способствуя переносу ацила ацилтрансферазой.

В некоторых других вариантах изобретения очищающие композиции согласно изобретению также содержат по меньшей мере один дополнительный фермент, включая, но не ограничиваясь ими, гемицеллюлазы, пероксидазы, протеазы, целлюлазы, ксиланазы, липазы, фосфолипазы, эстеразы, кутиназы, пектиназы, пектат-лиазы, амилазы, маннаназы, кератиназы, редуктазы, оксидазы, фенолоксидазы, липоксигеназы, лигниназы, пуллуланазы, танназы, пентозаназы, маланазы, бета-глюканазы, арабинозидазы, гиалуронидазы, хондроитиназы, лакказы и амилазы или их смеси. В некоторых вариантах изобретения используется комбинация ферментов (то есть «коктейль»), содержащая наиболее часто применяемые ферменты, такие как протеаза, липаза, кутиназа и/или целлюлаза в сочетании с ацилтрансферазой.

В некоторых других вариантах изобретения очищающие композиции также содержат по меньшей мере одно из таких веществ, как поверхностно-активное вещество, модифицирующая добавка, полимер, соль, активатор отбеливания, растворитель, буфер или ароматизатор и т.п., которые более подробно описаны в настоящей заявке.

В некоторых вариантах изобретения очищающей композицией является водная композиция. В некоторых предпочтительных вариантах изобретения указанная очищающая композиция содержит по меньшей мере примерно на 90% состоит из воды, исключая любые твердые компоненты.

Настоящее изобретение также относится к способам очистки, в которых используются описанные здесь очищающие композиции. Такие способы обычно включают объединение ацилтрансферазы (например, SGNH-ацилтрансферазы), спиртового субстрата для ацилтрансферазы и объекта (например, ткани), загрязненного веществом, содержащим донор ацила, где указанная ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием сложного эфира.

В некоторых вариантах изобретения указанный объект загрязнен веществом, содержащим масло (например, веществом, содержащим триацилглицерид, таким как вещество, содержащее C4-C18-триацилглицериды). В некоторых предпочтительных вариантах изобретения в результате объединения вещества, содержащего масло, и спирта, получают сложный эфир, который представляет собой душистый сложный эфир, в других вариантах изобретения получают сложный эфир, который не является душистым веществом, а в других вариантах изобретения получают поверхностно-активное вещество или другое средство для ухода за тканью или комбинации указанных сложных эфиров.

В некоторых из этих вариантов изобретения применение фермента ацилтрансферазы позволяет уменьшить неприятный запах, который обычно возникает в результате гидролиза триглицеридов, где указанное применение предусматривает синергическую обработку липазным ферментом, проводимую в целях повышения скорости удаления ацильных цепей из триацилглицерида; и/или присоединение ацильных цепей к спиртовому субстрату, что приводит к образованию сложноэфирного продукта, а не летучей жирной кислоты.

В некоторых своих особенно предпочтительных вариантах настоящее изобретение также относится к композициям для продуцирования душистых сложных эфиров. В некоторых вариантах изобретения указанные композиции включают ацилтрансферазу (например, SGNH-ацилтрансферазу), спиртовой субстрат для ацилтрансферазы и донор ацила, где указанная ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат в водной среде с образованием душистого сложного эфира. В некоторых особенно предпочтительных вариантах изобретения спиртовой субстрат и донор ацила используют для получения конкретного душистого сложного эфира. В некоторых вариантах изобретения указанной композицией является водная композиция, также содержащая душистый сложный эфир. В некоторых других вариантах изобретения указанной композицией является дегидратированная композиция, из которой после ее регидратации получают душистый сложный эфир.

В некоторых вариантах изобретения донор ацила переносит C1-C10-ацильную цепь на спиртовой субстрат. В некоторых особенно предпочтительных вариантах изобретения композициями для получения душистых сложных эфиров являются очищающие композиции.

В некоторых вариантах изобретения ацилтрансфераза иммобилизована на твердом носителе.

В некоторых других вариантах изобретения указанная композиция включает пищевой продукт. В некоторых других вариантах изобретения такой композицией является очищающая композиция. В некоторых дополнительных вариантах изобретения указанная композиция также содержит по меньшей мере одно поверхностно-активное вещество.

Настоящее изобретение также относится к способам, в которых для получения по меньшей мере одного душистого сложного эфира используются описанные здесь композиции. В общих чертах, эти способы включают объединение ацилтрансферазы (например, SGNH- ацилтрансферазы), спиртового субстрата для ацилтрансферазы и донора ацила, где указанная ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистого сложного эфира. В некоторых вариантах изобретения, спиртовой субстрат и донор ацила продуцируют конкретный душистый сложный эфир.

В некоторых вариантах изобретения в которых композиции являются дегидратированными, указанные способы также включают стадию регидратации компонентов после их объединения. В некоторых вариантах изобретения, регидратация происходит в результате добавления любой подходящей водной среды, включая воду, молоко или слюну. Так, например, в некоторых вариантах изобретения регидратация происходит в процессе отверждения с образованием душистого сложного эфира. В некоторых других вариантах изобретения спиртовой субстрат и донор ацила объединяют в водной среде.

Краткое описание графического материала

Некоторые аспекты подробного описания изобретения будут более понятны со ссылками на графический материал. При этом следует подчеркнуть, что в соответствии с общепринятой практикой различные детали графического материала не масштабированы. Наоборот, для большей ясности размеры различных деталей произвольно увеличены или уменьшены.

На фигуре 1 представлены графики, иллюстрирующие превращение цис-3-гексенола, 2-фенилэтанола и 2-метил-1-бутанола в их соответствующие бутирильные сложные эфиры под действием трибутирина и двух ацилтрансфераз.

На фигуре 2 представлены графики, иллюстрирующие сравнение свободных форм и форм ацилтрансферазы (AcT), которые были инкапсулированы в виде золя-геля в целях осуществления этерификации цис-3-гексенола под действием триацетина в течение 10, 30 и 120 минут.

На фигуре 3 представлена панель хроматограмм ЖХ/МС-данных, иллюстриующих переэтерификацию тетраэтиленгликоля под действием трибутирина и AcT в исходном детергенте.

На фигуре 4 представлена панель хроматограмм ЖХ/МС-данных, иллюстриующих переэтерификацию 13C-U-глицерина под действием трибутирина и AcT в исходном детергенте.

На фигуре 5 представлен график, иллюстриующий продуцирование бензилбутирата из жировй фракции масла и бензилового спирта в присутствии липаз и AcT.

На фигуре 6 проиллюстрирован репрезентативный метод получения душистых сложных эфиров из жировой фракции масла.

На фигуре 7 представлены результаты ТСХ-анализа липида после инкубирования яичного желтка/сорбита 1) с KLM3-мутантом pLA231 и 2) с контролем. На этой фигуре «РЕ» означает фосфатидилэтаноламин, а «PC» означает фосфатидилхолин.

На фигуре 8 представлена ГЖХ-хроматограмма образца 2467-112-1, то есть яичного желтка/сорбита, обработанного KLM3, pLA231.

На фигуре 9 представлена ГЖХ-хроматограмма образца 2467-112-2, то есть яичного желтка/сорбита, используемого в качестве контроля.

На фигуре 10 представлен ГЖХ/МС-спектр моноолеата сорбита, идентифицированного по SMO-спектру Grindsted и МС-спектру идентифицированного пика яичного желтка/сорбита, обработанного KLM3 pLA 231(2467-112-1).

Описание настоящего изобретения

Настоящее изобретение относится к композициям, содержащим ацилтрансферазу и спиртовой субстрат для ацилтрансферазы. В некоторых особенно предпочтительных вариантах изобретения, указанная композиция может быть использована для получения душистого сложного эфира. В некоторых других вариантах изобретения указанная композиция может быть использована в моющих средствах для выведения пятен, содержащих по меньшей мере один триглицерид. В некоторых других вариантах изобретения указанные композиции используют для получения соединений, обладающих очищающими свойствами (например, сложного эфира, представляющего собой поверхностно-активное вещество).

Если это не оговорено особо, то некоторые практические аспекты изобретения включают стандартные методы, обычно применяемые в молекулярной биологии, микробиологии, очистке белков, белковой инженерии, секвенировании белков и ДНК и в технике рекомбинантных ДНК, известных специалистам в данной области. Все выше- и нижеупомянутые патенты, патентные заявки, статьи и публикации во всей своей полноте вводятся в описание настоящей заявки посредством ссылки.

Кроме того, представленные здесь заголовки не должны рассматриваться как ограничение различных аспектов или вариантов настоящего изобретения, которые полностью могут быть включены в описание настоящего изобретения посредством ссылки. В соответствии с этим термины, используемые ниже, более подробно определяются на протяжении всего описания настоящей заявки. Но тем не менее, для лучшего понимания настоящего изобретения ниже приводится объяснение ряда терминов.

Определения

Если это не оговорено особо в описании настоящей заявки, все используемые здесь технические и научные термины употребляются в своем общепринятом значении, известном среднему специалисту в данной области, к которой относится настоящее изобретение. Хотя для осуществления настоящего изобретения могут быть применены любые методы и материалы, аналогичные или эквивалентные методам и материалам, описанным в настоящей заявке, однако в описании настоящей заявки приводятся лишь репрезентативные методы и материалы. Если это не оговорено особо, встречающиеся здесь существительные в единственном числе могут также относиться и к существительным и во множественном числе. Если это не оговорено особо, нуклеиновые кислоты записываются слева направо в направлении 5'→3', а аминокислотные последовательности записываются слева направо в направлении от амино-конца к карбокси-концу соответственно. Следует отметить, что настоящее изобретение не ограничивается конкретными описанными здесь методами, протоколами и реагентами, и такие методы, протоколы и реагенты могут варьировать в зависимости от ситуации, в которой они используются специалистами.

При этом предусматривается, что каждый верхний предел численных значений, представленных в настоящем описании, включает каждый низший предел численных значений, так как если бы этот низший предел численных значений был точно указан в описании настоящей заявки. Каждый минимальный предел численных значений, представленных в настоящем описании, включает каждый верхний предел численных значений, так как если бы этот верхний предел численных значений был точно указан в описании настоящей заявки. Каждый численный интервал, представленный в настоящей заявке, включает каждый более узкий интервал численных значений, который входит в указанный более широкий интервал численных значения, так как если бы все более узкие интервалы численных значений были точно указаны в описании настоящей заявки.

Используемый здесь термин «ацильная группа» означает органическую группу формулы (RC=O-).

Используемый здесь термин «ацилирование» означает химическую реакцию, которая переносит ацильную (RCO-) группу от одной молекулы («донора ацила») на другую молекулу («субстрат»), в основном, в результате замещения атома водорода группы -OH субстрата ацильной группой.

Используемый здесь термин «донор ацила» означает молекулу, которая отдает ацильную группу в ацилтрансферазной реакции.

Используемый здесь термин «спиртовой субстрат» означает любую органическую молекулу, содержащую реакционноспособную гидроксильную группу (-OH), связанную с атомом углерода. Этот термин не включает полисахариды и белки. Вода не является спиртовым субстратом. Примерами спиртовых субстратов являются, но не ограничиваются ими, алифатические спирты, алициклические или ароматические спирты, спирты терпенового ряда и полиолы, включая мономерные, димерные, тримерные и тетрамерные полиолы. В некоторых вариантах изобретения спирт содержит более чем одну гидроксильную группу. Спиртовые субстраты обладают способностью принимать ацильную группу в описанной ниже ацилтрансферазной реакции. В некоторых вариантах изобретения спиртом является первичный, вторичный или третичный спирт.

Используемый здесь термин «трансфераза» означает фермент, который катализирует перенос функциональных соединений на различные субстраты.

Используемый здесь термин «ацилтрансфераза» означает любой фермент, в основном, классифицированный как E.C.2.3.1.x, который обладает способностью переносить ацильную группу от донора ацила (например, липида) на спиртовой субстрат.

Используемый здесь термин «GDSX-ацилтрансфераза» означает ацилтрансферазу, имеющую отдельный активный центр, содержащий мотив последовательности GDSX (где X в большинстве случаев представляет собой L), обычно расположенный рядом с N-концом. GDSX-ферменты имеют пять консенсусных последовательностей (I- V). Такие ферменты известны специалистам (см., например, Upton et al, Trends Biochem. ScL, 20:178-179 [1995]; и Akoh et al, Prog. Lipid Res., 43:534-52 [2004]). Подпоследовательность GDSX-ацилтрансфераз содержит консервативные остатки SG и H в консенсусных последовательностях. Такими GDSX-ацилтрансферазами являются «SGNH-ацилтрансферазы».

Используемый здесь термин «SGNH-ацилтрансфераза» означает ацилтрансферазу, принадлежащую к семейству SGNH-гидролаз, где члены семейства SGNH-гидролаз содержат домен эстеразы типа SGNH-гидролаз, который имеет трехслойную альфа/бета/альфа-структуру, где бета-складки состоят из пяти параллельных цепей. Ферменты, содержащие этот домен, действуют как эстеразы, липазы и ацилтрансферазы, но имеют последовательности, обладающие незначительной гомологией с последовательностями классических липаз (см. Akoh et al, Prog. Lipid Res., 43:534-552 [2004]; и Wei et al, Nat. Struct. Biol., 2: 218-223 [1995]).

Белки, содержащие домен эстеразы типа SGNH-гидролаз, были обнаружены в микроорганизмах различных видов, и такими белками являются, но не ограничиваются ими, эстераза Streptomyces scabies (см. Sheffield et al., Protein Eng., 14:513-519 [2001]); эстераза вирусного гемаглютинина-эстераза поверхностных гликопротеинов вируса гриппа С, коронавирусов и тоговирусов (см. Molgaard et al, Acta Crystallogr. D58:111-119 [2002]); ацетилгидролазы млекопитающих (см. Lo et al, J. Mol. Biol., 330:539-551 [2003]); рамногалактуронан-ацетилэстераза грибов (см. Molgaard et al, Structure 8:373-383 [2000]); и многофункциональный фермент тиоэстераза I (TAP) от Escherichia coli (см. Molgaard et al, Acta Crystallogr.D 60: 472-478 [2004]). Домены эстеразы типа SGNH-гидролаз содержат уникальную сеть из водородных связей, которые стабилизируют каталитические центры этих ферментов. В некоторых предпочтительных вариантах изобретения они содержат консервативную каталитическую триаду из остатков Ser/Asp/His. SGNH-ацилтрансферазы также описаны в базе данных в консервативном домене GENBANK® (включенной в настоящее описание посредством ссылки) под регистрационным номером cd01839.3. SGNH-ацилтрансферазы после их контактирования с донором ацила образуют промежуточное соединение «ацил-фермент» и переносят ацильную группу на акцептор, не являющийся водой.

Используемый здесь термин «классическая липаза» означает фермент, обладающий липазной активностью и имеющий характерный мотив GXSXG, содержащий серин в активном центре (см., например, Derewenda et al., Biochem Cell Biol., 69:842-51 [1991]). В некоторых вариантах изобретения классической липазой является триацилглицерид-липаза, специфичная для sn1- и sn3-положений триацилглицерида.

SGNH-ацилтрансферазы и GDSL-ацилтрансферазы имеют аналогичную структуру, и оба этих фермента по своей структуре отличаются от классических липаз.

Используемый здесь термин «переэтерификация» означает катализируемый ферментом перенос ацильной группы от липидного донора (не являющегося свободной жирной кислотой) на акцептор ацила (не являющийся водой).

Используемый здесь термин «алкоголиз» означает катализируемое ферментом расщепление ковалентной связи производного кислоты в результате реакции взаимодействия со спиртом ROH, с образованием одного из продуктов, объединенного с атомом Н спирта, и другого продукта, объединенного с группой OR данного спирта.

Используемый здесь термин «гидролиз» означает катализируемый ферментом перенос ацильной группы от липида на группу ОН молекулы воды.

Термин «водный», используемый здесь в выражениях «водная композиция» и «водная среда», означает композицию, состоящую по меньшей мере примерно на 50% из воды. В некоторых вариантах изобретения водные композиции содержат по меньшей мере примерно 50% воды, по меньшей мере примерно 60% воды, по меньшей мере примерно 70% воды, по меньшей мере примерно 80% воды, по меньшей мере примерно 90% воды, по меньшей мере примерно 95% воды или по меньшей мере примерно 97% воды. В некоторых вариантах изобретения остальная часть водной композиции включает по меньшей мере один спирт.

В некоторых предпочтительных вариантах изобретения термин «водный» относится к композиции, которая обладает активностью в воде (Aw), составляющей по меньшей мере примерно 0,75, по меньшей мере примерно 0,8, по меньшей мере примерно 0,9 или по меньшей мере примерно 0,95 по сравнению с активностью в дистиллированной воде.

Используемый здесь термин «душистый сложный эфир» означает сложный эфир, который имеет приятный запах или вкус. Этот термин охватывает как душистые сложные эфиры, так и сложные эфиры с легким ароматом. Такие сложные эфиры хорошо известны специалистам.

Используемый здесь термин «средство для ухода за тканью» означает соединение, которое обладает очищающими свойствами и/или сообщает ткани преимущественные свойства. Такими соединениями являются поверхностно-активные вещества и эмульгаторы. В некоторых вариантах изобретения средства для ухода за тканью сообщают ткани преимущественные свойства, такие как размягчение, улучшение качества ткани на ощупь, отсутствие скатываемости, сохранение цвета и т.п.

Используемый здесь термин «сложный эфир, представляющий собой поверхностно-активное вещество», означает сложный эфир, который обладает свойствами поверхностно-активных веществ, где указанное поверхностно-активное вещество представляет собой соединение, уменьшающее поверхностное натяжение жидкости.

Используемый здесь термин «с детектируемым ароматом» определяет количество душистого сложного эфира, запах которого может улавливаться носом человека или вкусовыми сосочками его языка. Душистый сложный эфир, который присутствует в количестве, детектируемом только масс-спектрометром, но не улавливаемом носом человека или его вкусовыми сосочками, не является сложным эфиром с детектируемым ароматом.

Используемый здесь термин «объект» означает предмет, требующий очистки. При этом предусматривается, что настоящее изобретение охватывает любой объект, подходящий для его очистки, включая, но не ограничиваясь ими, ткани (например, одежду), обивочный материал, ковры, твердые поверхности (например, поверхности столов, полы и т.п.) или посуду (например, тарелки, чашки, блюдца, стаканы, столовые приборы, изделия из серебра и т.п.).

Используемый здесь термин «загрязненный» или «запачканный» относится к объекту, на котором имеется грязь. Грязное пятно не обязательно должно быть заметным для глаза человека, который смотрит на данный загрязненный объект. Так, например, термин «загрязненный или запачканный объект» означает объект (например, ткань), содержащий жирное вещество животного происхождения (например, молочный продукт), жирное вещество растительного происхождения, человеческий пот и т.п.

Используемый здесь термин «молочный продукт» означает молоко (например, цельное молоко, восстановленное жирное молоко, нежирное молоко или пахту) или приготовленный из него продукт, такой как сыр любого типа (например, сливочный сыр, твердый сыр, мягкий сыр и т.п.), масло, йогурт и мороженое. При этом не следует считать, что настоящее изобретение ограничивается каким-либо конкретным молочным продуктом, поскольку в определение данного термина входит любой продукт, приготовленный из молока.

Используемый здесь термин «объект, содержащий донор ацила» означает объект, включающий донор ацила (например, триглицерид). В некоторых вариантах изобретения донор ацила присутствует в виде пятна.

Используемый здесь термин «иммобилизованный», например, в выражении «иммобилизованный фермент», относится к ферменту, который связан (например, присоединен к субстрату) с субстратом (например, с твердым или полутвердым носителем) и не присутствует в растворе в свободном виде.

Используемый здесь термин «в растворе» означает, что молекула (например, фермент) не иммобилизована на субстрате, а присутствует в жидкой композиции в свободном виде.

Используемые здесь термины «количество, эффективное для..» и «эффективное количество», употребляемые в выражении «количество, эффективное для продуцирования детектируемого сложного эфира», означают количество компонента (например, фермента, субстрата, донора ацила или любых их комбинаций), необходимое для получения нужного продукта в данных условиях.

Используемый здесь термин «источник пероксида водорода» включает пероксид водорода, а также компоненты системы, которая может спонтанно или ферментативно продуцировать пероксид водорода как продукт реакции.

Используемый здесь термин «средства личной гигиены» означает продукты, применяемые для очистки, осветления и/или дезинфекции волос, кожи, волосистой части головы, а также зубов, и такими продуктами являются, но не ограничиваются ими, шампуни, лосьоны для тела, гели для душа, увлажнители для местного применения, зубная паста и/или другие очищающие средства для местного применения. В некоторых конкретных вариантах изобретения такие средства используются человеком, а в других вариантах изобретения такие средства могут быть использованы для животных, не являющихся человеком (например, в ветеринарии).

Используемые здесь термины «очищающие композиции» и «очищающие препараты» означают композиции, которые могут быть использованы для удаления нежелательных соединений с очищаемых предметов, таких как ткань, тарелки, контактные линзы, другие твердые субстраты, волосы (шампуни), кожа (мыла и кремы), зубы (жидкости для полоскания рта, зубные пасты) и т.п. Эти термины охватывают любые материалы/соединения, выбранные для желаемой очищающей композиции конкретного типа и для конкретной формы продукта (например, композиции в виде жидкости, геля, гранул или спрея), при условии, что такая композиция является совместимой с ацилтрансферазой и с любым(и) другим(и) ферментом(тами) и/или компонентами, присутствующими в данной композиции. Конкретный выбор материалов для очищающей композиции может быть легко сделан с учетом типа очищаемого объекта/очищаемой поверхности и нужной формы композиции в зависимости от условий очистки, применяемых перед использованием.

Эти термины также означают любую композицию, которая может быть использована для очистки, отбеливания, дезинфекции и/или стерилизации любого объекта и/или любой поверхности. При этом предполагается, что данные термины включают, но не ограничиваются ими, моющие композиции (например, жидкие и/или твердые моющие средства и моющие средства для тонких мягких тканей; препараты для очистки твердых поверхностей, подходящие для очистки стеклянных, деревянных, керамических и металлических поверхностей столов и для мойки окон и т.п.; чистящие средства для ковров; чистящие средства для печей; увлажнители ткани; мягчители ткани и средства для предварительного выведения пятен на текстильных изделиях и белья для стирки, а также средства для мытья посуды).

Так, например, используемый здесь термин «очищающая композиция», если это не оговорено особо, включает гранулированные или порошкообразные универсальные моющие средства или моющие средства, используемые для трудоемкого режима работы, а в частности, чистящие средства; универсальные моющие средства в виде жидкости, геля или пасты, а в частности, жидкости, используемые для трудоемкого режима работы (HDL); жидкие моющие средства для легких мягких тканей; средства для ручной мойки посуды или средства для мойки посуды в облегченных условиях, а в частности, сильновспенивающие средства; средства для мытья посуды в посудомоечной машине, включая различные таблетки, гранулы, жидкости и ополаскивающие средства, предназначенные для их применения в домашних условиях и на предприятиях; жидкие очищающие и дезинфецирующие средства, включая антибактериальные средства для ручной мойки, очищающее мыло, жидкости для полоскания рта, средства для чистки зубов, шампуни для мойки машин или ковров, средства для очистки ванн; шампуни для волос и ополаскиватели для волос; гели для душа и пенистые очистители ванн и металлических поверхностей, а также очищающие добавки, например, отбеливающие добавки, «палочки для удаления пятен», «средства для предварительной обработки» и/или «средства для предварительной промывки».

Используемые здесь термины «моющая композиция» и «моющий препарат» означают смеси, которые могут быть использованы в моющих средствах в целях удаления грязных пятен с конкретных объектов. В некоторых вариантах изобретения данный термин относится к стирке тканей и/или одежды (например, к «моющим средствам»). В некоторых альтернативных вариантах этот термин означает и другие моющие средства, такие как средства, используемые для очистки посуды, изделий из серебра, столовых приборов и т.п. (например, «средства для мойки посуды»). При этом следует отметить, что настоящее изобретение не ограничивается какими-либо конкретными моющими препаратами или композициями. Фактически предусматривается, что данный термин, помимо ацилтрансферазы, охватывает также моющие средства, содержащие поверхностно-активные вещества, другую(ие) трансферазу(ы), гидролитические и другие ферменты, оксидоредуктазы, модифицирующие добавки, отбеливатели, активаторы отбеливания, средства, придающие голубизну, флуоресцентные красители, ингибиторы спекания, маскирующие агенты, активаторы ферментов, антиоксиданты и солюбилизаторы.

Используемый здесь термин «композиция для очистки твердых поверхностей» означает моющие композиции для очистки твердых поверхностей, таких как полы, поверхности столов, шкафы, стены, плитка, сантехника, кухонные плиты, раковины и т.п. Такие композиции могут быть получены в любой форме, включая, но не ограничиваясь ими, твердые вещества, жидкости, эмульсии и т.п.

Используемый здесь термин «композиция для мытья посуды» означает все формы композиций для мытья посуды и других столовых приборов, используемых при приеме пищи и/или при обработке пищевых продуктов, и такими композициями являются, но не ограничиваются ими, композиции, полученные в форме геля, гранул или жидкости.

Используемый здесь термин «композиция для очистки ткани» означает все формы моющих композиций для очистки тканей, включая, но не ограничиваясь ими, композиции, полученные в форме геля, гранул, жидкости и мыла.

Используемый здесь термин «текстильное изделие» означает тканые изделия, а также штапельное волокно и элементарное волокно, подходящие для изготовления пряжи, тканых изделий, трикотажных изделий и нетканых изделий, или уже используемые в виде таких изделий. Этот термин охватывает пряжу, изготовленную из природного, а также синтетического (например, изготовленного промышленным способом) волокна.

Используемый здесь термин «текстильные материалы» является общим термином, который охватывает волокно, промежуточные продукты изготовления пряжи, пряжу, ткани и изделия, изготовленные из ткани (например, одежду и другие изделия).

Используемый здесь термин «ткань» охватывает любой текстильный материал. Таким образом, предусматривается, что этот термин включает одежду, а также ткань, пряжу, волокно, нетканые материалы, природные материалы, синтетические материалы и любой другой текстильный материал.

Используемый здесь термин «совместимый» означает, что вещества, входящие в состав очищающей композиции, не снижают ферментативную активность ацилтрансферазы до той степени, при которой ацилтрансфераза может терять эффективность, необходимую для ее использования в обычных условиях. Конкретные вещества, входящие в состав очищающей композиции, более подробно описаны ниже.

Используемый здесь термин «эффективное количество фермента» означает количество фермента, необходимое для достижения ферментативной активности, требуемой для конкретного применения (например, в качестве средства личной гигиены, очищающей композиции и т.п.). Такое эффективное количество может быть легко определено средним специалистом в данной области и зависит от многих факторов, таких как конкретно используемый фермент или вариант, цель применения очищающей композиции, конкретный состав очищающей композиции и требуемая форма композиции, например, жидкая, гелеобразная или сухая форма (например, гранулированная форма или брикет) и т.п.

Используемый здесь термин «композиции для очистки нетканых изделий» охватывает композиции для очистки твердых поверхностей, композиции для мытья посуды, очищающие композиции для личной гигиены (например, композиции для очистки полости рта, композиции для чистки зубов, композиции для личной гигиены и т.п.) и композиции, которые могут быть использованы в целлюлозно-бумажной промышленности.

Используемый здесь термин «ферментативное превращение» означает превращение субстрата в промежуточное соединение или превращение промежуточного соединения в конечный продукт в результате контактирования субстрата или промежуточного соединения с ферментом. В некоторых вариантах изобретения такое контактирование происходит в результате непосредственной обработки субстрата или промежуточного соединения соответствующим ферментом. В некоторых других вариантах контактирование включает обработку субстрата или промежуточного соединения микроорганизмом, который экспрессирует, и/или экскретирует данный фермент, и/или осуществляет метаболизм нужного субстрата и/или промежуточного соединения с образованием нужного промежуточного соединения и/или конечного продукта соответственно.

Используемый здесь термин «представляющий интерес белок» означает белок (например, фермент или «представляющий интерес фермент»), который анализируют, идентифицируют и/или модифицируют. В настоящем изобретении могут быть использованы представляющие интерес природные, а также рекомбинантные белки.

Используемый здесь термин «белок» означает любую композицию, состоящую из аминокислот и идентифицируемую специалистами как белок. Используемые здесь термины «белок», «пептид» и «полипептид» являются взаимозаменяемыми. Если пептид представляет собой часть белка, то использование этого термина будет понятно специалистам из контекста изобретения.

Используемые здесь функционально и/или структурно сходные белки рассматриваются как «родственные белки». В некоторых вариантах изобретения эти белки происходят от организмов различных родов и/или видов, включая белки, происходящие от организмов различных классов (например, бактериальные белки и белки грибов). В некоторых вариантах изобретения, указанные белки происходят от организмов различных родов и/или видов, включая белки, происходящие от организмов различных классов (например, бактериальные ферменты и ферменты грибов). В дополнительных вариантах изобретения родственные белки происходят от одного и того же вида. При этом следует отметить, что настоящее изобретение не ограничивается родственными белками, происходящими от какого-либо (каких-либо) конкретного(ых) источника(ов). Кроме того, термин «родственные белки» охватывает третичные структурные гомологи и гомологи с первичными последовательностями. В других вариантах изобретения этот термин охватывает белки, которые являются иммунологически перекрестно-реактивными.

Используемый здесь термин «производное» означает белок, происходящий от другого белка в результате присоединения одной или нескольких аминокислот к C- или N-концу(а) или к С- и N-концу(а), замены одной или нескольких аминокислот в одном или нескольких различных сайтах аминокислотной последовательности, и/или делеции одной или нескольких аминокислот у любого или у обоих концов белка или в одном или нескольких сайтах аминокислотной последовательности, и/или инсерции одной или нескольких аминокислот в одном или нескольких сайтах аминокислотной последовательности. Производное белка может быть получено путем модификации последовательности ДНК, кодирующей нативный белок; трансформации последовательности ДНК в подходящем хозяине и экспрессии модифицированной последовательности ДНК с образованием данного производного белка.

Родственные белки (и их производные) являются «вариантами белков». В некоторых вариантах изобретения варианты белков отличаются от родительского белка и друг от друга небольшим числом аминокислотных остатков. Отличающимися аминокислотными остатками могут быть один или несколько (например, примерно 1, примерно 2, примерно 3, примерно 4, примерно 5, примерно 10, примерно 15, примерно 20, примерно 30, примерно 40, примерно 50 или более) аминокислотных остатков. В некоторых вариантах изобретения число отличающихся аминокислот в вариантах составляет примерно от 1 до 10. В некоторых конкретных вариантах изобретения идентичность аминокислотных последовательностей родственных белков, а в частности, вариантов белков составляет по меньшей мере примерно 35%, примерно 40%, примерно 45%, примерно 50%, примерно 55%, примерно 60%, примерно 65%, примерно 70%, примерно 75%, примерно 80%, примерно 85%, примерно 90%, примерно 95%, примерно 97%, примерно 98% или примерно 99%. Кроме того, используемый здесь термин «родственный белок» или «вариант белка» означает белок, который отличается от другого родственного белка или родительского белка числом выступающих областей. Так, например, в некоторых вариантах изобретения варианты белков имеют примерно 1, примерно 2, примерно 3, примерно 4, примерно 5 или примерно 10 соответствующих выступающих областей, которые отличаются от областей родительского белка.

Для получения вариантов ферментов согласно изобретению может быть применено несколько методов, известных специалистам, включая, но не ограничиваясь ими, сайт-насыщающий мутагенез, сканирующий мутагенез, инсерционный мутагенез, неспецифический мутагенез, сайт-направленный мутагенез, направленная эволюция, а также различные другие рекомбинаторные методы.

В некоторых вариантах изобретения гомологичные белки конструируют так, чтобы они продуцировали ферменты с нужной(ыми) активностью(ями). В некоторых вариантах изобретения такие сконструированные белки принадлежат к семейству SGNH-гидролазных белков. В некоторых вариантах изобретения сконструированные белки включают по меньшей мере один из нижеследующих консервативных остатков L6, W14, W34, L38, R56, D62, L74, L78, H81, P83, M90, K97, Gl10, Ll14, L135, F180, G205 или их комбинации. В альтернативных вариантах изобретения такие сконструированные белки содержат мотивы GDSL-GRTT и/или ARTT. В других вариантах изобретения указанными ферментами являются мультимеры, включая, но не ограничиваясь ими, димеры, октамеры и тетрамеры.

В некоторых вариантах изобретения для выявления гомологии с первичной структурой аминокислотную последовательность ацилтрансферазы непосредственно сравнивают с первичной аминокислотной последовательностью ацилтрансферазы и с серией остатков, которые, как известно, являются инвариантными для всех ацилтрансфераз с известной последовательностью. После выравнивания консервативных остатков, проводимого с учетом необходимых инсерций и делеций в целях сохранения такого выравнивания (то есть во избежание элиминации консервативных остатков в результате произвольной делеции и инсерции) определяют остатки, эквивалентные конкретным аминокислотным остаткам в первичной последовательности ацилтрансферазы. В некоторых вариантах изобретения выравнивание консервативных остатков позволяет определить 100% эквивалентных остатков. Однако для определения эквивалентных остатков подходящим также является выравнивание более чем 75% или примерно до 50% консервативных остатков. В некоторых вариантах изобретения сохраняется консервативность каталитических сериновых и гистидиновых остатков.

В некоторых вариантах изобретения консервативные остатки могут быть использованы для определения соответствующих аминокислотных остатков ацилтрансферазы M. smegmatis, которые эквивалентны остаткам других ацилтрансфераз (например, ацилтрансфераз, происходящих от других видов Mycobacterium, а также от любых других микроорганизмов).

В некоторых вариантах настоящего изобретения последовательность ДНК, кодирующая ацилтрансферазу M. smegmatis и описанная в WO 05/056782, является модифицированной. В некоторых вариантах изобретения модифицированными являются нижеследующие остатки: Cys7, Aspl0, Serl1, Leul2, Thrl3, Trpl4, Trpl6, Pro24, Thr25, Leu53, Ser54, Ala55, Thr64, Asp65, Arg67, Cys77, Thr91, Asn94, Asp95, Tyr99, Vall25, Prol38, Leul40, Prol46, Prol48, Trpl49, Phel50, Ilel53, Phel54, Thrl59, Thrl86, Ile192, Ile194 и Phel96. Однако при этом следует отметить, что настоящее изобретение не ограничивается последовательностями, модифицированными в этих положениях. Действительно, предусматривается, что настоящее изобретение включает различные модификации и комбинации таких модификаций.

В некоторых дополнительных вариантах изобретения эквивалентные остатки определяются по их гомологии на уровне третичной и четвертичной структуры ацилтрансферазы, которая определяется методом рентгеновской кристаллографии. В этом контексте «эквивалентные остатки» определяются как остатки, для которых атомные координаты двух или нескольких атомов главной цепи конкретного аминокислотного остатка карбонилгидролазы и ацилтрансферазы M. smegmatis (N у атома N, CA у CA, C у атома C и O у атома O) составляют в пределах примерно от 0,13 нм до 0,1 нм после выравнивания. Выравнивание осуществляют по наилучшей модели, которая была ориентирована и позиционирована для достижения максимального перекрывания атомных координат неводородных атомов белка рассматриваемой ацилтрансферазы с атомными координатами ацилтрансферазы M. smegmatis. Как известно специалистам, наилучшей моделью является кристаллографическая модель, дающая наименьший R-фактор для экспериментальных дифракционных данных при наивысшем доступном разрешении. Эквивалентные остатки, которые по своим функциям и/или по своей структуре аналогичны конкретному остатку ацилтрансферазы M. smegmatis, определены как аминокислоты ацилтрансферазы, которые преимущественно сообщают конформацию, позволяющую изменять, модифицировать или модулировать структуру белка, изменять уровень связывания с субстратом и/или скорость катализа по механизму, определяемому конкретным остатком или приписываемому конкретному остатку ацилтрансферазы M. smegmatis. Кроме того, такими остатками являются остатки ацилтрансферазы (в тех случаях, если третичная структура была определена с помощью рентгеновской кристаллографии), которые занимают аналогичное положение, в той мере, что даже если атомы главной цепи данного остатка не удовлетворяют критериям эквивалентности с точки зрения степени занятости гомологичного положения, то атомные координаты по меньшей мере двух атомов остатка боковой цепи находятся в пределах 0,13 нм соответствующих атомов боковой цепи ацилтрансферазы M. smegmatis. Были определены координаты трехмерной структуры ацилтрансферазы M. smegmatis, которые представлены в примере 14 заявки WO 05/056782, и эти координаты могут быть применены, как описано выше, для определения эквивалентных остатков на уровне третичной структуры.

Характеризацию белков дикого типа и мутантов осуществляют любыми подходящими методами, и такая характеризация, предпочтительно, проводится на основе оценки представляющих интерес свойств. Так, например, в некоторых вариантах изобретения определяют pH и/или температуру, а также стабильность детергента и/или устойчивость к окислению. Действительно, считается, что могут быть также использованы ферменты, имеющие различные степени стабильности по одному или нескольким параметрам (по pH, температуре, устойчивости к протеолизу, стабильности детергента и/или устойчивости к окислению).

Используемый здесь термин «соответствующий…» относится к остатку в конкретном положении белка или пептида или к остатку, который является аналогичным, гомологичным или эквивалентным указанному остатку белка или пептида в конкретном положении.

Используемый здесь термин «соответствующая область», по существу, означает аналогичное положение в последовательности родственных белков или родительского белка.

Используемые здесь термины «кодирующая молекула нуклеиновой кислоты», «кодирующая последовательность нуклеиновой кислоты», «кодирующая последовательность ДНК» и «кодирующая ДНК» означают порядок расположения или последовательность дезоксирибонуклеотидов по всей цепи дезоксирибонуклеиновой кислоты. Порядок расположения этих дезоксирибонуклеотидов определяет порядок расположения аминокислот по длине полипептидной (белковой) цепи. Таким образом, последовательность ДНК кодирует аминокислотную последовательность.

Используемый здесь термин «аналогичная последовательность» означает последовательность белка, которая имеет такую же функцию, такую же третичную структуру и/или такие же консервативные остатки, как и последовательность представляющего интерес белка (то есть обычно представляющего интерес исходного белка). Так, например, в эпитопных областях, содержащих альфа-спиральную или бета-складчатую структуру, замена аминокислот в аналогичной последовательности позволяет сохранять ту же самую конкретную структуру. Этот термин также означает нуклеотидные последовательности, а также аминокислотные последовательности. В некоторых вариантах изобретения аналогичные последовательности получают так, чтобы замена аминокислот приводила к образованию варианта фермента, имеющего аналогичную или улучшенную функцию. В некоторых предпочтительных вариантах изобретения третичная структура и/или консервативные аминокислотные остатки представляющего интерес белка расположены в представляющем интерес сегменте или фрагменте или рядом с таким сегментом или фрагментом. Таким образом, если представляющий интерес сегмент или фрагмент содержит, например, альфа-спиральную или бета-складчатую структуру, то замена аминокислот позволяет сохранять данную конкретную структуру.

Используемый здесь термин «гомологичный белок» означает белок (например, ацилтрансферазу), активность и/или структура которого аналогичны активности и/или структуре представляющего интерес белка (например, ацилтрансферазы, происходящей от другого источника). При этом предусматривается, что гомологи необязательно должны быть эволюционно родственными. Таким образом, подразумевается, что этот термин охватывает один и тот же (одни и те же) или аналогичный (аналогичные) фермент(ы) (то есть аналогичные с точки зрения их структуры и функции), происходящий(ие) от различных видов. В некоторых предпочтительных вариантах изобретения может оказаться желательным идентифицировать гомолог, который имеет четвертичную, третичную и/или первичную структуры, аналогичные структуре белка и который может служить для замены сегмента или фрагмента в представляющем интерес белке аналогичным сегментом данного гомолога, что позволяет снижать степень дизрупции такой замены. В некоторых предпочтительных вариантах изобретения гомологичные белки индуцируют иммунный(ые) ответ(ы), аналогичный(е) иммунному(ым) ответу(ам), который(ые) индуцирует представляющий интерес белок.

Используемый здесь термин «гомологичные гены» означает по меньшей мере пару генов, происходящих от различных видов, где указанные гены соответствуют друг другу и являются идентичными или почти аналогичными друг другу. Этот термин охватывает гены, разделенные посредством видообразования (то есть образования новых видов)(например, ортологичные гены), а также гены, разделенные в результате генетической дупликации (например, паралогичные гены). Эти гены кодируют «гомологичные белки».

Используемый здесь термин «ортолог» и «ортологичные гены» означает гены от различных видов, которые эволюционировали от гена общего предка (то есть гомологичного гена) посредством видообразования. Обычно в процессе эволюции ортологи сохраняют свою функцию. Идентификация ортологов может быть применена для точного предсказания функции генов в только что секвенированных геномах.

Используемые здесь термины «паралог» и «паралогичные гены» означают гены, которые являются родственными в результате их дупликации в геноме. Ортологи сохраняют свою функцию в процессе эволюции, а паралоги приобретают новые функции, даже несмотря на то, что некоторые из этих функций часто являются родственными исходным функциям. Примерами паралогичных генов являются, но не ограничиваются ими, гены, кодирующие трипсин, химотрипсин, эластазу и тромбин, где каждый из указанных ферментов представляет собой сериновые протеиназы, и все вместе они принадлежат к одному и тому же виду.

Используемые здесь термины «белки дикого типа», «нативные белки» и «природные белки» означают белки, существующие в природе. Используемые здесь термины «последовательность дикого типа» и «ген дикого типа» являются взаимозаменяемыми и означают последовательность, которая является нативной или существует в природе в клетке-хозяине. Гены, кодирующие природный белок, могут быть получены общими методами, известными специалистам. Такие методы, по существу, включают синтез меченых зондов, имеющих предполагаемые последовательности, кодирующие области представляющего интерес белка, получение геномных библиотек из организмов, экспрессирующих такой белок, и скрининг библиотек представляющих интерес генов путем их гибридизации с зондами. Затем позитивно гибридизующиеся клоны картируют и секвенируют.

Степень гомологии последовательностей может быть определена любым подходящим методом, известным специалистам (см., например, Smith and Waterman, Adv. Appl. Math., 2:482 [1981]; Needleman and Wunsch, J. MoI. Biol., 48:443 [1970]; Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988], с помощью таких программ, как GAP, BESTFIT, FASTA и TFASTA, имеющихся в пакете программ Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); и Devereux et al, Nucl. Acid Res., 12:387-395 [1984]).

Используемый здесь термин «процент (%) идентичности последовательностей нуклеиновой кислоты» определяется как процент нуклеотидных остатков в последовательности-кандидате, которые идентичны нуклеотидным остаткам указанной последовательности.

Используемый здесь термин «гибридизация» означает процесс, посредством которого, как известно специалистам, цепь нуклеиновой кислоты присоединяется к комплементарной цепи в результате спаривания оснований.

Используемый здесь термин «условия гибридизации» означает условия, при которых осуществляют реакции гибридизации. Такие условия обычно классифицируются по степени «жесткости» условий, при которых определяют уровень гибридизации. Степень жесткости может зависеть, например, от температуры плавления (Tm) комплекса или зонда, связывающегося с нуклеиновой кислотой. Так, например, условия «максимальной жесткости» обычно означают гибридизацию при температуре примерно Tm-5°С (на 5°С ниже Tm зонда); условия «высокой жесткости» примерно на 5-10°С ниже Tm зонда; условия «умеренной жесткости» примерно на 10-20°С ниже Tm зонда, а условия «низкой жесткости» примерно на 20-25°С ниже Tm зонда. Альтернативно или дополнительно условия гибридизации зависят от концентрации соли или ионной силы и/или от одной или нескольких промывок в определенных условиях жесткости. Так, например, 6×SSC соответствует условиям очень низкой жесткости; 3×SSC = условиям низко-умеренной жесткости; 1×SSC = условиям умеренной жесткости; а 0,5×SSC = высокой жесткости. В зависимости от их свойств условия максимальной жесткости могут быть использованы для идентификации последовательностей нуклеиновой кислоты, строго идентичных или почти идентичных последовательностям зонда для гибридизации, а условия высокой жесткости могут быть использованы для идентификации последовательностей нуклеиновой кислоты, которые примерно на 80% или более идентичны последовательностям зонда.

В некоторых вариантах изобретения, а в частности, в тех случаях, когда требуется высокая селективность, для получения гибридов может оказаться желательным использование относительно жестких условий (например, относительно низкой концентрации соли и/или высоких температур).

Выражения «по существу, аналогичный» и «по существу, идентичный», если они относятся по меньшей мере к двум нуклеиновым кислотам или полипептидам, обычно означают, что данный полинуклеотид или полипептид имеют последовательности, которые по меньшей мере примерно на 40%, по меньшей мере примерно на 50%, по меньшей мере примерно на 60%, по меньшей мере примерно на 75%, по меньшей мере примерно на 80%, по меньшей мере примерно на 90%, по меньшей мере примерно на 95%, по меньшей мере примерно на 97%, а иногда и примерно на 98% и примерно на 99% идентичны исходной последовательности (то есть последовательности дикого типа). Идентичность последовательностей может быть определена с помощью известных программ, таких как BLAST, ALIGN и CLUSTAL, с использованием стандартных параметров. (см., например, Altschul, et al, J. Mol. Biol. 215:403-410 [1990]; Henikoff et al, Proc. Natl. Acad. Sci. USA 89:10915 [1989]; Karin et al, Proc. Natl. Acad. Sci USA 90:5873 [1993]; and Higgins et al, Gene 73:237 - 244 [1988]). Программы для осуществления анализов BLAST имеются в общедоступной базе данных Национального центра биотехнологической информации. Кроме того, поиск в базах данных может быть осуществлен с помощью программы FASTA (Pearson et al, Proc. Natl. Acad. Sci. USA 85:2444-2448 [1988]). Одним из показателей того, что два полипептида, по существу, идентичны друг другу, является то, что первый полипептид вступает в иммунную перекрестную реакцию со вторым полипептидом. Обычно полипептиды, которые отличаются консервативными аминокислотными заменами, являются иммунологически перекрестно-реактивными. Таким образом, полипептид, в основном, идентичен второму полипептиду, например, в том случае, если два пептида отличаются друг от друга только консервативными заменами. Показателем того, что две последовательности нуклеиновой кислоты, в основном, идентичны друг другу, является то, что две молекулы гибридизуются друг с другом в определенных условиях жесткости (например, в условиях умеренно-высокой жесткости).

Используемые здесь термины «выделенный», «изолированный» и «отделенный» относятся к белку, клетке, нуклеиновой кислоте или аминокислоте, не содержащим по меньшей мере одного компонента, с которым они обычно ассоциированы в природе. В некоторых случаях изолированным белком является белок, который секретируется в культуральную среду, а затем удаляется из этой среды.

Термин «рекомбинантный» относится к полинуклеотиду или полипептиду, который обычно не присутствует в клетке-хозяине. Рекомбинантная молекула может содержать две или более природных последовательностей, связанных друг с другом так, как это обычно не происходит в природе. Рекомбинантная клетка содержит рекомбинантный полинуклеотид или полипептид. Белки, продуцируемые рекомбинантными методами, получают с использованием клеток-хозяев, которые обычно не продуцируют такие белки.

Термин «гетерологичный» относится к элементам, которые обычно не связаны друг с другом. Так, например, если клетка-хозяин продуцирует гетерологичный белок, то таким белком является белок, который обычно не продуцируется клеткой-хозяином. Аналогичным образом промотором, который функционально присоединен к гетерологичной кодирующей последовательности, является промотор, функционально присоединенный к кодирующей последовательности, которая обычно не является функционально присоединенной к такому промотору в клетке-хозяине дикого типа. Термин «гомологичный», если он относится к экспрессии полинуклеотида или белка, означает, что данный полинуклеотид или белок обычно присутствуют в клетке-хозяине, в которой они экспрессируются.

Используемыми здесь «клетками-хозяевами», по существу, являются прокариотические или эукариотические хозяева, трансформированные или трансфецированные векторами, сконструированными методами рекомбинантных ДНК, известными специалистам. Трансформированные клетки-хозяева обладают способностью к репликации векторов, кодирующих варианты белка или экспрессирующих нужный вариант белка. В случае векторов, кодирующих пре- или препроформу варианта белка, такие варианты, если они экспрессируются, обычно секретируются из клетки-хозяина в среду данной клетки-хозяина.

В некоторых вариантах своего осуществления настоящее изобретение относится к активности некоторых ацилтрансфераз, направленной на эффективный катализ переноса ацильной группы от донора ацила (например, C220-эфира) на спиртовой субстрат в водной среде. Как подробно описано в настоящей заявке в некоторых вариантах изобретения, активность этих ферментов используют для получения сложных эфиров с приятным запахом или ароматом. В некоторых других вариантах изобретения активность указанных ферментов, предпочтительно, используют для устранения неприятного запаха, появляющегося при проведении очистки.

Не ограничиваясь каким-либо конкретным ферментом, спиртовым субстратом или донором ацила и руководствуясь лишь объяснением некоторых вариантов описанных здесь методов, следует отметить, что реакция, осуществляемая в соответствии с некоторыми вариантами рассматриваемых методов, проиллюстрирована ниже, где «АсТ» означает «ацилтрансферазу».

Так, например, также не ограничиваясь каким-либо конкретным ферментом, спиртовым субстратом или донором ацила и руководствуясь лишь объяснением некоторых вариантов описанных здесь методов, следует отметить, что ацилтрансферазный фермент используется для переноса ацильной группы от подходящего донора ацила (например, триглицерида, такого как трибутирин или триацетин) на спирт терпенового ряда, такой как гераниол или цитронеллол с образованием душистого сложного эфира. Аналогичным образом в других вариантах изобретения ацилтрансфераза может быть использована для устранения неприятного запаха от масляных пятен. В некоторых особенно предпочтительных вариантах изобретения указанными масляными пятнами являются пятна от молочных продуктов. В этих вариантах изобретения, направленных на устранение/предупреждение появления неприятного запаха, фермент AcT используют для уменьшения количества летучих жирных кислот с гнилостным запахом (например, масляной кислоты), продуцируемых при гидролизе триглицеридов. В некоторых вариантах изобретения ацилтрансферазный фермент действует синергически по меньшей мере с одним липазным ферментом, что приводит к увеличению скорости удаления ацильных цепей из триацилглицерида, а в других вариантах изобретения ацилтрансфераза действует по механизму присоединения ацильных цепей к спиртовому субстрату, в результате чего продуцируется нелетучая жирная кислота, а сложноэфирный продукт. В некоторых вариантах изобретения ацилтрансфераза действует по обоим вышеуказанным механизмам. В некоторых вариантах изобретения ацильная цепь триацилглицерида присоединяется к спиртовому субстрату с образованием душистого сложного эфира. В этих вариантах изобретения в качестве побочного продукта продуцируется не летучая жирная кислота с гнилостным запахом, а душистый сложный эфир. Указанный вариант изобретения схематически проиллюстрирован на фигуре 6.

Эти варианты изобретения, а также многие другие варианты изобретения более подробно описаны ниже.

Перед более подробным описанием изобретения, представленным ниже, следует отметить, что в обсуждаемых здесь методах может быть использован ряд других ферментов, обладающих способностью катализировать перенос ацильной группы от донора ацила на спиртовой субстрат с продуцированием сложного эфира. Такими ферментами являются, но не ограничиваются ими, классические липазы, ацил-СоА-зависимые трансферазы, фосфолипазы, кутиназы, GDSX-гидролазы, SGNH-гидролазы, сериновые протеазы и эстеразы, а также любые ферменты, способные после их контактирования с донором ацила образовывать ацилсодержащие промежуточные ферменты и переносить ацильную группу на акцептор, не являющийся водой.

В некоторых вариантах изобретения указанным ферментом является фермент дикого типа, а в других вариантах изобретения фермент имеет модифицированную аминокислотную последовательность, которая сообщает ферменту изменение специфичности к субстрату или усиление ацилтрансферазной активности по сравнению с ферментом дикого типа. В других своих вариантах настоящее изобретение относится к применению дополнительных компонентов.

Ацилтрансферазы

Как указывалось выше, настоящее изобретение относится к композициям, продуцирующим сложный эфир, которые содержат по меньшей мере одну ацилтрансферазу, и к способам применения такого(их) фермента(ов). При этом предусматривается, что ацилтрансфераза в композициях согласно изобретению содержит любой фермент, который может катализировать перенос ацильной группы от донора ацила на спиртовой субстрат. Как указывалось выше, в способах согласно изобретению могут быть использованы ферменты нескольких типов. В некоторых вариантах изобретения используемый фермент обладает более высокой специфичностью к спиртовым субстратам, чем к воде. В некоторых таких вариантах фермент обладает относительно низкой гидролитической активностью (то есть, относительно низкой способностью гидролизовать донор ацила в присутствии воды) и относительно высокой ацилтрансферазной активностью (то есть лучшей способностью гидролизовать донор ацила в присутствии спирта в водной среде), где отношение алкоголиз:гидролиз превышает примерно 1,0, по меньшей мере примерно 1,5 или по меньшей мере примерно 2,0. В некоторых вариантах изобретения ацилтрансфераза также обладает более высокой специфичностью к пероксиду, чем к воде, в результате чего продуцируются очищающие средства, содержащие перкислоту (например, где отношение пергидролиз:гидролиз составляет примерно более чем 1,0, по меньшей мере примерно 1,5 или по меньшей мере примерно 2,0).

В некоторых вариантах изобретения может быть использована GDSX-ацилтрансфераза, а в частности SGNH-ацилтрансфераза. Репрезентативными SGNH-ацилтрансферазами, которые могут быть использованы в настоящем изобретении, являются SGNH-ацилтрансферазы дикого типа, депонированные в базе данных GENBANK® NCBI под регистрационными номерами: YP_890535 (GID: 1 1846860; см. также WO 05/056782; M. smegmatis); NP_436338.1 (GID: 16263545; Sinorhizobium meliloti); ZP_01549788.1 (GID: 1 18592396; Stappia aggregate); NP_066659.1 (GID: 10954724; Agrobacterium rhizogenes); YP_368715.1 (GID: 78065946; Burkholderia sp.); YP_674187.1 (GID: 110633979; Mesorhizobium sp.); и NP_532123.1 (GID: 17935333; Agrobacterium tumefaciens), ортологи дикого типа и их гомологи и варианты, аминокислотные последовательности которых по меньшей мере примерно на 70%, по меньшей мере примерно на 80%, по меньшей мере примерно на 90%, по меньшей мере примерно на 95% или по меньшей мере примерно на 98% идентичны последовательностям любого фермента дикого типа. Указанные регистрационные номера GENBANK® во всей своей полноте вводятся в настоящее описание посредством ссылки, включая имеющиеся там последовательности нуклеиновых кислот и белков и описание этих последовательностей. Другие примеры таких ферментов были идентифицированы посредством поиска гомологичных последовательностей в базе данных GENBANK® NCBI с применением стандартных методов сравнения последовательностей, известных специалистам (например, BLAST, и т.п.). В некоторых вариантах изобретения ацилтрансфераза имеет аминокислотную последовательность, которая по меньшей мере примерно на 70% идентична аминокислотной последовательности, представленной в списке последовательностей YP_890535 GENBANK® (GID: 11846860; M. smegmatis; см. также WO 05/056782).

Другими примерами SGNH-ацилтрансферазных ферментов являются нижеследующие ферменты, которые происходят от нижеследующих видов, указанных вместе с их регистрационными номерами GENBANK®: Agrobacterium rhizogenes (Q9KWA6), А. rhizogenes (Q9KWBI), A. tumefaciens (Q8UFG4), A. tumefaciens (Q8UACO), A. tumefaciens (Q9ZI09), A. tumefaciens (ACA), Prosthecobacter dejongeii (RVM04532), Rhizobium loti (Q98MY5), R. meliloti (Q92XZ1), R. meliloti (Q9EV56), R. rhizogenes (NF006), R. rhizogenes (NF00602875), R. solanacerarum (Q8XQI0), Sinorhizobium meliloti (RSM02162), S. meliloti (RSM05666), Mesorhizobium loti (RMLO00301), A. rhizogenes (Q9KWA6), A. rhizogenes (Q9KWB1), Agrobacterium tumefaciens (AAD02335), Mesorhizobium loti (Q98MY5), Mesorhizobium loti (ZP00197751), Ralstonia solanacearum (Q8XQI0), Ralstonia eutropha (ZP00166901), Moraxella bovis (AAK53448), Burkholderia cepacia (ZP00216984), Chromobacterium violaceum (Q7NRP5), Pirellula sp. (NP_865746), Vibrio vulnificus (AA007232), Salmonella typhimurium (AAC38796), Sinorhizobium meliloti (SMa1993), Sinorhizobium meliloti (Q92XZ1) и Sinorhizobium meliloti (Q9EV56). Аминокислотные последовательности этих белков, выравнивание последовательностей и вся другая информация, относящаяся к вышеуказанным данным, описаны в заявке WO 05/056782, которая во всей своей полноте вводится в настоящее описание посредством ссылки.

Некоторые примеры таких ферментов были кристаллизованы, а многие репрезентативные аминокислотные замены, введенные в варианты ферментов и сохраняющие или изменяющие их активность, описаны в WO 05/056782, которая вводится в настоящее описание посредством ссылки. Список из 100 аминокислотных замен, которые являются устойчивыми к гидролитической активности, пергидролитической активности, активности разложения под действием перкислоты и/или которые являютя устойчивыми к действию пергидролазы M. smegmatis, а в некоторых вариантах изобретения такие замены могут быть использованы в целях изменения таких активностей, приводятся в таблицах 10-3, 10-4, 10-5, 10-6, 10-7, 10-8 и 10-9 WO05/056782. Учитывая структурное сходство SGNH-ацилтрансфераз, следует отметить, что аминокислотные замены, описанные в WO 05/056782, могут быть легко перенесены на другие члены семейства SGNH-ацилтрансфераз. Каждая из аминокислотных замен описана в WO 05/056782, и аминокислотные последовательности, продуцируемые в результате таких замен, вводятся в настоящее описание посредством ссылки.

В некоторых вариантах изобретения используемая здесь ацилтрансфераза не является ацетил-CoA-зависимым ферментом. В некоторых альтернативных вариантах изобретения GDSX- или SGNH-ацилтрансфераза, используемая в способах согласно изобретению, представляет собой ацилтрансферазу Candida parapsilosis, Aeromonas hydrophila или Aeromonas salmonicida дикого типа, а в других вариантах изобретения указанной ацилтрансферазой является ее вариант, который по меньшей мере примерно на 95% идентичен указанной ацилтрансферазе.

Ацилтрансферазу, используемую в настоящем изобретении, получают и выделяют стандартными методами, известными специалистам. В некоторых вариантах изобретения продуцирование ацилтрансферазы осуществляют рекомбинантными методами и методами с использованием неприродного хозяина, который либо продуцирует ацилтрансферазу внутри клеток, либо секретирует такую ацилтрансферазу. В некоторых вариантах изобретения к ферменту присоединяют сигнальную последовательность, что облегчает экспрессию фермента в результате секреции в периплазму (то есть в грамотрицательных микроорганизмах, таких как E.coli) или во внеклеточное пространство (то есть в грамположительных микроорганизмах, таких как Bacillus и Actinomycetes), или в эукариотических хозяевах (например, Trichoderma, Aspergillus, Saccharomyces и Pichia). При этом предусматривается, что любой аспект настоящего изобретения не ограничивается этими конкретными хозяевами, а поэтому в настоящем изобретении в качестве экспрессирующих хозяев могут быть использованы и различные другие микроорганизмы.

Так, например, клетки Bacillus хорошо известны специалистам как подходящие хозяева для экспрессии внеклеточных белков (например, протеаз). Внутриклеточная экспрессия белков не так хорошо известна. Внутриклеточную экспрессию ферментного белка в Bacillus subtilis часто осуществляют с использованием различных промоторов, включая, но не ограничиваясь ими, pVeg, pSPAC, pAprE или pAmyE в отсутствии сигнальной последовательности у 5'-конца гена. В некоторых вариантах изобретения экспрессия достигается в результате репликации плазмид (высоко- или низкокопийных), а в альтернативных вариантах изобретения экспрессия достигается посредством интеграции нужной конструкции в хромосому. Интеграция может быть осуществлена в любом локусе, включая, но не ограничиваясь ими, локусы aprE, amyE или pps. В некоторых вариантах изобретения фермент экспрессируют из одной или нескольких копий интегрированной конструкции. В альтернативных вариантах изобретения множество интегрированных копий получают путем интеграции конструкции, способной амплифицироваться (например, связываться с кластером антибиотиков и фланкироваться последовательностями с прямыми повторами) или путем лигирования множества копий с последующей их интеграцией в хромосому. В некоторых вариантах изобретения мониторинг экспрессии фермента с использованием либо реплицирующейся плазмиды, либо интегрированной конструкции проводят с помощью анализа на pNB-активность в соответствующей культуре.

Что касается Bacillus, то в некоторых вариантах изобретения экспрессия фермента в грамположительном хозяине Streptomyces осуществляется с использованием реплицирующейся плазмиды, а в других вариантах изобретения экспрессия фермента осуществляется посредством интеграции вектора в хромосому Streptomyces. Для инициации транскрипции гена фермента (например, промотора глюкозо-изомеразы, промотора A4) может быть использован любой промотор, способный распознаваться в Streptomyces. В настоящем изобретении для экспрессии могут быть также использованы реплицирующиеся плазмиды, либо челночные векторы, либо только Streptomyces (например, pSECGT).

В других вариантах изобретения фермент продуцируется в других клетках-хозяевах, включая, но не ограничиваясь ими, грибковые клетки-хозяева (например, клетки-хозяева Pichia sp., Aspergillus sp. или Trichoderma sp. и т.п.).

В некоторых вариантах изобретения фермент секретируется из клетки-хозяина, после чего его выделяют из культуральной среды, в которой была культивирована данная клетка-хозяин.

После секреции в культуральную среду фермент выделяют любым подходящим и/или стандартным методом (например, путем преципитации, центрифугирования, аффинной очистки, аффинной хроматографии, ионообменной хроматографии, двухфазной распределительной гидрофобной хроматографии, преципитации этанолом, обращенно-фазовой ВЭЖХ, хроматографии на двуокиси кремния или на катионообменной смоле, такой как DEAE, хроматофокусирования, электрофореза в ДСН-ПААГ, преципитации сульфатом аммония, гель-фильтрации (например, на сефадексе G-75), фильтрации или любым другим методом, известным специалистам). Действительно, специалистам известен ряд подходящих методов. В некоторых альтернативных вариантах изобретения фермент используют без очистки от других компонентов культуральной среды. В некоторых из этих вариантов культуральную среду просто концентрируют, а затем используют без дополнительной очистки белка от компонентов культуральной среды, а в других вариантах изобретения эту культуральную среду используют без любой дополнительной модификации.

Спиртовые субстраты

Спиртовым субстратом, который может быть использован в настоящем изобретении, является любая органическая молекула, содержащая реакционноспособную гидроксильную группу, связанную с атомом углерода, за исключением гидроксилсодержащих полисахаридов и белков. В некоторых вариантах изобретения спиртовой субстрат имеет формулу Z - OH, где Z представляет собой любую разветвленную, прямую, циклическую, ароматическую или линейную органическую группу или любые их замещенные варианты. В некоторых вариантах изобретения Z представляет собой замещенную или незамещенную алкильную, гетероалкильную, алкенильную, алкинильную, арильную, алкиларильную, алкилгетероарильную или гетероарильную группу, содержащую 2-30 атомов углерода. В некоторых других вариантах изобретения Z представляет собой алифатическую группу и алифатическую группу, замещенную алициклической или ароматической группой (например, терпен). В некоторых других вариантах изобретения спиртовым субстратом является полиол, такой как гликольсодержащая молекула (например, тетраэтиленгликоль, полиэтиленгликоль, полипропиленгликоль или политетрагидрофуран). Подходящими спиртовыми субстратами являются мономерные полиолы (например, глицерин), а также димерные, тримерные и тетрамерные полиолы и спирты ряда сахаров, такие как эритрит, изомальтит, лактит, мальтит, маннит, сорбит и ксилит. В некоторых вариантах изобретения полиолами являются молекулы формулы (Z-OH)n или Z- (OH)n, где n равно по меньшей мере примерно 1, примерно 2, примерно 3, примерно 4, примерно 5 или примерно 6 (например, где n равно 1-4). В некоторых вариантах изобретения, спирт присутствует как часть поверхностно-активного вещества или эмульгатора (например, высокомолекулярный первичный спирт с прямой цепью, такой как детергент NEODOLTM).

В некоторых вариантах изобретения спиртовые субстраты, используемые в способах получения душистого сложного эфира, описанных ниже, имеют формулу Z-OH, где Z представляет собой алициклическую или ароматическую группу или, например, терпен.

Примерами спиртовых субстратов, которые могут быть использованы в способах согласно изобретению, являются, но не ограничиваются ими, этанол, метанол, глицерин, пропанол, бутанол и спиртовые субстраты, представленные ниже в таблицах 1-3.

Доноры ацила

Донор ацила, используемый в способах согласно изобретению, содержит любую органическую молекулу, содержащую переносимую ацильную группу. В некоторых вариантах изобретения типичным донором ацила является сложный эфир формулы R1C(=O)OR2, где R1 и R2 независимо представляют собой любую органическую молекулу, хотя могут быть также использованы и другие молекулы. В некоторых вариантах изобретения подходящими донорами ацила являются мономерные молекулы, а в других вариантах изобретения такими донорами являются полимерные полиоловые эфиры, включая димерные и тримерные молекулы, а также полиоловые эфиры высшего порядка.

Используемый здесь термин «короткоцепочечный донор ацила» означает сложный эфир формулы R1C(=О)OR2, где R1 представляет собой любую органическую молекулу, которая содержит цепь по меньшей мере из 1-9 атомов углерода, а R2 представляет собой любую органическую молекулу. В некоторых вариантах изобретения короткоцепочечные ацильные сложные эфиры содержат ацильную цепь из 2-10 атомов углерода (то есть C2-C10-углеродную цепь). Репрезентативные длинноцепочечные ацильные сложные эфиры содержат C6-, C7-, C8-, C9-, С10-углеродную цепь. Репрезентативные длинноцепочечные ацильные сложные эфиры содержат ацетильную, пропильную, бутильную, пентильную или гексильную группы и т.п.

«Длинноцепочечный донор ацила» представляет собой сложный эфир формулы R1C(=О)OR2, где R1 представляет собой любую органическую молекулу, которая содержит цепь по меньшей мере из 10 атомов углерода, а R2 представляет собой любую органическую молекулу. Так, например, в некоторых вариантах изобретения длинноцепочечные доноры ацила содержат C11-, С12-, С13-, С14-, С15-, С16-, С17-, С18-, С19-, С20-, С21- или С22-ацильную цепь.

Репрезентативными сложными эфирами, которые могут быть использованы в настоящем изобретении, являются сложные эфиры формулы

R1OX[(R2)m(R3)n]p,

где R1 представляет собой молекулу, выбранную из группы, состоящей из H или замещенного или незамещенного алкила, гетероалкила, алкенила, алкинила, арила, алкиларила, алкилгетероарила и гетероарила. В некоторых вариантах изобретения R1 содержит примерно от 1 до 50000 атомов углерода, примерно от 1 до 10000 атомов углерода или даже примерно от 2 до 100 атомов углерода;

каждый R2 представляет собой необязательно замещенную алкоксилатную группу (в некоторых вариантах изобретения каждый R2 независимо представляет собой этоксилатную, пропоксилатную или бутоксилатную группу);

R3 представляет собой молекулу, образующую сложный эфир и имеющую формулу R4CO-,

где R4 представляет собой H, замещенный или незамещенный алкил, алкенил, алкинил, арил, алкиларил, алкилгетероарил и гетероарил (в некоторых вариантах изобретения R4 представляет собой замещенный или незамещенный прямой или разветвленный алкил, алкенил или алкинил, группу, содержащую от 5 до 22 или более атомов углерода; арильную, алкиларильную, алкилгетероарильную или гетероарильную группу, содержащую от 5 до 12 или более атомов углерода, либо R4 представляет собой замещенную или незамещенную C510алкильную группу или алкильную группу с более длинной цепью, либо R4 представляет собой замещенную или незамещенную C1122алкильную группу или алкильную группу с более длинной цепью);

х равно 1, если R1 представляет собой Н, а если R1 не является Н, то х равно целому числу, равному числу атомов углерода в R1 или целому числу, которое меньше числа атомов углерода в R1;

p равно целому числу, равному числу x или меньше этого числа;

m равно целому числу от 0 до 50, целому числу от 0 до 18 или целому числу от 0 до 12, а n равно по меньшей мере 1.

В некоторых вариантах настоящего изобретения молекулой, содержащей сложноэфирную группу, является алкилэтоксилат или пропоксилат, имеющий формулу

R1Ox[(R2)m(R3)n]p,

Где R1 представляет собой замещенную или незамещенную C232алкильную или гетероалкильную группу;

каждый R2 независимо представляет собой этоксилатную или пропоксилатную группу;

R3 представляет собой молекулу, образующую сложный эфир и имеющую формулу -R4CO-, где R4 представляет собой Н, замещенный или незамещенный алкил, алкенил, алкинил, арил, алкиларил, алкилгетероарил и гетероарил, а в некоторых вариантах изобретения R4 представляет собой замещенную или незамещенную прямую или разветвленную алкильную, алкенильную или алкинильную группу, содержащую от 5 до 22 или более атомов углерода, замещенную или незамещенную арильную, алкиларильную, алкилгетероарильную или гетероарильную группу, содержащую от 5 до 12 или более атомов углерода, либо R4 представляет собой замещенную или незамещенную C510алкильную группу или алкильную группу с более длинной цепью, либо R4 представляет собой замещенную или незамещенную C522алкильную группу или алкильную группу с более длинной цепью;

x равно целому числу, равному числу атомов углерода в R1 или целому числу, которое меньше числа атомов углерода в R1;

p равно целому числу, равному числу х, или числу, которое меньше данного числа;

m равно целому числу от 1 до 12 и

n равно по меньшей мере 1.

В некоторых вариантах настоящего изобретения молекула, содержащая сложноэфирную группу, имеет формулу

R1Ox[(R2)m(R3)n]p,

где R1 представляет собой Н или молекулу, содержащую первичную, вторичную, третичную или четвертичную аминовую группу, где указанная молекула R1, содержащая аминовую группу, выбрана из замещенного или незамещенного алкила, гетероалкила, алкенила, алкинила, арила, алкиларила, алкилгетероарила и гетероарила. В некоторых вариантах изобретения R1 содержит примерно от 1 до 50000 атомов углерода, примерно от 1 до 10000 атомов углерода или примерно от 2 до 100 атомов углерода;

каждый R2 представляет собой алкоксилатную группу (в некоторых вариантах изобретения каждый R2 независимо представляет собой этоксилатную, пропоксилатную или бутоксилатную группу);

R3 представляет собой молекулу, образующую сложный эфир и имеющую формулу R4CO-,

где R4 представляет собой H, замещенный или незамещенный алкил, алкенил, алкинил, арил, алкиларил, алкилгетероарил и гетероарил (в некоторых вариантах изобретения R4 представляет собой замещенную или незамещенную прямую или разветвленную алкильную, алкенильную или алкинильную группу, содержащую от 5 до 22 атомов углерода), замещенную или незамещенную арильную, алкиларильную, алкилгетероарильную или гетероарильную группу, содержащую от 9 до 12 или более атомов углерода, либо R4 представляет собой замещенную или незамещенную C510алкильную группу или алкильную группу с более длинной цепью, либо R4 представляет собой замещенную или незамещенную C1122алкильную группу или алкильную группу с более длинной цепью;

х равно 1, если R1 представляет собой Н, а если R1 не является Н, то х равно целому числу, равному числу атомов углерода в R1 или целому числу, которое меньше числа атомов углерода в R1;

p равно целому числу, равному числу x или меньше этого числа;

m равно целому числу от 0 до 12 или даже от 1 до 12 и

n равно по меньшей мере 1.

Подходящими донорами ацила являются триглицериды любого типа, включая триглицериды животного происхождения, триглицериды молочных продуктов, триглицериды растительного происхождения и синтетические триглицериды, включая, но не ограничиваясь ими, молекулы триацетина, трибутирина и молекулы с более длинной цепью, которые переносят ацетильные группы, бутирильные группы и ацильные группы с более длинной цепью соответственно. В настоящем изобретении могут быть также использованы диацилглицериды, моноацилглицериды, фосфолипиды, лизофосфолипиды и гликолипиды. В некоторых вариантах изобретения диацил- и триацилглицериды содержат однинаковые цепи жирных кислот, а в других вариантах изобретения, они содержат различные цепи жирных кислот. Другими подходящими сложными эфирами являются сложные эфиры, дающие окраску, такие как сложные эфиры п-нитрофенола. Другими сложными эфирами являются алифатические сложные эфиры (например, этилбутират), изопреноидные сложные эфиры (например, цитронеллилацетат) и ароматические сложные эфиры (например, бензилацетат).

В некоторых вариантах очищающих композиций согласно изобретению донор ацила присутствует на объекте (например, в качестве пятна на данном объекте). В некоторых особенно предпочтительных вариантах изобретения донор ацила деацилируется рассматриваемой композицией in situ.

В некоторых вариантах изобретения некоторые способы получения душистого сложного эфира, которые более подробно описаны в настоящей заявке, включают перенос короткоцепочечных (например, C210)ацильных групп, таких как ацетильные и бутирильные группы.

Очищающие композиции

Настоящее изобретение также относится к очищающим композициям, содержащим по меньшей мере одну ацилтрансферазу и по меньшей мере один спиртовой субстрат для ацилтрансферазы. В некоторых вариантах изобретения полученная очищающая композиция предназначена для очистки объектов, загрязненных молекулой донора ацила (например, триглицеридом) in situ. Таким образом, в некоторых вариантах изобретения ацилтрансфераза и спиртовой субстрат присутствуют в количествах, эффективных для продуцирования детектируемого сложного эфира после контактирования очищающей композиции с объектом, содержащим донор ацила. В некоторых вариантах изобретения очищающая композиция после ее контактирования с объектом, содержащим донор ацила, будет включать объект, содержащий донор ацила, и сложный эфир, продуцируемый в результате реакции взаимодействия спиртового субстрата и донора ацила, катализируемой ацилтрансферазой. Как указывалось выше, в некоторых вариантах изобретения такой ацилтрансферазой является SGNH-ацилтрансфераза. В некоторых дополнительных вариантах изобретения очищающая композиция содержит комбинацию спиртового субстрата и донора ацила, в результате чего после переноса ацильной группы от донора ацила на спиртовой субстрат под действием ацилтрансферазы будет продуцироваться средство для ухода за тканью (то есть сложный эфир, представляющий собой поверхностно-активное вещество).

В некоторых вариантах изобретения указанным спиртовым субстратом является молекула двойного назначения, то есть она функционирует в очищающей композиции как поверхностно-активное вещество или эмульгатор. Примерами таких спиртовых субстратов являются, но не ограничиваются ими, жирные спирты (например, алифатические C8-C18спирты с прямой или разветвленной цепью), например, цетиловый спирт (например, гексадекан-1-ол), этоксилаты жирных спиртов (например, этоксилаты NEODOLTM), происходящие от жирных спиртов, и этоксилаты полиолов (например, этоксилаты глицерина), которые обычно используются в очищающих композициях.

Как более подробно описано ниже, очищающие композиции согласно изобретению получают в любой подходящей форме, включая твердые вещества (например, с ферментом и спиртовым субстратом, адсорбированным на твердом веществе), жидкости и гели. В некоторых предпочтительных вариантах изобретения указанные композиции получают в концентрированной форме. В других вариантах изобретения рассматриваемая очищающая композиция используется в чистом виде, а в некоторых других вариантах изобретения она используется в виде спрея или предварительно промытой композиции. Используемая рабочая форма очищающей композиции (например, очищающая композиция в растворенной или разведенной форме) является водной, а поэтому она по меньшей мере на 50% состоит из воды, а во многих случаях она примерно на 50-99,99% состоит из воды. В некоторых вариантах изобретения рабочая концентрация спиртового субстрата в рассматриваемой очищающей композиции составляет примерно 0,0001-50% (об/об или масс./об), менее чем примерно 1%, менее чем примерно 0,1%, менее чем примерно 0,01% или менее чем примерно 0,001%. В некоторых вариантах изобретения рабочая концентрация рассматриваемого ацилтрансферазного фермента в очищающей композиции составляет примерно 0,01 м.д.(миллионные доли, масс./об)-примерно 1000 м.д., примерно 0,01-0,05 м.д., примерно 0,05-0,1 м.д., примерно 0,1- 0,5 м.д., примерно 0,5-1 м.д., примерно 1- 5 м.д., примерно 5-10 м.д., примерно 10-50 м.д., примерно 50- 100 м.д., примерно 100-500 м.д. или примерно 500-1000 м.д.

В некоторых вариантах изобретения очищающие композиции согласно изобретению также содержат по меньшей мере одну липазу (например, триацилглицеринлипазу, обладающую активностью, определенной как активность EC 3.1.1.3 в соответствии с номенклатурой ферментов IUBMB). В некоторых вариантах изобретения липазой является классическая липаза, описанная выше. При этом предполагается, что ацилтрансфераза и липаза действуют синергически, что способствует удалению ацильных цепей из ацилглицеридных молекул (например, триацилглицерина), присутствующих на данном объекте. Однако следует отметить, что настоящее изобретение не ограничивается каким-либо конкретным механизмом действия.

В некоторых вариантах изобретения очищающая композиция содержит источник пероксида, который может представлять собой либо сам пероксид водорода, либо композицию, которая продуцирует пероксид водорода как продукт реакции. Подходящими источниками пероксида водорода, которые продуцируют пероксид водорода как продукт реакции, являются, но не ограничиваются ими, источники пероксидов, выбранные из: (i) примерно 0,01-50, примерно 0,1-20 или примерно 1-10 масс.% соли перкислоты, органической пероксикислоты, гидропероксида мочевины и их смесей; (ii) примерно 0,01-50, примерно 0,1-20 или примерно 1-10 масс.% углевода и примерно 0,0001-1, примерно 0,001-0,5 или примерно 0,01-0,1 масс.% углевод-оксидазы, и (iii) их смесей. Подходящими солями перкислоты являются, но не ограничиваются ими, перборат щелочного металла, перкарбонат щелочного металла, перфосфаты щелочного металла, персульфаты щелочного металла и их смеси.

В некоторых вариантах изобретения сахарид выбран из моносахаридов, дисахаридов, трисахаридов, олигосахаридов (например, углеводов) и их смесей. Подходящими сахаридами являются, но не ограничиваются ими, сахариды, выбранные из D-арабинозы, L-арабинозы, D-целлобиозы, 2-дезокси-D-галактозы, 2-дезокси-D-рибозы, D-фруктозы, L-фукозы, D-галактозы, D-глюкозы, D-глицеро-D-гулогептозы, D-лактозы, D-ликсозы, L-ликсозы, D-мальтозы, D-маннозы, мелезитозы, L-мелибиозы, палатинозы, D-раффинозы, L-рамнозы, D-рибозы, L-сорбозы, стахиозы, сахарозы, D-трегалозы, D-ксилозы, L-ксилозы и их смесей.

Подходящими углевод-оксидазами являются, но не ограничиваются ими, углевод-оксидазы, выбранные из альдозооксидазы (EC 1.1.3.9 в соответствии с классификацией ИЮПАК), галактозооксидазы (EC l.1.3.9 в соответствии с классификацией ИЮПАК), целлобиозооксидазы (EC l.1.3.25 в соответствии с классификацией ИЮПАК), пиранозооксидазы (EC l..1.3.10 в соответствии с классификацией ИЮПАК), сорбозооксидазы (EC l.1.3.11 в соответствии с классификацией ИЮПАК) и/или гексозооксидазы (EC l.1.3.5 в соответствии с классификацией ИЮПАК) и глюкозооксидазы (EC 1.1.3.4 в соответствии с классификацией ИЮПАК) и их смесей.

В некоторых вариантах изобретения на объекте, содержащем донор ацила и очищаемом с использованием очищающей композиции, имеется пятно маслянистого вещества (например, вещества, содержащего триацилглицерид или т.п.). В некоторых вариантах изобретения на объекте (например, на ткани) имеется пятно от молочного продукта.

В некоторых вариантах изобретения спиртовой субстрат, в том случае, если его тип не играет важной роли для осуществления способов согласно изобретению, выбирают так, чтобы после его реакции взаимодействия с донором ацила, такой субстрат продуцировал душистый сложный эфир. Душистые сложные эфиры более подробно описаны ниже.

В некоторых вариантах изобретения указанной очищающей композицией является композиция для чистки ткани (то есть моющее средство), композиция для очистки поверхностей, композиция для чистки посуды или моющая композиция для автоматической мойки посуды. Способы получения репрезентативных очищающих композиций более подробно описаны в WO 0001826, которая вводится в настоящее описание посредством ссылки.

В некоторых вариантах изобретения рассматриваемая очищающая композиция содержит примерно 1-80%, примерно 5-50% (по массе) по меньшей мере одного поверхностно-активного вещества (например, неионогенного поверхностно-активного вещества, катионогенного поверхностно-активного вещества, анионогенного поверхностно-активного вещества или цвиттерионного поверхностно-активного вещества или любой их смеси). Репрезентативными поверхностно-активными веществами являются, но не ограничиваются ими, алкилбензолсульфонат (ABS), включая алкилбензолсульфонат с прямой цепью и алкилсульфонат натрия с прямой цепью, алкилфеноксиполиэтоксиэтанол (например, нонилфеноксиэтоксилат или нонилфенол), диэтаноламин, триэтаноламин и моноэтаноламин. Репрезентативными поверхностно-активными веществами, которые могут быть использованы при получении моющих средств, а в частности, моющих средств для стирки, являются поверхностно-активные вещества, описанные в патентах США № 3664961, 3919678, 4222905 и 4239659.

В некоторых вариантах изобретения моющим средством является твердое вещество, в некоторых вариантах изобретения таким средством является жидкость, а в других вариантах изобретения таким средством является гель. В некоторых предпочтительных вариантах изобретения указанные моющие средства также содержат буфер (например, карбонат натрия или бикарбонат натрия), модифицирующее(ие) моющее(ие) средство(а), отбеливатель, активатор(ы) отбеливания, дополнительный(ые) фермент(ы), фермент-стабилизирующий(ие) агент(ы), стимулятор(ы) образования мыльной пены, ингибитор(ы), добавка(и), препятствующая(ие) образованию оксидов, антикоррозийное(ые) средство(а), суспендирующий(ие) агент(ы), удаляющий(е) пятна, грязеотталкивающий(е) агент(ы), гермицид(ы), рН-корректирующий(е) агент(ы), немодифицирующий(е) подщелачиваюее(ие) вещество(а), хелатообразующий(е) агент(ы), органический(е) или неорганический(е) наполнитель(и), растворитель(и), гидротроп(ы), оптический(е) отбеливатель(и), краситель(и) и/или ароматизаторы.

В некоторых вариантах изобретения рассматриваемая очищающая композиция содержит один или несколько других ферментов (например, таких как пектин-лиазы, эндогликозидазы, гемицеллюлазы, пероксидазы, протеазы, целлюлазы, ксиланазы, липазы, фосфолипазы, эстеразы, кутиназы, пектиназы, пектат-лиазы, амилазы, маннаназы, кератиназы, редуктазы, оксидазы, оксидоредуктазы, фенолоксидазы, липоксигеназы, лигниназы, пуллуланазы, танназы, пентозаназы, маланазы, бета-глюканазы, арабинозидазы, гиалуронидазы, хондроитиназы, лакказы и амилазы) или их смесей. В некоторых вариантах изобретения используется комбинация ферментов (то есть «коктейль»), содержащая обычно применяемые ферменты, такие как протеаза, липаза, кутиназа и/или целлюлаза в комбинации с ацилтранферазой.

В рассматриваемых здесь детергентсодержащих очищающих композициях могут быть также использованы и другие ингридиенты широкого ряда, включая другие активные ингредиенты, носители, гидротропы, технологические добавки, красители или пигменты, растворители для жидких препаратов и т.п. В тех вариантах изобретения, в которых требуется дополнительная стимуляция образования мыльной пены, в указанные композиции включают стимуляторы образования мыльной пены, такие как С1016-алколамиды, обычно примерно от 1 до 10%.

В некоторых вариантах изобретения моющие композиции содержат воду и другие растворители в качестве носителей. Для этих целей подходящими являются низкомолекулярные первичные или вторичные спирты, например, метанол, этанол, пропанол и изопропанол. Одноатомные спирты являются предпочтительными для солюбилизации поверхностно-активных веществ, но могут быть также использованы полиолы, такие как полиолы, содержащие примерно 2-6 атомов углерода и примерно 2-6 гидроксигрупп (например, 1,3-пропандиол, этиленгликоль, глицерин и 1,2-пропандиол). В некоторых вариантах изобретения композиции содержат примерно 5-90%, а обычно примерно 10-50% указанных носителей.

В некоторых вариантах изобретения рассматриваемые здесь моющие композиции приготавливают так, чтобы в процессе водной очистки водная промывка имела рН примерно 6,8-11,0. Таким образом, готовые продукты обычно имеют рН в этом интервале. Рекомендованные методы регуляции pH предусматривают применение буферов, щелочей, кислот и т.п., и такие методы хорошо известны специалистам. В некоторых вариантах изобретения очищающая композиция содержит моющее средство для автоматической мойки посуды, которое имеет рабочий pH в пределах примерно от 9,0 до 11,5, примерно от 9,0 до 9,5, примерно от 9,5 до 10,0, примерно от 10,0 до 10,5, примерно от 10,5 до 11,0 или примерно от 11,0 до 11,5. В некоторых других вариантах изобретения очищающая композиция содержит жидкое моющее средство для стирки, которое имеет рабочий рН в пределах примерно от 7,5 до 8,5, примерно от 7,5 до 8,0 или примерно от 8,0 до 8,5. В некоторых других вариантах изобретения очищающая композиция содержит твердое моющее средство для стирки, которое имеет рабочий pH в пределах примерно от 9,5 до 10,5, примерно от 9,5 до 10,0 или примерно от 10,0 до 10,5.

В композициях согласно изобретению могут быть также использованы различные отбеливающие соединения, такие как перкарбонаты, пербораты и т.п., и их содержание обычно составляет примерно от 1 до 15% по массе. Такие композиции, если это необходимо, также содержат активаторы отбеливания, такие как тетраацетилэтилендиамин, нонаноилоксибензолсульфонат и т.п., также известные специалистам. Их содержание обычно составляет примерно от 1 до 10% по массе.

В различных вариантах настоящего изобретения могут быть использованы различные грязеотталкивающие агенты, а в частности, анионогенные олигоэфирные агенты, различные хелатообразующие агенты, а в частности, аминофосфонаты и этилендиаминдисукцинаты, различные агенты, удаляющие пятна глины, а в частности, этоксилированный тетраэтиленпентамин, различные диспергирующие агенты, а в частности, полиакрилаты и полиаспартаты, различные отбеливатели, а в частности, анионогенные отбеливатели, различные ингибиторы образования мыльной пены, а в частности, силиконы и вторичные спирты, различные мягчители ткани, а в частности, смектитовые глины и т.п., где содержание указанных агентов составляет примерно от 1 до 35% по массе. Стандартные методы получения композиций хорошо известны специалистам.

В некоторых вариантах очищающих композиций согласно изобретению могут быть также использованы стабилизаторы ферментов. Такими стабилизаторами являются, но не ограничиваются ими, пропиленгликоль (предпочтительно, примерно 1-10%), формиат натрия (предпочтительно, примерно 0,1-1%) и формиат кальция (предпочтительно, примерно 0,1-1%).

В других вариантах изобретения очищающие композиции согласно изобретению также включают по меньшей мере одну модифицирующую добавку. В некоторых предпочтительных вариантах изобретения модифицирующие компоненты присутствуют в композициях на уровне примерно 5-50% масс. Типичными модифицирующими добавками являются 1-10-микронные цеолиты, поликарбоксилаты, такие как цитрат и оксисукцинаты, слоистые силикаты, фосфаты и т.п. Другие широко применяемые модифицирующие добавки перечислены в стандартных фармацевтических справочниках и хорошо известны специалистам.

Другими необязательными ингредиентами являются хелатообразующие агенты; агенты, способствующие удалению пятен глины/препятствующие повторному осаждению; полимерные диспергирующие агенты; отбеливатели; осветлители; ингибиторы образования мыльной пены; растворители и добавки, придающие изделию эстетический вид.

Настоящее изобретение также относится к способам применения рассматриваемых здесь очищающих композиций. В некоторых вариантах изобретения методы очистки включают объединение по меньшей мере одной ацилтрансферазы, по меньшей мере одного спиртового субстрата для ацилтрансферазы и одного объекта, загрязненного веществом, содержащим донор ацила, где указаннная ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с продуцированием сложного эфира. В некоторых вариантах изобретения спиртовой субстрат выбрают так, чтобы он был способен продуцировать душистый сложный эфир. В некоторых других вариантах изобретения ацильная группа переносится на поверхностно-активное вещество или эмульгирующий агент, либо на один или несколько других агентов, перечисленных выше. В некоторых вариантах изобретения очищающая композиция также содержит донор ацила, который не служит в качестве очищающего агента (то есть не служит в качестве поверхностно-активного вещества, эмульгатора, окислителя и т.п.), а служит лишь для продуцирования душистого вещества. Такими донорами ацила являются, но не ограничиваются ими, триацетин и трибутирин.

В некоторых вариантах изобретения способы очистки согласно изобретению включают стадию продуцирования сложного эфира, обладающего очищающими свойствами, такого как сложноэфирное поверхностно-активное вещество или сложноэфирный эмульгирующий агент, который приобретает очищающие свойства в процессе промывки.

В некоторых вариантах изобретения указанным объектом может быть ткань (включая, но не ограничиваясь ими, одежду, драпировку, ковры, постельные принадлежности и т.п.), или твердые поверхности (включая, но не ограничиваясь ими, поверхности на кухнях, поверхности в ванных комнатах, кафельную плитку и т.п.), или посуда. В некоторых вариантах изобретения указанная ткань загрязнена веществом, содержащим масло, таким как вещество, содержащее триацилглицерид. В некоторых вариантах изобретения вещество, содержащее масло, включает по меньшей мере один С418-триацилглицерид (например, молочных продуктов).

В некоторых вариантах изобретения способы очистки предусматривают использование очищающей композиции, содержащей ацилтрансферазу, но не липазу (например, классическую липазу). В некоторых альтернативных вариантах изобретения рассматриваемые способы очистки предусматривают использование очищающей композиции, содержащей рассматриваемую ацилтрансферазу и липазу (например, липолазу (LipolaseTM), липозимTM (LipozymTM), липомаксТМ (Lipomax TM), липазу LipexTM, липазу AmanoTM, липазу Toyo-JozoTM, липазу MeitoTM или DiosynthTM). В некоторых вариантах изобретения использование конкретной комбинации ацилтрансфераза-липаза позволяет значительно уменьшить неприятный запах в отличие от способа, в котором применяется только липазный фермент. Следует отметить, что настоящее изобретение не ограничивается каким-либо конкретным механизмом или какой-либо конкретной теорией. Однако считается, что ацилтрансфераза и липаза действуют синергически, что способствует удалению ацильных групп из триацилглицерида (например, триацилглицерида, содержащего масляную кислоту) и тем самым, уменьшению неприятного запаха.

Поэтому в некоторых вариантах изобретения применение ацилтрансферазы в очищающей композиции приводит к более чем примерно 10% снижению содержания жирных кислот, вызывающих неприятный запах, примерно к 20% снижению содержания жирных кислот, вызывающих неприятный запах, примерно к более чем 30% снижению содержания жирных кислот, вызывающих неприятный запах, примерно к более чем 50% снижению содержания жирных кислот, вызывающих неприятный запах, примерно к более чем 70% снижению содержания жирных кислот, вызывающих неприятный запах, примерно к более чем 80% снижению содержания жирных кислот, вызывающих неприятный запах, или примерно к более чем 90% снижению содержания жирных кислот, вызывающих неприятный запах, по сравнению с эквивалентными очищающими композициями, не содержащими ацилтрансферазу. В некоторых особенно предпочтительных вариантах изобретения применение рассматриваемой ацилтрансферазы в очищающей композиции не приводит к появлению неприятного запаха.

Композиции для получения душистых сложных эфиров

Как указывалось выше, настоящее изобретение относится к композициям и к способам, применяемым для получения душистых сложных эфиров. В некоторых вариантах изобретения указанная композиция содержит по меньшей мере одну ацилтрансферазу, спиртовой субстрат для ацилтрансферазы и донор ацила. В некоторых из этих вариантов ацилтрансфераза катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистного сложного эфира в водной среде. В некоторых вариантах изобретения указанная композиция является, по существу, сухой (например, дегидратированной) композицией, в которой душистый сложный эфир продуцируется только после регидратации данной композиции. В других вариантах изобретения указанной композицией является водная композиция, также содержащая душистый сложный эфир.

Во многих вариантах изобретения спиртовой субстрат и донор ацила в данной композиции выбирают так, чтобы они продуцировали конкретный душистый сложный эфир. Репрезентативные душистые сложные эфиры, продуцируемые с использованием рассматриваемой композиции, а также подходящая комбинация спиртового субстрата и донора ацила, используемая для получения этих сложных эфиров, представлены ниже в таблицах 1-3. Известны и другие душистые сложные эфиры, а если знать молекулярную структуру таких душистых сложных эфиров, то можно понять, какой спиртовой субстрат и какой сложный эфир могут быть объединены в присутствии рассматриваемой ацилтрансферазы. В этих таблицах «AcT» означает ацилтрансферазу дикого типа M. smegmatis, «KLM3'» означает ацилтрансферазу Aeromonas sp., описанную в WO 04/064987, а LipomaxTM означает липазу, происходящую от Pseudomonas alcaligenes (Genencor).

Таблица 1
Переэтерификация алифатических спиртов
Спирт Структура Сложный эфир Донор ацила Фермент
Этанол бутират трибутирин,
p-NB,
жировая фракция масла
АсТ, KLM3'
Lipomax
2-метилбутан-1-ол ацетат,
бутират
триацетин,
p-NB,
трибутирин
АсТ, KLM3'
3-метилбутан-1-ол ацетат,
бутират
триацетин
трибутирин
АсТ
Гексиловый спирт ацетат триацетин,
трибутирин
АсТ
цис-3-гексен-1-ол ацетат,
бутират
триацетин
трибутирин
АсТ, KLM3'
Циклогексил-метанол ацетат триацетин АсТ
Циклогексил-этанол ацетат триацетин АсТ
Таблица 2
Переэтерификация спиртов терпенового ряда
Спирт Структура Сложный эфир Донор ацила Фермент
Гераниол ацетат,
бутират
триацетин
трибутирин
АсТ
Цитронеллол ацетат
бутират
триацетин
трибутирин
АсТ, KLM3'
Нерол ацетат триацетин АсТ
Миртенол ацетат триацетин АсТ
Миртанол ацетат триацетин АсТ
Таблица 3
Переэтерификация ароматических спиртов
Спирт Структура Сложный эфир Донор ацила Фермент
Бензиловый спирт ацетат,
бутират
триацетин
трибутирин
АсТ
Фенетиловый спирт ацетат триацетин АсТ, KLM3'
Пиперониловый спирт ацетат триацетин АсТ
Вератриловый спирт ацетат триацетин АсТ

В некоторых вариантах изобретения SGNH-ацилтрансферазу иммобилизируют на субстрате (например, на твердом или полутвердом носителе), таком как колонка или гель, а затем реакцию завершают путем отмывки спиртового субстрата и донора ацила от фермента.

Методы получения душистых сложных эфиров

Вышеописанная композиция может быть использована в различных способах получения душистых сложных эфиров, которые, по существу, включают объединение по меньшей мере одной ацилтрансферазы, по меньшей мере одного спиртового субстрата для ацилтрансферазы и по меньшей мере одного донора ацила, где указанная ацилтрансфераза в водной среде катализирует перенос ацильной группы от донора ацила на спиртовой субстрат с образованием душистого сложного эфира. В некоторых вариантах изобретения указанные способы включают регидратацию компонентов, а затем их объединение. В некоторых альтернативных вариантах изобретения ацилтрансферазу, спиртовой субстрат и донор ацила объединяют в водной среде. Как указывалось выше, в некоторых альтернативных вариантах изобретения ацилтрансферазой является SGNH-ацилтрансфераза.

Указанные способы могут быть применены в различных процессах обработки, в которых предпочтительными являются душистые сложные эфиры. Так, например, в некоторых вариантах изобретения указанную композицию включают в пищевые продукты для усиления или появления приятного запаха или аромата во время их потребления или используют в способах очистки, описанных выше. В некоторых других вариантах изобретения указанные композиции используют в способах получения сложных эфиров.

В одном из примеров композицию, продуцирующую душистый сложный эфир, включают в осушенной форме (например, адсорбированной на субстрате) в пищевой продукт, такой как жевательные резинки или конфеты. Регидратация пищевого продукта (например, в процессе отверждения или в результате добавления содержащей воду жидкости, такой как вода или молоко) инициирует ацилтрансферазную реакцию, что приводит к образованию душистого сложного эфира in situ. Аналогичным образом в некоторых вариантах изобретения указанные способы применяются в целях получения душистых сложных эфиров, которые используются как наполнители в пищевой промышленности, в производстве духов и/или в изготовлении чистящих средств.

В некоторых вариантах изобретения спиртовым субстратом может быть душистый спирт в чистом виде. В некоторых вариантах изобретения в вышеописанной реакции запах продукта изменяется в течение определенного периода времени (например, запах душистого спиртового субстрата превращается в запах сложного эфира данного спирта).

В некоторых других вариантах изобретения душистый спирт подвергается переэтерификации в присутствии длинной ацильной цепи (например, длинноцепочечной жирной кислоты), в результате чего образуется неароматный сложный эфир. В некоторых из этих вариантов такой неароматный сложный эфир гидролизуется в течение определенного периода времени либо спонтанно, либо в присутствии гидролазы, в результате чего снова образуется душистый спирт.

Способы продуцирования сложноэфирных поверхностно-активных веществ in situ

В некоторых вариантах изобретения in situ модификацию липидов осуществляют с использованием частиц, содержащих ацилтрансферазу, фосфолипиды и сорбит. В некоторых вариантах изобретения указанные частицы представляют собой формы, продуцированные в результате наноинкапсуляции, микроинкапсуляции, производства таблеток, гранулирования и/или с использованием покрытий из сложного эфира восков, как определено в «барьерной системе», известной специалистам.

В некоторых вариантах изобретения также наносят покрытия с применением технологии с использованием системы термозащиты (TPT). В некоторых вариантах изобретения в процессе промывки концентрации липидного субстрата, фосфолипида и акцепторной молекулы, сорбита являются очень низкими, что ограничивает продуцирование детергента, дающего зеленую окраску. В некоторых вариантах изобретения включение субстрата и акцепторной молекулы вместе с ферментом KLM3 в закрытый сосуд гарантирует, что концентрация реагентов будет достаточно высокой для осуществления быстрой биоконверсии. В некоторых вариантах изобретения в процессе хранения в конкретных условиях температуры и влажности KLM3 катализирует процесс модификации in situ, что приводит к образованию лизо-PC- и сорбит-ациловых сложных эфиров. Для полного превращения фосфолипидов (PC) оптимизированное отношение PC:сорбит составляет примерно 1:2; примерно 1:5, примерно 1:10, примерно 1:50 или, наиболее предпочтительно, примерно 1:100. В некоторых вариантах изобретения для получения наилучшей моющей композиции все фосфолипиды превращают в лизо-фосфолипидные производные и в эквивалентное количество сорбит-ациловых сложных эфиров. В случае оптимального ацилтрансферазного мутанта KLM3 ферментативная реакция будет приводить к образованию только лизо-фосфолипидов и сорбит-ациловых сложных эфиров, но при этом не будет образовываться значительного количества свободных жирных кислот. Для достижения большей эффективности детергента все фосфолипиды превращают в лизо-фосфолипидные производные.

В некоторых вариантах изобретения биохимическую реакцию проводят после инкапсулирования, а в некоторых вариантах изобретения может потребоваться дополнительное время хранения. После завершении реакции частицы добавляют в промывочный порошок. Частицы солюбилизируются в процессе промывки, в результате чего высвобождаются детергенты. При этом могут быть использованы субстраты широкого спектра (триглицериды, диглицеридмоноглицериды, фосфолипиды, галактолипиды, виниловые сложные эфиры, метиловые сложные эфиры и т.п. жирных кислот). Аналогичным образом подходящими также являются акцепторные молекулы широкого ряда. Такими акцепторами являются сорбит, ксилит, глюкоза, мальтоза, сахароза, полиолы, спирты с длинной, средней и короткой цепью, полисахариды, такие как пектин, крахмал, галактоманнан, альгинат, хитозан карагенанов, гидролизованный хитозан и олигосахариды, происходящие от этих полисахаридов. В дополнительных вариантах изобретения, акцепторными молекулами являются полипептиды и пептиды.

Полное описание заявки WO 05/056782, включая, но не ограничиваясь ими, все описания ацилтрансферазных ферментов, аминокислотных модификаций, кристаллических структур, аналитических методов, методов применения, последовательностей, гомологов, ортологов, выравнивания последовательностей, графического материала, таблиц, очищающих композиций и т.п. во всей своей полноте вводятся в настоящее описание посредством ссылки.

Экспериментальная часть

Нижеследующие примеры приводятся для иллюстрации и дополнительного описания некоторых предпочтительных вариантов и аспектов настоящего изобретения и не должны рассматриваться как ограничение объема изобретения.

Опубликованная заявка PCT WO 05/056782 относится к идентификации и применению ацилтрансферазных ферментов. Каждый из примеров 1-27 опубликованной заявки PCT WO 05/056782 отдельно вводится в настоящее описание посредством ссылки в целях иллюстрации всех описанных здесь методов, включая, но не ограничиваясь ими, методы получения ацилтрансфераз, методы идентификации ацилтрансфераз, методы тестирования ацилтрансфераз, полинуклеотидные и полипептидные последовательности ацилтрансфераз, методы применения ацилтрансфераз и композиции, в которых могут быть использованы ацилтрансферазы.

Пример 1

Ацилирование цис-3-гексенола, 2-фенилэтанола и изоамилового спирта

Ацилирование цис-3-гексенола, 2-фенилэтанола и изоамилового спирта осуществляют в воде, содержащей трибутирин и растворимую ацилтрансферазу.

В соответствии с типичной процедурой спирт (2 мкл) и трибутирин (2 мкл) в 200 мМ фосфатного буфера, pH 7 (500 мкл), обрабатывали ацилтрансферазой (M.smegatis; AcT) (34 м.д.) или KLM3' (20 м.д.) при 45°С в течение 40 минут. Затем в каждый сосуд добавляли дихлорметан (500 мкл), после чего содержимое подвергали вихревому перемешиванию (10 секунд) и центрифугировали для отделения органического и водного слоя. После этого, органический слой удаляли и продукт анализировали с помощью ЖХ/МС. Этот анализ проводили на ЖХ-МС-устройстве Agilent 6890 с использованием колонки HP-5MS размером 30 м ×0,25 мм (0,25 мкм-пленка). В ЖХ/МС-методе в качестве газа-носителя использовали гелий (l см3/мин), температура входного отверстия для впрыска составляла 250°С, а отношение деления потока составляло 20:1. Программа регуляции температуры в печи включала: выдерживание в течение 1 минуты при 60°С, а затем увеличение температуры до 300°С при 30°С/минуту в течение всей 10-минутной процедуры. Масс-детектор включали через 2 минуты после инжекторного сканирования от 30 до 400 е.а.м.

На фигуре 1 показано, что в каждом из этих экспериментов часть спирта превращали в их соответствующие сложные эфиры масляной кислоты. Такое количество для AcT значительно превышало количество для KLM3'.

Пример 2

Ацилирование цитронеллола и гераниола

Спирты терпенового ряда, а именно цитронеллол (1) и гераниол (2) оценивали как субстраты для ацилтрансфераз AcT и KLM3' с использованием триацетина и трибутирина в качестве доноров ацила.

Спирты терпенового ряда (2 мкл) и триацетин или трибутирин (2 мкл) в 50 мМ фосфатного буфера, pH 7 (500 мкл), обрабатывали AcT (34 м.д.) или KLM3' (20 м.д.) при 45°С в течение 40 минут. Из каждой реакционной смеси брали аликвоту (50 мкл), а затем разбавляли в метаноле/дихлорметане (1:3, 500 мкл) и анализировали с помощью ЖХ/МС на продуцирование сложного эфира. Результаты представлены в таблице 4.

Таблица 4
Степень превращения цитронеллола и гераниола в их соответствующие ацетиловые и бутириловые сложные эфиры с использованием двух ацилтрансфераз
Фермент Цитронеллол Гераниол
Ацетат Бутират Ацетат Бутират
АсТ ++ +++ +++ ++++
KLM3' Следовое количество Следовое количество Отсутствует Отсутствует

Пример 3

Ацилирование спиртов в воде с использованием ацилтрансферазы, адсорбированной на ткани 1

1 мл-аликвоту раствора ацилтрансферазы (100 м.д. в 5 мМ буфера HEPES, pH 8) добавляли в центр квадратного среза вязаной хлопчатобумажной ткани (10×10 см) и эту ткань оставляли на ночь для сушки на воздухе.

На образец ткани, содержащий адсорбированную АсТ, а также на контрольный образец, не содержащий фермента, наносили аликвоты (10 мл) раствора, содержащего бензиловый спирт (1% об/об) и триацетин (1% об/об) в 50 мМ фосфатно-натриевого буфера, pH 7. На ткани, содержащей фермент AcT, через 2 минуты появлялся характерный запах бензилацетата, тогда как контрольный образец не издавал какого-либо явного запаха.

Пример 4

Ацилирование спиртов в воде с использованием ацилтрансферазы, иммобилизованной на ткани II

Образцы трикотажной хлопчатобумажной ткани (20×20 см) помещали на лист пластика и обрабатывали АсТ (1 мл 12 мг/мл), полиэтиленимином (500 мкл 20% масс./об раствора) и деионизованной водой (1 мл). Ткань сушили в течение ночи в условиях окружающей среды, а затем ее удаляли с листа пластика и смачивали в 50 мМ фосфатно-натриевого буфера (400 мл, pH 7) при медленном перемешивании в течение ночи. Затем образец хлопчатобумажной ткани тщательно промывали водопроводной водой и, не выжимая, оставляли сушиться. Второй образец хлопчатобумажной ткани получали методом, описанным выше, за исключением того, что смесь ферментов, нанесенная на ткань, помимо компонентов, перечисленных выше, содержала латексную суспензию (1 мл AIRFLEXTM 423, AirProducts, Allentown, PA).

Два образца помещали рядом друг с другом и обрабатывали водным раствором бензилового спирта (2% об/об) и триацетина (2% об/об) в 50 мМ фосфатно-натриевого буфера (40 мл, pH 7). От обоих образцов, по сравнению с контрольным образцом, исходил явный запах бензилацетата. Образцы также обрабатывали раствором п-нитрофенилбутирата (200 мкл 10 мМ в воде) для визуализации гидролитической активности связанной АсТ. В этом случае заметную окраску давал лишь образец хлопчатобумажной ткани, обработанный AcT/PEI.

Пример 5

Ацилирование бензилового спирта в воде посредством регидратации смеси триацетин/спирт, адсорбированной на крахмале

Бензиловый спирт (0,5 мл) и триацетин (0,5 мл) добавляли к 10 г мальтодекстрина (Grain Processing Corp., IA), а затем смесь подвергали интенсивному механическому перемешиванию с получением свободнотекучего порошка, имеющего слабый запах или вообще не имеющего запах. Часть этой смеси (1 г) помещали в чашку Петри, после чего обрабатывали раствором AcT (1 м.д.), и менее чем за 5 минут наблюдалось продуцирование бензилацетата с характерным запахом. Контрольную процедуру осуществляли с использованием воды, и менее чем за 1 час какого-либо продуцирования бензилацетата не наблюдалось.

Пример 6

Переэтерификация с использованием АсТ, иммобилизованной в золе-геле с двуокисью кремния

Ацилтрансферазу (АсТ) иммобилизовали в золе-геле с двуокисью кремния и полученную форму сравнивали с растворимой формой фермента на способность продуцировать душистые сложные эфиры в водных условиях.

i) Инкапсуляция AcT в золе-геле

Аликвоту (2,2 мл) смеси (1:1) силиката натрия (27% SiO2, 14% NaOH, Sigma Aldrich Corp., WI) и метилсиликоната натрия (30% в воде, Gelest, NJ), перемешивая, добавляли к фосфорной кислоте (4 мл 1,5 M). Затем добавляли раствор ацилтрансферазы (1 мл 12 мг/мл) и смесь выдерживали при комнатной температуре до образования геля. После этого полученный гель два раза промывали 50 мМ фосфатным буфером, pH 7 (50 мл), и отверждали в течение ночи в герметично закрытом контейнере.

ii) Этерификация цис-3-гексенола

Порцию влажного золя-геля (0,66 г, эквивалентные 1 мг AcT), описанного выше, инкубировали с цис-3-гексенолом (20 мкл) и триацетином (40 мкл) в 50 мМ фосфатно-натриевого буфера, pH 7. Степень превращения цис-3-гексенола в ацетиловый сложный эфир сравнивали со степенью превращения, наблюдаемого для контроля, содержащего растворимую АсТ (0,5 мг AcT). Через 10, 30 и 120 минут, из двух реакционных смесей брали аликвоты (10 мкл) и эти аликвоты анализировали с помощью ГХ/МС. Результаты представлены на фигуре 2.

Хотя очевидно, что иммобилизованный фермент образует ацетиловый сложный эфир (время удерживания - 4,5 минуты) с меньшей скоростью, чем свободный фермент, однако следует отметить, что удаление иммобилизованной формы фермента способствует предотвращению последующего гидролиза душистого сложного эфира, как это наблюдалось для свободного фермента через 30 и 120 минут.

Пример 7

Переэтерификация спирта и душистого сложного эфира с использованием АсТ

Смесь бензилового спирта и цитронеллилацетата (1% об/об каждого) в 50 мМ фосфатно-калиевого буфера, рН 7, обрабатывали AcT (10 м.д.) при комнатной температуре. Через несколько минут наблюдался характерный запах бензилацетата и цитронеллола. Присутствие этих соединений подтверждали с помощью ГХ/МС методом, описанным в примере 1. Результаты этого эксперимента продемонстрировали возможность одновременного продуцирования двух душистых веществ из их предшественников с менее выраженным запахом.

Пример 8

Выделение душистого сложного эфира из ткани, на которой имеются пятна масла

Расплавленное масло (40-50 мг) наносили на 6 образцов трикотажной нетканой хлопчатобумажной ткани (по 250-300 мг на каждый) и эти образцы оставляли для охлаждения до комнатной температуры. Образцы взвешивали, а затем обрабатывали либо LIPOMAX, либо AcT, либо комбинациями двух ферментов (таблица 5). На каждый образец наносили 20 мл 5 мМ буфера HEPES, pH 7, содержащего бензиловый спирт (10 мкл, 0,005% об/об) и фермент(ы). После перемешивания при комнатной температуре в течение 20 минут образцы удаляли, а затем эти образцы были оценены на запах до и после сушки двумя исследователями. После сушки также измеряли общую потерю массы. Результаты систематизированы в таблице 6.

Таблица 5
Степень удаления масла из образцов хлопчатобумажной ткани с пятнами масла
Образец Условия Ткань (масса)
(мг)
Масло (масса)
до сушки
Масло (масса) после сушки % потери массы
1 Контроль 276,6 40,7 39,0 4,2%
2 1 м.д. АсТ
1 м.д. LM
280,5 45,1 37,9 16%
3 1 м.д. только АсТ 289,5 46,6 42,8 8%
4 1 м.д. только LM 271,7 45,3 38,3 15%
5 1 м.д. АсТ
1 м.д. LM
275,4 45,9 39,4 14%
6 1 м.д. АсТ
5 м.д. LM
261,1 47,3 40,7 14%
АсТ = ацилтрансфераза M. smegmatis; LM = липаза LIPOMAXTM
Таблица 6
Степень образования неприятного запаха образцов с масляными пятнами после их обработки ферментом
Образец Запах влажного образца до сушки (n=2) Запах образца после сушки (n=1) Описание запаха после сушки
1 0 -0,5 слегка прогорклый запах
2 +2 -2 сильный прогорклый запах
3 +0,5 -0,5 слегка прогорклый запах
4 -1,5 -2 сильный прогорклый запах
5 +2 -1 легкий фруктовый запах/слегка прогорклый запах
6 +1,5 0 фруктовый запах/прогорклый запах

Пример 9

Определение отношения продукта переэтерификации:гидролиза

Трибутирин (l0 мкл) добавляли к буферу (1 мл), содержащему 4% этанол, и обрабатывали либо AcT, либо KLM3', а также контролем, не содержащим фермента, при 40°С в течение 2 часов. Из каждого образца брали аликвоту (100 мкл), а затем ее разбавляли в дихлорметане (900 мкл) и проводили ЖХ/МС-анализ. Для каждого из условий определяли количество этилбутирата:масляной кислоты и отношение этилбутират:масляная кислота. Контроль не обнаруживал переноса ацила или гидролиза субстрата. АсТ-обработанный образец обнаруживал полный гидролиз трибутирина, а отношение масляная кислота:этилбутират составляло 1:2. KLM3'-обработанный образец обнаруживал лишь частичный гидролиз трибутирина, однако в этом образце отношение масляная кислота:этилбутират составляло 1:5.

Пример 10

Одновременное продуцирование перкислоты и душистого вещества, достигаемое с использованием растворимых и иммобилизованных форм АсТ

Комбинация AcT, триацетина, разбавленного водного пероксида водорода (50-500 м.д.) и бензилового спирта (10-50 м.д.), способствовала продуцированию перуксусной кислоты и душистого бензилацетата.

Раствор бензилового спирта (50 мкл), триацетата глицерина (триацетина, 100 мкл) и пинацианолхлоридного красителя (50 мкл 1 мг/мл в 80% ацетоне) обрабатывали 30% пероксидом водорода (100 мкл) и 75 м.д. раствора ацилтрансферазы (100 мкл). Через 1-2 минуты появлялся характерный приятный запах бензилового спирта. Краситель полностью обесцвечивался через 10 минут. Такой душистый запах в значительной степени подавлял неприятный запах перуксусной кислоты.

Данный эксперимент повторяли с использованием циклогексилметанола (50 мкл), в результате чего наблюдалось обесцвечивание красителя и образование душистого циклогексилметилацетата. Контрольный эксперимент в отсутствиеи АсТ не обнаруживал какого-либо заметного появления душистого запаха или обесцвечивания красителя.

На небольшой образец трикотажной хлопчатобумажной ткани (5 ×5 см) наносили раствор ацилтрансферазы (1 мл 10 м.д.) и этот образец оставляли для сушки. Добавление 1-2 мл раствора бензилового спирта (50 мкл), триацетата глицерина (триацетина, 100 мкл), 30% пероксида водорода (100 мкл) и пинацианолхлоридного красителя (50 мкл 1 мг/мл в 80% ацетоне) приводило к образованию душистого бензилацетата и обесцвечиванию красителя.

Порядок добавления может быть изменен, и в данном случае, на образец ткани может быть нанесено 1-2 мл раствора бензилового спирта (50 мкл), триацетата глицерина (триацетина, 100 мкл) и пинацианолхлоридного красителя (50 мкл 1 мг/мл в 80% ацетоне), а затем образец может быть оставлен для сушки. Последующее добавление AcT (1 мл 10 м.д.) и пероксида водорода (1 мл 3%-ного пероксида водорода) приводило к обесцвечиванию красителя, то есть пурпурный образец становился бесцветным, и к появлению запаха бензилацетата через 10 минут.

Пример 11

Ацилирование полиолов трибутирином в исходном детергенте

А) Эмульсию трибутирина (1% об/об) и тетраэтиленгликоля (1% об/об) в 5 мМ буфера HEPES, pH 7,8, содержащего 1,5 г/л AATCC HDL, получали путем тщательного вихревого перемешивания. Аликвоту (200 мкл) этой смеси 10-кратно разводили путем ее добавления к 1,8 мл 5 мМ буфера HEPES, pH 7,8, содержащего 1,5 г/л AATCC HDL, и, перемешивая, обрабатывали AcT (l0 м.д.) при комнатной температуре. В определенные периоды времени брали небольшие аликвоты (50 мкл) и разводили в 20% водном ацетонитриле, а затем проводили ЖХ/МС-анализ.

ЖХ/МС-анализ осуществляли на ВЭЖХ-системе Surveyor, которая была подсоединена к тройному квадрупольному масс-спектрометру Quantum TSQ (ThermoFisher, San Jose, CA), действующему в позитивном режиме электронапыления (+ESI). Используемая ВЭЖХ-колонка представляла собой колонку Agilent Zorbax SB-Aq Cl8 (100×2,1 мм). Соединения элюировали с использованием градиента: растворитель A (25 мМ формиат аммония в Н2О) с возрастающим количеством растворителя B (90% метанол + 10% растворитель А)→ растворитель A в течение 10 минут.

Сначала наблюдались только два исходных вещества, а именно тетраэтиленгликоль, элюирующийся за 3,9 минуты с m/z=212, и трибутирин, элюирующийся за 6,9 минуты с m/z=320. Оба соединения давали ожидаемые отношения m/z для продуктов присоединения ионов аммония. После добавления фермента AcT наблюдался новый пик, элюирующийся за 5,8 минуты с m/z=282, и этот пик соответствовал монобутириловому сложному эфиру тетраэтиленгликоля (фигура 3). После перемешивания в течение ночи появлялся явный запах масляной кислоты.

B) Описанный выше эксперимент повторяли с использованием глицерина, равномерно меченного 13С (13С-U-глицерина), и трибутирина. Меченный изотопами субстрат позволял идентифицировать глицерин (m/z 110), монобутирин (m/z 180) и дибутирин (m/z 250), полученный из ацильного донора трибутирина, от сложных эфиров масляной кислоты (m/z=183 и 253 для моно- и дибутирина соответственно), образованных в результате ацилирования акцептора меченого глицеринового ацила (m/z=113).

ЖХ/МС-анализ (фигура 4) смеси после инкубирования в течение ночи указывал на образование меченного моно- и дибутирина, а также немеченых аналогов.

Пример 12

Появление приятного запаха от ткани с жирными масляными пятнами в условиях стирки в прачечной

Образцы хлопчатобумажной ткани с жирными масляными пятнами стирали в условиях прачечных в Terg-O-тометре (U. S. Testing, Co. Inc. Hoboken, N.J.) в присутствии липазы и/или ацилтрансферазы (AcT) и спирта-акцептора в целях уменьшения количества свободных короткоцепочечных жирных кислот (C4-C8) и продуцирования сложных эфиров короткоцепочечных жирных кислот с приятным запахом.

Образцы с жирными масляными пятнами (CFT CS-10, Test Fabrics, Inc. West Pittston, PA, USA) (6 на 1-литровый чан Terg) либо не обрабатывали липазой, либо обрабатывали препаратом Lipex (Novozymes)(1,2 м.д.) или Lipomax (Genencor)(2 м.д.) в присутствии или в отсутствие ацилтрансферазы (AcT) (2 м.д.) в стандартном жидком детергенте в жестких условиях (AATCC HDL) (1,5 г/л) в 5 мМ буфера HEPES, при pH 7,8 и жесткости 6 г/г. За 30 минут до стирки при 77°F (~42°С) в каждый чан добавляли бензиловый спирт (1 г/л).

Через 15 и 30 минут из каждого чана брали аликвоту (8 мл) и эту аликвоту экстрагировали гексаном (2 мл). Гексановый слой отделяли от водной эмульсии в центрифуге и 1 мл добавляли в сосуды для газовой хроматографии (ГХ). Этот анализ проводили на ЖХ-МС-устройстве Agilent 6890 с использованием колонки HP-5MS размером 30 м ×0,25 мм (0,25 мкм-пленка). В ЖХ/МС-методе в качестве газа-носителя использовали гелий (l см3/мин), температура входного отверстия для впрыска составляла 250°С, а отношение деления потока составляло 20:1. Программа регуляции температуры в печи включала: выдерживание в течение 1 минуты при 60°С с последующим увеличением температуры до 240°С при 20°С/минуту в течение всей 10-минутной процедуры. Масс-детектор включали через 2 минуты после инжекторного сканирования от 30 до 400 е.а.м.

Результаты ЖХ/МС-анализа представлены на фигуре 5 и ниже в таблице 7. Бензилбутират не детектировался ни в чане с контролем (чан 1), ни в чане с контролем + AcT (чан 2). Оба препарата Lipex и Lipomax, взятые отдельно, продуцировали некоторое количество бензилбутирата, при этом в то же самое время первый препарат продуцировался в большем количестве. Добавление AcT приводило к увеличению количества бензилбутирата, продуцируемого обеими липазами, однако эффект от препарата Lipomax был значительно выше, что позволяет предположить о его сильном синергическом действии.

Таблица 7
Образование бензилбутирата на хлопчатобумажной ткани с жирными масляными пятнами в условиях стирки в прачечной
Бензилбутират (корректирующая зона ГХ)
Условия 15 минут 30 минут
«пустышка» 0 0
контроль 0 0
контроль + АсТ 0 0
Lipex 53000 32000
Lipex + АсТ 77000 59000
Lipomax 0 11000
Lipomax + АсТ 170000 32000

Пример 13

Уменьшение неприятного запаха от ткани с жирными масляными пятнами в условиях стирки в прачечной

После проведения эксперимента со стиркой, описанного в примере 12, образцы хлопчатобумажной ткани сушили в течение ночи и проводили субъективные оценки на наличие неприятного запаха, которые были систематизированы в таблице 8.

Таблица 8
Оценка неприятного запаха после стирки хлопчатобумажной ткани с жирными масляными пятнами
Чан # Условия Комментарии
1 контроль запах масла/нейтральный
2 контроль+АсТ запах масла/нейтральный
3 Lipex прогорклый/гнилостный запах
4 Lipex+АсТ прогорклый/гнилостный запах
5 Lipomax неприятный, но менее неприятный, чем запах образцов в чанах #3 и #4
6 LipomaxAcT слегка неприятный запах, но менее неприятный, чем запах образца в чане #5

Наихудший запах ассоциировался с образцами, обработанными Lipex. Образцы, обработанные Lipomax, имели значительно менее гнилостный запах, хотя этот запах был хуже, чем у контрольных образцов. По сравнению с образцами, обработанными только Lipomax, у образцов, обработанных Lipomax+AcT, наблюдалось заметное уменьшение неприятного запаха.

Пример 14

Применение KLM3' для получения моноолеата сорбита из сорбита и яичного желтка

Липид-ацилтрансферазный мутант KLM3 pLA231 тестировали путем его инкубирования в системе, содержащей яичный желток и сорбит, в течение 4 часов при 40°С.

Продукт реакции экстрагировали органическим растворителем и выделенные липиды анализировали с помощью ВЭТСХ и ГЖХ/МС. Полученные результаты подтвердили способность мутанта KLM3 pLA231 продуцировать моноолеат сорбита из сорбита и яичного желтка.

Специалистам в области производства моющих средств известно, что сорбит может быть использован в различных препаратах. Также известно, что ткани часто имеют жирные пятна, включая пятна от жира/масел и яиц.

Одной из целей данного исследования является анализ эффекта мутанта KLM3 в смеси сорбита и яичного желтка в отношении продуцирования поверхностно-активного вещества, применяемого в качестве чистящего средства.

Материалы и методы

Вариант KLM3 pLA231: мутации W122A, A236E, L31F (активность: 1,6 TIPU/мл).

Сорбит, 70% (Danisco).

Яичный желток: пастеризованный яичный желток от Hedegaard, DK 9560 Hadsund.

Стандартный компонент моноолеат сорбита был получен от Grindsted SMO № 452454.

ВЭТСХ

Аппликатор: аппликатор CAMAG AST4.

ВЭТСХ-пластина: 20×10 см (Merck № 1.05641).

Пластину перед ее использованием активировали путем сушки в печи при 160°С в течение 20-30 минут.

Нанесение: 8,0 мкл экстрагированных липидов, растворенных в смеси хлороформ:метанол (2:1), наносили на ВЭТСХ-пластину с использованием аппликатора AST4.

Рабочий буфер:4: хлороформ:метанол:вода (74:26:4).

Нанесение/время элюирования: 16 минут.

Проявляющая жидкость: 6% ацетат меди в 16% H3PO4.

После элюирования пластину сушили в печи при 160°С в течение 10 минут, охлаждали и погружали в проявляющую жидкость, а затем сушили еще 6 минут при 160°С. Эту пластину визуально оценивали и сканировали (на ТСХ-сканере Camag).

ГЖХ-анализ

Капиллярный газовый хроматограф Perkin Elmer Autosystem 9000, снабженный колонкой с двуокисью кремния WCOT, 12,5 м × 0,25 мм внут. диаметр × пленка толщиной 0,1 мкм, содержащая 5% фенил-метил-силикон (CP Sil 8 CB от Chrompack).

Газ-носитель: гелий.

Инжектор: PSSI-охлажденный инжектор с разделением потока (начальная температура 50°С, доведенная до 385°С), объем 1,0 мкл.

Детектор FID: 395°С

Программа работы печи: 1 2 3
Температура печи, °С 90 280 350
Изотермическая реакция, время, мин 1 0 10
Скорость увеличения температуры, °С/мин 15 4

Приготовление образца: липид, экстрагированый из образцов, растворяли в 0,5 мл смеси гептан:пиридин, 2:1, содержащей внутренний стандарт гептадекан, 0,5 мг/мл. 300 мкл раствора образца переносили в гофрированный сосуд, добавляли 300 мкл MSTFA (N-метил-N-триметилсилилтрифторацетамид) и смесь подвергали реакции в течение 20 минут при 60°С.

Экспериментальная часть

KLM3 pLA231 тестировали в субстрате яичного желтка и сорбита в соответствии с протоколом, описанным в таблице 9.

Таблица 9
Ажурная ткань 2467-112 1 2
Яичный желток г 0,67 0,67
Сорбит, 70% г 0,33 0,33
KLM3, pLA 231, 1 TIPU/мл мл 0,1
Вода мл 0,1

Процедура

Яичный желток и сорбит перемешивали с помощью магнитной мешалки в сосуде из драмского стекла и нагревали до 50°С. Затем добавляли фермент и смесь инкубировали 4 часа при 50°С.

Реакцию прекращали добавлением 7,5 мл смеси хлороформ:метанол, 2:1, и смесь перемешивали на миксере Whirley. Липиды экстрагировали на устройстве Rotamix (25 об/мин) в течение 30 минут и образцы центрифугировали при 700×g в течение 10 минут. 1 мл фазы растворителя брали для проведения ТСХ- и ГЖХ/МС-анализа.

Результаты

ВЭТСХ-анализ липидов образцов 1 и 2 представлен на фигуре 7.

ВЭТСХ-хроматограмма указывала на образование полярного компонента, которым, предположительно, является сложный эфир сорбита.

Для дополнительной идентификации, образцы анализировали с помощью ГЖХ/МС.

ГЖХ-хроматограмма обработанного ферментом образца (1) и контрольного образца (2) представлена на фигурах 8 и 9.

МС-спектры наиболее ярких пиков моноолеата сорбита фигуры 8 представлены на фигуре 10, и эти спектры сравнимы с МС-спектрами моноолеата сорбита.

ВЭТСХ-анализ продуктов реакции показал, что полярный компонент образуется в процессе инкубирования. ГЖХ/МС-анализ подтвердил образование моноолеата сорбита. Моноолеат сорбита представляет собой полярный компонент, обладающий поверхностно-активными свойствами и действующий как поверхностно-активное вещество в водных системах.

Все патенты и публикации, упомянутые в описании настоящего изобретения, являются показателями известных уровней техники, к которым относится настоящее изобретение. Все патенты и публикации вводятся в настоящее описание посредством ссылки так, как если бы каждая отдельная публикация была конкретно и отдельно введена в настоящее описание посредством ссылки.

В соответствии с некоторыми вариантами настоящего изобретения для среднего специалиста в данной области очевидно, что в описанные здесь варианты могут быть внесены различные модификации, и предусматривается, что такие модификации входят в объем настоящего изобретения.

Для специалиста в данной области совершенно очевидно, что настоящее изобретение в достаточной степени адаптировано для достижения упомянутых здесь целей и получения конечных результатов и преимуществ, а также присущих ему признаков. Описанные здесь композиции и способы представляют собой репрезентативные варианты и приводятся лишь в иллюстративных целях, а поэтому они не должны рассматриваться как ограничение объема настоящего изобретения. Для каждого специалиста в данной области совершенно очевидно, что в настоящее изобретение могут быть внесены различные изменения и модификации, не выходящие за рамки существа и объема изобретения.

Настоящее изобретение, описанное здесь в целях иллюстрации, может быть осуществлено в отсутствие любого элемента или элементов, на ограничение или ограничения которых не дается каких-либо конкретных указаний в описании настоящей заявки. Используемые здесь термины и выражения употребляются лишь в описательных целях и не ограничивают объем изобретения, а поэтому их употребление не исключает существование каких-либо эквивалентов, представленных и описанных здесь признаков или их частей, и при этом следует отметить, что в объем заявленной формулы изобретения могут входить различные модификации. Таким образом, следует отметить, что хотя настоящее изобретение конкретно описано со ссылкой на некоторые варианты и необязательные признаки изобретения, однако сами специалисты в данной области могут внести какие-либо модификации и варианты приведенных здесь концепций, но при этом подразумевается, что такие модификации и варианты входят в объем настоящего изобретения, определенный в прилагаемой формуле изобретения.

Настоящее изобретение описано в своем широком смысле и определено видовыми признаками. Каждая группа, включающая более узкий вид и подвид и входящая в общие видовые признаки, также является частью настоящего изобретения. Настоящее изобретение включает видовое описание с условиями или с негативными признаками, исключающими любой объект изобретения из данного вида, независимо от наличия или отсутствия данного объекта в настоящем описании.

1. Композиция для получения душистого сложного эфира, содержащая следующие компоненты:
а) SGNH-ацилтрансферазу,
b) спиртовой субстрат для указанной SGNH-ацилтрансферазы, содержащий 2-10 атомов углерода, и
с) донор ацила, представляющий собой сложноэфирный субстрат, содержащий ацильную цепь из 2-10 атомов углерода,
где спиртовой субстрат и донор ацила в композиции выбирают так, чтобы они продуцировали душистый сложный эфир, и указанная SGNH-ацилтрансфераза катализирует перенос указанной ацильной группы от указанного донора ацила на указанный спиртовой субстрат с образованием душистого сложного эфира в водной среде.

2. Композиция по п.1, где указанной композицией является водная композиция, которая дополнительно содержит указанный душистый сложный эфир.

3. Композиция по п.1, где указанный спиртовой субстрат и указанный донор ацила выбирают так, чтобы они продуцировали конкретный душистый сложный эфир.

4. Композиция по п.1, где указанная SGNH-ацилтрансфераза иммобилизована на твердом носителе.

5. Композиция по п.1, где указанной композицией является дегидратированная композиция, и где указанный душистый сложный эфир образуется после регидратации указанной композиции.

6. Композиция по п.1, где указанная композиция включена в пищевой продукт.

7. Композиция по п.1, где указанной композицией является очищающая композиция, содержащая по меньшей мере одно поверхностно-активное вещество.

8. Композиция по п.1, где указанной композицией является очищающая композиция, содержащая источник пероксида водорода.

9. Способ получения душистого сложного эфира, включающий объединение:
а) SGNH-ацилтрансферазы,
b) спиртового субстрата для указанной SGNH-ацилтрансферазы, содержащего 2-10 атомов углерода, и
с) донора ацила, представляющего собой сложноэфирный субстрат, содержащий ацильную цепь из 2-10 атомов углерода,
в условиях ацилтрансферазной реакции,
где спиртовой субстрат и донор ацила в композиции выбирают так, чтобы они продуцировали душистый сложный эфир, и указанная SGNH-ацилтрансфераза катализирует перенос указанной ацильной группы от указанного донора ацила на указанный спиртовой субстрат с образованием указанного душистого сложного эфира.

10. Способ по п.9, где указанный спиртовой субстрат и указанный донор ацила выбирают так, чтобы они продуцировали конкретный душистый сложный эфир.

11. Способ по п.9, где указанный способ включает регидратацию указанных компонентов после их объединения.

12. Способ по п.11, где указанная регидратация происходит в процессе отверждения.

13. Способ по п.9, где указанная SGNH-ацилтрансфераза, указанный спиртовой субстрат и указанный донор ацила объединяют в водной среде.

14. Способ по п.9, где указанная SGNH-ацилтрансфераза иммобилизована на твердом носителе.

15. Способ одновременного получения отбеливателя, представляющего собой перкислоту, и душистого сложного эфира, включающий объединение:
а) SGNH-ацилтрансферазы,
b) спиртового субстрата для указанной SGNH-ацилтрансферазы, содержащего 2-10 атомов углерода, и
с) донора ацила, представляющего собой сложноэфирный субстрат, содержащий ацильную цепь из 2-10 атомов углерода, и
d) водного раствора пероксида водорода,
в условиях ацилтрансферазной реакции,
где спиртовой субстрат и донор ацила в композиции выбирают так, чтобы они продуцировали душистый сложный эфир, и указанная SGNH-ацилтрансфераза катализирует перенос указанной ацильной группы от указанного донора ацила на указанный спиртовой субстрат с образованием указанного душистого вещества и указанного отбеливателя.

16. Способ по п.15, где указанной перкислотой является перуксусная кислота.

17. Способ по п.15, где указанной SGNH-ацилтрансферазой является ацилтрансфераза M. smegmatis.

18. Способ по п.15, где указанным душистым сложным эфиром является сложный C2-C6-эфир первичного спирта.

19. Способ по п.15, где нанесение указанного отбеливателя на пятно приводит к удалению указанного пятна.



 

Похожие патенты:

Настоящее изобретение относится к области молекулярной биологии и генетической инженерии и может быть использовано в пищевой промышленности. Из нитчатого гриба Mortierella alpina получены новые гены ацилтрансферазы лизофосфатидной кислоты (АТЛК).

Изобретение относится к области биотехнологии и биохимии. Предложено применение композиции, включающей фермент трансглюкозидазу (ЕС 2.4.1.24), для разложения полисахарида природной камеди, причем указанный полисахарид природной камеди является субстратом для указанного фермента трансглюкозидазы.
Изобретение относится к области биохимии. Предложен способ ингибирования активности фермента РНК-полимеразы.

Изобретение относится к области биохимии, в частности к способу синтеза целевого белка с пониженным ксилозилированием, пониженным фукозилированием или их комбинацией.

Изобретение относится к области биотехнологии, а именно к способу продукции требуемого полипептида (варианты), способу получения фармацевтической композиции, клетке СНО для получения требуемого белка, клетке СНО-реципиенту ДНК, кодирующей требуемый полипептид, способу продукции требуемого полипептида.

Изобретение относится к области биотехнологии и молекулярной генетики. .

Изобретение относится к области молекулярной биологии и биохимии и может быть использовано в молекулярной диагностике, связанной с выявлением РНК-мишеней. .

Изобретение относится к пептидным альдегидам с тирозином в качестве C-концевого остатка, которые являются особенно эффективными для стабилизации протеаз типа субтилизина в жидких моющих средствах.

Изобретение относится к области биотехнологии и касается способа мытья посуды. Охарактеризованный способ заключается в обеспечении композиции для мытья посуды и посуды, нуждающейся в очистке, приведении указанной посуды в контакт с указанной композицией для мытья посуды при условиях, эффективно обеспечивающих очистку указанной посуды, где указанная композиция для мытья посуды содержит модифицированный субтилизин, где указанный модифицированный субтилизин, по меньшей мере, на 70% гомологичен последовательности AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR и содержит (i) замену G116V и, по меньшей мере, одну дополнительную мутацию или (ii) замену S126R.

Изобретение относится к области биотехнологии и биохимии. Предложено применение композиции, включающей фермент трансглюкозидазу (ЕС 2.4.1.24), для разложения полисахарида природной камеди, причем указанный полисахарид природной камеди является субстратом для указанного фермента трансглюкозидазы.

Настоящее изобретение относится к области биотехнологии и может быть использовано в производстве композиций, предназначенных для удаления крахмалсодержащих загрязнений.

Настоящее изобретение относится к жидкому моющему составу для мытья посуды ручным способом, содержащему: (a) от 0,001% до 10% по массе катионного полимера и (b) от 0,005% до 3% по массе активного неорганического перламутрового агента, при этом упомянутый неорганический перламутровый агент имеет размер частиц менее 50 мкм, и катионный полимер является солью гидроксиэтилцеллюлозы.
Изобретение относится к областям биохимии и микробиологии. Предложен способ удаления биопленки с поверхности на основе обработки пергидролазой и смесью ферментов, а также соответствующие набор и композиция.

Настоящее изобретение относится к способу очистки посуды вручную жидким моющим составом для мытья посуды ручным способом, включающему этап, на котором наносят указанный состав на указанную посуду, при этом указанный состав содержит: (а) от 6% до 32% по массе анионного поверхностно-активного вещества, содержащего не более чем приблизительно 10% по массе всего состава, сульфонатного поверхностно-активного вещества; (b) от 0,005% до 3% по массе активного перламутрового агента; (с) от 0,01% до 1% по массе модификатора реологии и (d) от 0,01% до 5% по массе катионного полимера, при этом модификатор реологии содержит микроволоконную целлюлозу.

Изобретение относится к области биотехнологии. .

Настоящее изобретение относится к дисперсной отбеливающей композиции, содержащей, в пересчете на общий вес композиции: a) от примерно 15% до примерно 80% кислородсодержащего отбеливателя; b) от примерно 0,01% до примерно 20% поверхностно-активного вещества; c) и от примерно 0,00005% до примерно 0,3% фермента, где указанный фермент: i. проявляет эндо-бета-1,4-глюканазную активность (E.C.3.2.1.4); и ii. проявляет более примерно 80% максимальной активности при pH 9,2 при проведении измерений при 40°C; и iii. не содержит углеводсвязывающего участка (CBM) класса A, и где весовое соотношение доступного кислорода к поверхностно-активному веществу составляет более примерно 0,45. Техническим результатом настоящего изобретения является получение дисперсной отбеливающей композиции на основе пероксидных кислородсодержащих отбеливателей с неожиданно улучшенными частящим действием и показателем отбеливания, а также с повышенной сохранностью тканей. 2 н. и 12 з.п. ф-лы, 3 пр., 1 табл.
Наверх