Потребительские товары с вариантами протеазы



Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы
Потребительские товары с вариантами протеазы

 


Владельцы патента RU 2598717:

ДЗЕ ПРОКТЕР ЭНД ГЭМБЛ КОМПАНИ (US)
ДАНИСКО ЮС ИНК. (US)

Изобретение относится к биохимии. Конкретно к потребительским товарам, содержащим протеазы для холодной воды, и способам получения и применения таких товаров. Описан способ обработки и/или очистки поверхности, предпочтительно поверхности ткани. Вводят в контакт указанную поверхность с составом в водном промывном растворе, при этом указанный состав содержит вспомогательный материал и вариант протеазы. Затем промывают и/или высушивают поверхность, при этом предпочтительно температура водного промывного раствора составляет 5-30°С. Указанный вариант протеазы представляет собой вариант родительской протеазы, с последовательностью указанной родительской протеазы на, по меньшей мере, 90% идентичной аминокислотной последовательности SEQ ID NO: 1. Аминокислотные положения указанного варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN′, показанной в SEQ ID NO: 2. Указанный вариант протеазы содержит мутацию T022R. Изобретение обеспечивает улучшенную очистку, белизну и/или свежесть. 1 н. и 8 з.п. ф-лы, 4 ил., 13 табл., 43 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к потребительским товарам, содержащим протеазы, а также способам получения и использования таких потребительских товаров.

Уровень техники

Производители моющих средств включают протеазы в свои товары, чтобы обеспечить хорошую очистку от пятен (например, крови). Однако, учитывая устойчивость и потребительские тенденции к более низким температурам стирки, оказывается все более трудным обеспечивать потребителю приемлемые преимущества, и остается необходимость в улучшении очистки и профиля свежести этих составов моющих средств для стирки. Изобретатели обнаружили, что дополнительно включив некоторые протеазы в потребительские товары, например, состав моющего средства для стирки, которые могут, с одной стороны, содержать оттеночный агент, растворимый в холодной воде осветлитель, катализатор отбеливания, липазу первого промывания, бактериальную чистящую целлюлазу, неионное поверхностно-активное вещество Guerbet и/или капсулу отдушки, улучшается одно или более из очистки, белизны, восприятия белизны и/или профиля свежести такого потребительского товара.

Сущность изобретения

Настоящее изобретение относится к потребительским товарам, содержащим протеазы, в особенности протеазы для холодной воды, и к способам получения и использования таких товаров. Такие составы обеспечивают улучшенную очистку и свежесть. Такие протеазы получают из родительского фермента, субтилизина, полученного из Bacillus lentus, путем замещения, инсерции и/или делеции одной или более из аминокислот родительских ферментов.

Краткое описание чертежей

ФИГ.1 обеспечивает выравнивание зрелых реперных протеаз, включая Bacillus amyloliquefaciens субтилизин BPN' (SEQ ID NO:2) и B. lentus субтилизин GG36 протеазы (SEQ ID NO:1). Каждое аминокислотное положение каждого варианта протеазы, описанного в данной заявке, в том числе каждый вариант протеазы для холодной воды, пронумеровано в соответствии с нумерацией соответствующего аминокислотного положения в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной на Фигуре 1, как определено выравниванием варианта протеазы аминокислотной последовательности с аминокислотной последовательностью Bacillus amyloliquefaciens субтилизина BPN'.

Фигура 2 демонстрирует pHPLT-GG36 плазмид экспрессии.

Фигура 3 демонстрирует pRA68 плазмид экспрессии.

Фигура 4 демонстрирует pRA96 плазмид экспрессии.

Подробное описание изобретения

Определения

Как используют в данной заявке, «потребительский товар» означает товар для ухода за тканями и для домашнего ухода.

Как используют в данной заявке, термин «товар для ухода за тканями и для домашнего ухода» относится к товарам для ухода за тканями и для домашнего ухода и/или в целом предназначен для использования или потребления в той форме, в которой продается, и который предназначен для обработки тканей, твердых поверхностей и любых других поверхностей, и очистки систем, для ухода и очистки неодушевленных поверхностей, а также товарам для кондиционирования тканей и другим товарам, предназначенным специально для ухода и хранения тканей, и товарам для воздушного ухода, включая, воздушный уход, включая системы освежителей воздуха и доставки ароматизаторов, уход за автомобилем, уход за домашними животными, уход за скотом, личную гигиену, уход за ювелирными изделиями, посудой, кондиционирование тканей (включая смягчение и/или освежение), моющие средства для стирки, добавки для стирки и промывания и/или по уходу, составы предварительной обработки перед очисткой, очищающие средства для очистки и/или обработки твердой поверхности, включая очистители для пола и унитазов, средства для очистки и/или обработки стекол, средства для очистки и/или обработки плитки, средства для очистки и/или обработки керамики, и другие чистящие средства для использования потребителем или учреждениями. В некоторых осуществлениях товары для ухода за тканями и для домашнего ухода приемлемы для использования на ранах и/или коже. «Товар для ухода за тканями и для домашнего ухода» включает товары для использования потребителем или учреждениями. Это определение не включает товары (a) предназначенные для использования для очистки контактных линз, или ультрафильтрационных мембран, или (b) при заживлении ран или для медицинского лечения кожных состояний. Такие товары ухода для за тканями и для домашнего ухода, в общем, предназначены для использования или потребления в той форме, в которой они продаются.

Как используют в данной заявке, термин «состав для очистки и/или обработки» представляет собой подмножество товаров для ухода за тканями и для домашнего ухода. Такие товары включают, но не ограничиваясь приведенным, товары для обработки тканей, твердых поверхностей и любых других поверхностей в области ухода за тканями и домашнего ухода, в том числе, воздушного ухода, включая освежители воздуха и системы доставки ароматизаторов, уход за автомобилем, мытье посуды, кондиционирование тканей (включая смягчение и/или освежение), моющие средства для стирки, добавки для стирки и промывания и/или ухода, средства для очистки и/или обработки твердых поверхностей, включая очистители для пола и унитазов, гранулированные или порошковые универсальные моющие средства или моющие средства «для работы с высокой нагрузкой», особенно чистящие моющие средства; жидкие, гелеобразные или пастообразные универсальные моющие средства, особенно так называемые типы жидкостей «для работы с высокой нагрузкой»; жидкие моющие средства для деликатной стирки; средства для ручного мытья посуды или средства для мытья посуды облегченного типа, особенно средства с высоким вспениванием, средства для мытья посуды в посудомоечных машинах, в том числе различные таблетки, гранулированные, жидкие и промывающие типы для использования в бытовых целях и учреждениях: шампуни для автомобилей или ковров, чистящие средства для ванных комнат, включая очистители для унитазов, а также чистящие вспомогательные вещества, такие как отбеливающие добавки и типы «пятновыводителей-карандашей» или типы для предварительной обработки, товары на подложке, такие как высушивающие листы.

Как используют в данной заявке, термин «состав для очистки и/или обработки ткани и/или твердой поверхности» представляет собой подмножество составов для очисти и обработки, которое включает, если не указано иное, гранулированные или порошковые универсальные или «для работы с высокой нагрузкой» моющие средства, особенно чистящие моющие средства; жидкие, гелеобразные или пастообразные универсальные моющие средства, особенно так называемые «для работы с высокой нагрузкой» типы жидкостей; жидкие моющие средства для деликатной стирки; средства для ручного мытья посуды или средства для мытья посуды облегченного типа, особенно с высоким вспениванием; средства для мытья посуды в посудомоечных машинах, в том числе различные таблетки, гранулированные, жидкие средства и средства для промывания для бытового использования и использования в учреждениях; жидкие средства для очистки и дезинфекции, шампуни для автомобилей или ковров, чистящие средства для ванных комнат, включая очистители для унитазов, товары для кондиционирования тканей, в том числе смягчения и/или освежения, которые могут быть в жидкой, твердой форме и/или форме листового высушивающего средства, а также вспомогательные вещества для очистки, такие как отбеливающие добавки и «пятновыводители-карандаши» или типы для предварительной обработки, товары на подложке, такие, как высушивающие листы. Все такие товары, которые могут быть применимы могут быть в разовой, концентрированной или даже высококонцентрированной форме, даже при условии, что такие товары в определенном аспекте могут быть неводными.

Как используют в данной заявке, термин «вариант протеазы для холодной воды» означает вариант родительской протеазы, где указанная родительская протеазная последовательность на, по меньшей мере, 90%, по меньшей мере, 95%, по меньшей мере, 96%, по меньшей мере, 97%, по меньшей мере, 98%, по меньшей мере, 99%, по меньшей мере, 99, 5% или 100% идентична аминокислотной последовательности SEQ ID NO:1, указанный вариант имеет одну или более следующих характеристик:

a) показатель эффективности по Тестовому методу 2, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере, 2; от 1,1 до приблизительно 10, от 1,1 до приблизительно 8 или даже от 1,1 до приблизительно 5;

b) показатель эффективности по Тестовому методу 3, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере 2; от 1,1 до приблизительно 10, от 1,1 до приблизительно 8 или даже от 1, до приблизительно 5;

c) показатель эффективности по Тестовому методу 4, по меньшей мере, 1,0, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере, 2, от 1,0 до приблизительно 10, от 1, 0 до приблизительно 8 или даже от 1, 0 до приблизительно 5;

d) показатель эффективности по Тестовому методу 6, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере 2; от 1,1 до приблизительно 10, от 1,1 до приблизительно 8 или даже от 1,1 до приблизительно 5, при этом каждое аминокислотное положение пронумеровано в соответствии с нумерацией соответствующего аминокислотного положения в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN'. Предпочтительные протеазы для холодной воды, приемлемые для применения в настоящем изобретении имеют характеристики в соответствии с Тестовым методом 6, как определено в d) выше.

Тестовый метод 2, Тестовый метод 3, Тестовый метод 4 и Тестовый метод 6 ясно описаны ниже в разделе под названием «ТЕСТОВЫЕ МЕТОДЫ».

Как используют в данной заявке, термин «вариант протеазы» означает вариант родительской протеазы, указанная родительская протеазная последовательность на, по меньшей мере, 90%, по меньшей мере, 95%, по меньшей мере, 96%, по меньшей мере, 97%, по меньшей мере, 98%, по меньшей мере, 99%, по меньшей мере, 99,5% или 100% идентична аминокислотной последовательности SEQ ID NO:1, при этом каждое аминокислотное положение пронумеровано в соответствии с нумерацией соответствующего аминокислотного положения в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN'.

Как используют в данной заявке, при использовании в формуле изобретения, единственное число подразумевает, что заявлено или описано как единственное, так и множественное число.

Как используют в данной заявке, термины «включать», «включает» и «включая» предназначены быть неограничивающими.

Как используют в данной заявке, термин «твердый» включает гранулированные, порошкообразные, карандашеобразные и таблеткообразные формы продукта.

Как используют в данной заявке, термин «жидкий» включает жидкие, гелеобразные, пастообразные и газообразные формы продукта.

Как используют в данной заявке, термин «положение» включает ткани, одежду и/или твердые поверхности.

Если не указано иное, все уровни компонентов или составов приведены по отношению к активной части этого компонента или состава, и без примесей, например, остаточных растворителей или побочных продуктов, которые могут присутствовать в коммерчески доступных источниках таких компонентов или составов.

Все процентные содержания и соотношения рассчитываются по массе, если не указано иное. Все процентные содержания и соотношения рассчитываются на основе общего состава, если не указано иное.

Следует понимать, что каждый максимальный количественный предел, указанный в данном описании, включает все нижние количественные пределы, как если бы нижние количественные пределы были специально раскрыты в данной заявке. Каждый минимальный количественный предел, указанный в данном описании, будет включать все высшие количественные пределы, как если бы такие высшие количественные пределы были специально раскрыты в данной заявке. Каждый количественный диапазон, указанный в данном описании, будет включать все более узкие количественные диапазоны, которые попадают в такие более широкие диапазоны, как если бы такие более узкие количественные диапазоны были специально раскрыты в данной заявке.

Потребительские товары

Как описано в данной заявке, потребительские товары, содержащие варианты протеазы, описанные в данной заявке, имеют конкретное применение в чистящей индустрии, например, моющих средствах для стирки и мытья посуды. Эти применения помещают ферменты в различные экологические стрессы. Варианты протеазы, использованные в настоящем изобретении, обеспечивают преимущества по сравнению со многими ферментами, используемыми в настоящее время, в связи, по меньшей мере, отчасти, с их устойчивостью в различных условиях.

Действительно, существует целый ряд условий мытья, включая различные моющие составы, объемы промывных вод, температуры промывных вод и продолжительность мытья, которым подвергаются протеазы, участвующие в мытье. Кроме того, моющие составы, используемые в различных географических зонах, имеют различные концентрации их соответствующих компонентов, присутствующих в промывной воде. Например, европейские моющие средства содержат типично приблизительно 4500-5000 м.д. компонентов моющих средств в промывной воде, в то время как японские моющие средства содержат типично приблизительно 667 м.д. компонентов моющих средств в промывной воде. В Северной Америке, особенно в США, моющие средства содержат типично приблизительно 975 м.д. компонентов моющих средств в промывной воде.

Система с низкой концентрацией моющих средств включает моющие средства, где менее, чем приблизительно 800 м.д. компонентов моющего средства присутствует в промывной воде. Японские моющие средства, типично, считаются системой с низкой концентрацией моющих средств, поскольку они содержат приблизительно 667 м.д. компонентов моющего средства в промывной воде.

Средняя концентрация моющих средств включает моющие средства, где от приблизительно 800 м.д. до приблизительно 2000 м.д. компонентов моющего средства присутствуют в промывной воде. Североамериканские моющие средства, как правило, считаются системами со средними концентрациями моющих средств, поскольку они содержат приблизительно 975 м.д. компонентов моющего средства в промывной воде. Бразилия, типично, содержит приблизительно 1500 м.д. компонентов моющего средства в промывной воде.

Система с высокой концентрацией моющих средств включает моющие средства, где больше, чем приблизительно 2000 м.д. компонентов моющего средства присутствуют в промывной воде. Европейские моющие средства, как правило, считаются системами с высокой концентрацией моющих систем, поскольку они содержат приблизительно 4500-5000 м.д. компонентов моющего средства в промывной воде.

Латиноамериканские моющие средства, как правило, представляют собой фосфатные моющие средства с высоким пенообразованием и ряд моющих средств, используемых в Латинской Америке, может подпадать как под средние, так под и высокие концентрации моющих средств, поскольку они находятся в диапазоне от 1500 м.д. до 6000 м.д. компонентов моющего средства в промывной воде. Как указано выше, Бразилия типично имеет приблизительно 1500 м.д. компонентов моющего средства в промывной воде. Тем не менее, другие географические положения фосфатных моющих средств с высоким ценообразованием, а не только другие страны Латинской Америки, могут иметь системы с высокой концентрацией моющих средств до приблизительно 6000 м.д. компонентов моющего средства, присутствующих в промывной воде.

В свете вышеизложенного, очевидно, что концентрации составов моющих средств в типовых промывных растворах во всем мире варьируются от менее, чем приблизительно 800 м.д. состава моющего средства («географические положения низкой концентрации моющего средства»), например, приблизительно 667 м.д. в Японии, от приблизительно 800 м.д. до приблизительно 2000 м.д. («географические положения средней концентрации моющего средства»), например, от приблизительно 975 м.д. в США и от приблизительно 1500 м.д. в Бразилии до более, чем приблизительно 2000 м.д. («географические положения высокой концентрации моющего средства»), например, от приблизительно 4500 м.д. до приблизительно 5000 м.д. в Европе и приблизительно 6000 м.д. в географических положениях фосфатных моющих средств с высоким пенообразованием.

Концентрации типовых промывных растворов определяют эмпирически. Например, в США, типичная стиральная машина удерживает объем приблизительно 64, 4 л промывного раствора. Соответственно, для того, чтобы получить концентрацию приблизительно 975 м.д. моющего средства в промывном растворе приблизительно 62,79 г состава моющего средства должно быть добавлено к 64, 4 л промывного раствора. Это количество является типичным количеством, которое измеряет в промывной воде потребитель с помощью измерительной чашки, обеспеченной моющим средством.

В качестве дополнительного Примера, различные географические положения используют различные температуры мытья. Температура промывной воды в Японии, типично, меньше, чем в Европе. Например, температура промывной воды в Северной Америке и Японии, типично, составляет от приблизительно 10 до приблизительно 30°C (например, приблизительно 20°C), в то время как температура промывной воды в Европе, типично, составляет от приблизительно 30 до приблизительно 60°C (например, приблизительно 40°C). Тем не менее, в интересах экономии энергии, многие потребители переходят на использование холодной промывной воды. Кроме того, еще в некоторых регионах, холодная вода типично используется для стирки, а также для мытья посуды. В некоторых осуществлениях «холодная промывная вода» в соответствии с настоящим изобретением использует мытье при температурах от приблизительно 10°C до приблизительно 40°C, или от приблизительно 20°C до приблизительно 30°C, или от приблизительно 15°C до приблизительно 25°C, а также все другие комбинации в диапазоне от приблизительно 15°C до приблизительно 35°C, и все диапазоны в пределах от 10°C до 40°C.

В качестве дополнительного Примера, различные географические положения обычно имеют разные жесткости воды. Жесткость воды обычно описываются в терминах гран на галлон смешанных Ca2+/Mg2+. Жесткость является мерой количества кальция (Ca2+) и магния (Mg2+) в воде. Большая часть воды в Соединенных Штатах является жесткой, но степень жесткости меняется. Умеренно жесткая (60-120 м.д.) и жесткая (121-181 м.д.) вода имеет от 60 до 181 миллионных долей (миллионные доли, конвертированные в гран на галлон США, являются м.д. #, разделенными на 17,1, что равно гран на галлон) твердых минералов.

Вода Гран на галлон Миллионные доли
Мягкая Менее, чем 1,0 Менее, чем 17
Слегка жесткая 1,0-3,5 17-60
Умеренно жестка 3,5-7,0 60-120
Жесткая 7,0-10,5 120-180
Очень жесткая Более, чем 10,5 Более, чем 180

Европейская жесткость воды, типично, больше, чем приблизительно 10,5 (например, от приблизительно 10,5 до приблизительно 20,0) гран на галлон смешанных Ca2+/Mg2+ (например, приблизительно 15 гран на галлон смешанных Ca2+/Mg2+). Североамериканская жесткость воды, типично, больше, чем японская жесткость воды, но меньше, чем европейская жесткость воды. Например, североамериканская жесткость воды может составлять от приблизительно 3 до приблизительно 10 гран, от приблизительно 3 до приблизительно 8 гран или приблизительно 6 гран. Японская жесткость воды, типично, ниже, чем североамериканская жесткость воды, как правило, меньше, чем приблизительно 4, например, приблизительно 3 гран за галлон смешанных Ca2+/Mg2+.

Соответственно, в некоторых осуществлениях настоящее изобретение обеспечивает потребительские товары, которые показывают удивительную характеристику мытья в, по меньшей мере, одном наборе условий мытья (например, температура воды, жесткость воды и/или концентрация моющего средства).

В частности, настоящее изобретение включает способ мытья.

В некоторых осуществлениях потребительские товары в соответствии с настоящим изобретением сопоставимы по характеристике мытья с другими потребительскими товарами, содержащими другие протеазы субтилизина. В некоторых осуществлениях потребительские товары в соответствии с настоящим изобретением проявляют повышенную характеристику мытья по сравнению с потребительскими товарами, содержащими протеазы субтилизина, которые в настоящее время коммерчески доступны. Таким образом, в некоторых осуществлениях в соответствии с настоящим изобретением, потребительские товары, содержащие варианты протеазы, предоставленные в данной заявке, проявляют повышенную очистку, что обусловлено, по меньшей мере, частично, повышением окислительной стабильности, повышенной термической стабильностью, повышенными возможностями очистки в различных условиях, и/или повышенной хелаторной стабильностью задействованных ферментов.

Потребительские товары

Во всех своих формах, составы, раскрытые в данной заявке, являются потребительскими товарами.

В одном аспекте, раскрывается состав, содержащий вспомогательный материал и вариант протеазы для холодной воды, при этом указанный состав представляет собой потребительский товар.

Тестовый метод 2, Тестовый метод 3, Тестовый метод 4 и Тестовый метод 6 обсуждены ниже в разделе под названием «ТЕСТОВЫЕ МЕТОДЫ».

В одном аспекте указанного состава, указанный вариант протеазы содержит одну или более, или даже две, или более, или предпочтительно три или более из следующих мутаций X1R, X2S, X2M, X2A, X2R, X2W, X3R, X4R, X4S, X4C, X8A, X9A, X9F, X9W, X10S, X10A, X10H, X10M, X12F, X12R, X14K, X14F, X14Q, X15R, X15F, X16S, X17R, X17M, X17F, X18R, X18K, X20F, X20K, X20R, X22A, X22R, X22Y, X22V, X22Q, X22L, X22W, X23A, X23S, X23F, X24R, X24F, X24W, X24Q, X24H, X24L, X25V, X25F, X25R, X26F, X27L, X27F, X27R, X27V, X28A, X28N, X28E, X29T, X30E, X31F, X33S, X33G, X33D, X34P, X35M, X36T, X36F, X36R, X38L, X38F, X38R, X40N, X40L, X40T, X40W, X40H, X40R, X42I, X43A, X43F, X43I, X43S, X43R, X43M, X43W, X43D, Х45Т, X46R, X48R, X50C, X51W, X51F, X51H, X52F, X52E, X52N, X55Y, X57R, Х59А, X59F, X59R, X60P, X60Q, X60A, X62E, X62Q, X63V, X63M, Х63Т, X63I, X63A, X63S, X63H, X63Q, X63D, X63E, X63P, X64F, Х64Т, Х68А, X68C, X69N, X69T, X69P, X69W, X71G, X72C, X74C, X75A, X75F, Х75Е, X75R, X76D, X78R, X78N, X78I, X79W, X79Q, X81R, X82F, X82T, X82V, X82R, X82M, X85M, X86W, X86L, X86I, X89P, X89T, X89G, X89H, X89L, X89V, X89W, X89F, X89I, X91N, X91F, X92F, X94N, X99F, X99T, Х99Р, X99G, X99M, X100S, X100N, X100Q, X100I, X101A, X101N, X101G, X101T, X101D, X101E, X101P, X101F, X102A, X102T, X102N, X102H, X102E, X103G, X103N, X103D, X103A, X104L, X104I, X104E, X104D, X105T, X105E, X105Q, X106G, X106T, X106E, X106D, X106A, X106V, X106F, X107M, X107F, X108I, X108G, X109M, X111V, X111I, X112V, X112L, X112Q, X114G, X115K, X115R, X116K, X116A, X116L, X117F, X118R, X118I, X119C, X120A, X120F, X120R, X121F, X121E, X123G, X123E, X124S, X128D, X128F, X128L, X128N, X128H, X128M, X128I, X128Q, X129E, X132A, X132E, X138G, X144R, X147L, X148I, X158E, X159D, X159E, X159C, X160D, X166D, X166E, X167W, X175V, X177C, X181A, X182R, X183I, X183D, X183M, X183F, X183R, X185E, X185V, X185I, X186H, X186K, X188E, X188D, X188R, X192H, X192W, X194E, X194V, X194F, X197F, X198L, X198F, X203E, X203C, X208S, X209S, X209N, X209F, X209T, X209E, X209H, X209G, X209L, X210R, X210V, X210L, X211Q, X211R, X212I, X212M, X212F, X213A, X214F, X215N, X215D, X215E, X215H, X215F, X216F, X216A, X217E, X217N, X217D, X218D, X218P, X218E, X224A, X224G, X227I, X230E, X231I, X231C, X232V, X233C, X234F, X235F, X236F, X236N, X236H, X238R, X238K, X238L, X239K, X239G, X239R, X239H, X239T, X239N, X239S, X239F, X240R, X241R, X242L, X242R, X243F, X243R, X244R, X245R, X246S, X248D, X248V, X248I, X248R, X249R, X249T, X250I, X251R, X251S, X252I, X252F, X252R, X252K, X252H, X253I, X253R, X253F, X254C, X256N, X258R, X260V, X260I, X262D, X262H, X263F, X265F, X267V, X267N, X267M, X269I, X269R, X270C, X271I, X271V, X271H, X271M, X271L, X271P, X271A, X271F, X271T, X272F, X272F, X272R, X273F, X273I и X274G.

В предпочтительном аспекте указанного состава, указанный вариант протеазы содержит одну или более, предпочтительно две или предпочтительно три, или более из следующих мутаций X1R, X2S, X4R, X4S, X9A, X10S, X14K, X16S, X17R, X18R, X20R, X22A, X22R, X24R, X24W, X25R, X25V, X26F, X42I, X43R, X43A, X46R, X52F, X52E, X52N, X57R, X59A, X62E, X62Q, X68A, X68C, X71G, X72C, X74C, X75A, X75F, X75R, X76D, X78R, X82R, X86W, X89P, X89T, X89G, X89H, X89I, X89V, X89W, X91N, X94N, X100S, X101A, X101N, X101G, X101D, X103G, X103N, X104L, X104I, X106V, X106G, X108I, X111V, X112V, X115K, X115R, X117F, X1181, X121F, X128D, X128F, X128L, X128N, X129E, X144R, X148I, X158E, X159E, X160D, X166D, X185E, X185I, X186H, X188E, X188D, X197F, X203E, X209S, X209N, X209F, X209T, X209E, X209H, X209G, X210R, X212I, X212F, X214F, X215N, X215D, X215E, X217E, X217N, X224A, X230E, X231I, X236F, X238R, X238K, X239K, X239G, X239R, X239S, X241R, X242R, X242L, X243R, X244R, X248I, X248V, X249R, X250I, X252R, X253R, X262D, X263F, X265F, X267V, X267N, X269I, X269R, X271F, X271I, X271H, X271P, X271T, X271V, X271L и X272F, и необязательно одну или более из следующих мутаций: X103A, X159D, X236H, X245R, X248D и X252K.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующего набора мутаций X022R-X024R, X009A-X271L, X018R-X241R, X018R-X115R, X043R-X249R, X020R-X249R, X004R-X249R, X020R-X024R, X018R-X249R, X009A-X020R, X020R-X241R, X009A-X078R, X020R-X115R, X018R-X024R, X024R-X242R, X022R-X115R, X018R-X043R, X020R-X043R, X018R-X242R, X242R-X269R, X018R-X244R, X024R-X269R, X020R-X271L, X024R-X271L, X004R-X009A, X020R-X269R, X001R-X024R, X244R-X271L, X009A-X018R, X241R-X271L, X004R-X024R, X009A-X249R, X009A-X022R, X062E-Х129Е, X062E-X159E, X016S-X148I, X158E-X249R, X016S-X062E, X111V-X188D, X022A-X062E, X062E-X148I, X022A-X129E, X062E-X271F, X062E-Х158Е, X016S-X159E, X062E-X186H, X128N-X159E, X062E-X188D, X062E-X128N, X148I-X159E, X103G-X158E, X111V-X159E, X158E-X271F, X016S-X188D, X022A-X111V, X128N-X158E, X016S-X158E, X104L-X158E, X128N-X186H, X159E-X209E, X062E-X101A, X111V-X209E, X148I-X188D, X101A-X209E, X022A-X188D, X016S-X022A, X128N-X129E, X016S-X209E, X016S-X128N, X022A-X089P, X128N-X209E, X089P-X158E, X062E-X103G, X186H-X271F, X016S-X129E, X089P-Х159Е, X111V-X249R, X101A-X129E, X148I-X209E, X022A-X159E, X129E-X249R, X129E-X209E, X104L-X129E, X128N-X188D, X111V-X158E, X022A-Х158Е, X062E-X209E, X062E-X249R, X101A-X186H, X089P-X129E, X129E-X271F, X22A-X111V-X159E, X101A-X103G-X104L-X209E, X101A-X103G-X104L-X159E, X101A-X103G-X104L-X188D, X101G-X103A-X104I-X159D, X22A-X103G-X159E, X22A-X128N-X271F-X209E, Х22А-Х209Е-X271F, Х22А-Х101А-Х209Е, X101A-X209E-X271F, X22A-X111V-X128N, X22A-X101A-X159E, X101A-X103G-X104L, X22A-X101A-X103G-X104L, X101A-X103G-X104L, X101G-X103A-X104I, X101A-X103G-X104L-X128N, X103A-X104I-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X104I-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X103A-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X103A-X104L-, X232V-X236H-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X236H-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X245R-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X245R-X248D, X62E-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X62E-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X249R, X22A-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X249R, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X24R, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X253R, X101G-X103A-X104I-X158E-X232V-X245R-X248D-X249R, X22A-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X159E-X232V-X245R-X248D-X249R, X101G-X103A-X1041-X159D-X232V-X245R-X248D-X238R, X101G-X103A-X104I-X158E-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X159D-X232V-X245R-X248D, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X76D и X101G-X103A-X104I-X159E-X232V-X245R-X248D-X271F.

В одном аспекте указанного состава, указанный вариант протеазы содержит всего три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций, предпочтительно три или четыре, наиболее предпочтительно три мутации, выбранные из: X1R, X2S, X2M, X2A, X2R, X2W, X3R, X4R, X4S, X4C, X8A, X9A, X9F, X9W, X10S, X10A, X10H, X10M, X12F, X12R, X14K, X14F, X14Q, X15R, X15F, X16S, X17R, X17M, X17F, X18R, X18K, X20F, X20K, X20R, X22A, X22R, X22Y, X22V, X22Q, X22L, X22W, X23A, X23S, X23F, X24R, X24F, X24W, X24Q, X24H, X24L, X25V, X25F, X25R, X26F, X27L, X27F, X27R, X27V, X28A, X28N, X28E, X29T, ХЗОЕ, X31F, X33S, X33G, X33D, X34P, X35M, X36T, X36F, X36R, X38L, X38F, X38R, X40N, X40L, X40T, X40W, X40H, X40R, X42I, X43A, X43F, X43I, X43S, X43R, X43M, X43W, X43D, X45T, X46R, X48R, X50C, X51W, X51F, X51H, X52F, X52E, X52N, X55Y, X57R, X59A, X59F, X59R, X60P, X60Q, X60A, X62E, X62Q, X63V, X63M, X63T, X63I, X63A, X63S, X63H, X63Q, X63D, X63E, X63P, X64F, X64T, X68A, X68C, X69N, X69T, X69P, X69W, X71G, X72C, X74C, X75A, X75F, X75E, X75R, X76D, X78R, X78N, X78I, X79W, X79Q, X81R, X82F, X82T, X82V, X82R, X82M, X85M, X86W, X86L, X86I, X89P, X89T, X89G, X89H, X89L, X89V, X89W, X89F, X89I, X91N, X91F, X92F, X94N, X99F, X99T, X99P, X99G, Х99М, X100S, X100N, X100Q, X100I, X101A, X101N, X101G, X101T, X101D, X101E, X101P, X101F, X102A, X102T, X102N, X102H, X102E, X103G, X103N, X103D, X103A, X104L, X104I, X104E, X104D, X105T, X105E, X105Q, X106G, X106T, X106E, X106D, X106A, X106V, X106F, X107M, X107F, X108I, X108G, X109M, X111V, X111I, X112V, X112L, X112Q, X114G, X115K, X115R, X116K, X116A, X116L, X117F, X118R, XI18I, X119C, X120A, X120F, X120R, X121F, X121E, X123G, X123E, X124S, X128D, X128F, X128L, X128N, X128H, X128M, X128I, X128Q, X129E, X132A, X132E, X138G, X144R, X147L, X148I, X158E, X159D, X159E, X159C, X160D, X166D, X166E, X167W, X175V, Х177С, Х181А, X182R, X183I, X183D, X183M, X183F, X183R, X185E, X185V, X185I, X186H, X186K, X188E, X188D, X188R, X192H, X192W, X194E, X194V, X194F, X197F, X198L, X198F, X203E, X203C, X208S, X209S, X209N, X209F, X209T, X209E, X209H, X209G, X209L, X210R, X210V, X210L, X211Q, X211R, X212I, X212M, X212F, X213A, X214F, X215N, X215D, X215E, X215H, X215F, X216F, X216A, X217E, X217N, X217D, X218D, X218P, X218E, X224A, X224G, X227I, X230E, X231I, Х231С, X232V, X233C, X234F, X235F, X236F, X236N, X236H, X238R, X238K, X238L, X239K, X239G, X239R, X239H, X239T, X239N, X239S, X239F, X240R, X241R, X242L, X242R, X243F, X243R, X244R, X245R, X246S, X248D, X248V, X248I, X248R, X249R, X249T, X250I, X251R, X251S, X252I, X252F, X252R, X252K, X252H, X253I, X253R, X253F, X254C, X256N, X258R, X260V, X260I, X262D, X262H, X263F, X265F, X267V, X267N, X267M, X269I, X269R, X270C, X271I, X271V, X271H, X271M, X271L, X271P, Х271А, X271F, Х271Т, X272F, X272F, X272R, X273F, X273I и X274G.

В предпочтительном аспекте указанного состава, указанный вариант протеазы содержит всего три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций, предпочтительно три или четыре, наиболее предпочтительно три мутации, выбранные из: X1R, X2S, V4R, V4S, X9A, X10S, X14K, X16S, H17R, X18R, X20R, X22A, X22R, X24R, X24W, X25R, X25V, X26F, X42I, X43R, X43A, G46R, X52F, X52E, X52N, T57R, Q59A, X62E, X62Q, X68A, X68C, X71G, X72C, X74C, X75A, X75F, X75R, X76D, X78R, L82R, P86W, X89P, X89T, X89G, X89H, X89I, X89V, X89W, X91N, X94N, X100S, X101A, X101N, X101G, X101D, X103G, X103N, X104L, X104I, X106V, X106G, X108I, X111V, X112V, X115K, X115R, X117F, X118I, X121F, X128D, X128F, X128L, X128N, X129E, X144R, X148I, X158E, X159E, X160D, X166D, X185E, X185I, X186H, X188E, X188D,D197F, X203E, X209S, X209N, X209F, X209T, X209E, X209H, X209G, X210R, X212I, X212F, X214F, X215N, X215D, X215E, X217E, X217N, X224A, X230E, X231I, X236F, X238R, X238K, X239K, X239G, X239R, X239S, X241R, X242R, X242L, X243R, X244R, X248I, X248V, X249R, X250I, X252R, X253R, X262D, X263F, X265F, X267V, X267N, X269I, X269R, X271F, X271I, X271H, X271P, X271T, X271V, X271L и X272F; и необязательно одну или более из следующих мутаций: X103A, X159D, X236H, X245R, X248D и X252K.

В одном аспекте указанного состава, указанный вариант протеазы содержит:

а) две или более из следующих мутаций: X1R, X2S, V4R, V4S, X9A, X10S, X14K, X16S, X22A, X22R, X24R, X25V, X26F, X42I, X52F, X52E, X52N, X62E, X62Q, X68A, Х68С, X71G, X72C, X74C, X75A, X75F, X78R, X89P, X89T, X89G, X89H, X89W, X91N, X94N, X100S, X101A, X101N, X101G, X101D, X103G, X103N, X104L, X104I, X108I, X111V, X112V, X115K, X117F, X121F, X128D, X128F, X128L, X128N, X129E, X148I, X158E, X159E, X160D, X166D, X185E, X186H, X188E, X188D, X203E, X209S, X209N, X209F, X209T, X209E, X209H, X209G, X210R, X212I, X212F, X214F, X215N, X215D, X215E, X217E, X217N, X224A, X230E, X231I, X236F, X238R, X238K, X239K, X239G, X239R, X248V, X249R, X250I, X262D, X263F, X265F, X267V, X267N, X269I, X269R, X271F, X271I, X271H и X272F; и/или

b) один или более из следующих наборов мутаций: Х062Е-Х129Е, X062E-X159E, X016S-X148I, X158E-X249R, X016S-X062E, X111V-X188D, X022A-X062E, X062E-X148I, X022A-X129E, X062E-X271F, Х062Е-X158E, X016S-X159E, X062E-X186H, X128N-X159E, X062E-X188D, X062E-X128N, X148I-X159E, X103G-X158E, X111V-X159E, X158E-X271F, X016S-X188D, X022A-X111V, X128N-X158E, X016S-X158E, X104L-X158E, X128N-X186H, X159E-X209E, X062E-X101A, X111V-X209E, X148I-X188D, Х101А-X209E, X022A-X188D, X016S-X022A, X128N-X129E, X016S-X209E, X016S-X128N, X022A-X089P, X128N-X209E, X089P-X158E, X062E-X103G, X186H-X271F, X016S-X129E, X089P-X159E, X111V-X249R, Х101А-X129E, X148I-X209E, X022A-X159E, X129E-X249R, X129E-X209E, X104L-X129E, X128N-X188D, X111V-X158E, X022A-X158E, X062E-X209E, X062E-X249R, Х101А-X186H, X089P-X129E, X129E-X271F, X22A-X111V-X159E, X101A-X103G-X104L-X209E, X101A-X103G-X104L-X159E, X101A-X103G-X104L-X188D, X101G-X103A-X104I-X159D, X22A-X103G-X159E, X22A-X128N-X271F-X209E, X22A-X209E-X271F, Х22А-Х101А-Х209Е, X101A-X209E-X271F, X22A-X111V-X128N, Х22А-Х101А-X159E, X101A-X103G-X104L, X22A-X101A-X103G-X104L, X101A-X103G-X104L, X101G-X103A-X104I, X101A-X103G-X104L-X128N, X103A-X104I-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X104I-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X103A-X159D-X232V-X236H-X245R-X248D-X252K, X101G-X103A-X104L-X232V-X236H-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X236H-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X245R-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X248D-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X245R-X252K, X101G-X103A-X104L-X159D-X232V-X236H-X245R-X248D, Х62Е-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X62E-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X249R, Х22А-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X249R, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X24R, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X253R, X101G-X103A-X104I-X15 8Е-X232V-X245R-X248D-X249R, Х22А-X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X101G-X103A-X1041-X159E-X232V-X245R-X248D-X249R, X101G-X103A-X1041-X159D-X232V-X245R-X248D-X238R, X101G-X103A-X104I-X158E-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X159D-X232V-X245R-X248D, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X76D и X101G-X103A-X104I-X159E-X232V-X245R-X248D-X271F; указанный вариант имеет общий суммарный заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, относительно В. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1. Эти варианты протеазы могут быть особо предпочтительными в водном промывном растворе с низкой ионной силой или низкими концентрациями моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит:

a) две или более из следующих мутаций X4R, X17R, X18R, X20R, X22R, X24R, X24W, X25R, X43R, X43A, X46R, X52F, X52N, X57R, X59A, X62Q, X71G, X75R, X76D, X78R, X82R, X86W, X89P, X89W, X89T, X89I, X89H, X89V, X104L, X106V, X106G, X115R, X118I, X121F, X144R, X185I, X197F, X209N, X209S, X217E, X231I, X239R, X239S, X241R, X242R, X242L, X243R, X244R, X248I, X249R, X252R, X253R, X271T, X271V, X271L, X271H, X271F, X271P, X1R, X9A, X212F и X269R; и/или

b) один или более, из следующих наборов мутаций X022R-X024R, X009A-X271L, X018R-X241R, X018R-X115R, X043R-X249R, X020R-X249R, X004R-X249R, X020R-X024R, X018R-X249R, X009A-X020R, X020R-X241R, X009A-X078R, X020R-X115R, X018R-X024R, X024R-X242R, X022R-X115R, X018R-X043R, X020R-X043R, X018R-X242R, X242R-X269R, X018R-X244R, X024R-X269R, X020R-X271L, X024R-X271L, X004R-X009A, X020R-X269R, X001R-X024R, X244R-X271L, X009A-X018R, X241R-X271L, X004R-X024R, X009A-X249R, X009A-X022R, X101G-X103A-X104I-X159D-X232V-X245R-X248D-X271F, X101G-X103A-X104I-X158E-X232V-X245R-X248D-X271F, X101G-X103A-X1041-X158E-X232V-X245R-X248D-X249R, X101G-X103A-X1041-X159D-X232V-X245R-X248D-X24R, X101G-X103A-X104L-X159D-X232V-X236H-X245R-X252K, X101G-X103A-X104L-X232V-X236H-X245R-X248D-X252K; указанный вариант протеазы имеет общий суммарный заряд 0, +1, +2, +3, +4 или +5, предпочтительно имеет положительный общий суммарный заряд, наиболее предпочтительно +1, +2 или +3, относительно B. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1. Эти варианты протеазы могут быть особо предпочтительными в водном промывном растворе с высокой ионной силой или высокими концентрациями моющих средств.

В одном аспекте, указанная родительская протеаза может быть выбрана из группы, состоящей из ферментов, коммерчески доступных под торговыми марками Savinase®, Polarzyme®, Kannase®, Liquanase®, Liquanase Ultra®, Savinase Ultra®, Ovozyme® от Novozymes A/S (Denmark), тех, которые продают под торговыми марками Maxacal®, Properase®, Purafect®, FN3®, FN4®, Excellase® и Purafect ОХР® от Genencor International и тех, которые доступны от Henkel/Kemira, а именно BLAP(последовательность показана на Фигуре 29 патента США 5, 352, 604 со следующими мутациями S99D+S101R+S103A+V104I+G159S, в данной заявке имеет название BLAP) и BLAPX(BLAPcS3T+V4I+V205I).

В одном аспекте указанного состава указанный состав содержит вариант протеазы (например, вариант субтилизина), родитель которого имеет протеолитическую активность, указанный вариант протеазы содержит аминокислотную последовательность, которая отличается от аминокислотной последовательности, показанной в SEQ ID NO:1 на не более, чем 50, не более, чем 40, не более, чем 35, не более, чем 30, не более, чем 25, не более, чем 20, не более, чем 19, не более, чем 18, не более, чем 17, не более, чем 16, не более, чем 15, не более, чем 14, не более, чем 13, не более, чем 12, не более, чем 11, не более, чем 10, не более, чем 9, или не более, чем 8 аминокислотных остатков, при этом аминокислотные положения пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью, при этом вариант субтилизина содержит один из следующих наборов замещений:

(a) X101G-X103A-X104I-X159D-X232V-X236H-X245R-X248D-X252K; или

(b) X87N; или

(c) X87N-S101G-V104N; или

(d) X76D, X103A-X104L; или

(e) Y167A-R170S-A194P; или

(f) X87N-G118V-X129Q-X130A.

В одном аспекте указанного состава, указанный вспомогательный материал может содержать ингредиент, выбранный из группы, состоящей из: инкапсулята, содержащего отдушку, оттеночный агент, поверхностно-активные вещества, структурообразователи, хелатирующие агенты, агенты, ингибирующие перенос красителя, диспергаторы, дополнительные ферменты, стабилизаторы ферментов, каталитические материалы, активаторы отбеливания, перекись водорода, источники перекиси водорода, предварительно сформированные перкислоты, полимерные диспергирующие агенты, агенты, удаляющие загрязнения и глину/ агенты против повторных отложений, осветлители, подавители ценообразования, красители, отдушки, эластификаторы структуры, смягчители ткани, носители, гидротропные агенты, технологические добавки, растворители, пигменты и их смеси.

В одном аспекте указанного состава, указанный состав может содержать вспомогательный материал, выбранный из группы, состоящей из:

a) инкапсулятов отдушки;

b) оттеночных агентов для тканей;

c) растворимых в холодной воде осветлителей;

d) катализатора отбеливания, который может включать металлический катализатор, такой, как катализатор переходных металлов, или более предпочтительно, материал, выбранный из группы, состоящей из иминий катионов, иминий полиинов; иминий цвиттерионов; модифицированных аминов; модифицированных аминоксидов; N-сульфонилиминов; N-фосфонилиминов; N-ацилиминов; тиадиазолдиоксидов; перфториминов; циклических сахарных кетонов и их смеси;

e) липаз первого промывания;

f) бактериальных чистящих целлюлаз;

g) неионных поверхносто-активных веществ Guerbet; и h) их смесей.

В одном аспекте указанного состава, указанный вариант протеазы содержит одну или более, или даже две или более из следующих мутаций A001R, Q002S, Q002M, Q002A, Q002R, Q002W, S003R, V004R, V004S, V004C, I008A, S009A, S009F, S009W, R010S, R010A ,R010H, R010M, Q012F, Q012R, P014K, P014F, P014Q, A015R, A015F, A016S, H017R, Н017М, H017F, N018R, N018K, G020F, G020K, G020R, T022A, T022R, T022Y, T022V, T022Q, T022L, T022W, G023A, G023S, G023F, S024R, S024F, S024W, S024Q, S024H, S024L, G025V, G025F, G025R, V026F, K027L, K027F, K027R, K027V, V028A, V028N, V028E, A029T, V030E, L031F, T033S, T033G, T033D, G034P, I035M, S036T, S036F, S036R, T038L, T038F, T038R, P040N, P040L, P040T, P040W, P040H, P040R, L042I, N043A, N043F, N043I, N043S, N043R, N043M, N043W, N043D, R045T, G046R, A048R, F050C, V051W, V051F, V051H, P052F, P052E, P052N, P055Y, T057R, Q059A, Q059F, Q059R, D060P, D060Q, D060A, N062E, N062Q, G063V, G063M, G063T, G063I, G063A, G063S, G063H, G063Q, G063D, G063E, G063P, H064F, H064T, V068A, V068C, A069N, A069T, A069P, A069W, T071G, I072C, A074C, L075A, L075F, L075E, L075R, N076D, S078R, S078N, S078I, I079W, I079Q, V081R, L082F, L082T, L082V, L082R, L082M, A085M, P086W, P086L, P086I, E089P, E089T, E089G, E089H, E089L, E089V, E089W, E089F, E089I, Y091N, Y091F, A092F, K094N, S099F, S099T, S099P, S099G, S099M, G100S, G100N, G100Q, G100I, S101A, S101N, S101G, S101T, S101D, S101E, S101P, S101F, G102A, G102T, G102N, G102H, G102E, S103G, S103N, S103D, S103A, V104L, V104I, V104E, V104D, S105T, S105E, S105Q, S106G, S106T, S106E, S106D, S106A, S106V, S106F, I107M, I107F, A108I, A108G, Q109M, L111V, L111I, E112V, E112L, E112Q, A114G, G115K, G115R, N116K, N116A, N116L, N117F, G118R, G118I, M119C, H120A, H120F, H120R, V121F, V121E, N123G, N123E, L124S, S128D, S128F, S128L, S128N, S128H, S128M, S128I, S128Q, P129E, S132A, S132E, A138G, S144R, V147L, L148I, A158E, G159D, G159E, G159C, S160D, S166D, S166E, Y167W, M175V, V177C, D181A, Q182R, N183I, N183D, N183M, N183F, N183R, N185E, N185V, N185I, R186H, R186K, S188E, S188D, S188R, Y192H, Y192W, A194E, A194V, A194F, D197F, I198L, I198F, V203E, V203C, T208S, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, Y209L, P210R, P210V, P210L, G211Q, G211R, S212I, S212M, S212F, T213A, Y214F, A215N, A215D, A215E, A215H, A215F, S216F, S216A, L217E, L217N, L217D, N218D, N218P, N218E, T224A, T224G, V227I, A230E, A231I, A231C, A232V, L233C, V234F, K235F, Q236F, Q236N, Q236H, N238R, N238K, N238L, P239K, P239G, P239R, P239H, P239T, P239N, P239S, P239F, S240R, W241R, S242L, S242R, N243F, N243R, V244R, Q245R, I246S, N248D, N248V, N2481, N248R, H249R, H249T, L250I, K251R, K251S, N2521, N252F, N252R, N252K, N252H, T253I, T253R, T253F, A254C, S256N, G258R, T260V, T260I, L262D, L262H, Y263F, S265F, L267V, L267N, L267M, N269I, N269R, A270C, E271I, E271V, E271H, E271M, E271L, E271P, E271A, E271F, E271T, A272F, A272F, A272R, A273F, A273I и T274G.

В предпочтительном аспекте состава, указанный вариант протеазы содержит одну или более, или даже две или более из следующих мутаций A1R, Q2S, V4R, V4S, S9A, R10S, P14K, A16S, H17R, N18R, G20R, T22A, T22R, S24R, S24W, G25R, G25V, V26F, L42I, N43R, N43A, G46R, P52F, Р52Е, P52N, T57R, Q59A, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, L75R, N76D, S78R, L82R, P86W, Е89Р, Е89Т, E89G, E89H, E89I, E89V, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, S106V, S106G, A108I, L111V, E112V, G115K, G115R, N117F, G118I, V121F, S128D, S128F, S128L, S128N, P129E, S144R, L148I, A158E, G159E, S160D, S166D, N185E, N185I, R186H, S188E, S188D, D197F, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N2481, N248V, H249R, L250I, N252R, T253R, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H, E271P, E271T, E271V, E271L и A272F, и необязательно одну или более из следующих мутаций: S103A, G159D, Q236H, Q245R, N248D и N252K.

В предпочтительном аспекте настоящего изобретения, представлен состав, содержащий вспомогательный материал и вариант протеазы, при этом указанный вариант протеазы содержит один или более из следующих наборов мутаций: G020R-N043R, N062E-A158E, S103G-A158E, S128N-A158E, A016S-A158E, V104L-A158E, E089P-A158E, L111V-A158E, Т022А-A158E, S101A-A158E, L148I-A158E, P129E-A158E, T022A-E089P, A016S-E089P, N062E-E089P, N062E-E271F, A158E-E271F,R186H-E271F, P129E-E271F, L111V-E271F, Y209E-E271F, A016S-E271F, S188D-E271F, T022A-E271F, G159E-E271F, V104L-E271F, S101A-E271F, E089P-E271F, S128N-E271F, S103G-E271F, L148I-E271F, H249R-E271F, N062E-G159E, A016S-G159E, S128N-G159E, L148I-G159E, L111V-G159E, E089P-G159E, T022A-G159E, P129E-G159E, S103G-G159E, V104L-G159E, A158E-G159E, S101A-G159E, A158E-H249R, L111V-H249R, P129E-H249R, N062E-H249R, A016S-H249R, R186H-H249R, L148I-H249R, G159E-H249R, S101A-H249R, S188D-H249R, V104L-H249R, Y209E-H249R, T022A-H249R, S128N-H249R, S103G-H249R, E089P-H249R, T022A-L111V, S101A-L111V, A016S-L111V, V104L-L111V, N062E-L111V, S103G-L111V, E089P-L111V, A016S-L148I, N062E-L148I, T022A-L148I, P129E-L148I, V104L-L148I, S103G-L148I, S128N-L148I, S101A-L148I, E089P-L148I, L111V-L148I, A016S-N062E, T022A-N062E, N062E-P129E, T022A-P129E, S128N-P129E, A016S-P129E, S101A-P129E, V104L-P129E, E089P-P129E, S103G-P129E, L111V-P129E, N062E-R186H, S128N-R186H, S101A-R186H, T022A-R186H, A016S-R186H, A158E-R186H, E089P-R186H, P129E-R186H, G159E-R186H, S103G-R186H, V104L-R186H, L111V-R186H, L148I-R186H, N062E-S101A, T022A-S101A, A016S-S101A, E089P-S101A, N062E-S103G, T022A-S103G, A016S-S103G, S101A-S103G, E089P-S103G, N062E-S128N, A016S-S128N, T022A-S128N, S101A-S128N, V104L-S128N, E089P-S128N, S103G-S128N, L111V-S128N, L111V-S188D, N062E-S188D, A016S-S188D, L148I-S188D, T022A-S188D, S128N-S188D, S101A-S188D, V104L-S188D, E089P-S188D, P129E-S188D, G159E-S188D, R186H-S188D, S103G-S188D, A158E-S188D, A016S-T022A, A016S-V104L, T022A-V104L, S101A-V104L, N062E-V104L, S103G-V104L, E089P-V104L, G159E-Y209E, L111V-Y209E, S101A-Y209E, A016S-Y209E, S128N-Y209E, L148I-Y209E, P129E-Y209E, N062E-Y209E, T022A-Y209E, S103G-Y209E, A158E-Y209E, S188D-Y209E, V104L-Y209E, E089P-Y209E, R186H-Y209E, N018R-W241R, G020R-W241R, S024R-W241R, S009A-W241R, G020R-W241R, V004R-W241R, N043R-W241R, S078R-W241R, T022R-W241R, G115R-W241R, A001R-W241R, S212F-W241R, L082R-W241R, N018R-V244R, S024R-V244R, S078R-V244R, G020R-V244R, S212F-V244R, S009A-V244R, L082R-V244R, A001R-V244R, N043R-V244R, T022R-V244R, V004R-V244R, G115R-V244R, W241R-V244R, S242R-V244R, A001R-V004R, S009A-T022R, N018R-T022R, G020R-T022R, V004R-T022R, A001R-T022R, S024R-S242R, N018R-S242R, V004R-S242R, G020R-S242R, S212F-S242R, L082R-S242R, S078R-S242R, A001R-S242R, S009A-S242R, T022R-S242R, G115R-S242R, N043R-S242R, W241R-S242R, N018R-S212F, T022R-S212F, V004R-S212F, S024R-S212F, A001R-S212F, G115R-S212F, G020R-S212F, S009A-S212F, N043R-S212F, S078R-S212F, L082R-S212F, S009A-S078R, G020R-S078R, S024R-S078R, T022R-S078R, N018R-S078R, V004R-S078R, A001R-S078R, N043R-S078R, T022R-S024R, G020R-S024R, N018R-S024R, A001R-S024R, V004R-S024R, S009A-S024R, V004R-S009A, A001R-S009A, S242R-N269R, S024R-N269R, G020R-N269R, T022R-N269R, H249R-N269R, S212F-N269R, N043R-N269R, V244R-N269R, A001R-N269R, N018R-N269R, S078R-N269R, S009A-N269R, G115R-N269R, W241R-N269R, V004R-N269R, L082R-N269R, N018R-N043R, G020R-N043R, V004R-N043R, T022R-N043R, S009A-N043R, A001R-N043R, S024R-N043R, S009A-N018R, V004R-N018R, A001R-N018R, S024R-L082R, S009A-L082R, N018R-L082R, A001R-L082R, S078R-L082R, G020R-L082R, T022R-L082R, V004R-L082R, N043R-L082R, N043R-H249R, G020R-H249R, V004R-H249R, N018R-H249R, S009A-H249R, S212F-H249R, T022R-H249R, S024R-H249R, G115R-H249R, A001R-H249R, L082R-H249R, S242R-H249R, W241R-H249R, V244R-H249R, S078R-H249R, N018R-G115R, G020R-G115R, T022R-G115R, S078R-G115R, S009A-G115R, V004R-G115R, A001R-G115R, L082R-G115R, N043R-G115R, S024R-G115R, S009A-G020R, N018R-G020R, V004R-G020R, A001R-G020R, S009A-E271L, G020R-E271L, S024R-E271L, V244R-E271L, W241R-E271L, N043R-E271L, T022R-E271L, H249R-E271L, S212F-E271L, G115R-E271L, S242R-E271L, S078R-E271L, V004R-E271L, N269R-E271L, A001R-E271L, N018R-E271L и L082R-E271L, G020K-N062E, S024F-N116L, G020K-S024F, S024R-A174T, S024R-G118R, S024R-K235F, S024R-P086R, S024R-P086W, S078R-G118R, T033S-G118R, T033S-K235F, Y209A-W241R, G020R-N076D, N018R-Q245R, S024R-R045T, A232V-Q245R, G118R-A172V, G118R-A194T, I008T-S024R, K235F-N243F, N018R-S103A, N018R-V104I, P086W-G118R, P086W-N243F, P086W-Y209A, S024C-T033S, S024R-A232V, S024R-N243F, S024R-P239Q, S024R-S101G, S024R-S141G, S024R-T033S, S024R-T274I, S024R-Y209A, S078R-P086W, S101G-A232V, T033S-L148F, T033S-P086W, T033S-P201S, T033S-S078R, T033S-W241R, T033S-Y209A, A230E-H249R, A232V-H249R, G118R-K235F, N076D-Q245R, P086W-K235F, S024R-R247H, S024R-V104A, S078R-K235F, S101G-H249R, S103A-A232V, T033S-A048T, T033S-P239T, T033S-T253A, T143A-Y209A, Y209A-K235F, N018R-R045T, Y209A-N243F, S024R-A272P, S024R-R269C, S101G-V104I, V104I-A232V, N076D-H249R и S024R-N076D, G020R-N076D, S024R-R045T, A230E-H249R, N018R-R045T, N018R-Q245R, S101G-A232V, S024R-A232V, A232V-Q245R, S024R-S101G, N018R-V104I, N018R-S103A, S101G-H249R, A232V-H249R, S103A-A232V, N076D-Q245R, S101G-V104I, V104I-A232V, N076D-H249R, S024R-N076D, S024F-N116L, G020K-S024F, G020K-N062E, T033S-G118R, S024R-P086W, S024R-G118R, S024R-P086R, Y209A-W241R, S024R-W241R, S024R-K235F, G118R-Y209A, S078R-G118R, T033S-K235F, S024R-A174T, P086W-Y209A, I008T-S024R, P086W-G118R, T033S-W241R, S024R-N243F, S024R-Y209A, T033S-P086W, S024R-T033S, P086W-N243F, T033S-P201S, S024R-P239Q, S078R-P086W, K235F-N243F, G118R-A172V, T033S-L148F, T033S-S078R, T033S-N243F, S024C-T033S, G118R-A194T, T033S-Y209A, S024R-S141G, S024R-T274I, P086W-K235F, A015T-T033S, Y209A-K235F, S024R-R247H, S078R-K235F, S024R-V104A, T033S-A048T, G118R-K235F, T033S-T253A, T143A-Y209A, T033S-P239T, Y209A-N243F, S024R-A272P и S024R-R269C и где общий суммарный заряд варианта составляет 0, +1, +2, +3, +4, +5, -1, -2, -3, -4 или -5 относительно общего суммарного заряда Bacillus lentus субтилизин GG36 протеазы, и где общий суммарный заряд необязательно получают одним или более замещениями, выбранными из: N43D,R45T, N62E, N76D, S101D, P129E,A158E, G159D, G159E, S166D, S188D,A230E, N18R, G20K, G20R, T22R, S24R, N43R, G118R, Q245R, H249R, N269R, E271F и E271L, и при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, указанный состав является потребительским товаром.

В предпочтительном осуществлении, состав содержит вариант протеазы как описано выше, где дополнительно к одному или более определенным наборам мутаций, общий суммарный заряд варианта регулируют до общего суммарного заряда 0, +1, +2, +3, +4, +5, -1, -2, -3, -4 или -5 относительно общего суммарного заряда Bacillus lentus субтилизин GG36 протеазы (SEQ ID NO:1) одним или более дополнительными замещениями, выбранными из N43D,R45T, N62E, N76D, S101D, P129E,A158E, G159D, G159E, S166D, S188D,A230E, N18R, G20K, G20R, T22R, S24R, N43R, G118R, Q245R, H249R, N269R, E271F и E271L. В одном предпочтительном осуществлении отрицательный заряд добавляют одним или более замещениями, выбранными из N043D,R045T, N076D и A230E. В одном предпочтительном осуществлении положительный заряд добавляют одним или более замещениями, выбранными из G020K, S024R, G118R, Q245R, H249R, E271F и E271L.

В предпочтительном составе вариант протеазы выбран из вариантов протеазы, имеющих один или более из наборов мутаций, выбранных из группы, состоящей из: G020R-N043R, N062E-A158E, S103G-A158E, S128N-A158E, A016S-A158E, V104L-A158E, E089P-A158E, L111V-A158E, T022A-A158E, S101A-A158E, L148I-A158E, P129E-A158E, T022A-E089P, A016S-E089P, N062E-E089P, N062E-E271F, A158E-E271F, R186H-E271F, P129E-E271F, L111V-E271F, Y209E-E271F, A016S-E271F, S188D-E271F, T022A-E271F, G159E-E271F, V104L-E271F, S101A-E271F, E089P-E271F, S128N-E271F, S103G-E271F, L148I-E271F, H249R-E271F, N062E-G159E, A016S-G159E, S128N-G159E, L148I-G159E, L111V-G159E, E089P-G159E, T022A-G159E, P129E-G159E, S103G-G159E, V104L-G159E, A158E-G159E, S101A-G159E, A158E-H249R, L111V-H249R, P129E-H249R, N062E-H249R, A016S-H249R, R186H-H249R, L148I-H249R, G159E-H249R, S101A-H249R, S188D-H249R, V104L-H249R, Y209E-H249R, T022A-H249R, S128N-H249R, S103G-H249R, E089P-H249R, T022A-L111V, S101A-L111V, A016S-L111V, V104L-L111V, N062E-L111V, S103G-L111V, E089P-L111V, A016S-L148I, N062E-L148I, T022A-L148I, P129E-L148I, V104L-L148I, S103G-L148I, S128N-L148I, S101A-L148I, E089P-L148I, L111V-L148I, A016S-N062E, T022A-N062E, N062E-P129E, T022A-P129E, S128N-P129E, A016S-P129E, S101A-P129E, V104L-P129E, E089P-P129E, S103G-P129E, L111V-P129E, N062E-R186H, S128N-R186H, S101A-R186H, T022A-R186H, A016S-R186H, A158E-R186H, E089P-R186H, P129E-R186H, G159E-R186H, S103G-R186H, V104L-R186H, L111V-R186H, L148I-R186H, N062E-S101A, T022A-S101A, A016S-S101A, E089P-S101A, N062E-S103G, T022A-S103G, A016S-S103G, S101A-S103G, E089P-S103G, N062E-S128N, A016S-S128N, T022A-S128N, S101A-S128N, V104L-S128N, E089P-S128N, S103G-S128N, L111V-S128N, L111V-S188D, N062E-S188D, A016S-S188D, L148I-S188D, T022A-S188D, S128N-S188D, S101A-S188D, V104L-S188D, E089P-S188D, P129E-S188D, G159E-S188D, R186H-S188D, S103G-S188D, A158E-S188D, A016S-T022A, A016S-V104L, T022A-V104L, S101A-V104L, N062E-V104L, S103G-V104L, E089P-V104L, G159E-Y209E, L111V-Y209E, S101A-Y209E, A016S-Y209E, S128N-Y209E, L148I-Y209E, P129E-Y209E, N062E-Y209E, T022A-Y209E, S103G-Y209E, A158E-Y209E, S188D-Y209E, V104L-Y209E, E089P-Y209E, R186H-Y209E, N018R-W241R, G020R-W241R, S024R-W241R, S009A-W241R, G020R-W241R, V004R-W241R, N043R-W241R, S078R-W241R, T022R-W241R, G115R-W241R, A001R-W241R, S212F-W241R, L082R-W241R, N018R-V244R, S024R-V244R, S078R-V244R, G020R-V244R, S212F-V244R, S009A-V244R, L082R-V244R, A001R-V244R, N043R-V244R, T022R-V244R, V004R-V244R, G115R-V244R, W241R-V244R, S242R-V244R, A001R-V004R, S009A-T022R, N018R-T022R, G020R-T022R, V004R-T022R, A001R-T022R, S024R-S242R, N018R-S242R, V004R-S242R, G020R-S242R, S212F-S242R, L082R-S242R, S078R-S242R, A001R-S242R, S009A-S242R, T022R-S242R, G115R-S242R, N043R-S242R, W241R-S242R, N018R-S212F, T022R-S212F, V004R-S212F, S024R-S212F, A001R-S212F, G115R-S212F, G020R-S212F, S009A-S212F, N043R-S212F, S078R-S212F, L082R-S212F, S009A-S078R, G020R-S078R, S024R-S078R, T022R-S078R, N018R-S078R, V004R-S078R, A001R-S078R, N043R-S078R, T022R-S024R, G020R-S024R, N018R-S024R, A001R-S024R, V004R-S024R, S009A-S024R, V004R-S009A, A001R-S009A, S242R-N269R, S024R-N269R, G020R-N269R, T022R-N269R, H249R-N269R, S212F-N269R, N043R-N269R, V244R-N269R, A001R-N269R, N018R-N269R, S078R-N269R, S009A-N269R, G115R-N269R, W241R-N269R, V004R-N269R, L082R-N269R, N018R-N043R, G020R-N043R, V004R-N043R, T022R-N043R, S009A-N043R, A001R-N043R, S024R-N043R, S009A-N018R, V004R-N018R, A001R-N018R, S024R-L082R, S009A-L082R, N018R-L082R, A001R-L082R, S078R-L082R, G020R-L082R, T022R-L082R, V004R-L082R, N043R-L082R, N043R-H249R, G020R-H249R, V004R-H249R, N018R-H249R, S009A-H249R, S212F-H249R, T022R-H249R, S024R-H249R, G115R-H249R, A001R-H249R, L082R-H249R, S242R-H249R, W241R-H249R, V244R-H249R, S078R-H249R, N018R-G115R, G020R-G115R, T022R-G115R, S078R-G115R, S009A-G115R, V004R-G115R, A001R-G115R, L082R-G115R, N043R-G115R, S024R-G115R, S009A-G020R, N018R-G020R, V004R-G020R, A001R-G020R, S009A-E271L, G020R-E271L, S024R-E271L, V244R-E271L, W241R-E271L, N043R-E271L, T022R-E271L, H249R-E271L, S212F-E271L, G115R-E271L, S242R-E271L, S078R-E271L, V004R-E271L, N269R-E271L, A001R-E271L, N018R-E271L и L082R-E271L.

В другом аспекте изобретатели обнаружили, что предпочтительные протеазы содержат, по меньшей мере, одну, или даже две или более несущих заряд мутаций, выбранных из группы, состоящей из N062E, S101D, Р129Е, A158E, G159D/E, S166D и/или S188D: Такие протеазы особо предпочтительны для включения в составы моющих средств, приемлемые для добавления в воду с получением промывного раствора, предпочтительно имеющего низкую ионную силу или низкую концентрацию моющего средства. Таким образом, в предпочтительном аспекте в соответствии с настоящим изобретением, такие протеазы образуют часть состава моющего средства, который добавляют в воду, для процесса ручного мытья или машинного мытья, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от приблизительно 0, 1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0, 3 мСм/см до приблизительно 2, 5 мСм/см, или даже от приблизительно 0, 5 мСм/см до приблизительно 2 мСм/см.

В дополнительном аспекте такие протеазы, содержащие, по меньшей мере, одну, или даже две или более несущих заряд мутаций, выбранных из группы, состоящей из N062E, S101D, Р129Е, A158E, G159D/E, S166D и/или S188D имеют заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, наиболее предпочтительно -1 или -2 относительно фермента SEQ ID NO:1. Предпочтительные мутации для получения желаемого суммарного заряда содержат одну, две или более мутаций выбранных из группы, состоящей из: G20K, S024R, G118R, Q245R, H249R и E271F/L.

В соответствии с настоящим изобретением, особо предпочтительные протеазы для использования в настоящем изобретении:

(a) содержат одну или более из несущих заряд мутаций, выбранных из группы, состоящей из N062E, S101D, P129E, A158E, G159D/E, S166D и/или S188D; и/или

(b) имеют заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, наиболее предпочтительно -1 или -2 относительно фермента SEQ ID NO:1; и/или

(c) содержат одну, две, три или более мутаций для получения желаемого суммарного заряда, выбранных из группы, содержащей G20K, S024R, G118R, Q245R, H249R и/или E271F/L.

Под «мутациями для получения желаемого суммарного заряда» подразумевают, что если ферментный вариант сравнивают с Bacillus lentus субтилизин GG36 протеазой, общий суммарный заряд варианта относительно Bacillus lentus субтилизина GG36 может быть отрегулирован, чтобы быть в предпочтительном диапазоне путем выбора одной или более дополнительных мутаций предпочтительно выбранных из определенных мутаций, например, перечисленных в (c) выше.

Предпочтительно эти предпочтительные протеазы образуют часть состава моющего средства, который добавляют в воду в процессе ручного мытья или машинного мытья, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от приблизительно 0,1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0,3 мСм/см до приблизительно 2,5 мСм/см, или даже от приблизительно 0,5 мСм/см до приблизительно 2 мСм/см.

Не имея желания быть связанными теорией, полагают, что такие мутации для получения желаемого суммарного заряда, обеспечивают улучшенную общую характеристику протеаз путем обеспечения оптимального заряда молекулы для условий низкой ионной силы или промывные растворы, содержащие низкую концентрацию моющих средств - только посредством осторожной комбинации определенных мутаций, из которых эти предпочтительны, чтобы такие предпочтительные протеазы могли быть получены.

В другом аспекте изобретатели обнаружили, что предпочтительные протеазы содержат, по меньшей мере, одну или две или более несущих заряд мутаций, выбранных из группы, состоящей из N018R, G020K/R, T022R, S024R, N043R, Q245R, H249R и/или N269R. Такие протеазы особо предпочтительны для включения в составы моющих средств, которые будут добавлены в воду с получением промывного раствора, предпочтительно имеющего высокую ионную силу или высокую концентрацию моющего средства. Например, эти предпочтительные протеазы могут образовывать часть состава моющего средства, который добавляют в воду в процессе ручного мытья или машинного мытья, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от выше приблизительно 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3,5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

В дополнительном аспекте такие протеазы содержат, по меньшей мере, одну, или две, или даже более несущих заряд мутаций выбранных из группы, состоящей из N018R, G020K/R, T022R, S024R, N043R, Q245R, H249R и/или N269R имеют заряд 0, +1, +2, +3, +4 или +5, предпочтительно +1, +2 или +3, наиболее предпочтительно+2 относительно фермента SEQ ID NO:1. Предпочтительные мутации для получения желаемого суммарного заряда содержат одну, две или более мутаций, выбранных из группы, состоящей из: N043D,R045T, N076D и/или A230A.

Особо предпочтительные протеазы:

(a) содержат одну или две или более несущих заряд мутаций, выбранных из группы, состоящей из N018R, G020K/R, T022R, S024R, N043R, Q245R, H249R и/или N269R; и/или

(b) имеют заряд 0, +1, +2, +3, +4 или +5, предпочтительно +1, +2 или +3, наиболее предпочтительно +2 относительно фермента SEQ ID NO:1; и/или

(c) содержат мутации для получения желаемого суммарного заряда, выбранные из группы, состоящей из N043D, R045T, N076D и/или A230E.

Предпочтительно эти протеазы образуют часть состава моющего средства, который добавляют в воду в процессе ручного мытья или машинного мытья, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от выше приблизительно 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3,5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

Не желая быть связанными теорией полагают, что такие мутации для получения желаемого суммарного заряда, обеспечивают улучшенную общую характеристику протеаз в условиях высокой ионной силы или высокой концентрации моющих средств - только посредством осторожной комбинации определенных мутаций, из которых такие предпочтительны, чтобы такие предпочтительные протеазы могли быть получены.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более, предпочтительно два или более, или три или более из следующих наборов мутаций T022R-S024R, S009A-E271L, N018R-W241R, N018R-G115R, N043R-H249R, G020R-H249R, V004R-H249R, G020R-S024R, N018R-H249R, S009A-G020R, G020R-W241R, S009A-S078R, G020R-G115R, N018R-S024R, S024R-S242R, T022R-G115R, N018R-N043R, G020R-N043R, N018R-S242R, S242R-N269R, N018R-V244R, S024R-N269R, G020R-E271L, S024R-E271L, V004R-S009A, G020R-N269R, A001R-S024R, V244R-E271L, S009A-N018R, W241R-E271L, V004R-S024R, S009A-H249R, S009A-T022R, N062E-P129E, N062E-G159E, A016S-L148I, A158E-H249R, A016S-N062E, L111V-S188D, T022A-N062E, N062E-L148I, T022A-P129E, N062E-E271F, N062E-A158E, A016S-G159E, N062E-R186H, S128N-G159E, N062E-S188D, N062E-S128N, L148I-G159E, S103G-A158E, L111V-G159E, A158E-E271F, A016S-S188D, T022A-L111V, S128N-A158E, A016S-A158E, V104L-A158E, S128N-R186H, G159E-Y209E, N062E-S101A, L111V-Y209E, L148I-S188D, S101A-Y209E, T022A-S188D, A016S-T022A, S128N-P129E, A016S-Y209E, A016S-S128N, Т022А-E089P, S128N-Y209E, E089P-A158E, N062E-S103G, R186H-E271F, A016S-P129E, E089P-G159E, L111V-H249R, S101A-P129E, L148I-Y209E, T022A-G159E, P129E-H249R, P129E-Y209E, V104L-P129E, S128N-S188D, L111V-A158E, Т022А-А158Е, N062E-Y209E, N062E-H249R, S101A-R186H, Е089Р-P129E, P129E-E271F, T22A-L111V-G159E, S101A-S103G-V104L-Y209E, S101A-S103G-V104L-G159E, S101A-S103G-V104L-S188D, S101G-S103A-V104I-G159D, T22A-S103G-G159E, T22A-S128N-E271F-Y209E, T22A-Y209E-E271F, T22A-S101A-Y209E, S101A-Y209E-E271F, T22A-L111V-S128N, T22A-S101A-G159E, S101A-S103G-V104L, T22A-S101A-S103G-V104L, S101A-S103G-V104L, S101G-S103A-V104I, S101A-S103G-V104L-S128N, S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D и S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: G020K-G023A-N043W-G118R-S128I-P129E-G159D-S188D, G020K-G023A-N062E-N116L, G020K-G023A-N062E-N116L-S188D, G020K-G023A-N062E-N116L-S188D-T213A, G020K-G100S-N116L-A158E-S166D-N243F, G020K-N043W-N062E-N116L-S188D, G020K-N062E, G020K-N062E-116L, G020K-N062E-N116L-S188D, G020K-N062E-N116L-T213A, G020K-N062E-S188D-T213A, G020K-S024F-N062E-N116L-G118R-S188D, G020K-S024F-N062E-N116L-S188D, G020K-S024F-N062E-S188D-T213A, G023A-N062E-N116L-S188D, G023A-S024F-N062E-N116L-T213A, N043R-N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F, N043R-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, N043W-N062E-N116L, N043W-S101D-S212M-N243F, N062E-N116L-G118R-S188D, N062E-N116L-G118R-T213A, N062E-N116L-S188D-T213A, S024F-G118R-S128I-P129E-G159D, S024F-N062E-N116L-S188D, S024R-S101G-S103A-V104I-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129Q-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129Q-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, S101D-S103N-N116L-S144R-A215D, S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, T022A-N043R-S101G-S103A-V104I-G159D-S188D-L217E-A232V-Q245R-N248D-E271F, T022A-N043R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D-E271F, T022A-N043R-S103A-V104I-S128I-P129E-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D, T022A-S101G-S103A-V104I-G159D-L217E-A232V-Q245R-N248D-E271F, T022A-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, T022L-T038F-A048R-N062E-G100S-R186K, T033S-N043W-N218D-P239G-N243F, V026F-A048R-S105T-T213A-N218D-T224A, V026F-L031F-S078N-G102A-S160D, V026F-V051W-V104L-S106E, V104L-S105T-T213A-L217E-S256N, A016S-N062E-A158E-H249R, A016S-N062E-A158E-R186H-E271F, A016S-N062E-A158E-R186H-H249R, A016S-N062E-V104L-A158E-R186H-E271F, A016S-S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, G020K-G023A-N062E-S188D, G020K-G023A-S024F-N062E-G118R-S188D-T213A, G020K-N043W-N062E-N116L-S188D-T213A-P239G, G020K-S024F-N062E-S188D-P239G, G023A-N062E-N116L-G118R, G023A-N062E-N116L-G118R-S188D-P239G, G023A-S024F-N062E-N116L-G118R, H017R-T022A-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, N043R-N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F, N062E-A158E-G159E-H249R, N062E-A158E-H249R, N062E-A158E-R186H-E271F, N062E-A158E-R186H-H249R, N062E-A158E-R186H-H249R-E271F, N062E-A158E-S188D-H249R, N062E-A158E-S188D-H249R-E271F, N062E-G159E-H249R, N062E-G159E-H249R-E271F, N062E-G159E-R186H-H249R, N062E-G159E-S188D-H249R, N062E-R186H-S188D-H249R-E271F, N062E-S101A-A158E-H249R, N062E-S101A-A158E-R186H-E271F, N062E-S101A-A158E-R186H-H249R-E271F, N062E-S101A-G159E-H249R, N062E-S101A-R186H-H249R, N062E-S101A-S188D-H249R, N062E-S101A-S188D-H249R-E271F, N062E-S101A-V104L-A158E-R186H-E271F, N062E-S128N-A158E-G159E-E271F, N062E-V104L-A158E-S188D-H249R-E271F, N076D-S101G-S103A-V104I-A232V-M222Q-Q245R, S024F-N062E-N116L-P239G, S024F-N062E-S188D-T213A, S024F-N116L, S024R-N043R-N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-A158E-S188D-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-G159E-S188D-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-L148I-A158E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-L148I-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-L148I-A158E-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128N-A158E-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-S128N-P129E-A158E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128N-P129E-A232V-Q245R-N248D, S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F-E271F, S101A-S103A-V104L-A158E-S188D-A232V-Q245R-N248D-H249R, S101A-S128N-A158E-R186H-E271F, S101A-S128N-A158E-Y209E-H249R, S101A-V104L-A158E-R186H-S188D-H249R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-A158E-S188D-M222Q-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-A158E-S188D-M222S-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-A232V-M222Q-Q245R, S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S188D-A232V-Q245R-N248D-H249R, S101G-S103G-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101S-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101S-S103G-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101S-S103G-V104V-A158E-S188D-A232V-Q245R-N248D-H249R, S128N-A158E-G159E-E271F, S128N-A158E-H249R, S128N-A158E-R186H-E271F, S128N-A158E-R186H-H249R, S128N-A158E-R186H-S188D-E271F, S128N-A158E-S188D-E271F, S128N-A158E-S188D-H249R, S128N-A158E-S188D-Y209E-E271F, S128N-A158E-Y209E-, T022A-N043R-S103A-V104I-G118R-P129E-G159D-S188D-A232V-Q245R-N248D, T022A-N062E-A158E, T022A-S024R-S101D-S103A-V104I-G118R-G159D-S188D-A232V-N248D-E271F, T022A-S024R-S101D-S103A-V104I-G118R-P129E-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-S101D-S103A-V104I-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-A158E-A232V-N238R-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-N238R-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-N238R-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-N238R-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S128N-A158E-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S128N-P129E-A158E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S128N-S188D-A232V-Q245R-N248D, T022A-S024R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D, T022A-S024R-S103A-V104I-P129E-G159D-S188D-A232V-N248D-E271F, T022A-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D, T022A-S101G-S103A-V104I-P129E-A158E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-S128N-P129E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-S128N-P129E-S188D-A232V-N238R-Q245R-N248D, T022A-S128N-A158E-H249R, V104L-S128N-A158E-H249R, V104L-S128N-A158E-R186H-E271F, V104L-S128N-A158E-R186H-H249R и/или V104L-S128N-A158E-S188D-H249R. Эти варианты протеазы являются высоко предпочтительными вариантами протеазы для использования в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет низкую ионную силу и/или низкую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: A016S-N062E-A158E-H249R-E271F, A016S-N062E-S128N-R186H-E271F, A016S-N062E-V104L-R186H-S188D-E271F, A016S-S101A-S128N-R186H, A016S-S128N-A158E-R186H, A016S-V104L-A158E-R186H-E271F, A016S-V104L-S188D-H249R, A158E-R186H-H249R, A158E-R186H-S188D-H249R-E271F, G020K-G023A-N116L-S188D, G020K-G023A-S024F-N062E-N116L-S188D-T213A, G020K-N043W-N062E-N116L-P239G, G020K-S024F-N043W-N062E-N116L-T213A, G020K-S024F-N062E, G023A-N043W-N062E-N116L-G118R-T213A, G023A-T038F-S078N-G100S-S212M-A215D, G100S-N116L-A158E-T213A, G102A-S103N-S105T-A194E, H017R-T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N043R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, N043R-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R, N043W-N062E-N116L-S188D, N062E-A158E-H249R-E271F, N062E-A158E-R186H-S188D-H249R, N062E-L148I-G159E, N062E-N116L-S188D, N062E-R186H-H249R, N062E-S078N-G102A-N116L-S144R-L250I, N062E-S101A-A158E-R186H-H249R, N062E-S101A-A158E-S188D-H249R, N062E-S101A-R186H, N062E-S101A-R186H-E271F, N062E-S101A-R186H-H249R-E271F, N062E-S101A-R186H-S188D-E271F, N062E-S101A-R186H-S188D-H249R, N062E-S101A-V104L-R186H-S188D-E271F, N062E-S128N-A158E, N062E-S128N-G159E-H249R, N062E-S188D-P239G, N062E-V104L-G159E-H249R, N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F, N076D-S101G-S103A-V104I-A114V-A158E-S188D-A232V-Q245R-N248D-H249R-E271F, N076D-S101G-S103A-V104I-A232V-M222S-Q245R, S024F-A048R-G118R-S166D-L217E, S024F-N062E-N116L, S024F-N062E-N116L-T213A-P239G, S024F-N062E-S188D-P239G, S024F-S101D-G118R-A215D-L250I-A272F, S024R-K027R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, S024R-S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-N238R-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-L148I-A158E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129E-L148I-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128L-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128N-G159E-S188D-A232V-Q245R-N248D, S078N-V104L-G118R-S128D, S101A-A158E-R186H-H249R, S101A-A158E-R186H-S188D-H249R, S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F, S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F, S101A-S103G-A158E-R186H-H249R, S101A-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101A-S103S-V104I-G159E-A232V-Q245R-N248D-H249R, S101A-S128N-A158E-H249R, S101A-S128N-A158E-S188D-Y209E-E271F, S101A-S128N-A158E-Y209E, S101A-S128N-P129E-R186H-H249R, S101A-V104L-A158E-R 186H-H249R, S101A-V104L-A158E-R186H-S188D-E271F, S101A-V104L-S128N-A158E-R186H-E271F, S101G-S103A-V104I-A158E-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-A158E-G159E-S188D-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D, S101G-S103A-V104I-A232V-M222S-Q245R, S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-P129E-A158E-S188D-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D, S101G-S103A-V104I-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S128L-S130A-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S128N-P129E-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-S128N-P129E-A232V-Q245R-N248D, S101G-S103A-V104I-S130A-A158E-N183D-S188D-L217E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-S188D-A232V-N238R-Q245R-N248D, S101G-S103A-V104L-A158E-S188D-A232V-Q245R-N248D-H249R, S101S-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101S-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S101S-S103S-V104V-A158E-S188D-A232V-Q245R-N248D-H249R, T022A-N043R-N062E-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, T022A-N043R-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, T022A-N043R-S101D-S103A-V104I-G118R-P129E-G159D-S188D-A232V-N248D-E271F, T022A-N043R-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, T022A-N043R-S103A-V104I-G118R-G159D-S188D-A232V-N248D-E271F, T022A-N043R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D-E271F, T022A-N043R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D, T022A-N043R-S103A-V104I-P129E-G159D-S188D-A232V-Q245R-N248D, T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, T022A-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, T022A-S024R-N043R-S101D-S103A-V104I-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-N043R-S103A-V104I-G159D-S188D-L217D-A232V-N248D-E271F, T022A-S024R-S101D-S103A-V104I-G118R-S128I-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S101G-S103A-V104I-P129E-L148I-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S103A-V104I-G118R-P129E-G159D-S188D-A232V-N248D-E271F, T022A-S024R-S103A-V104I-G159D-S188D-L217D-A232V-N248D-E271F, T022A-S024R-S103A-V104I-G159D-S188D-L217D-A232V-Q245R-N248D-E271F, T022A-S101A-A158E-R186H-H249R, T022A-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, T022A-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-H249R-E271F, T022A-S101G-S103A-V104I-G159E-S188D-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-P129E-A232V-N238R-Q245R-N248D, T022A-S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D-H249R, T022A-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R, T022A-S103A-V104I-G118R-G159D-S188D-L217D-A232V-Q245R-N248D, T022A-S103A-V104I-G159D-S188D-A232V-N248D, T022L-L031F-G102A-S128D-T224A-N243F, T022L-T038F-V121F-S160D-A272F, V026F-S078N-G159C-R186K-N243F, V104L-A158E-H249R, V104L-A158E-R186H-H249R, V104L-A158E-R186H-H249R-E271F, V104L-A158E-R186H-S188D-H249R, V104L-A158E-R186H-S188D-H249R-E271F, V104L-A158E-S188D-H249R-E271F, V104L-S128N-A158E-R186H-S188D-E271F, V104L-S128N-G159E-E271F, V104L-S128N-R186H-S188D-H249R и/или V121F-N185E-T224A-P239G. Эти варианты протеазы являются предпочтительными вариантами для использования в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет низкую ионную силу и/или низкую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: A016S-S128N-R186H-E271F, N076D-S101G-S103A-V104I-A158E-S188D-M222S-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128L-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S024R-S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R-E271G, S024R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R, T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R-E271F, T022A-S101G-G102A-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F, A016S-A158E-H249R, A016S-A158E-H249R-E271F, A016S-A158E-R186H-H249R, A016S-L111V-S188D-, A016S-T022A-A158E-R186H-E271F, A048R-S078N-N116L-N185E-L217E-P239G, A048R-S128D-N185E-P239G, A158E-R186H-H249R-E271F, E089P-S101A-P129E-R186H, G020K-G023A-N043W-N116L-S188D-T213A-P239G, G020K-G023A-N062E-N116L-G118R-T213A, G020K-G023A-S024F-N062E-S188D-T213A-P239G, G020K-K027R-P129E-S166D-P239G, G020K-S024F-N062E-P239G, G020K-S024F-T033S-P129E-A194E, G023A-G100S-A194E-S212M, G023A-N043W-N116L-G118R-S188D, G023A-S024F-G118R-S188D-P239G, G023A-S024F-K027R-N062E, G023A-S024F-N043W-N062E-N116L-G118R, G023A-S024F-N116L-G118R-S188D-T213A, G023A-S024F-N116L-S188D-P239G, K027R-G100S-G118R-S160D-S188D-N243F, K027R-S101D-S103N-S105T-A272F, N043R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R, N062E-S078N-N116L-T224A, N062E-V104L-A158E-R186H-S188D-H249R, N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F, N076D-S101G-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F, S024F-G102A-R186K-T213A-L217E-N243F, S024F-N043W-G118R-S188D, S024F-N043W-V104L-V121F-P129E, S024F-N116L-G118R-S188D-P239G, S024F-S103N-V104L-G118R-S188D, S024R-N043R-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R, S024R-N043R-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R, S024R-N076D-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F, S024R-S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-S128N-A158E-G159E-S188D-A232V-Q245R-N248D, S024R-S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D, S101A-L111V-P129E, S101A-S103A-V104L-G159E-A232V-Q245R-N248D-H249R, S101A-S103S-V104L-G159E-A232V-Q245R-N248D-H249R, S101A-V104L-S128N-A158E-R186H, S101G-S103A-V104I-P129E-L148I-S188D-A232V-Q245R-N248D, S101G-S103A-V104I-S128N-P129E-A158E-A232V-N238R-Q245R-N248D, S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D-H249R, S101G-S103S-V104L-G159E-A232V-Q245R-N248D-H249R, S101S-S103A-V104L-G159E-A232V-Q245R-N248D-H249R, S128N-P129E-R186H, Т022А-A158E-R186H-H249R-E271F, T022A-S024K-S101G-S103A-V104I-S128N-A158E-G159E-A232V-Q245R-N248D, T022A-S024R-S101G-S103A-V104I-S128N-P129E-A158E-S188D-A232V-Q245R-N248D-H249R, T022A-S024R-S103A-V104I-S128I-G159D-S188D-A232V-N248D, T022A-S101G-S103A-V104I-L148I-S188D-A232V-Q245R-N248D, Т022А-S101G-S103A-V104I-S128N-G159E-A232V-Q245R-N248D, T022A-S101G-S103A-V104I-S128N-P129E-A158E-A232V-N238R-Q245R-N248D, T022A-S128N-A158E-R186H, Т022А-S128N-R186H-S188D-, T022A-V104L-A158E-H249R, T022A-V104L-R186H-S188D-H249R, T022L-G023A-K027R-S101D-V104L-S216F, T022L-S078N-N116L-P129E-S256N, T022L-S078N-S128D-T213A, T033S-G118R-P129E-A194E-P239G, T033S-S105T-S188D-S216F, V026F-V104L-S256N-A272F, T022A-N043R-S103A-V104I-S128I-G159D-S188D-A232V-Q245R-N248D, T022A-S024R-N043R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D, T022A-S101D-S103A-V104I-G118R-G159D-S188D-L217D-A232V-Q245R-N248D-E271F, T022A-S103A-V104I-G118R-P129E-G159D-S188D-A232V-Q245R-N248D-E271F, T022A-S103A-V104I-G159D-S188D-L217D-A232V-Q245R-N248D-E271F и/или Т022А-S103A-V104I-S128I-P129E-G159D-S188D-A232V-N248D-E271F. Эти варианты протеазы являются полезными в особенности в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет низкую ионную силу и/или низкую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: G118R-Y209A, G118R-Y209A-N243F, L021M-S024R-T033S, P005S-S078R-G118R-W241R, P086W-G118R-A133V, P086W-G118R-N243F, P086W-G118R-Y209A, P086W-Y209A-N243F, S024R-A174T, S024R-G118R, S024R-G118R-Y209A, S024R-G118R-Y209A-K235F, S024R-G118R-Y209A-N243F, S024R-K235F, S024R-P086R, S024R-P086S-S141G, S024R-P086W, S024R-P086W-G118R, S024R-P086W-G118R-V203I, S024R-P086W-N243F, S024R-P086W-Y209A, S024R-S078R-P086W, S024R-S078R-P086W-G118R-A270T, S024R-S078R-P086W-N243F, S024R-T033S-A133V, S024R-T033S-G118R, S024R-T033S-P086S-S085N-K235F, S024R-T033S-P086S-S087N-Y209A, S024R-T033S-P086W, S024R-T033S-P086W-G118R, S024R-T033S-S078R-P086W, S024R-T033S-S078R-P086W-G118R, S024R-T033S-S078R-Y209A, S024R-T033S-W241R, S024R-T033S-Y209A-K235F, S024R-Y209A-W241R, S078R-G118R, S078R-P086W-K235F, S078R-P086W-N243F, S078R-P086W-Y209A, S078R-Y209A-K235F, T033S-A172V-Y209A, T033S-G118R, T033S-G118R-G159D-Y209A, T033S-G118R-N243F, T033S-G118R-W241R, T033S-G118R-Y209A-N243F, T033S-K235F, T033S-P086W-G118R, T033S-P086W-G118R-Y209A-N243F, T033S-P086W-N243F, T033S-S078R-P086W, T033S-S078R-P086W-G118R-Y209A, T033S-S078R-Y209A, T033S-Y209A-N243F, Y209A-W241R, A001R-S009A-N043R, A001R-S101G-S103A-V104I-A232V-Q245R, A001T-N018R-S024R-N076D-N116A-T213A-H249R, A194F-G211Q-Q236N, E089I-N116A-N117F-T224A-H249R, G020R-G025R-N116A-Y167W, G020R-H249R-N269R, G020R-N043D-N076D-A230E-H249R, G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R, G020R-N043D-S101G-S103A-V104I-A232V-Q245R, G020R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-N043R-A230E, G020R-N043R-A230E-S242R, G020R-N043R-E271L, G020R-N043R-H249R, G020R-N043R-H249R-E271L, G020R-N043R-N269R, G020R-N043R-R045T-A230E, G020R-N043R-R045T-S101A-N269R, G020R-N043R-R045T-S242R, G020R-N043R-S101A-N116A-T213A-A215F, G020R-N043R-S101A-N269R, G020R-N043R-S101G-S103A-V104I-A232V-Q245R, G020R-N043R-S212F, G020R-N043R-S212F-W241R, G020R-N043R-S242R, G020R-N043R-S242R-E271L, G020R-N043R-S242R-H249R, G020R-N043R-V244R, G020R-N043R-W241R, G020R-N062Q-E089I-R186K-S212M, G020R-N076D, G020R-N076D-S101G-S103A-V104I-A232V-Q245R, G020R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-N116A-N269R, G020R-P052N-N062Q-Y091F-Y192W, G020R-Q059A-S144R-Y192W-T224A, G020R-S024R-K27E-N043R-N076D-A230E, G020R-S024R-N043D-H249R, G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-N043D-S242R, G020R-S024R-N043R-R045T, G020R-S024R-N043R-R045T-H249R, G020R-S024R-N043R-R045T-N116A, G020R-S024R-N043R-R045T-N116A-T213A, G020R-S024R-N043R-R045T-S101A-N269R, G020R-S024R-N043R-R045T-S101A-T213A, G020R-S024R-N043R-S242R, G020R-S024R-N076D-H249R, G020R-S024R-N116A, G020R-S024R-N116A-A215F, G020R-S024R-N116A-T213A, G020R-S024R-N116A-T213A-A215F, G020R-S024R-P052N-Q059A-S216F, G020R-S024R-R045T-A230E-S242R, G020R-S024R-R045T-N116A-N269R, G020R-S024R-R045T-N269R, G020R-S024R-S101A-A215F, G020R-S024R-S101A-N116A, G020R-S024R-S101G-S103A-V104I-L217E-A232V-Q245R-H249R, G020R-S024R-S242R-H249R, G020R-S024R-T213A, G020R-S024R-T213A-A215F, G020R-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-S078R-S101G-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-A215F-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-G211Q-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-S087D-S101G-S103A-V104I-A232V-Q245R, G020R-S101A-N116A-N269R, G020R-S101A-S103A-V104I-A215F-A232V-Q245R, G020R-S101A-S103A-V104I-G118R-A232V-Q245R, G020R-S101A-S103A-V104L-A232V-Q245R, G020R-S101A-S103A-V104V-A232V-Q245R, G020R-S101A-S103S-V104I-A232V-Q245R, G020R-S101A-S103S-V104V-A232V-Q245R, G020R-S101G-I198L-A215F-A232V-Q245R, G020R-S101G-S103A-A232V-Q245R, G020R-S101G-S103A-V104I-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-A232V-Q245R, G020R-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-T213A-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-V150L-A232V-Q245R, G020R-S101G-S103A-V104L-A232V-Q245R, G020R-S101G-S103A-V104V-A232V-Q245R, G020R-S101G-S103G-V104I-A232V-Q245R, G020R-S101G-S103S-V104I-A232V-Q245R, G020R-S101G-S103S-V104L-A232V-Q245R, G020R-S101G-V104I-T213A-A215F-A232V-Q245R, G020R-S101S-S103A-V104I-A232V-Q245R, G020R-S101S-S103A-V104V-A232V-Q245R, G020R-S101S-S103G-V104I-A232V-Q245R, G020R-S101S-S103G-V104V-A232V-Q245R, G020R-S101S-S103S-V104I-A232V-Q245R, G020R-S101S-S103S-V104L-A232V-Q245R, G020R-S101S-S103S-V104V-A232V-Q245R, G020R-S103N-S216F-Q236N-N252R, G020R-S144R-N185I-L233C-Q236N, G020R-S212F-H249R, G020R-S242R-N269R, G020R-T022R-E271L, G020R-T022R-N043R, G020R-T022R-N043R-S212F, G020R-T022R-N043R-W241R, G020R-T022R-S024R-S242R, G020R-T022R-S078R-S242R, G020R-T022R-S078R-W241R, G020R-T022R-S212F-W241R, G020R-T022R-S242R, G020R-T022R-W241R, G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N116S-T213A-A215F-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-T213A-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-G211Q-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-G211Q-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-I198L-G211Q-T213A-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T038A-N043R-S101A, G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-A232V, G020R-T22W-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-T22W-S078R-S101G-S103A-V104I-N116A-T213A-A215F-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-A215F-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R, G020R-T22W-S101G-S103A-V104I-A232V-Q245R, G020R-T22W-S101G-S103A-V104I-G211Q-A232V-Q245R, G020R-T22W-S103A-V104I-A232V-Q245R, G023A-P052N-S144R-Y192W-S216F, G023A-P052N-Y192W-I198L-N252R, G023A-S024R-N117F-S212M-S216F, G023A-S078R-S216F-Q236N-H249R, G023A-Y091F-S101A-I198L-N252R, G023A-Y091F-V121F-Y192W-Q236N, G025R-E089I-N116A-P239S-A270C, G025R-G046R-V121F, G025R-N043A-E089I-N117F, G025R-S103N-R186K-A194F-T224A, G046R-A194F-S212M, G046R-E089I-Y091F-S101A-N116A, G046R-E089I-Y192W-L233C-A270C, G046R-N183D-N238L, G046R-Q059A-S103N-G211Q-S212M, G046R-Q059A-S106G-L217E-H249R, L148I-T213A-N252R, N018R-G020R-N043D, N018R-G020R-N043D-A230E-S242R, N018R-G020R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-N043D-R045T-A230E, N018R-G020R-N043R-N076D-H249R, N018R-G020R-N043R-N076D-S242R-H249R, N018R-G020R-N043R-R045T-S242R, N018R-G020R-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-R045T, N018R-G020R-S024R-N043D-R045T-L233I-S242R, N018R-G020R-S024R-N043R-R045T-N076D-A230E, N018R-G020R-S024R-N076D-S087D-H249R, N018R-G020R-S024R-N076D-V150L-H249R, N018R-G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-N043D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-N043D-S101G-S103A-V104I-A232V-Q245R, N018R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043R-N076D-A230E, N018R-N043R-R045T-H249R, N018R-N043R-R045T-S101G-S103A-V104I-A232V-Q245R, N018R-N043R-R045T-S242R-H249R, N018R-N043R-S101G-S103A-V104I-A232V-Q245R, N018R-N043R-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043R-S242R-H249R, N018R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-N076D-S101G-V104I-A232V-Q245R, N018R-Q245R, N018R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-R045T-S101G-S103A-V104I-A232V-Q245R, N018R-S024R-N043D-A230E, N018R-S024R-N043D-N076D-H249R, N018R-S024R-N043D-N076D-H249R-N269R, N018R-S024R-N043D-N076D-S078R-H249R, N018R-S024R-N043D-R045T-H249R, N018R-S024R-N043D-S101G-S103A-V104I-A232V-Q245R, N018R-S024R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-S024R-N043R-N076D-H249R, N018R-S024R-N043R-N076D-H249R-N269R, N018R-S024R-N043R-N076D-S087D-H249R, N018R-S024R-N043R-N076D-V150L-H249R, N018R-S024R-N076D-G211Q-A215F-H249R, N018R-S024R-N076D-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-G211Q-T213A-H249R, N018R-S024R-N076D-H249R, N018R-S024R-N076D-H249R-N269R, N018R-S024R-N076D-N116A-A215F-H249R, N018R-S024R-N076D-N116A-G211Q-A215F-H249R, N018R-S024R-N076D-N116A-G211Q-H249R, N018R-S024R-N076D-N116A-T213A-A215F-H249R, N018R-S024R-N076D-S078R-H249R, N018R-S024R-N076D-S078R-S087D-H249R, N018R-S024R-N076D-S078R-V150L-H249R, N018R-S024R-N076D-S087D-H249R-N269R, N018R-S024R-N076D-S087D-S242R-H249R, N018R-S024R-N076D-S087D-V150L-H249R, N018R-S024R-N076D-S101A-A215F-H249R, N018R-S024R-N076D-S101A-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-S101A-I198L-G211Q-A215V-H249R, N018R-S024R-N076D-S101A-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N116A-G211Q-H249R, N018R-S024R-N076D-S101A-N116A-T213A-H249R, N018R-S024R-N076D-S101G-V104I-A232V-H249R, N018R-S024R-N076D-S242R-H249R, N018R-S024R-N076D-T213A-A215F-H249R, N018R-S024R-N076D-V104I-H249R, N018R-S024R-N076D-V150L-H249R, N018R-S024R-R045T-S242R, N018R-S024R-S101G-V104I, N018R-S024R-S101G-V104I-A232V, N018R-S024R-S242R, N018R-S024R-V104I-H249R, N018R-S024R-V244R, N018R-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-S087D-S101G-S103A-V104I-A232V-Q245R, N018R-S101G-Q245R, N018R-S101G-S103A-H249R, N018R-S101G-S103A-Q245R, N018R-S101G-S103A-V104I-A232V-Q245R, N018R-S101G-S103A-V104I-V150L-A232V-Q245R, N018R-S101G-V104I-A232V-H249R, N018R-S101G-V104I-A232V-Q245R, N018R-S101G-V104I-H249R, N018R-S103A-A232V-H249R, N018R-S103A-V104I-H249R, N018R-T022R-S024R-N043D-N076D-H249R, N018R-T022R-S024R-N043R-N076D-H249R, N018R-T022R-S024R-N076D-H249R, N018R-T022R-S024R-N076D-S087D-H249R, N018R-T022R-S024R-N076D-V150L-H249R, N018R-T022W-S024R-N076D-N116A-G211Q-H249R, N018R-T022W-S024R-N076D-N116A-T213A-H249R, N018R-T022W-S024R-N076D-S101A-I198L-A215F-H249R, N018R-T022W-S024R-N076D-S101A-I198L-H249R, N018R-T022W-S024R-N076D-S101A-N116A-A232V-Q245R, N018R-T22K-N043D-S101G-S103A-V104I-A232V-Q245R, N018R-T22W-S024R-N076D-N116A-T213A-H249R, N018R-T22W-S024R-N076D-S101A-N116A-A232V-Q245R, N018R-V104I-A232V-H249R, N043A-N062Q-A194F-G211Q, N043A-T057R-N117F-S144R-N183D, N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043D-R045T-N076D-H249R, N043D-S078R-S101G-S103A-V104I-A232V-Q245R, N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, N043D-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N043R-N076D-S101G-S103A-V104I-A232V-Q245R, N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-N076D-S242R-H249R, N043R-N116A-N269R, N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, N043R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-S078R-S101G-S103A-V104I-A232V-Q245R, N043R-S087D-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-S101A-N116A-A215F-N269R, N043R-S101A-N116A-N269R, N043R-S101A-N116A-T213A-A215F-N269R, N043R-S101A-N269R, N043R-S101A-T213A-N269R, N043R-S101G-S103A-V104I-A232V-Q245R, N043R-S101G-S103A-V104I-A232V-Q245R-E271L, N043R-S101G-S103A-V104I-A232V-Q245R-H249R, N043R-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-S101G-S103A-V104I-A232V-S242R-Q245R, N043R-S101G-S103A-V104I-V150L-A232V-Q245R, N043R-S242R-H249R, N043R-T213A-A215F-N269R, N062Q-S103N-N117F-A194F, N062Q-S103N-V121F-S144R-H249R, N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N076D-S101G-S103A-V104I-A232V-Q245R, N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N076D-S103A-V104I-Q109R, N076D-S103A-V104I-Q109R-Q245R, N076D-S103A-V104I-S212P-E271V, N076D-S103A-V104I-S212P-Q245L-E271V, N076D-S87R-S103A-V104I-S212P-E271V, N117F-A194F-T213A-A270C, N117F-T213A-A215F, P052N-S078R-S103N-L148I-T213A, P052N-S103N-N116A-L148I-Y192W,R019H-G020R-T022W-S078R-S101G-S103A-V104I-G211Q-A232V-Q245R,R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R,R045T-S078R-S101G-S103A-V104I-A232V-Q245R,R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, S009A-G020R-N043R-S212F, S009A-G020R-N043R-W241R, S009A-G020R-S024R-N043R, S009A-N043R-S078R, S009A-N043R-S078R-S242R, S009A-N043R-S212F, S009A-N043R-W241R, S009A-T022R-N043R-S078R, S009A-T022R-S078R-S212F, S009A-T022R-S078R-S212F-W241R, S009A-T022R-S212F-W241R, S024R-A215F-N269R, S024R-A232V-Q245R, S024R-G025R-N183D-Y192W-P239S, S024R-N043A-N117F-A194F-G211Q, S024R-N043D-H249R, S024R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R, S024R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-N043R-A215F, S024R-N043R-A230E, S024R-N043R-A230E-S242R, S024R-N043R-H249R, S024R-N043R-N076D-H249R, S024R-N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, S024R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R, S024R-N043R-N116A-A215F, S024R-N043R-N116A-A215F-N269R, S024R-N043R-N116A-N269R, S024R-N043R-N116A-T213A-N269R, S024R-N043R-R045T-N076D-A230E-H249R, S024R-N043R-R045T-N269R, S024R-N043R-R045T-S101A-N116A-A215F-N269R, S024R-N043R-R045T-S101A-N116A-T213A-N269R, S024R-N043R-R045T-S242R, S024R-N043R-R045T-T213A-A215F-N269R, S024R-N043R-S101A-A215F, S024R-N043R-S101A-A215F-N269R, S024R-N043R-S101A-N116A, S024R-N043R-S101A-N116A-A215F-N269R, S024R-N043R-S101G-S103A-V104I-A232V-Q245R, S024R-N043R-S242R, S024R-N062Q-V104L-S106G-H249R, S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-N076D-V104I-A232V-Q245R, S024R-N116A-T213A-N269R, S024R-R045T, S024R-R045T-N076D-A230E-S242R-H249R, S024R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-S078R-S212F, S024R-S078R-V104L-N116A-N183D, S024R-S087D-S101G-S103A-V104I-A232V-Q245R, S024R-S101A-H120F-A194F-H249R, S024R-S101A-N269R, S024R-S101G-S103A-V104I-A232V-Q245R, S024R-S101G-S103A-V104I-V150L-A232V-Q245R, S024R-S101G-V104I-Q245R, S024R-S103A-Q245R, S024R-S103A-V104I-A232V-H249R, S024R-S103A-V104I-H249R, S024R-S103A-V104I-Q245R, S024R-Y167W-T224A-H249R, S078R-S087D-S101G-S103A-V104I-A232V-Q245R, S078R-S101G-S103A-V104I-A232V-Q245R, S078R-S101G-S103A-V104I-A232V-Q245R-N269R, S078R-S101G-S103A-V104I-V150L-A232V-Q245R, S078R-S103N-S106G-Y167W-Q236N, S078R-V104L-T213A-A215F-T224A, S078R-Y091F-V121F-L233C-N252R, S087D-S101G-S103A-V104I-A232V-Q245R-N269R, S087R-S101G-S103A-V104I-Q109R-S212P-A232V-Q245R-E271V, S099F-S144R-Y167W-N252R, S101A-H120F-Y192W-A215F-T224A, S101A-S103A-V104I-T213A-A232V-Q245R-N269R, S101G-S103A-V104I-A232V-Q245R, S101G-S103A-V104I-A232V-Q245R-E271L, S101G-S103A-V104I-A232V-Q245R-H249R, S101G-S103A-V104I-A232V-Q245R-N269R, S101G-S103A-V104I-A232V-Q245R-N269R, S101G-S103A-V104I-A232V-S242R-Q245R, S101G-S103A-V104I-A232V-V244R-Q245R, S101G-S103A-V104I-G115R-A232V-Q245R, S101G-S103A-V104I-N116A-T213A-A232V-Q245R-N269R, S101G-S103A-V104I-Q109R-A232V-Q245R, S101G-S103A-V104I-Q109R-S212P-A232V-Q245R, S101G-S103A-V104I-Q109R-S212P-A232V-Q245R-E271V, S101G-S103A-V104I-S212F-A232V-Q245R, S101G-S103A-V104I-V150L-A232V-Q245R-H249R, S101G-S103A-V104I-V150L-A232V-Q245R-N269R, S105T-S128N-S144R-L148I-S212M, S106G-N117F-N238L, S144R-G211Q-N238L-P239S-H249R, T022R-N043R-S101G-S103A-V104I-A232V-Q245R, T022R-N076D-S101G-S103A-V104I-A232V-Q245R, T022R-S087D-S101G-S103A-V104I-A232V-Q245R, T022R-S101G-S103A-V104I-A232V-Q245R, T022W-S078R-Y167W-S212M-A270C, T057R-E089I-I198L, T057R-S099F-S105T-I198L-T213A, T057R-S099F-V121F-N185I-Y192W, T057R-Y167W-H249R, V004R-G020R-H249R, V004R-G020R-N043R, V004R-G020R-S024R, V004R-G020R-S024R-H249R, V004R-G020R-S024R-N043R, V004R-G020R-S024R-N043R-S242R, V004R-G020R-S024R-V244R, V004R-N043R-S101G-S103A-V104I-A232V-Q245R, V004R-S009A-G020R-N043R, V004R-S009A-G020R-N043R-S242R, V004R-S009A-G020R-S024R-S242R, V004R-S009A-G020R-S242R, V004R-S009A-N043R-W241R, V004R-S009A-S024R-N043R-W241R, V004R-S009A-S078R-W241R, V004R-S009A-W241R, V004R-S101G-S103A-V104I-A232V-Q245R, V104L-L217E-T224A-H249R-N252R, V104L-T213A-S216F, V121F-N252R-A270C и/или Y091F-S099F-S101A-S105T-Y167W. Эти варианты протеазы являются высоко предпочтительными вариантами протеазы для использования в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет высокую ионную силу и/или высокую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: S101G-S103A-V104I-A232V-Q236H-Q245R-N252K, S101G-S103A-V104I-A232V-Q245R-N248R, S101G-S103A-V104I-G159R-A232V-Q245R-N248D, A232V-Q245R, E089I-N117F-N185I-A215F-L233C, G020R-E089I-L217E, G020R-G023A-V104L-Y192W-L233C, G020R-N043D-R045T-N076D-S242R-H249R, G020R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, G020R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R, G020R-N043R-N076D-A230E-H249R, G020R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-N116A-A215F-N269R, G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, G020R-R045T-N116A-N269R, G020R-R045T-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-A215F, G020R-S024R-K27R-N043D-S242R-H249R, G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-S024R-N043R-N076D, G020R-S024R-N043R-R045T-A215F, G020R-S024R-N043R-R045T-N076D-S242R-H249R, G020R-S024R-N043R-R045T-N116A-T213A-A215F, G020R-S024R-N076D-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-T38I-N043R-R045T-N076D-S242R-H249R, G020R-S078R-S101A-S103A-V104I-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N116A-N183D-I198L-A215F-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-N183D-A215F-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-A131V-N183D-T213A-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V, G020R-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-S078R-S101G-S103A-V104I-N183D-G211Q-T213A-A232V-Q245R-E271G, G020R-S078R-S101G-S103A-V104I-T180A-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-S101A-S103A-V104I-T213A-A215F-A232V-Q245R, G020R-S101A-S103G-V104V-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-G211Q-A232V-Q245R, G020R-S101G-S103A-V104I-N183D-G211Q-A232V-Q245R-, G020R-S103A-V104I-A232V-Q245R, G020R-S242R-H249R, G020R-T022W-S078R-S101A-S103A-V104I-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-I198L-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R, G020R-T022W-S078R-S101A-S103A-V104I-N183D-I198L-T213A-A215F-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-G211Q-T213A-A232V-Q245R, G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T022W-S101A-N116A-I198L-G211Q-T213A-A215F-H249R, G020R-T022W-S101A-S103A-V104I-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-G211Q-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-I198L-G211Q-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-G211Q-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-G211Q-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-A114T-T213A-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-I198L-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N183D-I198L-T213A-A215F-A232V-Q245R, G020R-T022W-S103A-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S103A-V104I-A232V-Q245R, G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-G211Q-A215F-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-N116A-G211Q-A215F-A232V-Q245R, G020R-T22W-S101A-S103A-V104I-N116A-G211Q-T213A-A215F-A232V-Q245R, G020R-T22W-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T22W-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R, G025R-N043A-Y091F-I198L-A270C, G025R-S105T-S128N-S144R-A270C, G046R-E089I-S099F-R186K-S212M, G118R-A172V, G118R-A194T, G118R-Y209A-K235F, H017Y-S024R-T033S-P086W, I008T-S024R, K027R-N043R-S101G-S103A-V104I-A232V-Q245R-N269R, K027R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, K235F-N243F, N018R-G020R-H249R, N018R-G020R-N043D-H249R, N018R-G020R-N043D-R045T-A230E-S242R, N018R-G020R-N043D-R045T-N076D-S242R, N018R-G020R-N043D-R045T-S240P, N018R-G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-N043D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-N043R, N018R-G020R-N043R-N076D, N018R-G020R-N043R-N076D-A230E-S242R, N018R-G020R-N043R-R045T-N076D-H249R, N018R-G020R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-G020R-R045T-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-S024R-N043D-N076D-S242R, N018R-G020R-S024R-N043D-R045T-S242R, N018R-G020R-S024R-N043R-N076D-H249R, N018R-G020R-S024R-N043R-R045T-N076D-H249R, N018R-G020R-S024R-N076D-A215F-H249R, N018R-G020R-S024R-N076D-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-L217E-H249R, N018R-G020R-S024R-N076D-N116A-A215F-H249R, N018R-G020R-S024R-N076D-N116A-N183D-A215F-H249R, N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-H249R, N018R-G020R-S024R-N076D-N116A-N183D-T213A-A215F-H249R, N018R-G020R-S024R-N076D-N183D-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-H249R, N018R-G020R-S024R-N076D-S101A-N183D-G211Q-A215F-H249R, N018R-G020R-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-G020R-T022W-S024R-N076D-N116A-N183D-I198L-T213A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-H249R, N018R-G020R-T22W-S024R-N076D-N116A-N183D-I198L-T213A-H249R, N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N043D-R045T-N076D-S242R-H249R, N018R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-N043D-R045T-S101G-S103A-V104I-A232V-Q245R, N018R-N043D-R045T-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N043R-N076D-A230E-S242R-H249R, N018R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043R-N076D-S242R-H249R, N018R-N043R-R045T-N076D-A230E-S242R, N018R-N043R-R045T-N076D-S076T-S101G-S103A-V104I-A232V-Q245R-A273T, N018R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043R-R045T-N076D-S242R, N018R-N043R-R045T-S242R, N018R-N076D-H249R, N018R-N076D-Q245R, N018R-N076D-S101G-A232V-Q245R, N018R-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N076D-S101G-S103A-V104I-H249R, N018R-N076D-S101G-V104I-H249R, N018R-N076D-S103A-V104I-H249R, N018R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-S024R-N043D-A230E-H249R, N018R-S024R-N043D-A230E-S242R, N018R-S024R-N043D-H249R, N018R-S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-S024R-N043D-N076D-S242R-H249R, N018R-S024R-N043D-N076D-V150L-H249R, N018R-S024R-N043D-S242R, N018R-S024R-N043D-S242R-H249R, N018R-S024R-N043R-N076D-L217E-H249R, N018R-S024R-N043R-N076D-S078R-H249R, N018R-S024R-N043R-R045T-A230E-H249R, N018R-S024R-N076D, N018R-S024R-N076D-A232V-H249R, N018R-S024R-N076D-G211Q-H249R, N018R-S024R-N076D-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-I198L-T213A-A215F-H249R, N018R-S024R-N076D-1198M-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-L088I-S101A-N116A-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-N116A-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N116A-H249R, N018R-S024R-N076D-N116A-I198L-A215F-H249R, N018R-S024R-N076D-N116A-I198L-A215F-H249R-V268G, N018R-S024R-N076D-N116A-I198L-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N116A-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-N116A-I198L-H249R, N018R-S024R-N076D-N116A-I198L-T213A-H249R, N018R-S024R-N076D-N116A-I198L-Y209H-T213A-H249R, N018R-S024R-N076D-N116A-M117I-N183D-T213A-H249R, N018R-S024R-N076D-N116A-N183D-G211Q-H249R, N018R-S024R-N076D-N116A-T213A-H249R, N018R-S024R-N076D-N183D-I198L-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N183D-T213A-A215F-H249R, N018R-S024R-N076D-S101A-G211Q-A215F-H249R, N018R-S024R-N076D-S101A-G211Q-H249R, N018R-S024R-N076D-S101A-H249R, N018R-S024R-N076D-S101A-I198L-A215F-H249R, N018R-S024R-N076D-S101A-II 98L-G211Q-H249R, N018R-S024R-N076D-S101A-I198L-H249R, N018R-S024R-N076D-S101A-I198L-T213A-H249R, N018R-S024R-N076D-S101A-N116A-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N116A-I198L-G211Q-H249R, N018R-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N116A-I198L-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-I198L-T213A-H249R, N018R-S024R-N076D-S101A-N116A-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N183D-G211Q-H249R, N018R-S024R-N076D-S101A-N183D-T213A-H249R, N018R-S024R-N076D-S101G-A232V, N018R-S024R-N076D-S103A-A232V-Q245R, N018R-S024R-N076D-T213A-H249R, N018R-S024R-N076D-V104I, N018R-S024R-Q245R, N018R-S024R-R045T-A230E-S242R, N018R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-S024R-S242R, N018R-S024R-V104I, N018R-S024R-V30S-L31S-D32I-T33Q-G34V-I35F, N018R-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-S101G-S103A-V104I, N018R-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-S101G-V104I, N018R-S103A, N018R-S103A-V104I-A232V, N018R-T022K-N043D-S101G-S103A-V104I-A232V-Q245R, N018R-T022W-S024R-N076D-G211Q-H249R, N018R-T022W-S024R-N076D-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-I198L-A215F-H249R, N018R-T022W-S024R-N076D-I198L-G211Q-H249R, N018R-T022W-S024R-N076D-I198L-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-N116A-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N116A-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N116A-I198L-T213A-H249R, N018R-T022W-S024R-N076D-N116A-Т213А-A215F-H249R, N018R-T022W-S024R-N076D-S101A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-I198L-G211Q-Q245R, N018R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-I198L-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-N116A-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-I198L-T213A-H249R, N018R-T022W-S024R-N076D-S101A-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-T213A-H249R, N018R-T022W-S024R-N076D-T213A-A215F-H249R, N018R-T22W-S024R-N076D-I198L-A215F-H249R, N018R-T22W-S024R-N076D-N116A-G211Q-H249R, N018R-T22W-S024R-N076D-N116A-G211Q-T213A-H249R, N018R-T22W-S024R-N076D-N116A-T213A-A215F-H249R, N018R-T22W-S024R-N076D-S101A-A215F-H249R, N018R-T22W-S024R-N076D-S101A-G211Q-T213A-H249R, N018R-T22W-S024R-N076D-S101A-I198L-A215F-H249R, N018R-T22W-S024R-N076D-S101A-I198L-T213A-A215F-H249R, N018R-T22W-S024R-N076D-S101A-N116A-A215F-H249R, N018R-T22W-S024R-N076D-S101A-N116A-I198L-A215F-H249R, N018R-T22W-S024R-N076D-T213A-A215F-H249R, N018R-V1041, N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N043D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R-A272V, N043D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R-R275S, N043D-S101G-S103A-V104I-A232V-Q245R, N043D-S101G-S103A-V104I-A232V-Q245R-H249R, N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N043R-N076D-S101G-S103A-V104I-L217E-A232V-Q245R, N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-V234I-Q245R, N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-R045T-S078R-S101G-S103A-V104I-N218S-A232V-Q245R, N043R-R045T-S101G-S103A-V104I-A232V-Q245R, N043R-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-S087D-S101G-S103A-V104I-A232V-Q245R, N062Q-S101A-Q236N-N252R-A270C, N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N076D-S101G-S103A-V104I-A232V-S242R-Q245R, P005S-S024R-T033S-N243F, P014L-G020R-S024R-N043R-R045T-S101A-A215F, P052N-V104L-N183D-S216F-H249R, P086W-G118R, P086W-N243F, P086W-Y209A, Q012H-G020R-S078R-S101G-S103A-V104I-I198L-G211Q-T213A-A232V-Q245R,R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R,R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R,R045T-S078R-S101G-S103A-V104I-A232V-Q245R-H249R,R045T-S101G-S103A-V104I-A232V-Q245R-N269R,R045T-S242R-H249R, S024C-T033S, S024R-A232V, S024R-G046R-Y091F-V121F, S024R-G118R-K235F, S024R-N043A-S105T-S106G-I198L, S024R-N043D-R045T-S242R-H249R, S024R-N043D-S101G-S103A-V104I-A232V-Q245R, S024R-N043D-S242R-H249R, S024R-N043R-N076D, S024R-N043R-N076D-A230E-S242R, S024R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, S024R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, S024R-N043R-R045T-S242R-H249R, S024R-N043R-S101A-T213A, S024R-N076D-Q245R, S024R-N076D-S101G-A232V-Q245R, S024R-N076D-S101G-M175L-A232V-Q245R, S024R-N076D-S101G-Q245R, S024R-N076D-S101G-S103A-V104I-A232V-Q245R, S024R-N076D-S103A-V104I-Q245R, S024R-N076D-V104I-Q245R, S024R-N243F, S024R-P086R-G118R, S024R-P086W-Y209A-K235F, S024R-P239Q, S024R-Q245R-H249R, S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-S101G, S024R-S101G-Q245R, S024R-S101G-V104I-H249R, S024R-S103A-A232V, S024R-S103A-M175L-A232V-H249R, S024R-S141G, S024R-T033S, S024R-T033S-А194Т, S024R-T033S-G118R-K235F, S024R-T033S-G118R-Y209A, S024R-T033S-K235F, S024R-T033S-S078R-G118R, S024R-T033S-S078R-N243F, S024R-T033S-Y209A, S024R-T033S-Y209A-N243F, S024R-T274I, S024R-V104I-H249R, S024R-V104I-Q245R, S024R-Y091F-I198L-A215F-P239S, S024R-Y209A, S024R-Y209A-K235F, S024R-Y209A-S242P, S078R-P086W, S078R-S099F-N116A-R186K-T224A, S078R-S101G-S103A-V104I-A232V-Q245R-H249R, S101G-A232V, S101G-S103A-V104I-A232V-H249R, S101G-S103A-V104I-A232V-Q245R-H249R-N269R, S101G-S103A-V104I-Q245R, S105T-G211Q-S216F, S106G-N185I-S216F-Q236N, T022R-S101G-S103A-V104I-V150L-A232V-Q245R, T033S-G118D-A138V-Y209A, T033S-G118R-Y209A-, T033S-L148F, T033S-N243F, T033S-P086W, T033S-P201S, T033S-S078R, T033S-W241R, T033S-Y209A, T033S-Y209A-K235F, V004M-N018R-S024R-N076D-N116A-I198L-G211Q-T213A-H249R, V104I-A232V-H249R и/или V104L-H120F-R186K-S216F-N252R. Эти варианты протеазы являются предпочтительными вариантами протеазы для использования в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет высокую ионную силу и/или высокую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит один или более из следующих наборов мутаций: A015T-T033S, A016T-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, A230E-H249R, A232V-H249R, E089I-S105T-N116A-A215F-S216F, E089I-Y091F-N185I-G211Q-A270C, G020R-A090S-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R, G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, G020R-N043R-N076D, G020R-N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, G020R-P052N-S101A-I198L-L233C, G020R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, G020R-S024R-N043D-N076D-H249R, G020R-S024R-N043D-N076D-S242R-H249R, G020R-S024R-N043D-R045T-A230E-S242R.G020R-S024R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, G020R-S024R-N043R-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, G020R-S024R-R045T-N076D-S242R-H249R, G020R-S024R-R045T-S101G-S103A-V104I-A232V-Q245R, G020R-S078R-S101A-S103A-V104I-G115E-N116A-N183D-G211Q-T213A-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R-T274I, G020R-S101A-S103A-V104I-N116A-N183D-I198L-G211Q-T213A-A215F-A232V-Q245R, G020R-S101A-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R, G020R-S101A-S103A-V104I-T213A-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R, G020R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T022R-N269R, G020R-T022R-S078R-S212F-W241R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R-N269S, G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R-T274I, G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-I198L-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N183D-I198L-A215F-A232V-Q245R, G020R-T022W-S101A-S103A-V104I-N183D-T213A-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R-N263S, G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N183D-A215F-A232V-Q245R, G020R-T022W-S101G-S103A-V104I-N183D-A232V-Q245R, G025R-N062Q-S128N-S144R-N185I, G025R-N116A-H120F-T224A-A270C, G118R-K235F, K027R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018K-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R-N269R, N018R-G020R-N043D-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-G020R-N043D-N076D-S242R-H249R, N018R-G020R-N043D-R045T-N076D-H249R, N018R-G020R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-G020R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-G020R-N043D-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-G020R-N043R-R045T-H249R, N018R-G020R-N043R-R045T-N076D-A230E-H249R, N018R-G020R-N076D, N018R-G020R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-G020R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-G020R-S024R-N043R-N076D, N018R-G020R-S024R-N076D-A131T-A215F-H249R, N018R-G020R-S024R-N076D-G211Q-H249R, N018R-G020R-S024R-N076D-G211Q-N243D-H249R, N018R-G020R-S024R-N076D-G211Q-T213A-A215F-H249R, N018R-G020R-S024R-N076D-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-I198L-A215F-H249R, N018R-G020R-S024R-N076D-I198L-H249R, N018R-G020R-S024R-N076D-I198L-T213A-A215F-H249R, N018R-G020R-S024R-N076D-N116A-G211Q-T213A-A215F-H249R, N018R-G020R-S024R-N076D-N116A-H249R, N018R-G020R-S024R-N076D-N116A-I198L-G211Q-A215F-H249R-N269S, N018R-G020R-S024R-N076D-N116A-I198L-G211Q-A215F-Q245R, N018R-G020R-S024R-N076D-N116A-I198L-H249R, N018R-G020R-S024R-N076D-N116A-N183D-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-N116A-N183D-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-N116A-N183D-I198L-A215F-H249R, N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-N116A-N183D-I198L-H249R, N018R-G020R-S024R-N076D-N116A-N183D-T213A-H249R, N018R-G020R-S024R-N076D-N183D-A215F-H249R, N018R-G020R-S024R-N076D-N183D-G211Q-H249R, N018R-G020R-S024R-N076D-N183D-G211Q-T213A-A215F-H249R, N018R-G020R-S024R-N076D-N183D-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-N183D-I198L-A215F-H249R, N018R-G020R-S024R-N076D-N183D-I198L-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-N204D-T213A-H249R, N018R-G020R-S024R-N076D-S101A-G211Q-A215F-H249R-N269D, N018R-G020R-S024R-N076D-S101A-H249R, N018R-G020R-S024R-N076D-S101A-I198L-T213A-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N116A-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N116A-N183D-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N116A-T213A-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N116A-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N183D-G211Q-H249R, N018R-G020R-S024R-N076D-S101A-N183D-I198L-A215F-H249R, N018R-G020R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N183D-I198L-T213A-H249R, N018R-G020R-S024R-N076D-S101A-N183D-T213A-A215F-H249R, N018R-G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-S024R-S101G-S103A-V104I-A232V-Q245R, N018R-G020R-T022W-S024R-N076D-I198L-T213A-H249R, N018R-G020R-T022W-S024R-N076D-N116A-I198L-H249R, N018R-G020R-T022W-S024R-N076D-N116A-I198L-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-N116A-N183D-I198L-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-N116A-N183D-T213A-H249R, N018R-G020R-T022W-S024R-N076D-N183D-G211Q-T213A-H249R, N018R-G020R-T022W-S024R-N076D-N183D-I198L-G211Q-H249R, N018R-G020R-T022W-S024R-N076D-S101A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-G211Q-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-G211Q-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-G211Q-T213A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-I198L-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-G211Q-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-I198L-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-T213A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N116A-T213A-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N183D-A215F-H249R, N018R-G020R-T022W-S024R-N076D-S101A-N183D-G211Q-A215F-H249R, N018R-G020R-T022W-S024R-N076D-T213A-H249R, N018R-N043D-A230E-H249R, N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N043D-N076D-S242R-H249R, N018R-N043D-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-A272D, N018R-N043R-N076D-A230E-H249R, N018R-N043R-N076D-S242R, N018R-N043R-R045T-A230E-S242R, N018R-N043R-R045T-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-N043R-S078R-S101G-S103A-V104I-A232V-Q245R, N018R-N043R-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-N076D-A232V-H249R, N018R-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N018R-N076D-S101G-I198T-A232V, N018R-N076D-S101G-S103A-V104I-Q245R, N018R-N076D-S101G-V104I, N018R-N076D-S242R, N018R-N076D-S242R-H249R, N018R-N076D-V104I-Q245R-H249R, N018R-R045T-H249R, N018R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R, N018R-S024R-N043D-N076D-S087D-H249R, N018R-S024R-N043D-N076D-S242R, N018R-S024R-N076D-A086V-S101A-N183D-I198L-G211Q-H249R, N018R-S024R-N076D-A215F-H249R, N018R-S024R-N076D-A232V, N018R-S024R-N076D-I198L-A215F-H249R, N018R-S024R-N076D-I198L-G211Q-H249R, N018R-S024R-N076D-I198L-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-I198L-H249R, N018R-S024R-N076D-I198L-T213A-H249R, N018R-S024R-N076D-L217E-H249R-N269R, N018R-S024R-N076D-N116A-A150T-T213A-H249R, N018R-S024R-N076D-N116A-G211Q-T213A-H249R, N018R-S024R-N076D-N116A-I198L-G211Q-H249R, N018R-S024R-N076D-N116A-I198L-T213A-A215F-H249R, N018R-S024R-N076D-N116A-N183D-A215F-H249R, N018R-S024R-N076D-N116A-N183D-G211Q-A215F-H249R, N018R-S024R-N076D-N116A-N183D-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N116A-N183D-G211Q-T213A-H249R, N018R-S024R-N076D-N116A-N183D-H249R, N018R-S024R-N076D-N116A-N183D-I198L-A215F-H249R, N018R-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-N116A-N183D-I198L-G211Q-H249R, N018R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-N116A-N183D-I198L-H249R, N018R-S024R-N076D-N116A-N183D-I198L-T213A-H249R, N018R-S024R-N076D-N116A-N183D-T213A-A215F-H249R, N018R-S024R-N076D-N116A-N183D-T213A-H249R, N018R-S024R-N076D-N183D-A215F-H249R, N018R-S024R-N076D-N183D-G211Q-H249R, N018R-S024R-N076D-N183D-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-N183D-G211Q-T213A-H249R, N018R-S024R-N076D-N183D-H249R, N018R-S024R-N076D-N183D-H249R-A248T, N018R-S024R-N076D-N183D-I198L-A215F-H249R, N018R-S024R-N076D-N183D-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-N183D-I198L-G211Q-H249R, N018R-S024R-N076D-N183D-I198L-H249R, N018R-S024R-N076D-N183D-I198L-T213A-A215F-H249R, N018R-S024R-N076D-N183D-I198L-T213A-H249R, N018R-S024R-N076D-N183D-T213A-H249R, N018R-S024R-N076D-S087D-H249R, N018R-S024R-N076D-S101A-G211Q-T213A-A215F-H249R-A270V, N018R-S024R-N076D-S101A-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-S101A-N116A-G211Q-A215F-H249R, N018R-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N116A-H249R, N018R-S024R-N076D-S101A-N116A-I198L-G211Q-A215F-H249R, N018R-S024R-N076D-S101A-N116A-I198L-H249R, N018R-S024R-N076D-S101A-N116A-I198L-T213A-H249R, N018R-S024R-N076D-S101A-N116A-N183D-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-G211Q-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-G211Q-H249R, N018R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N116A-N183D-H249R, N018R-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N116A-N183D-I198L-H249R, N018R-S024R-N076D-S101A-N116A-N183D-I198L-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N116A-N183D-T213A-H249R, N018R-S024R-N076D-S101A-N183D-A215F-H249R, N018R-S024R-N076D-S101A-N183D-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N183D-H249R, N018R-S024R-N076D-S101A-N183D-I198L-A215F-H249R, N018R-S024R-N076D-S101A-N183D-I198L-G211Q-H249R, N018R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-H249R, N018R-S024R-N076D-S101A-N183D-I198L-H249R, N018R-S024R-N076D-S101A-N183D-I198L-T213A-A215F-H249R, N018R-S024R-N076D-S101A-N183D-I198L-T213A-H249R, N018R-S024R-N076D-S101A-N183D-T213A-A215F-H249R, N018R-S024R-N076D-S101A-T213A-A215F-H249R, N018R-S024R-N076D-S101A-V197A-T213A-A215F-H249R, N018R-S024R-N076D-S101G, N018R-S024R-N076D-S101G-Q245R, N018R-S024R-N076D-S101G-S103A-V104I-A232V, N018R-S024R-N076D-S103A-H249R, N018R-S024R-N076D-S103A-V104I-L135I-A232V, N018R-S024R-N076D-T213A-A215F-H249R-T260K, N018R-S024R-N076D-V150L-S242R-H249R, N018R-S024R-R045T-A230E-H249R, N018R-S101G-S103A-V104I-A232V-Q245R-H249R, N018R-T022R-S024R-N076D-S101A-N116A-N183D-G211Q-H249R, N018R-T022W-S024R-N076D-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-I198L-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-I198L-H249R, N018R-T022W-S024R-N076D-I198L-T213A-H249R, N018R-T022W-S024R-N076D-N116A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-H249R, N018R-T022W-S024R-N076D-N116A-I198L-A215F-H249R, N018R-T022W-S024R-N076D-N116A-I198L-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-N116A-I198L-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-I198L-H249R, N018R-T022W-S024R-N076D-N116A-I198L-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-G211Q-H249R, N018R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-Q245R, N018R-T022W-S024R-N076D-N1116A-N183D-I198L-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-A209V-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-H249R, N018R-T022W-S024R-N076D-N116A-N183D-I198L-Y209H-G211Q-H249R, N018R-T022W-S024R-N076D-N116A-N183D-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N116A-N183D-T213A-H249R, N018R-T022W-S024R-N076D-N183D-G211Q-H249R, N018R-T022W-S024R-N076D-N183D-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-N183D-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N183D-H249R, N018R-T022W-S024R-N076D-N183D-I198L-A215F-H249R, N018R-T022W-S024R-N076D-N183D-I198L-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-N183D-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-N183D-I198L-H249R, N018R-T022W-S024R-N076D-N183D-T213A-H249R, N018R-T022W-S024R-N076D-S101A-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-S101A-I198L-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-S101A-I198L-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N116A-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N116A-T213A-A215F-H249R-L267I, N018R-T022W-S024R-N076D-S101A-N116T-I198L-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N183D-G211Q-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N183D-G211Q-H249R, N018R-T022W-S024R-N076D-S101A-N183D-G211Q-T213A-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N183D-G211Q-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N183D-I198L-A215F-H249R, N018R-T022W-S024R-N076D-S101A-N183D-I198L-T213A-H249R, N018R-T022W-S024R-N076D-S101A-N183D-I198L-Y209H-H249R, N018R-T022W-S024R-N076D-S101A-N183D-T213A-A215F-H249R, N018R-T22W-S024R-N076D-G211Q-T213A-H249R, N018R-T22W-S024R-N076D-N116A-I198L-T213A-H249R, N018R-T22W-S024R-N076D-S101A-I198L-H249R, N018R-V104I-A232V, N043A-Q059A-S101A-S216F-T224A, N043D-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, N043D-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R, N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R, N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043D-S242R-H249R, N043R-A230E-H249R, N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, N043R-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N043R-N076D-S101G-S103T-V104I-A232V-Q245R-H249R-N269R, N043R-R045T-H249R, N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R, N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R, N043R-R045T-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N043R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R, N043R-S078R-S101G-S103A-V104I-L217E-A232V-Q245R, N043R-S101G-S103A-V104I-Q245R-H249R, N043R-S101G-S103A-V104I-V150L-A232V-Q245R-N269R, N076D-A232V-Q245R, N076D-Q245R, N076D-S101G-A232V-Q245R, N076D-S101G-S103A-Q245R, N076D-S101G-S103A-V104I-A232V-H249R, N076D-S101G-S103A-V104I-H249R, N076D-S101G-S103A-V104I-V150L-A232V-Q245R, N076D-S101G-V104I-H249R, N076D-S101G-V104I-Q245R, N076D-S103A-V104I-A232V-Q245R, N076D-S103A-V104I-Q245R, N076D-V104I-A232V-Q245R, N076D-V104I-Q245R, P005S-N018R-T022W-S024R-N076D-S101A-T213A-A215F-H249R, P086W-K235F, P086W-Y209A-K235F, Q012H-V104A-G118R, R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, R045T-S101G-S103A-V104I-A232V-Q245R, S024R-G118R-N243F-R269H, S024R-K235F-N243F, S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R, S024R-N043R-N076D-A230E-H249R, S024R-N076D-A232V-H249R, S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R, S024R-N076D-S101G, S024R-N076D-S101G-A232V-H249R, S024R-N076D-S101G-S103A-A232V, S024R-N076D-S101G-S103A-V104I-M175L-H249R, S024R-N076D-S101G-S103A-V104I-Q245R, S024R-N076D-S101G-V104I-A232V-H249R, S024R-N076D-S103A-H249R, S024R-N076D-S103A-Q245R, S024R-N076D-S103A-V104I-H249R, S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R, S024R-R045T-S242R-A273V, S024R-R247H, S024R-S101G-S103A, S024R-S101G-S103A-A232V, S024R-S101G-S103A-V104I, S024R-S103A-Q245R-H249R, S024R-S103A-V104I, S024R-S106G-N116A-S212M-T224A, S024R-T033S-A151V, S024R-T033S-A174V-K235F, S024R-T033S-A228T, S024R-T033S-K235F-W241R, S024R-T033S-N243F, S024R-V104A, S024R-V104I-A232V, S024R-Y209A-N243F, S078R-K235F, S087D-S101G-S103A-V104I-A232V-S242R-Q245R, S099F-S105T-S106G-A194F-S212M, S101G-H249R, S101G-S103A-V104I, S101G-S103A-V104I-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R, S101G-S103A-V104I-G159D-A232V-Q245R-N248R, S101G-S103A-V104I-V150L-A232V-Q245R, S103A-A232V, S103A-A232V-H249R, S103A-A232V-Q245R, S103A-V104I-Q245R, S103N-H120F-Y167W-I198L-L233C, T022W-A194F-T213A-L233C-N238L, T022W-E089I-S216F, T033S-A048T, T033S-P086W-S156L-Y209A, T033S-P239T, T033S-T253A, T057R-N183D-Q236N, T143A-Y209A, V004E-T033S-S078R, V004R-S009A-T022R-S078R-S212F и/или Y209A-K235F. Эти варианты протеазы являются полезными вариантами протеазы для использования в способах обработки и/или очистки поверхностей, в которых (i) поверхность вводят в контакт с составом, содержащим вспомогательный материал и вариант протеазы в водном промывном растворе; и (ii) поверхность затем промывают и/или высушивают, при этом водный промывной раствор предпочтительно имеет высокую ионную силу и/или высокую концентрацию моющих средств.

В одном аспекте указанного состава, указанный вариант протеазы содержит три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций в группе положений, содержащей положения 1, 2, 3, 4, 8, 9, 10, 12, 14, 15, 16, 17, 18, 20, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 38, 40, 42, 43, 45, 46, 48, 50, 51, 52, 55, 57, 59, 60, 62, 63, 64, 68, 69, 71, 72, 74, 75, 76, 78, 79, 81, 82, 85, 86, 89, 91, 92, 94, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 111, 112, 114, 115, 116, 117, 118, 119, 120, 121, 123, 124, 128, 129, 132, 138, 144, 147, 148, 158, 159, 160, 166, 167, 175, 177, 181, 182, 183, 185, 186, 188, 192, 194, 197, 198, 203, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 224, 227, 230, 231, 232, 233, 234, 235, 236, 238, 239, 240, 241, 242, 243, 244, 245, 246, 248, 249, 250, 251, 252, 253, 254, 256, 258, 260, 262, 263, 265, 267, 269, 270, 271, 272, 273 и 274.

В одном предпочтительном аспекте указанного состава, указанный вариант протеазы содержит три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций в группе положений, содержащей положения 1, 2, 4, 9, 10, 14, 16, 17, 18, 20, 22, 24, 25, 26, 42, 43, 46, 52, 57, 59, 62, 68, 71, 72, 74, 75, 76, 78, 82, 86, 89, 91, 94, 100, 101, 103, 104, 106, 108, 111, 112, 115, 117, 118, 121, 128, 129, 144, 148, 158, 159, 160, 166, 185, 186, 188, 197, 203, 209, 210, 212, 214, 215, 217, 224, 230, 231, 236, 238, 239, 241, 242, 243, 244, 248, 249, 250, 252, 253, 262, 263, 265, 267, 269, 271 и 272.

В одном аспекте указанного состава, указанный вариант протеазы содержит всего три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций, выбранных из: A001R, Q002S, Q002M, Q002A, Q002R, Q002W, S003R, V004R, V004S, V004C, I008A, S009A, S009F, S009W, R010S, R010A, R010H, R010M, Q012F, Q012R, P014K, P014F, P014Q, A015R, A015F, A016S, H017R, H017M, H017F, N018R, N018K, G020F, G020K, G020R, T022A, T022R, T022Y, T022V, T022Q, T022L, T022W, G023A, G023S, G023F, S024R, S024F, S024W, S024Q, S024H, S024L, G025V, G025F, G025R, V026F, K027L, K027F, K027R, K027V, V028A, V028N, V028E, A029T, V030E, L031F, T033S, T033G, T033D, G034P, I035M, S036T, S036F, S036R, T038L, T038F, T038R, P040N, P040L, P040T, P040W, P040H, P040R, L042I, N043A, N043F, N0431, N043S, N043R, N043M, N043W, N043D, R045T, G046R, A048R, F050C, V051W, V051F, V051H, P052F, P052E, P052N, P055Y, T057R, Q059A, Q059F, Q059R, D060P, D060Q, D060A, N062E, N062Q, G063V, G063M, G063T, G063I, G063A, G063S, G063H, G063Q, G063D, G063E, G063P, H064F, H064T, V068A, V068C, A069N, A069T, A069P, A069W, T071G, I072C, A074C, L075A, L075F, L075E, L075R, N076D, S078R, S078N, S078I, I079W, I079Q, V081R, L082F, L082T, L082V, L082R, L082M, A085M, P086W, P086L, P086I, E089P, E089T, E089G, E089H, E089L, E089V, E089W, E089F, E089I, Y091N, Y091F, A092F, K094N, S099F, S099T, S099P, S099G, S099M, G100S, G100N, G100Q, G100I, S101A, S101N, S101G, S101T, S101D, S101E, S101P, S101F, G102A, G102T, G102N, G102H, G102E, S103G, S103N, S103D, S103A, V104L, V104I, V104E, V104D, S105T, S105E, S105Q, S106G, S106T, S106E, S106D, S106A, S106V, S106F, I107M, I107F, A108I, A108G, Q109M, L111V, L111I, E112V, E112L, E112Q, A114G, G115K, G115R, N116K, N116A, N116L, N117F, G118R, G118I, M119C, H120A, H120F, H120R, V121F, V121E, N123G, N123E, L124S, S128D, S128F, S128L, S128N, S128H, S128M, S128I, S128Q, P129E, S132A, S132E, A138G, S144R, V147L, L148I, A158E, G159D, G159E, G159C, S160D, S166D, S166E, Y167W, M175V, V177C, D181A, Q182R, N183I, N183D, N183M, N183F, N183R, N185E, N185V, N185I, R186H, R186K, S188E, S188D, S188R, Y192H, Y192W, A194E, A194V, A194F, D197F, I198L, I198F, V203E, V203C, T208S, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, Y209L, P210R, P210V, P210L, G211Q, G211R, S212I, S212M, S212F, T213A, Y214F, A215N, A215D, A215E, A215H, A215F, S216F, S216A, L217E, L217N, L217D, N218D, N218P, N218E, T224A, T224G, V227I, A230E, A231I, A231C, A232V, L233C, V234F, K235F, Q236F, Q236N, Q236H, N238R, N238K, N238L, P239K, P239G, P239R, P239H, P239T, P239N, P239S, P239F, S240R, W241R, S242L, S242R, N243F, N243R, V244R, Q245R, I246S, N248D, N248V, N248I, N248R, H249R, H249T, L250I, K251R, K251S, N2521, N252F, N252R, N252K, N252H, T253I, T253R, T253F, A254C, S256N, G258R, T260V, T260I, L262D, L262H, Y263F, S265F, L267V, L267N, L267M, N269I, N269R, E270C, E271I, E271V, E271H, E271M, E271L, E271P, E271A, E271F, E271T, A272F, A272F, A272R, A273F, A273I и T274G.

В одном предпочтительном аспекте указанного состава, указанный вариант протеазы содержит всего три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или даже 25 мутаций, выбранных из: A1R, Q2S, V4R, V4S, S9A, R10S, Р14К, A16S, H17R, N18R, G20R, Т22А, T22R, S24R, S24W, G25R, G25V, V26F, L42I, N43R, N43A, G46R, P52F, Р52Е, P52N, T57R, Q59A, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, L75R, N76D, S78R, L82R, P86W, Е89Р, E89T, E89G, Е89Н, E89I, E89V, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, S106V, S106G, A108I, L111V, E112V, G115K, G115R, N117F, G118I, V121F, S128D, S128F, S128L, S128N, P129E, S144R, L148I, A158E, G159E, S160D, S166D, N185E, N185I, R186H, S188E, S188D, D197F, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, N248V, H249R, L250I, N252R, T253R, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H, E271P, E271T, E271V, E271L и A272F; и необязательно одну или более из следующих мутаций: S103A, G159D, Q236H, Q245R, N248D и N252K.

В одном аспекте указанного состава, в частности для использования при высоких концентрациях моющих средств или ионной силы, указанный вариант протеазы содержит:

a) две или более из следующих мутаций: A1R, Q2S, V4R, V4S, S9A, R10S, P14K, A16S, Т22А, T22R, S24R, G25V, V26F, L42I, P52F, Р52Е, P52N, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, S78R, Е89Р, E89T, E89G, Е89Н, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, A108I, L111V, E112V, G115K, N117F, V121F, S128D, S128F, S128L, S128N, P129E, L148I, A158E, G159E, S160D, S166D, N185E, R186H, S188E, S188D, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, N248V, H249R, L250I, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, Е271Н и A272F; и/или

b) один или более из следующих наборов мутаций: N062E-P129E, N062E-G159E, A016S-L148I, A158E-H249R, A016S-N062E, L111V-S188D, T022A-N062E, N062E-L148I, Т022А-Р129Е, N062E-E271F, N062E-A158E, A016S-G159E, N062E-R186H, S128N-G159E, N062E-S188D, N062E-S128N, L148I-G159E, S103G-A158E, L111V-G159E, A158E-E271F, A016S-S188D, T022A-L111V, S128N-A158E, A016S-A158E, V104L-A158E, S128N-R186H, G159E-Y209E, N062E-S101A, L111V-Y209E, L148I-S188D, S101A-Y209E, T022A-S188D, A016S-T022A, S128N-P129E, A016S-Y209E, A016S-S128N, Т022А-E089P, S128N-Y209E, E089P-A158E, N062E-S103G, R186H-E271F, A016S-P129E, E089P-G159E, L111V-H249R, S101A-P129E, L148I-Y209E, T022A-G159E, P129E-H249R, P129E-Y209E, V104L-P129E, S128N-S188D, L111V-A158E, T022A-A158E, N062E-Y209E, N062E-H249R, S101A-R186H, E089P-P129E, P129E-E271F, T22A-L111V-G159E, S101A-S103G-V104L-Y209E, S101A-S103G-V104L-G159E, S101A-S103G-V104L-S188D, S101G-S103A-V104I-G159D, T22A-S103G-G159E, T22A-S128N-E271F-Y209E, T22A-Y209E-E271F, T22A-S101A-Y209E, S101A-Y209E-E271F, T22A-L111V-S128N, T22A-S101A-G159E, S101A-S103G-V104L, T22A-S101A-S103G-V104L, S101A-S103G-V104L, S101G-S103A-V104I, S101A-S103G-V104L-S128N, S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D и S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F;

указанный вариант протеазы имеет общий суммарный заряд 0, +1, +2, +3, +4 или +5, предпочтительно имеет общий суммарный положительный заряд, наиболее предпочтительно +1, +2 или+3, относительно B. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: X1R, X230E, X271L, X115R, X20R, X249R, X235F, X27V/F/L, X75E, X82R, X18R, X269R, X43D, X43R, X76D, X45T, X212F, X242R, X24R, X78R, X9A, X22R, X121E, X244R, X28E, X30E, X4R и X241R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' приведенной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы A1R, A230E, E271L, G115R, G20R, H249R, K235F, K27V/F/L, L75E, L82R, N18R, N269R, N43D, N43R, N76D, R45T, S212F, S242R, S24R, S78R, S9A, T22R, V121E, V244R, V28E, V30E, V4R и W241R, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы AIR, A230E, E271L, G115R, G20R, H249R, K235F, K27V/F/L, L75E, L82R, N18R, N269R, N43D, N43 R, N76D, R45T, S212F, S242R, S24R, S78R, S9A, T22R, V121E, V244R, V28E, V30E, V4R и W241R, и необязательно содержит, по меньшей мере, одну мутацию, выбранную из группы S103A, G159D, Q236H, Q245R, N248D и N252K, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, где указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: X16S, X18R, X20R, Х22А, X24R, X43R/D, Х45Т, X76D, X101A, X103G, X104L, X111V, X128N, X148I, X230E, X242R и X249R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: A16S, N18R, G20R, T22A, S24R, N43R, N43D, R45T, N76D, S101A, S103G, V104L, L111V, S128N, L148I, A230E, S242R и H249R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: X20R-X43R-X249R, X20R-X22R-X43R, X20R-X43R-X242R, X20R-X43R-X271L, X20R-X43R-X244R, X20R-X24R-X43R-X242R, X9A-X22R-X78R-X212F-X241R, X9A-X20R-X43R-X212F, X9A-X43R-X212F, X20R-X43R-X212F, X20R-X22R-X43R-X212F, X24R-X78R-X212F, X9A-X43R-X78R, X9A-X43R-X78R-X242R, X9A-X20R-X43R-X78R, X20R-X24R-X43R-X78R-X242R, X22R-X24R-X78R-X212F, X9A-X20R-X43R-X78R-X242R, X20R-X43R-X78R-X249R, X20R-X43R-X78R, X9A-X78R-X212F, X9A-X22R-X43R-X78R, X9A-X20R-X24R-X43R, X9A-X22R-X78R-X212F, X4R-X9A-X22R-X78R-X212F, X20R-X24R-X43R, X1R-X9A-X43R, X20R-X24R-X43R-X115R, X9A-X24R-X43R, X20R-X22R-X24R-X43R, X1R-X24R-X43R, X9A-X20R-X24R-X43R-X242R, X9A-X20R-X22R-X78R-X212F, X9A-X24R-X43R-X244R, X9A-X24R-X43R-X242R, X4R-X9A-X22R-X24R-X212F и X22R-X24R-X43R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: A1R, A230E, E271L, G115R, G20R, H249R, K235F, K27V/F/L, L75E, L82R, N18R, N269R, N43D, N43R, N76D, R45T, S212F, S242R, S24R, S78R, S9A, T22R, V121E, V244R, V28E, V30E, V4R, W241R, G20R-N43R-H249R, G20R-T22R-N43R, G20R-N43R-S242R, G20R-N43R-E271L, G20R-N43R-V244R, G20R-S24R-N43R-S242R, S9A-T22R-S78R-S212F-W241R, S9A-G20R-N43R-S212F, S9A-N43R-S212F, G20R-N43R-S212F, G20R-T22R-N43R-S212F, S24R-S78R-S212F, S9A-N43R-S78R, S9A-N43R-S78R-S242R, S9A-G20R-N43R-S78R, G20R-S24R-N43R-S78R-S242R, T22R-S24R-S78R-S212F, S9A-G20R-N43R-S78R-S242R, G20R-N43R-S78R-H249R, G20R-N43R-S78R, S9A-S78R-S212F, S9A-T22R-N43R-S78R, S9A-G20R-S24R-N43R, S9A-T22R-S78R-S212F, V4R-S9A-T22R-S78R-S212F, G20R-S24R-N43R, A1R-S9A-N43R, G20R-S24R-N43R-G115R, S9A-S24R-N43R, G20R-T22R-S24R-N43R, A1R-S24R-N43R, S9A-G20R-S24R-N43R-S242R, S9A-G20R-T22R-S78R-S212F, S9A-S24R-N43R-V244R, S9A-S24R-N43R-S242R, V4R-S9A-T22R-S24R-S212F и T22R-S24R-N43R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: X101G-X103A-X104I-X232V-X245R-X248D, X101G-X103A-X1041-X159D-X232V-X245R, X101G-X103A-X1041-X159R-X232V-X245R-X248D, X101G-X103A-X1041-X159D-X232V-X245R-X248R, X101G-X103A-X104I-X232V-X245R, X101G-X103A-X104I-X232V-X245R-X248R, X101G-X103A-X104I-X159R-X232V-X245R-X248R и X101G, X103A, X104I, X232V, Х236Н, X245R и X252K, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: S101G-S103A-V104I-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R, S101G-S103A-V104I-G159R-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248R, S101G-S103A-V104I-A232V-Q245R, S101G-S103A-V104I-A232V-Q245R-N248R, S101G-S103A-V104I-G159R-A232V-Q245R-N248R, S101G, S103A, V104I, A232V, Q236H и Q245R, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: X16S, X22A, X24R, X62E, X76D, Х89Р, X101A/G, X103G/A, X104L/I, X111V, X128N, Х129Е, X232V, X148I, X158E, X159D/E, X166D, X186H, X188D, X209E, X236H, X238R, X245R, X248D/R, X249R, X252K/R, X253R и X271F, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, при этом указанный вариант протеазы является зрелой формой, имеющей протеолитическую активность, и содержит аминокислотные последовательности, содержащие комбинацию аминокислотных замещений, выбранных из: A16S, T22A, S24R, N62E, N76D, Е89Р, S101A/G, S103G/A, V104L/I, L111V, S128N, Р129Е, A232V, L148I, A158E, G159D/E, R186H, S188D, Y209E, Q236H, Q245R, N248D/R, H249R, N252K/R, T253R и E271F, при этом аминокислотные положения варианта субтилизина пронумерованы в соответствии с аминокислотной последовательностью B. amyloliquefaciens субтилизина BPN' показанной как SEQ ID NO:2.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, или 25 мутаций, выбранных из группы A16S, Т22А, S24R, N62E, N76D, Е89Р, S101A/G, S103G/A, V104L/I, L111V, S128N, P129E, A232V, L148I, A158E, G159D/E, R186H, S188D, Y209E, Q236H, Q245R, N248D/R, H249R, N252K7R, T253R и E271F, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1, и при этом общий суммарный заряд варианта протеазы составляет 0, +1, +2, +3, +4, +5, -1, -2, -3, -4 или -5 относительно общего суммарного заряда Bacillus lentus субтилизин GG36 протеазы, и при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы A1R, Q2S, V4R, V4S, S9A, R10S, P14K, A16S, H17R, N18R, G20R, T22A, T22R, S24R, S24W, G25R, G25V, V26F, L42I, N43R, N43A, G46R, P52F, P52E, P52N, T57R, Q59A, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, L75R, N76D, S78R, L82R, P86W, E89P, E89T, E89G, Е89Н, E89I, E89V, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, S106V, S106G, A108I, L111V, E112V, G115K, G115R, N117F, G118I, V121F, S128D, S128F, S128L, S128N, P129E, S144R, L148I, A158E, G159E, S160D, S166D, N185E, N185I, R186H, S188E, S188D, D197F, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, N248V, H249R, L250I, N252R, T253R, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H, E271P, E271T, E271V, E271L и A272F, и необязательно содержит, по меньшей мере, одну мутацию, выбранную из группы S103A, G159D, Q236H, Q245R, N248D и N252K, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы A16S, T22A, S24R, N62E, N76D, E89P, S101A/G, S103G/A, V104L/I, L111V, S128N, P129E, A232V, L148I, A158E, G159D/E, R186H, S188D, Y209E, Q236H, Q245R, N248D/R, H249R, N252K/R. T253R и E271F, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы A1R, A230E, E271L, G115R, G20R, H249R, K235F, K27V/F/L, L75E, L82R, N18R, N269R, N43D, N43R, N76D, R45T, S212F, S242R, S24R, S78R, S9A, T22R, V121E, V244R, V28E, V30E, V4R и W241R, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотной последовательностью.

В одном аспекте указанного состава, указанный состав содержит вариант протеазы, содержащий аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1, при этом указанный вариант протеазы содержит аминокислотную последовательность, которая отличается от аминокислотной последовательности SEQ ID NO:1 на не более, чем две, три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 мутаций, выбранных из группы A1R, A230E, E271L, G115R, G20R, H249R, K235F, K27V/F/L, L75E, L82R, N18R, N269R, N43D, N43R, N76D, R45T, S212F, S242R, S24R, S78R, S9A, T22R, V121E, V244R, V28E, V30E, V4R и W241R, и необязательно содержит, по меньшей мере, одну мутацию, выбранную из группы S103A, G159D, Q236H, Q245R, N248D и N252K, при этом аминокислотные положения варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN' показанной в SEQ ID NO:2, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизин BPN' аминокислотой последовательностью.

В одном аспекте указанного состава указанный вариант протеазы содержит:

a) две или более из следующих мутаций V4R, H17R, N18R, G20R, T22R, S24R, S24W, G25R, N43R, N43A, G46R, P52F, P52N, T57R, Q59A, N62Q, T71G, L75R, N76D, S78R, L82R, P86W, Е89Р, E89W, Е89Т, E89I, Е89Н, E89V, V104L, S106V, S106G, G115R, G118I, V121F, S144R, N185I, D197F, Y209N, Y209S, L217E, A231I, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, H249R, N252R, T253R, Е271Т, E271V, E271L, Е271Н, E271F, Е271Р, A1R, S9A, S212F и N269R; и/или

b) один или более из следующих наборов мутаций T022R-S024R, S009A-E271L, N018R-W241R, N018R-G115R, N043R-H249R, G020R-H249R, V004R-H249R, G020R-S024R, N018R-H249R, S009A-G020R, G020R-W241R, S009A-S078R, G020R-G115R, N018R-S024R, S024R-S242R, T022R-G115R, N018R-N043R, G020R-N043R, N018R-S242R, S242R-N269R, N018R-V244R, S024R-N269R, G020R-E271L, S024R-E271L, V004R-S009A, G020R-N269R, A001R-S024R, V244R-E271L, S009A-N018R, W241R-E271L, V004R-S024R, S009A-H249R, S009A-T022R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K и S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K;

указанный вариант протеазы имеет общий суммарный заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, относительно B. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1.

В одном аспекте указанного состава, указанный состав содержит вторую неиммуноэквивалентную протеазу, выбранную из группы, содержащей:

a) субтилизины (ЕС 3.4.21.62);

b) трипсин-подобные или химотрипсин-подобные протеазы;

c) металлопротеазы; и

d) их смеси.

В одном аспекте указанного состава, указанный состав содержит вторую не-иммуноэквивалентную протеазу, выбранную из группы, содержащей:

a) субтилизины (ЕС 3.4.21.62) полученные из B. subtilis, B. amyloliquefaciens, Bacillus pumilus и Bacillus gibsonii;

b) трипсиновые протеазы и/или химотрипсиновые протеазы, полученные из Cellumonas;

c) металлопротеазы, полученные из Bacillus amyloliquefaciens; и

d) их смеси.

В одном аспекте указанного состава, указанный состав содержит дополнительный фермент, выбранный из группы, состоящей из гемицеллюлаз, пероксидаз, протеаз, целлюлаз, целлобиоза дегидрогеназ, ксилоглюканаз, ксиланаз, липаз, фосфолипаз, эстераз, кутиназ, пектиназ, маннаназ, пектат лиаз, кератиназ, редуктаз, оксидаз, фенолоксидаз, липоксигеназ, лигниназ, пуллуланаз, танназ, пентозаназ, лихеназ, глюканаз, арабинозидаз, гиалуронидаз, хондроитиназ, лакказ, амилаз и их смесей.

В одном аспекте указанного состава, указанный дополнительный фермент выбирают из группы, состоящей из:

a) липаз первого промывания;

b) альфа-амилаз;

c) бактериальных чистящих целлюлаз; и

d) их смесей.

В одном аспекте указанного состава, относительно указанного вспомогательного материала(ов), в указанном составе

a) указанный инкапсулят содержит отдушку, содержащую микрокапсулу отдушки;

b) указанный оттеночный агент содержит материал, выбранный из группы, состоящей из основных, кислотных, гидрофобных, прямых и полимерных красителей, и конъюгатов красителей, имеющих длину волны пика поглощения от 550 нм до 650 нм и их смеси;

c) указанное моющее поверхностно-активное вещество содержит материал, выбранный из группы, состоящей из анионных моющих поверхностно-активных веществ, неионных моющих поверхностно-активных веществ, катионных моющих поверхностно-активных веществ, цвиттерионных моющих поверхностно-активных веществ и амфотерных моющих поверхностно-активных веществ и их смесей;

d) указанный структурообразователь содержит материал, выбранный из группы, состоящей из цеолитов, фосфатов и их смесей;

e) указанная силикатная соль содержит материал, выбранный из группы, состоящей из силаката натрия, силиката калия и их смесей;

f) указанный осветлитель предпочтительно содержит материал, выбранный из группы, состоящей из растворимых в холодной воде осветлителей и их смесей;

g) указанный карбоксилатный полимер содержит материал, выбранный из группы, состоящей из малеатного/акрилатного статистического сополимера или полиакрилатного гомополимера и их смесей;

h) указанный полимер, высвобождающий загрязнения, содержит материал, выбранный из группы, состоящей из терефталатных сополимеров и их смесей;

i) указанный целлюлозный полимер содержит материал, выбранный из группы, состоящей из алкилцеллюлозы. алкилалкоксиалкилцеллюлозы, карбоксиалкилцеллюлозы, алкилкарбоксиалкилцеллюлозы и их смесей;

j) указанный катализатор отбеливания содержит катализатор переходных металлов или лиганд для образования катализатора переходных металлов, или предпочтительно материал, выбранный из группы, состоящей из иминий катионов, иминий полиионов; иминий цвиттерионов; модифицированных аминов; модифицированных аминоксидов; N-сульфонил иминов; N-фосфонил иминов; N-ацил иминов; тиадиазол диоксидов; перфториминов; циклических сахарных кетонов и их смесей;

k) указанный активатор отбеливания содержит материал, выбранный из группы, состоящей из додеканоил оксибензол сульфоната, деканоил оксибензол сульфоната, деканоил оксибензойной кислоты или ее солей, 3,5,5-триметил гексаноилоксибензол сульфоната, тетраацетил этилендиамина (TAED), нонаноилоксибензолсульфоната (NOBS) и их смесей;

l) указанный источник перекиси водорода содержит материал, выбранный из группы, состоящей из неорганических пергидратных солей, включая соли щелочных металлов такие как натриевые соли пербората (обычно моно- или тетрагидрат), перкарбоната, персульфата, перфосфата, персиликатные соли и их смеси;

m) указанный хелатирующий агент содержит материал, выбранный из группы, состоящей из DTPA(диэтилентриаминпентауксусной кислоты), HEDP (гидроксиэтандифосфониевой кислоты), DTPMP (диэтилентриаминпента(метиленфосфониевой кислоты)), этилендиаминдиянтарной кислоты (EDDS), 1,2-дигидроксибензол-3, 5-дисульфоновой кислоты динатриевой соли гидрата, производных указанных хелатирующих агентов; и

n) их смеси.

В одном аспекте указанного состава, указанный состав содержит оттеночный агент для ткани, выбранный из группы, состоящей из

a) красителей;

b) конъюгатов краситель-глина, содержащих, по меньшей мере, один катионный основной краситель и смектитовую глину; и

c) их смесей.

В одном аспекте указанного состава, указанный состав содержит оттеночный агент для ткани, выбранный из группы, состоящей из

a) низкомолекулярных красителей; полимерных красителей и их смесей;

b) конъюгатов краситель-глина, содержащих, по меньшей мере, один катионный основной краситель и смектитовую глину; и

c) их смесей.

В одном аспекте указанного твердого состава моющего средства для стирки, указанный состав содержит, исходя из общей массы состава:

a) от приблизительно 0,0005 мас% до приблизительно 0,1 мас%, от приблизительно 0,001 мас% до приблизительно 0,05 мас%, или даже от приблизительно 0,002 мас% до приблизительно 0,03 мас% указанного варианта протеазы; и

b) один или более из следующих:

(i) от приблизительно 0,00003 мас% до приблизительно 0,1 мас% оттеночного агента для ткани;

(ii) от приблизительно 0,001 мас% до приблизительно 5 мас%, капсул отдушки;

(iii) от приблизительно 0,001 мас% до приблизительно 1 мас%, растворимых в холодной воде осветлителей;

(iv) от приблизительно 0,00003 мас% до приблизительно 0,1 мас% катализаторов отбеливания;

(v) от приблизительно 0,00003 мас% до приблизительно 0,1 мас% липаз первого промывания;

(vi) от приблизительно 0,00003 мас% до приблизительно 0,1 мас% бактериальных чистящих целлюлаз;

(vii) от приблизительно 0,05 мас% до приблизительно 20 мас% неионных поверхностно-активных веществ Guerbet.

Описан состав в соответствии с любым из потребительских товаров, описанных в данной заявке, при этом указанный состав является разовой дозой с одним или множеством отделений.

Состав в соответствии с любым из потребительских товаров, описанных в данной заявке, где указанный состав является разовой дозой со множеством отделений, при этом вариант протеазы находится в отделении, не содержащем какой-либо источник перекиси водорода и/или хелатирующий агент.

В одном аспекте, описан водный промывной раствор, содержащий потребительский товар, содержащий вспомогательный материал и вариант протеазы, который содержит:

а) две или более из следующих мутаций: A1R, Q2S, V4R, V4S, S9A, R10S, P14K, A16S, T22A, T22R, S24R, G25V, V26F, L42I, P52F, P52E, P52N, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, S78R, E89P, E89T, E89G, E89H, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, A108I, L111V, E112V, G115K, N117F, V121F, S128D, S128F, S128L, S128N, P129E, L148I, A158E, G159E, S160D, S166D, N185E, R186H, S188E, S188D, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, N248V, H249R, L250I, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H и A272F; и/или

b) один или более из следующих наборов мутаций: N062E-P129E, N062E-G159E, A016S-L148I, A158E-H249R, A016S-N062E, L111V-S188D, T022A-N062E, N062E-L148I, T022A-P129E, N062E-E271F, N062E-A158E, A016S-G159E, N062E-R186H, S128N-G159E, N062E-S188D, N062E-S128N, L148I-G159E, S103G-A158E, L111V-G159E, A158E-E271F, A016S-S188D, T022A-L111V, S128N-A158E, A016S-A158E, V104L-A158E, S128N-R186H, G159E-Y209E, N062E-S101A, L111V-Y209E, L148I-S188D, S101A-Y209E, T022A-S188D, A016S-T022A, S128N-P129E, A016S-Y209E, A016S-S128N, T022A-E089E, S128N-Y209E, E089P-A158E, N062E-S103G, R186H-E271F, A016S-P129E, E089P-G159E, L111V-H249R, S101A-P129E, L148I-Y209E, T022A-G159E, P129E-H249R, P129E-Y209E, V104L-P129E, S128N-S188D, L111V-A158E, T022A-A158E, N062E-Y209E, N062E-H249R, S101A-R186H, E089P-P129E, P129E-E271F, T22A-L111V-G159E, S101A-S103G-V104L-Y209E, S101A-S103G-V104L-G159E, S101A-S103G-V104L-S188D, S101G-S103A-V104I-G159D, Т22А-S103G-G159E, T22A-S128N-E271F-Y209E, T22A-Y209E-E271F, T22A-S101A-Y209E, S101A-Y209E-E271F, T22A-L111V-S128N, T22A-S101A-G159E, S101A-S103G-V104L, T22A-S101A-S103G-V104L, S101A-S103G-V104L, S101G-S103A-V104I, S101A-S103G-V104L-S128N, S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D и S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F;

указанный вариант протеазы имеет общий суммарный заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, относительно B. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1; и

при этом указанный водный промывной раствор предпочтительно имеет проводимость от приблизительно 0,1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0,3 мСм/см до приблизительно 2,5 мСм/см, или даже от приблизительно 0,5 мСм/см до приблизительно 2 мСм/см.

Описан промывной раствор, содержащий потребительский товар, содержащий вспомогательный материал и вариант протеазы, содержащий:

a) две или более из следующих мутаций V4R, H17R, N18R, G20R, T22R, S24R, S24W, G25R, N43R, N43A, G46R, P52F, P52N, T57R, Q59A, N62Q, T71G, L75R, N76D, S78R, L82R, P86W, Е89Р, E89W, Е89Т, E89I, Е89Н, E89V, V104L, S106V, S106G, G115R, G118I, V121F, S144R, N185I, D197F, Y209N, Y209S, L217E, A231I, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, H249R, N252R, T253R, E271T, E271V, E271L, E271H, E271F, E271P, A1R, S9A, S212F и N269R; и/или

b) один или более из следующих наборов мутаций T022R-S024R, S009A-E271L, N018R-W241R, N018R-G115R, N043R-H249R, G020R-H249R, V004R-H249R, G020R-S024R, N018R-H249R, S009A-G020R, G020R-W241R, S009A-S078R, G020R-G115R, N018R-S024R, S024R-S242R, T022R-G115R, N018R-N043R, G020R-N043R, N018R-S242R, S242R-N269R, N018R-V244R, S024R-N269R, G020R-E271L, S024R-E271L, V004R-S009A, G020R-N269R, A001R-S024R, V244R-E271L, S009A-N018R, W241R-E271L, V004R-S024R, S009A-H249R, S009A-T022R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K и S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, указанный вариант протеазы имеет общий суммарный заряд 0, +1, +2, +3, +4 или +5, предпочтительно имеет общий суммарный положительный заряд, наиболее предпочтительно +1, +2 или+3, относительно B. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ID NO:1; и указанный промывной раствор моющего средства для стирки имеет проводимость от более, чем приблизительно 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3,5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

В одном аспекте, такой потребительский товар может быть гранулированным или порошковым моющим средством для стирки.

В одном аспекте, любой из потребительских товаров, описанных в данной заявке, может быть в виде разовой дозы со множеством отделений. В одном аспекте указанной разовой дозы со множеством отделений, вариант протеазы может находиться в отделении, не содержащем какой-либо дополнительный фермент и/или хелатирующий агент.

В одном аспекте, такие составы могут быть жидким моющим средством для стирки, товаром для мытья посуды и/или гранулированным или порошковым моющим средством.

В одном аспекте, любой из потребительских товаров, описанных в данной заявке, может быть в виде разовой дозы со множеством отделений. В одном аспекте указанной разовой дозы со множеством отделений, протеаза может находиться в отделении, не содержащем какой-либо дополнительный фермент и/или хелатирующий агент.

Потребительский товар может принять любую форму, в том числе жидкую или твердую. Потребительский товар может быть в виде мешочка разовой дозы, особенно в виде жидкости, и, типично потребительский товар является, по меньшей мере, частично, или даже полностью, заключенным в водорастворимый мешочек.

В одном или нескольких аспектах вышеупомянутого потребительского товара, такой потребительский товар может иметь любую комбинацию параметров и/или характеристик, описанных выше.

Описание дополнительной протеазы

Приемлемые варианты протеазы включают ферменты, полученные из родительской протеазы, последовательность указанной родительской протеазы на, по меньшей мере, 90%, по меньшей мере, 95%, по меньшей мере, 96%, по меньшей мере, 97%, по меньшей мере, 98%, по меньшей мере, 99%, по меньшей мере, 99,5% или 100% идентична аминокислотной последовательности SEQ ED NO:1, указанный вариант имеет одну или более из следующих характеристик:

a) показатель эффективности по Тестовому методу 2, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1, 3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1, 6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9; по меньшей мере, 2; от 1,1 до приблизительно 10, от 1,1 до приблизительно 8 или даже от 1,1 до приблизительно 5;

b) показатель эффективности по Тестовому методу 3, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере, 2; от 1,1 до приблизительно 10, от 1,1 до приблизительно 8 или даже от 1,1 до приблизительно 5;

c) показатель эффективности по Тестовому методу 4, по меньшей мере, 1,0, по меньшей мере, 1,1, по меньшей мере, 1,2, по меньшей мере, 1,3, по меньшей мере, 1,4, по меньшей мере, 1,5, по меньшей мере, 1,6, по меньшей мере, 1,7, по меньшей мере, 1,8, по меньшей мере, 1,9, по меньшей мере, 2, от 1,0 до приблизительно 10, от 1,0 до приблизительно 8 или даже от 1,0 до приблизительно 5.

Предпочтительные варианты протеаз имеют характеристики, определенные в соответствии с Тестовым методом 2 выше.

Приемлемые протеазы могут быть получены из субтилизинов, в особенности полученные из субтилизина Bacillus Lentus SEQ ID NO:1 и в одном аспекте могут содержать одну или более из следующих мутаций:

A1R, Q2S, V4R, V4S, S9A, R10S, РЫК, A16S, H17R, N18R, G20R, Т22А, T22R, S24R, S24W, G25R, G25V, V26F, L42I, N43R, N43A, G46R, P52F, Р52Е, P52N, T57R, Q59A, N62E, N62Q, V68A, V68C, T71G, I72C, A74C.L75A, L75F, L75R, N76D, S78R, L82R, P86W, Е89Р, Е89Т, E89G, Е89Н, E89I, E89V, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, S106V, S106G, A108I, L111V, E112V, G115K, G115R, N117F, G118I, V121F, S128D, S128F, S128L, S128N, Р129Е, S144R, L148I, A158E, G159E, S160D, S166D, N185E, N185I, R186H, S188E, S188D, D197F, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, N248V, H249R, L250I, N252R, T253R, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H, E271P, E271T, E271V, E271L и/или A272F. В одном предпочтительном аспекте ферментный вариант содержит, по меньшей мере, две из указанных выше мутаций.

В одном аспекте, приемлемые протеазы включают субтилизины, в особенности Bacillus Lentus SEQ ID NO:1, которые могут содержать один или более из следующих наборов мутаций, инсерций или делеций:

T022R-S024R, S009A-E271L, N018R-W241R, N018R-G115R, N043R-H249R, G020R-H249R, V004R-H249R, G020R-S024R, N018R-H249R, S009A-G020R, G020R-W241R, S009A-S078R, G020R-G115R, N018R-S024R, S024R-S242R, T022R-G115R, N018R-N043R, G020R-N043R, N018R-S242R, S242R-N269R, N018R-V244R, S024R-N269R, G020R-E271L, S024R-E271L, V004R-S009A, G020R-N269R, A001R-S024R, V244R-E271L, S009A-N018R, W241R-E271L, V004R-S024R, S009A-H249R, S009A-T022R, N062E-P129E, N062E-G159E, A016S-L148I, A158E-H249R, A016S-N062E, L111V-S188D, T022A-N062E, N062E-L148I, Т022А-Р129Е, N062E-E271F, N062E-A158E, A016S-G159E, N062E-R186H, S128N-G159E, N062E-S188D, N062E-S128N, L148I-G159E, S103G-A158E, L111V-G159E, A158E-E271F, A016S-S188D, T022A-L111V, S128N-A158E, A016S-A158E, V104L-A158E, S128N-R186H, G159E-Y209E, N062E-S101A, L111V-Y209E, L148I-S188D, S101A-Y209E, T022A-S188D, A016S-T022A, S128N-P129E, A016S-Y209E, A016S-S128N, Т022А-Е089Р, S128N-Y209E, Е089Р-А158Е, N062E-S103G, R186H-E271F, A016S-P129E, E089P-G159E, L111V-H249R, S101A-P129E, L148I-Y209E, T022A-G159E, P129E-H249R, P129E-Y209E, V104L-P129E, S128N-S188D, L111V-A158E, Т022А-А158Е, N062E-Y209E, N062E-H249R, S101A-R186H, Е089Р-Р129Е, P129E-E271F;

(b) T22A-L111V-G159E, S101A-S103G-V104L-Y209E, S101A-S103G-V104L-G159E, S101A-S103G-V104L-S188D, S101G-S103A-V104I-G159D, T22A-S103G-G159E, T22A-S128N-E271F-Y209E, T22A-Y209E-E271F, T22A-S101A-Y209E, S101A-Y209E-E271F, T22A-L111V-S128N, T22A-S101A-G159E, S101A-S103G-V104L, T22A-S101A-S103G-V104L, S101A-S103G-V104L, S101G-S103A-V104I, S101A-S103G-V104L-S128N, S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D и/или S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F.

В одном аспекте, приемлемые протеазы включают варианты субтилизинов, в особенности Bacillus Lentus SEQ ID NO:1, указанные варианты содержат три, четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14 или 15 мутаций в группе положений, включающей положения 1, 2, 4, 9, 10, 14, 16, 17, 18, 20, 22, 24, 25, 26, 42, 43, 46, 52, 57, 59, 62, 68, 71, 72, 74, 75, 76, 78, 82, 86, 89, 91, 94, 100, 101, 103, 104, 106, 108, 111, 112, 115, 117, 118, 121, 128, 129, 144, 148, 158, 159, 160, 166, 185, 186, 188, 197, 203, 209, 210, 212, 214, 215, 217, 224, 230, 231, 236, 238, 239, 241, 242, 243, 244, 248, 249, 250, 252, 253, 262, 263, 265, 267, 269, 271 и 272.

В одном предпочтительном аспекте, приемлемые протеазы включают варианты субтилизинов, в особенности Bacillus Lentus SEQ ID NO:1, указанные варианты содержат всего три мутации, выбранные из группы, содержащей: A1R, Q2S, V4R, V4S, S9A, R10S, Р14К, A16S, H17R, N18R, G20R, Т22А, T22R, S24R, S24W, G25R, G25V, V26F, L42I, N43R, N43A, G46R, P52F, Р52Е, P52N, T57R, Q59A, N62E, N62Q, V68A, V68C, T71G, I72C, A74C, L75A, L75F, L75R, N76D, S78R, L82R, P86W, Е89Р, Е89Т, E89G, Е89Н, E89I, E89V, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, S106V, S106G, A108I, L111V, E112V, G115K, G115R, N117F, G118I, V121F, S128D, S128F, S128L, S128N, Р129Е, S144R, L148I, A158E, G159E, S160D, S166D, N185E, N185I, R186H, S188E, S188D, D197F, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, Т224А, A230E, A231I, Q236F, N238R, N238K, Р239К, P239G, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, N248V, H249R, L250I, N252R, T253R, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H, E271P, E271T, E271V, E271L и A272F; и необязательно одну или более из следующих мутаций: S103A, G159D, Q236H, Q245R, N248D и N252K; предпочтительно, указанный вариант содержит четыре, пять, шесть, семь, восемь, девять, 10, 11, 12, 13, 14 или 15 указанных выше мутаций и необязательно одну или более из следующих мутаций: S103A, G159D, Q236H, Q245R, N248D и N252K.

В одном аспекте, описанная указанная протеаза является вариантом субтилизина GG36, имеющего SEQ ID NO:1, указанный вариант содержит одну или более мутаций и имеет общий суммарный заряд -5, -4, -3, -2, -1 или 0 относительно субтилизина GG36 дикого типа.

В одном аспекте, указанные варианты протеазы являются протеазами с низкой ионной силой. Такие протеазы с низкой ионной силой являются вариантами субтилизина GG36 имеющего SEQ ID NO:1, указанные варианты содержат одну или более мутаций, предпочтительно как определено выше, и имеют нулевой или отрицательный общий суммарный заряд -5, -4, -3, -2, -1 или 0, предпочтительно 0, -1, -2 или -3, относительно субтилизина GG36 дикого типа. Поэтому, в соответствии с предпочтительным аспектом настоящего изобретения представлен процесс мытья ткани, включающий мытье ткани в водном промывном растворе, содержащем такую протеазу с нулевым или отрицательным общим суммарным зарядом, и вспомогательный материал, указанный промывной раствор имеет низкую ионную силу. Под низкой ионной силой подразумевают промывной раствор, проводимость которого составляет от приблизительно 0,1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0, 3 мСм/см до приблизительно 2,5 мСм/см, или даже от приблизительно 0,5 мСм/см до приблизительно 2 мСм/см. Предпочтительно такие варианты протеазы будут использованы в составах моющих средств низких концентраций.

Протеаза предпочтительно содержит мутации, выбранные из:

(a) двух или более из следующих мутаций: A1R, Q2S, V4R, V4S, S9A, R10S, Р14К, A16S, Т22А, T22R, S24R, G25V, V26F, L42I, P52F, Р52Е, P52N, N62E, N62Q, V68A, V68C, 7710, I72C, A74C, L75A, L75F, S78R, Е89Р, Е89Т, E89G, Е89Н, E89W, Y91N, K94N, G100S, S101A, S101N, S101G, S101D, S103G, S103N, V104L, V104I, A108I, L111V, E112V, G115K, N117F, V121F, S128D, S128F, S128L, S128N, P129E, L148I, A158E, G159E, S160D, S166D, N185E, R186H, S188E, S188D, V203E, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, P210R, S212I, S212F, Y214F, A215N, A215D, A215E, L217E, L217N, T224A, A230E, A231I, Q236F, N238R, N238K, P239K, P239G, P239R, N248V, H249R, L250I, L262D, Y263F, S265F, L267V, L267N, N269I, N269R, E271F, E271I, E271H и A272F; и/или

(b) одного или более из следующих наборов мутаций: N062E-P129E, N062E-G159E, A016S-L148I, A158E-H249R, A016S-N062E, L111V-S188D, T022A-N062E, N062E-L148I, Т022А-Р129Е, N062E-E271F, N062E-A158E, A016S-G159E, N062E-R186H, S128N-G159E, N062E-S188D, N062E-S128N, L148I-G159E, S103G-A158E, L111V-G159E, A158E-E271F, A016S-S188D, T022A-L111V, S128N-A158E, A016S-A158E, V104L-A158E, S128N-R186H, G159E-Y209E, N062E-S101A, L111V-Y209E, L148I-S188D, S101A-Y209E, T022A-S188D, A016S-T022A, S128N-P129E, A016S-Y209E, A016S-S128N, Т022А-Е089Р, S128N-Y209E, Е089Р-А158Е, N062E-S103G, R186H-E271F, A016S-P129E, E089P-G159E, L111V-H249R, S101A-P129E, L148I-Y209E, T022A-G159E, P129E-H249R, P129E-Y209E, V104L-P129E, S128N-S188D, L111V-A158E, Т022А-А158Е, N062E-Y209E, N062E-H249R, S101A-R186H, Е089Р-Р129Е, P129E-E271F, T22A-L111V-G159E, S101A-S103G-V104L-Y209E, S101A-S103G-V104L-G159E, S101A-S103G-V104L-S188D, S101G-S103A-V104I-G159D, Т22А-S103G-G159E, T22A-S128N-E271F-Y209E, T22A-Y209E-E271F, T22A-S101A-Y209E, S101A-Y209E-E271F, T22A-L111V-S128N, T22A-S101A-G159E, S101A-S103G-V104L, T22A-S101A-S103G-V104L, S101A-S103G-V104L, S101G-S103A-V104I, S101A-S103G-V104L-S128N, S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D и S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F;

В одном аспекте указанные выше проотеазы с низкой ионной силой образуют часть состава моющего средства, который разбавляют водой, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от приблизительно 0,1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0,3 мСм/см до приблизительно 2,5 мСм/см, или даже от приблизительно 0,5 мСм/см до приблизительно 2 мСм/см.

В одном аспекте, указанные протеазы являются протеазами с высокой ионной силой. Такие протеазы с высокой ионной силой являются вариантами субтилизина GG36, имеющего SEQ ID NO:1, указанные варианты содержат две или более мутаций, предпочтительно как определено выше и имеют общий суммарный заряд +5, +4, +3, +2, +1 или 0, предпочтительно положительный общий суммарный заряд, наиболее предпочтительно +1, +2 или +3, относительно субтилизина GG36 дикого типа. Поэтому в соответствии с предпочтительным аспектом настоящего изобретения обеспечен процесс мытья ткани, включающий мытье ткани в водном промывном растворе, содержащем такую протеазу с нулевым или суммарным положительным зарядом, и вспомогательный материал, указанный промывной раствор имеет высокую ионную силу. Под высокой ионной силой подразумевают промывной раствор, проводимость которого составляет от выше 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3, 5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

В данном осуществлении мутации протеаз предпочтительно выбирают из:

a) двух или более из следующих мутаций V4R, H17R, N18R, G20R, T22R, S24R, S24W, G25R, N43R, N43A, G46R, P52F, P52N, T57R, Q59A, N620, T71G, L75R, N76D, S78R, L82R, P86W, Е89Р, E89W, Е89Т, E89I, Е89Н, E89V, V104L, S106V, S106G, G115R, G118I, V121F, S144R, N185I, D197F, Y209N, Y209S, L217E, A231I, P239R, P239S, W241R, S242R, S242L, N243R, V244R, N248I, H249R, N252R, T253R, Е271Т, E271V, E271L, Е271Н, E271F, Е271Р, AIR, S9A, S212F и N269R; и/или

b) одного или более из следующих наборов мутаций T022R-S024R, S009A-E271L, N018R-W241R, N018R-G115R, N043R-H249R, G020R-H249R, V004R-H249R, G020R-S024R, N018R-H249R, S009A-G020R, G020R-W241R, S009A-S078R, G020R-G115R, N018R-S024R, S024R-S242R, T022R-G115R, N018R-N043R, G020R-N043R, N018R-S242R, S242R-N269R, N018R-V244R, S024R-N269R, G020R-E271L, S024R-E271L, V004R-S009A, G020R-N269R, A001R-S024R, V244R-E271L, S009A-N018R, W241R-E271L, V004R-S024R, S009A-H249R, S009A-T022R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F, S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R, S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R, S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K, S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K.

В одном аспекте, указанные выше протеазы с высокой ионной силой образуют часть состава моющего средства, который разбавляют в воде, типично в стиральной машине, с образованием промывного раствора, проводимость которого составляет от выше приблизительно 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3,5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

Заряд вариантов протеаз выражен относительно субтилизин GG36 протеазы дикого типа, имеющей аминокислотную последовательность SEQ ID NO:1. Аминокислотами, придающими одинарный отрицательный заряд, являются D и E и такими, которые придают одинарный положительный заряд, являются R, H и K. Любой аминокислотный заряд относительно SEQ ID NO:1, который изменяет заряд, используют для расчета заряда варианта протеазы. Например, введение мутации с отрицательным зарядом из нейтрального положения дикого типа добавит суммарный заряд -1 к варианту протеазы, в то время как введение мутации с отрицательным зарядом (D или Е) из положительного аминокислотного остатка дикого типа (R, H или K) добавит суммарный заряд -2. Суммирование изменения заряда от всех аминокислотных остатков, отличных от варианта протеазы относительно субтилизин GG36 протеазы дикого типа, имеющей аминокислотную последовательность SEQ ID NO:1, дает изменение заряда варианта протеазы.

Предпочтительный диапазон зарядов для протеаз для использования в растворах моющих средств для стирки с низкой проводимостью составляет -5, -4, -3, -2, -1, 0, в особенности -2, -1.

Предпочтительный диапазон зарядов для протеаз для использования в растворах моющих средств для стирки с высокой проводимостью составляет +5, +4, +3, +2, +1, 0, в особенности+2, +1. Путем правильного выбора заряда могут быть получены неожиданно повышенные уровни чистящих характеристик.

Растворы с низкой проводимостью определены как имеющие проводимость от приблизительно 0,1 мСм/см до приблизительно 3 мСм/см, от приблизительно 0,3 мСм/см до приблизительно 2,5 мСм/см, или даже от приблизительно 0,5 мСм/см до приблизительно 2 мСм/см.

Растворы с высокой проводимостью определены как имеющие проводимость от приблизительно 3 мСм/см до приблизительно 30 мСм/см, от приблизительно 3,5 мСм/см до приблизительно 20 мСм/см, или даже от приблизительно 4 мСм/см до приблизительно 10 мСм/см.

Способы получения протеаз для холодной воды

Несколько приемлемых способов известны в данной области техники для создания модифицированных полинуклеотидных последовательностей в соответствии с настоящим изобретением, включая, но не ограничиваясь приведенным, сайт-насыщенный мутагенез, мутагенез сканирования, инсерционный мутагенез, мутагенез делеций, случайный мутагенез, сайт-направленный мутагенез, и направленные эволюции, а также различные другие рекомбинантные подходы. Традиционно используемые способы включают ДНК тасование (См. Stemmer, Proc NatiAcad Sci USA. 25:10747-51 [1994]), способы на основе негомологической рекомбинации генов (например, ITCHY) (Ostermeier et al, Bioorg Med Chem. 7:2139-44 [1999]), SCRATCHY (Lutz et al. Proc NatiAcad Sci USA. 98:11248-53 [2001]), SHIPREC (Sieber et al, Nat Biotechnol., 19:456-60 [2001]) и NRR (Bittker et al, Nat Biotechnol., 20:1024-9 [2001]; Bittker et al, Proc NatiAcad Sci. USA. 101:7011-6 [2004]), и способы, основанные на использовании олигонуклеотидов для введения случайных и направленных мутаций, делеций и/или инсерций (Ness et al, Nat Biotechnol. 20:1251-5 [2002]; Coco et al, Nat Biotechnol., 20:1246-50 [2002]; Zha et al, Chembiochem. 3:34-9 [2003], Glaser et al, J Immuno L, 149:3903-13 [1992], Sondek и Shortle, Proc NatiAcad Sci USA89:3581-5 [1992], Yanez et al. Nucleic Acids Res., 32:el58 [2004], Osuna et al.. Nucleic Acids Res., 32:el36 [2004], Gaytan et al, Nucleic Acids Res., 29: E9 [2001], и Gaytan et al., Nucleic Acids Res., 30: e84 [2002]).

В некоторых осуществлениях, полноразмерный родительский полинуклеотид лигирует в соответствующий плазмид экспрессии, и следующий способ мутагенеза используют для облегчения конструирования модифицированной протеазы в соответствии с настоящим изобретением, хотя другие способы могут быть использованы. Способ основан на том, что описано Pisarchik et al. (Pisarchik et al., Prot. Eng. Des. Select., 20:257-265 [2007]). В некоторых осуществлениях, обеспечивается дополнительное преимущество, состоящее в том, что рестриктаза, используемая в данной заявке, охватывает ее распознающую последовательность, что позволяет дигестию практически любой нуклеотидной последовательности и препятствует образованию рубцов рестриктазного сайта. Во-первых, как описано в данной заявке, встречающийся в природе ген, кодирующий полноразмерную протеазу, получают и секвенируют и проверяют на наличие одной или нескольких точек, в которых желательны мутации (делеция, инсерция, замещение или их комбинация) в одной или более аминокислотах. Мутация гена для того, чтобы изменить последовательность в соответствие с желаемой последовательностью, достигается путем удлинения праймера в соответствии с общеизвестными способами. Фрагменты слева и справа от желаемой точки(точек) мутации амплифицируют при помощи ПЦР и включения Earn 1104I сайта рестрикции. Левый и правый фрагменты дигестируют с Earn 1104I для создания множества фрагментов, имеющих комплементарные три базовых выступа, которые затем объединяют и лигируют для создания библиотеки модифицированных последовательностей, содержащих одну или более мутаций. Этот способ позволяет избежать возникновения сдвига рамки мутаций. Кроме того, этот способ упрощает процесс мутагенеза, потому что все олигонуклеотиды могут быть синтезированы таким образом, чтобы иметь тот же сайт рестрикции, и не иметь синтетических линкеров, необходимых для создания сайтов рестрикции, как это требуют некоторые другие способы.

Неограничивающий набор способов, используемых, чтобы получить протеазы для холодной воды приведен в Примерах 31-43.

Приемлемые оттеночные агенты для тканей

Флуоресцентные оптические осветлители испускают, по меньшей мере, некоторый видимый свет. В отличие от них, оттеночные агенты для тканей могут изменить оттенок поверхности, поскольку они поглощают, по меньшей мере, часть спектра видимого света. Приемлемые оттеночные агенты для тканей включают красители, конъюгаты краситель-глина и пигменты, которые удовлетворяют требованиям Тестового метода 1 в Разделе Тестовый метод данной заявки. Приемлемые красители включают низкомолекулярные красители и полимерные красители. Приемлемые низкомолекулярные красители включают красители, выбранные из группы, состоящей из красителей, подпадающих под классификации Цветового индекса (C.I.) прямого синего, прямого красного, прямого фиолетового, кислотного синего, кислотного красного, кислотного фиолетового, основного синего, основного фиолетового и основного красного, или их смесей.

Оттеночные красители сформулированы так, чтобы осаждаться на тканях из промывного раствора, чтобы улучшить восприятие белизны ткани. В одном аспекте, оттеночный краситель имеет синий или фиолетовый цвет. В одном аспекте, оттеняющий краситель(и) может иметь длину волны пика поглощения от 550 нм до 650 нм, или в одном аспекте от 570 нм до 630 нм. Сочетание красителей, которые взяты вместе, имеет визуальный эффект для человеческого глаза как один краситель, имеющий длину волны пика поглощения на полиэфире от 550 нм до 650 нм, или от 570 нм до 630 нм. Это может быть обеспечено, например, путем смешивания красного и зелено-синего красителя для получения синего или фиолетового оттенка.

Красители являются окрашенными органическими молекулами, растворимыми в водных средах, которые содержат поверхностно-активные вещества. Красители описаны в 'Industrial Dyes', Wiley VCH2002, K. Hunger (editor). Красители перечислены в Color Index International, опубликованной Society of Dyers и Colourists и theAmericanAssociation of Textile Chemists и Colorists. Красители, типично, выбирают из классов основных, кислотных, гидрофобных, прямых и полимерных красителей и конъюгатов красителей. Специалисты в области разработки моющих средств имеют возможность выбирать приемлемые оттеночные красители из этих публикаций. Полимерные оттеночные красители являются коммерчески доступными, например, от Milliken, Spartanburg, South Carolina, USA.

Примеры приемлемых красителей представляют собой прямой фиолетовый 7, прямой фиолетовый 9, прямой фиолетовый 11, прямой фиолетовый 26, прямой фиолетовый 31, прямой фиолетовый 35, прямой фиолетовый 40, прямой фиолетовый 41, прямой фиолетовый 51, прямой фиолетовый 66, прямой фиолетовый 99, кислотный фиолетовый 50, кислотный синий 9, кислотный фиолетовый 17, кислотный черный 1, кислотный красный 17, кислотный синий 29, растворитель фиолетовый 13, дисперсный фиолетовый 27, дисперсный фиолетовый 26, дисперсный фиолетовый 28, дисперсный фиолетовый 63 и дисперсный фиолетовый 77, основной синий 16, основной синий 65, основной синий 66, основной синий 67, основной синий 71, основной синий 159, основной фиолетовый 19, основной фиолетовый 35, основной фиолетовый 38, основной фиолетовый 48; основной синий 3, основной синий 75, основной синий 95, основной синий 122, основной синий 124, основной синий 141, тиазолиниевые красители, реактивный синий 19, реактивный синий 163, реактивный синий 182, реактивный синий 96, Liquitint® Violet CT (Milliken, Spartanburg, USA) и Azo-CM-Cellulose (Megazyme, Bray, Republic of Ireland).

Указанные выше оттеночные агенты для тканей могут быть использованы в комбинации (может быть использована любая смесь оттеночных агентов для тканей). Приемлемые оттеночные агенты для тканей могут быть приобретены от Aldrich, Milwaukee, Wisconsin, USA; Ciba Specialty Chemicals, Basel, Switzerland; BASF, Ludwigshafen, Germany; Dayglo Color Corporation, Mumbai, India; Organic Dyestuffs Corp., East Providence, Rhode Island, USA; Dystar,Frankfurt, Germany; Lanxess, Leverkusen, Germany; Megazyme, Wicklow, Ireland; Clariant, Muttenz, Switzerland; Avecia, Manchester, UK и/или получены в соответствии с Примерами, содержащимися в данной заявке.

Дополнительные приемлемые оттеночные агенты более подробно описаны в патенте США 7,208,459 B2.

Инкапсуляты

В одном аспекте вышеупомянутого потребительского товара, указанный потребительский товар может содержать, исходя из общей массы потребительского товара, от приблизительно 0,001 мас% до приблизительно 5 мас%, от приблизительно 0,01 мас% до приблизительно 2 мас%, или даже от приблизительно 0,03 мас% до приблизительно 0,5 мас%, указанного инкапсулята, содержащего отдушку, в одном аспекте указанная инкапсулированная отдушка включает микрокапсулу отдушки. Приемлемые инкапсуляты, типично, содержат ядро, оболочку, имеющую внутреннюю и внешнюю поверхность, указанная оболочка инкапсулирует указанное ядро. В одном аспекте указанного инкапсулята, указанное ядро может содержать материал, выбранный из группы, состоящей из отдушек; осветлителей; красителей; репеллентов для насекомых; силиконов; восков; вкусовых добавок, витаминов; средств для смягчения ткани; агентов по уходу за кожей в одном аспекте, парафинов; ферментов; антибактериальных агентов; отбеливателей; воспринимаемых органами чувств добавок, и их смесей, и указанная оболочка может содержать материал, выбранный из группы, состоящей из полиэтиленов; полиамидов; полистиролов; полиизопренов; поликарбонатов; полиэфиров; полиакрилатов; аминопластов, в одном аспекте указанный аминопласт может содержать полимочевины, полиуретан и/или полимочевинауретан, в одном аспекте указанная полимочевина может содержать полиоксиметиленмочевину и/или меламин формальдегид; полиолефинов; полисахаридов, в одном аспекте указанный полисахарид может содержать альгинат и/или хитозан; желатина; шеллака, эпоксидных смол; виниловых полимеров; нерастворимых в воде неорганических веществ; силиконов; и их смесей.

В одном аспекте указанного инкапсулята, указанное ядро может содержать отдушку.

В одном аспекте указанного инкапсулята, указанная оболочка может содержать меламин формальдегид и/или поперечно сшитый меламин формальдегид.

В одном аспекте, описанные приемлемые инкапсуляты могут содержать материал ядра и оболочку, указанная оболочка, по меньшей мере, частично окружает указанный материал ядра. По меньшей мере, 75%, 85% или даже 90% указанных инкапсулятов могут иметь предел прочности от приблизительно 0,2 МПа до приблизительно 10 МПа, от приблизительно 0,4 МПа до приблизительно 5 МПа, от приблизительно 0,6 МПа до приблизительно 3,5 МПа, или даже от приблизительно 0,7 МПа до приблизительно 3 МПа; и утечку полезного агента от 0% до приблизительно 30%, от 0% до приблизительно 20%, или даже от 0% до приблизительно 5%.

В одном аспекте, по меньшей мере, 75%, 85% или даже 90% указанных инкапсулятов могут иметь размер частиц от приблизительно 1 микрон до приблизительно 80 микрон, от приблизительно 5 микрон до 60 микрон, от приблизительно 10 микрон до приблизительно 50 микрон, или даже от приблизительно 15 микрон до приблизительно 40 микрон.

В одном аспекте, по меньшей мере, 75%, 85% или даже 90% указанных инкапсулятов могут иметь толщину стенок частиц от приблизительно 30 нм до приблизительно 250 нм, от приблизительно 80 нм до приблизительно 180 нм, или даже от приблизительно 100 нм до приблизительно 160 нм.

В одном аспекте, указанный материал ядра инкапсулята может содержать материал, выбранный из группы, состоящей из сырья отдушки и/или необязательно материал, выбранный из группы, состоящей из растительного масла, включая неразбавленное и/или смешанное растительные масла, включая касторовое масло, кокосовое масло, хлопковое масло, виноградное масло, рапсовое масло, соевое масло, кукурузное масло, пальмовое масло, льняное масло, подсолнечное масло, оливковое масло, арахисовое масло, кокосовое масло, пальмоядровое масло, касторовое масло, лимонное масло и их смеси; сложные эфиры растительных масел, сложные эфиры, в том числе дибутиладипат, дибутилфталат, бутилбензиладипат, бензилоктиладипат, трикрезилфосфат, триоктилфосфат и их смеси; углеводороды с неразветвленной или разветвленной цепью, в том числе углеводороды с неразветвленной или разветвленной цепью с температурой кипения более, чем приблизительно 80°C; частично гидрогенизированные терфенилы, диалкилфталаты, алкилбифенилы, в том числе моноизопропилбифенил, алкилированный нафталин, в том числе дипропилнафталин, петролейные спирты, в том числе керосин, минеральное масло и их смеси; ароматические растворители, включая бензол, толуол и их смеси; силиконовые масла, и их смеси.

В одном аспекте, указанный материал стенок инкапсулята может содержать приемлемую смолу, включая продукт реакции альдегида и амина, приемлемые альдегиды включают формальдегид. Приемлемые амины включают меламин, мочевину, бензогуанамин, гликольурил и их смеси. Приемлемые меламины включают метилолмеламин, метилированный метилолмеламин, иминомеламин и их смеси. Приемлемые мочевины включают диметилолмочевину, метилированную диметилол мочевину, мочевину-резорцин, и их смеси.

В одном аспекте, приемлемые уловители формальдегидов могут быть применены с инкапсулятами, например, в суспензии капсул и/или добавлены в потребительский товар перед, во время или после того, как инкапсуляты были добавлены в такой потребительский товар.

Приемлемые капсулы могут быть получены следуя доктрине USPA 2008/0305982A1; и/или USPA 2009/0247449 A1. Альтернативно, приемлемые капсулы могут быть приобретены от Appleton Papers Inc. of Appleton, Wisconsin USA.

Дополнительно, материалы для получения указанных выше инкапсулятов могут быть получены от Solutia Inc. (St Louis, Missouri U.S.A.), Cytec Industries (West Paterson, New Jersey U.S.A.), sigma-Aldrich (St. Louis, Missouri U.S.A.), CP Keico Corp. of San Diego, California, USA; BASFAG of Ludwigshafen, Germany; Rhodia Corp. of Cranbury, New Jersey, USA; Hercules Corp. of Wilmington, Delaware, USA; Agrium Inc. of Calgary, Alberta, Canada, ISP of New Jersey U.S.A., Akzo Nobel of Chicago, IL, USA; Stroever Shellac Bremen of Bremen, Germany; Dow Chemical Company of Midland, MI, USA; Bayer AG of Leverkusen, Germany; Sigma-Aldrich Corp., St. Louis, Missouri, USA.

Способ получения варианта родительской протеазы

Неограничивающий набор способов, используемых для получения протеаз, приведен в Примерах 31-43.

Нумерация протеазных аминокислот, номенклатура ферментов и дополнительные определения

Нумерация аминокислотных положений, используемых в данном патенте, является системой нумерации Bacillus amyloliquefaciens субтилизина BPN'. Каждое аминокислотное положение каждого варианта протеазы, включая каждый вариант протеазы, пронумеровано в соответствии с нумерацией соответствующего аминокислотного положения в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN', показанной на Фигуре 1, как определено выравниванием аминокислотной последовательности варианта протеазы с Bacillus amyloliquefaciens субтилизина BPN' аминокислотной последовательностью.

Альтернативной схемой нумерации является нумерация конкретной аминокислотной последовательности В. lentus субтилизин GG36 протеазы, имеющей аминокислотную последовательность SEQ ED NO:1. Ни одно из аминокислотных положений вариантов протеазы, включая варианты протеазы, описанные в данной заявке, не пронумерованы используя такую альтернативную схему нумерации.

При описании вариантов протеазы в данной заявке, следующая номенклатура используется для легкости ссылки: Оригинальная аминокислота(ы): положение(я):замещенная аминокислота(ы).

Мутации называют по однобуквенному коду для родительской аминокислоты, с последующей трехциферной нумерацией положений и затем однобуквенного кода для варианта аминокислоты. Например, мутирующий глицин (G) в положении 87 к серину (S) представлен как «G087S» или «G87S». Множественные мутации указаны путем введения «-» между мутациями. Мутации в положениях 87 и 90 представлены либо как «G087S-A090Y» или «G87S-A90Y» или «G87S+A90Y» или «G087S+A090Y». Для делеций, используют однобуквенный код «Z». Для инсерции относительно родительской последовательности однобуквенный код «Z» является левой стороной номера положения. Для делеций, однобуквенный код «Z» является правой стороной номера положения. Для инсерции, номер положения является номером положения перед вставленной аминокислотой(ами) плюс 0,01 для каждой аминокислоты. Например, инсерция трех аминокислот аланина (А), серина (S) и тирозина (Y) между положениями 87 и 88 показана как «Z087.01A-Z087.02S-Z087.03Y». Таким образом комбинирование всех мутаций выше плюс делеция в положении 100 представляет собой: «G087S-Z087.01A-Z087.02S-Z087.03Y-A090Y-A100Z».

Во всех случаях, используется принятая IUPAC однобуквенная или трехбуквенная аббревиатура аминокислот: Одна буква Х относится к любой из двадцати аминокислот.

Термин «дикого типа», со ссылкой на аминокислотную последовательность или последовательность нуклеиновой кислоты, указывает, что аминокислотная последовательность или последовательность нуклеиновой кислоты является нативной или природной последовательностью. Как используют в данной заявке, термин «встречающийся в природе» относится ко всему (например, белки, аминокислоты, или последовательности нуклеиновых кислот), что встречается в природе (то есть, не был обработан рекомбинантными методами). Как используют в данной заявке, термин «не встречающийся в природе» относится ко всему, что не встречается в природе (например, рекомбинантным нуклеиновым кислотам, полученным в лаборатории).

Как используют в данной заявке в связи с положениями аминокислотного остатка «соответствующий чему-либо» или «соответствует чему-либо» или «соответствует» относится к аминокислотному остатку в перечисленных положениях белка или пептида, или аминокислотному остатку, аналогичному, гомологичному или эквивалентному указанному остатку белка или пептида. Как используют в данной заявке, «соответствующая область» обычно относится к аналогичному положению вдоль родственных белков или реперного белка.

Термины «полученный из» и «происходит от» относятся не только к протеазе, вырабатываемой или выработанной штаммом организма, который рассматривается, но и к протеазе, кодируемой ДНК последовательностью, выделенной из таких штаммов, и производится в организме хозяина, содержащего такую ДНК последовательность. Кроме того, термин относится к протеазе, которая кодируется ДНК последовательностью, синтетического и/или кДНК происхождения и которая имеет идентифицирующие характеристики протеазы, которая рассматривается. Для Примера, «протеазы, полученные из Bacillus» относятся к тем ферментам, которые имеют протеолитическую активность, которые природно получены из Bacillus, а также к сериновым протеазам, вырабатываемым Bacillus источниками, но которые с помощью методов генной инженерии вырабатываются не-Bacillus организмами, трансформируемыми нуклеиновой кислотой, кодирующей сериновые протеазы.

Термин «идентичный» в контексте двух нуклеиновых кислот или полипептидных последовательностей относится к остаткам двух последовательностей, которые являются одинаковыми при выравнивании для максимального соответствия, измеренного с помощью одного из следующих сравнений последовательности или алгоритмов анализа.

Как используют в данной заявке, «гомологичные гены» относится к паре генов из разных, но обычно близких видов, которые соответствуют друг другу и которые являются одинаковыми или очень похожими друг на друга. Термин охватывает гены, которые разделяются по видообразованию (например, разработка новых видов) (например, ортологичных генов), а также гены, которые были разделены генетическим дублированием (например, паралогичные гены).

Термин «зрелая» форма белка, полипептида или пептида относится к функциональной форме белка, полипептида или пептида без последовательности сигнального пептида и пропептидной последовательности.

Как используют в данной заявке, «гомология» относится к сходству последовательностей или идентичности, при этом идентичность является предпочтительной. Гомология может быть определена с использованием стандартных методов, известных в данной области техники (См. например. Smith и Waterman, Adv. Appl. Math. 2:482 [1981]; Needleman и Wunsch, J. Mol. Biol. 48:443 [1970\; Pearson и Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988]; программное обеспечение, такое как GAP, BESTFIT, FASTA и TFASTA в Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); и Devereux et al., Nucl. Acid Res. 12:387-395 [1984]). Одним Примером полезного алгоритма является PILEUP. PILEUP создает множество выравниваний последовательности из группы родственных последовательностей с использованием прогрессивного попарного выравнивания. Она также может построить график, отображающий кластеризацию отношений, которые используются для создания выравнивания. PILEUP использует упрощение способа прогрессивного выравнивания Feng и Doolittle (См., Feng и Doolittle, J. Mol. Evol. 35:351-360 [1987]). Способ аналогичен опианному Higgins и Sharp (См., Higgins и Sharp, CABIOS 5:151-153 [1989]). Полезные PILEUP параметры включают вес гэпа по умолчанию 3,00, длину веса гэпа по умолчанию 0,10, и взвешенные концы гэпа. Другой Пример полезного алгоритма представляет собой алгоритм BLAST, описанный Altschul et al., (См., Altschul et al., J. Mol. Biol. 215:403-410 [1990]; и Karlin и Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787 [1993]). Особенно полезная BLAST программа представляет собой WU-BLAST-2 программу (См., Altschul et al, Meth. Enzymol. 266:460-480 [1996]). WU-BLAST-2 использует несколько поисковых параметров, большинство из них установлены на значения по умолчанию. Регулируемые параметры установлены со следующими значениями: охват перекрывания =1, фракция перекрывания =0,125, код порога (T)=11. HSP S и HSP S2 параметры являются динамическими значениями и устанавливаются самой программой в зависимости от состава конкретной последовательности и состава конкретной базы данных, по сравнению с которой ищут последовательность, которая рассматривается. Тем не менее, эти значения могут быть отрегулированны для повышения чувствительности.

Процент идентичности последовательности между реперной последовательностью и тестовой последовательностью, которая рассматривается, может быть легко определен специалистом в данной области техники. Процент идентичности, который является общим у полинуклеотидной или полипептидной последовательности определяется прямым сравнением информации последовательности между молекулами путем выравнивания последовательностей и определения идентичности способами, известными в данной области техники. Примером алгоритма, приемлемого для определения подобия последовательности, является алгоритм BLAST (См., Altschul, et al, J. Mol. Biol., 215:403-410 [1990]). Программное обеспечение для проведения BLAST анализов публично доступно от National Center for Biotechnology Information. Этот алгоритм предполагает в первую очередь выявление высоких оценочных пар последовательностей (HSP) путем выявления коротких слов длиной W в запросе последовательности, которые либо соответствуют, либо удовлетворяют некоторому положительному T-значному пороговому баллу при выравнивании со словами той же длины в базе данных последовательностей. Эти изначальные окружающие попадания слов выступают в качестве отправных точек, чтобы найти более длинные HSP, содержащие их. Попадания слов расширены в обоих направлениях вдоль каждой из двух последовательностей, которые сравнивают, настолько, насколько совокупный балл выравнивания может быть увеличен. Расширение попаданий слов прекращается, когда: совокупная оценка выравнивания падает на величину Х с максимальным достигнутым значением; совокупная оценка стремится к нулю или ниже, или в конце любая последовательность будет достигнута. Параметры BLAST алгоритма W, Т и Х определяют чувствительность и скорость выравнивания. Программа BLAST использует по умолчанию длину слова (W) 11, BLOSUM62 матрицу подсчета (См., Henikoff и Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 [1992]) выравнивания (B) 50, ожидание (Е) 10, М'5, N'-4, и сравнение обеих нитей.

Алгоритм BLAST затем выполняет статистический анализ подобия двух последовательностей (См. например, Karlin и Altschul, выше). Одним из показателей подобия предоставляемого BLAST алгоритмом является наименьшая сума вероятностей (P(N)), которая дает представление о вероятности, с которой совпадение между двумя нуклеотидными или аминокислотными последовательностями будет происходить случайно. Например, нуклеиновая кислота считается похожа на серин-протеазную нуклеиновую кислоту в соответствии с настоящим изобретением, если наименьшая сумма вероятностей сравнения тестовой нуклеиновой кислоты и серин-протеазной нуклеиновой кислоты составляет менее, чем приблизительно 0,1, более предпочтительно менее, чем приблизительно 0,01, а наиболее предпочтительно менее, чем приблизительно 0,001. Если тестовая нуклеиновая кислота кодирует серин-протеазный полипептид, то рассматривают подобие указанной серин-протеазной нуклеиновой кислоты, если результаты сравнения с наименьшей суммой вероятностей менее, чем приблизительно 0,5, и более предпочтительно менее, чем приблизительно 0,2.

Процент «идентичности» или «идентичность» в контексте двух или более нуклеиновых кислот или полипептидных последовательностей относится к двум или более последовательностям, которые могут быть одинаковыми или иметь определенный процент от остатков нуклеиновых кислот или аминокислотных остатков, соответственно, что то же самое, когда сравнивают, и выравнивают для максимального подобия, что определяется с помощью алгоритма сравнения последовательностей или при визуальном осмотре. «Процент идентичности последовательности» или «% идентичности» или «% идентичности последовательности или «% идентичности аминокислотной последовательности» рассматриваемой аминокислотной последовательности к реперной (т.е. запрос) аминокислотной последовательности означает, что рассматриваемая аминокислотная последовательность идентична (т.е. на основе аминокислота-аминокислота) на определенный процент в запросе аминокислотной последовательности при сравнении длины, когда последовательности оптимально выровнены. Таким образом, 80% идентичности аминокислотной последовательности или 80% идентичность относительно двух аминокислотный последовательностей означает, что 80% из аминокислотных остатков в двух оптимально выровненных аминокислотных последовательностях идентичны.

«Процент идентичности последовательности» или «% идентичности» или «% идентичности последовательности» или «% идентичности нуклеотидной последовательности» рассматриваемой последовательности нуклеиновых кислот относительно (т.е. в запросе) последовательности нуклеиновых кислот означает, что рассматриваемая последовательность нуклеиновых кислот идентична (то есть, на нуклеотид-нуклеотидном основании для полинуклеотидной последовательности) на определенный процент в запросе последовательности по сравнению длины, когда последовательности оптимально выровнены. Таким образом, 80% идентичности нуклеотидной последовательности или 80% идентичность относительно двух последовательностей нуклеиновых кислот означает, что 80% нуклеотидных остатков в двух оптимально выровненных последовательностях нуклеиновых кислот идентичны.

В некоторых осуществлениях, процент идентичности последовательности или «% идентичности последовательности» или «% идентичности» рассматриваемой последовательности запросной последовательности может быть вычислен путем оптимального выравнивания двух последовательностей и сравнения двух оптимально выровненных последовательностей сравнением по длине. Определяют количество положений в оптимальном выравнивании, при которых идентичные остатки имеются в обеих последовательностях, обеспечивая тем самым количество совпадающих положений, а количество совпадающих положений затем делится на общее количество положений сравнений длины (что, если не указано иное, является длиной запросной последовательности). Полученное число умножается на 100 для получения процента идентичности последовательности рассматриваемой последовательности к запросной последовательности.

«Оптимальное выравнивание» или «оптимально выровненный» относится к выравниванию двух (или более) последовательностей, которое дает наибольший балл процента идентичности. Например, оптимальное выравнивание двух последовательностей белков может быть достигнуто путем ручного выравнивания последовательностей так, чтобы максимальное количество идентичных аминокислотных остатков в каждой последовательности было выровнено в соответствие друг с другом или с помощью программного обеспечения или процедур, описанных в данной заявке или известных в данной области техники. Оптимальное выравнивание двух последовательностей нуклеиновых кислот может быть достигнуто путем ручного выравнивания последовательностей таким образом, что максимальное количество идентичных нуклеотидных остатков в каждой последовательности выровнено в соответствие друг с другом или с помощью программного обеспечения или процедур, описанных в данной заявке или известных в данной области техники.

В некоторых осуществлениях, две полипептидные последовательности считаются «оптимально выровненными», когда они выравниваются с помощью определенных параметров, таких как матрица замещений определенной аминокислоты, штраф за существование гэпа (также называемый штраф за открытый гэп), и штраф за расширение гэпа, с тем чтобы достижение наивысшего балла подобия было возможно для пары последовательностей. Матрицу оценки BLOSUM62 (См., Henikoff и Henikoff, supra) часто используют как матрицу подсчета замещений по умолчанию в алгоритмах выравнивания полипептидной последовательности (например, BLASTP). Штраф за существование гэпа выносится за введение единой гэпа аминокислоты в одной из выровненных последовательностей, и штраф за расширение гэпа выносится за каждое положение остатка в гэпе. Используют такие иллюстративные параметры выравнивания: матрица оценки BLOSUM62, штраф за существование гэпа =11, и штраф за расширение гэпа =1. Счет выравнивания определяют аминокислотными положениями каждой последовательности, при которых начинается и заканчивается выравнивание (например, окно выравнивания), и необязательно путем инсерции гэпа или множества гэпов в одну или две последовательности, так, чтобы достигнуть наивысшего возможного балла подобия.

Оптимальное выравнивание между двумя или более последовательностями может быть определено вручную визуальным осмотром или путем использования компьютера, например, но не ограничиваясь приведенным, BLASTP программой для аминокислотных последовательностей и BLASTN программой для последовательностей нуклеиновых кислот (См. например, Altschul et al.. Nucleic Acids Res. 25(17):3389-3402 (1997); См. также, the National Center for Biotechnology Information (NCBI) веб-сайт).

Неиммуноэквивалентный фермент и/или дополнительные ферменты

Потребительские товары могут включать один или более ферментов, которые обеспечивают эффективность очистки и/или преимущества ухода за тканью. Примеры приемлемых ферментов включают, но не ограничиваясь приведенным, гемицеллюлазы, пероксидазы, протеазы, целлюлазы, ксиланазы, липазы, фосфолипазы, эстеразы, кутиназы, пектиназы, маннаназы, пектат лиазы, кератиназы, редуктазы, оксидазы, фенолоксидазы, липоксигеназы, лигниназы, пуллуланазы, танназы, пентозаназы, маланазы, β-глюканазы, арабинозидазы, гиалуронидазу, хондроитиназу, лакказу и амилазы, или их смеси. Типичная комбинация является коктейлем ферментов, который может содержать, например, протеазу и липазу в сочетании с амилазой. Если они присутствуют в потребительском товаре, вышеупомянутые дополнительные ферменты могут находиться на уровнях от приблизительно 0,00001% до приблизительно 2%, от приблизительно 0,0001% до приблизительно 1% или даже от приблизительно 0,001% до приблизительно 0,5% фермента белка по массе потребительского товара.

В одном аспекте приемлемые ферменты будут включать протеазу. Приемлемые протеазы включают металлопротеазы и сериновые протеазы, включая нейтральные или щелочные микробные сериновые протеазы, такие, как субтилизины (ЕС 3.4.21.62). Приемлемые протеазы включают протеазы животного, растительного или микробного происхождения. В одном аспекте, такая приемлемая протеаза может быть микробного происхождения. Приемлемые протеазы включают химически или генетически модифицированные мутанты вышеупомянутых приемлемых протеаз. В одном аспекте, приемлемая протеаза может быть сериновой протеазой, такой как щелочная микробная протеаза и/или протеаза трипсинового типа. Примеры приемлемых нейтральной или щелочной протеазы включают:

(a) субтилизины (ЕС 3.4.21.62), в том числе полученные из Bacillus, таких как Bacillus lentus, B. alkalophilus, B. subtilis, B. amyloliquefaciens. Bacillus pumilus и Bacillus gibsonii, как описано в патентах США 6,312,936 B1, США 5,679,630, США 4,760,025, США 7,262,042 и WO 09/021867.

(б) протеазы трипсинового типа или химотрипсинового типа, такие как трипсин (например, свиного или бычьего происхождения), в том числе протеазу Fusarum, описанную в US 5288627 и химотрипсиновые протеазы, полученные из Cellumonas, описанные в США РА 2008/0063774 А1.

(с) металлопротеазы, в том числе полученные из Bacillus amyloliquefaciens, описанные в США PA 2008/0293610 A1.

Приемлемые протеазы включают протеазы, полученные из Bacillus gibsonii или Bacillus Lentus.

Приемлемые коммерчески доступные протеазные ферменты включают те, которые продаются под торговыми марками Alcalase®, Savinase®, Primase®, Durazym®, Polarzyme®, Kannase®, Liquanase®, Liquanase Ultra®, Savinase Ultra®, Ovozyme®, Neutrase®, Everlase® и Esperase® от Novozymes A/S(Denmark), те, которые продаются под торговыми марками Maxatase®, Maxacal®, Maxapem®, Properase®, Purafect®, Purafect Prime®, Purafect Ox®, FN3®, FN4®, Excellase® и Purafect ОХР® от Genencor International, те, которые продаются под торговыми марками Opticlean® и Optimase® от Solvay Enzymes, доступные от Henkel/Kemira, а именно BLAP (последовательность показана на Фигуре 29 US 5,352,604 со следующими мутациями S99D+S101R+S103A+V104I+G159S, в данной заявке имеют название BLAP), BLAP R (BLAP с S3T+V4I+V199M+V205I+L217D), BLAP Х (BLAP с S3T+V4I+V205I) и BLAPF49 (BLAP с S3T+V4I+А194Р+V199M+V205I+L217D) - все от Henkel/Kemira; и KAP (Bacillus alkalophilus субтилизин с мутациями A230V+S256G+S259N) от Kao.

В одном аспекте, потребительский товар может включать протеазу, которая неиммуноэквивалентна протеазе в соответствии с настоящим изобретением. Для целей в соответствии с настоящим изобретением, иммуноэквивалентная протеаза будет иметь высокую степень идентичности (>80%) с BPN' и перекрестие реагировать с тем же антителом. Приемлемые неиммуноэквивалентные ферменты будет включать полученные из Bacillus Lentus, Bacillus gibsonii и металлопротеазу, полученную из Bacillus amyloliquefaciens.

Приемлемые альфа-амилазы включают альфа-амилазы бактериального или грибкового происхождения. Химически или генетически модифицированные мутанты (варианты) включены. Приемлемая щелочная альфа-амилаза может быть получена из штамма Bacillus, таких как Bacillus licheniformis, Bacillus amyloliquefaciens. Bacillus stearothermophilus, Bacillus subtilis, или других Bacillus sp., таких как Bacillus sp. NCIB 12289, NCIB 12512, NCIB 12513, DSM9375 (USP 7,153,818) DSM12368, DSMZ №12649, KSM AP1378 (US 6,979,731), KSM K36 и KSM K38 (US 6,916,645). Приемлемые амилазы включают:

(a) варианты, описанные в WO 94/02597, US 6,297,037, US 7,378,264 и US 5,763,385, в особенности варианты с замещениями в одном или более из следующих положений относительно ферментов, указанных как SEQ ID No. 2 в US 7,378,264: 15, 23, 105, 106, 124, 128, 133, 154, 156, 181, 188, 190, 197, 202, 208, 209, 243, 264, 304, 305, 391, 408 и 444.

(b) варианты, описанные в USP 5,856,164 и US 6,673,589, US 6,093,562, US 6,187,576 и US PA 2008/0193999 A1 в особенности варианты с одним или более замещениями в следующих положениях относительно AA560 фермента, указанного как SEQ ID No.12 в US PA 2008/0193999 A1:

26, 30, 33, 82, 37, 106, 118, 128, 133, 149, 150, 160, 178, 182, 186, 193, 203, 214, 231, 256, 257, 258, 269, 270, 272, 283, 295, 296, 298, 299, 303, 304, 305, 311, 314, 315, 318, 319, 339, 345, 361, 378, 383, 419, 421, 437, 441, 444, 445, 446, 447, 450, 461, 471, 482, 484, предпочтительно также содержащих делеции D183* и G184*.

(c) варианты, проявляющие, по меньшей мере, 90% идентичности с SEQ ID No.4 в US PA 2008/0193999 A1 фермента дикого типа из Bacillus SP722, в особенности варианты с делениями в 183 и 184 положениях и варианты, описанные в US 6,187,576, который включен в данную заявку путем ссылки.

(d) варианты, проявляющие, по меньшей мере, 95% идентичности с ферментом дикого типа из Bacillus sp.707 (SEQ ID NO:7 в US 6,093,562), в особенности варианты, содержащие одну или более из следующих мутаций М202, М208, S255, R172 и/или М261. В одном аспекте, указанная амилаза содержит одну или более из M202L, M202V, M202S, М202Т, M202I, M202Q, M202W, S255N и/или R172Q. Особо приемлемыми являются варианты, которые содержат M202L или М202Т мутации.

Приемлемые коммерчески доступные альфа-амилазы включают DURAMYL®, LIQUEZYME®, TERMAMYL®, TERMAMYLULTRA®, NATALASE®, SUPRAMYL®, STAINZYME®, STAINZYME PLUS®, FUNGAMYL® и BAN® (Novozymes A/S. Bagsvaerd, Denmark), KEMZYM® AT 9000 Biozym Biotech Trading GmbH Wehlistrasse 27bA-1200 Wien Austria, RAPIDASE®, PURASTAR®, ENZYSIZE®, OPTISIZE HT PLUS® и PURASTAR OXAM® (Genencor International Inc., Palo Alto, California) и КАМ® (Kao, 14-10 Nihonbashi Kayabacho, 1-chome, Chuo-ku Tokyo 103-8210, Japan). В одном аспекте, приемлемые амилазы включают NATALASE®, STAINZYME® и STAINZYME PLUS® и их смеси.

В одном аспекте, такой дополнительный фермент может быть выбран из группы, состоящей из: липаз, в том числе «липаз первого цикла», таких как описанные в патенте США 6,939,702 B1 и США РА 2009/0217464. В одном аспекте, липаза является липазой первого промывания, в одном аспекте, вариантом дикого типа липазы из Thermomyces lanuginosus включающей T231R и N233R мутации. Последовательность дикого типа является 269 аминокислотами (аминокислоты 23-291) номер доступа Swissprot Swiss-Prot 059952 (полученная из Thermomyces lanuginosus (Humicola lanuginosa)). Приемлемые липазы включают те, которые продаются под торговыми марками Lipex®, Lipolex® и Lipoclean® от Novozymes, Bagsvaerd, Denmark.

В одном аспекте, состав содержит вариант Thermomyces lanuginosa липазы, имеющий >90% идентичности с аминокислотой дикого типа и содержащий замещение(я) при Т231 и/или N233, в одном аспекте, T231R и N233R.

В одном аспекте, другие ферменты включают целлюлазы бактериального или грибкового происхождения. Включены химически модифицированные или белково разработанные мутанты. Приемлемые целлюлазы включают целлюлазы рода Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, например, грибковые целлюлазы из Humicola insolens, Myceliophthora thermophila и Fusarium oxysporum, описанные в US 4,435,307, US 5,648,263, US 5,691,178, US 5,776,757 и US 5,691,178. Приемлемые целлюлазы включают щелочные или нейтральные целлюлазы, имеющие преимущества ухода за цветом. Примерами таких целлюлаз являются целлюлазы, описанные в US 5,520,838, US 5,948,672, US 5,919,691, US 6,001,639, WO 98/08940. Другие Примеры представляют собой целлюлазные варианты, такие, как описанные в US 6,114,296, US 5,457,046, US 5,457,046, US 5,686,593, US 5,763,254, US 6,117,664, US PA 2009/0170747 A1 и PCT/DK 98/00299. Коммерчески доступные целлюлазы включают CELLUZYME®, и CAREZYME® (Novozymes A/S), CLAZINASE®, и PURADAX НА® (Genencor International Inc.), и KAC-500(В)® (Kao Corporation).

В одном аспекте, целлюлаза может быть бактериальной чистящей целлюлазой. Такие бактериальные чистящие целлюлазы являются эндо бета 1,4-глюканазами и имеют структуру, не содержащую класс A углеводную связывающую молекулу (СВМ). Класс ACBM определен в соответствии с A.В. Boraston et al. Biochemical Journal 2004, Volume 382 (part 3) pages 769-781. В частности, целлюлаза не содержит класс ACBM семейств 1, 2а, 3, 5 и 10.

В одном аспекте, бактериальная чистящая целлюлаза может быть гликозилгидролазой, имеющей ферментативную активность по отношению к аморфным субстратам целлюлозы, при этом гликозилгидролазу выбирают из GH семейств 5, 7, 12, 16, 44 или 74. В одном аспекте, целлюлоза может быть гликозилгидролазой, выбранной из GH семейства 5. В одном аспекте, целлюлаза может быть Celluclean®, от Novozymes. Данная целлюлаза описаны более подробно в US7, 141, 403. Определение гликозилгидролазного (GH) семейства более подробно описано в Biochem J. 1991, v280, 309-316.

Другая приемлемая бактериальная чистящая целлюлаза является гликозилгидролазой, имеющей ферментативную активность в отношении как ксилоглюкана, так и аморфных целлюлозных субстратов, при этом гликозилгидролазу выбирают из GH семейств 5, 12, 44 или 74. В одном аспекте, гликозилгидролазу выбирают из GH семейства 44. Гликозилгидролазный фермент может принадлежать к гликозилгидролазному семейству 44.

Приемлемые гликозилгидролазы могут быть выбраны из группы, состоящей из: GH семейства 44 гликозилгидролаз из Paenibacillus polyxyma (дикого типа), например XYG1006, описанного в US 7,361,736 или являются его вариантами; GH семейства 12 гликозилгидролаз из Bacillus licheniformis (дикого типа) например Seq. No. ID:1 описанного в US 6,268,197 или являются его вариантами; GH семейства 5 гликозилгидролаз из Bacillus agaradhaerens (дикого типа) или являются его вариантами; GH семейства 5 гликозилгидролаз из Paenibacillus (дикого типа) например XYG1034 и XYG1022 описанного в US6, 630, 340 или его варианты; GH семейства 74 гликозилгидролаз из Jonesia sp.(дикого типа) например XYG1020 описанного в WO 2002/077242 или его варианты; и GH семейства 74 гликозилгидролаз из Trichoderma Reesei (дикого типа), например, фермента, более подробно описанного в последовательности ID NO.2 US 7,172,891, или его варианты.

Приемлемые гликозилгидролазы могут быть выбраны из группы, состоящей из: GH семейства 44 гликозилгидролаз из Paenibacillus polyxyma (дикого типа), например XYG1006 или его варианта.

Приемлемые бактериальные чистящие целлюлазы продают под торговыми марками Celluclean® и Whitezyme® (Novozymes A/S, Bagsvaerd, Denmark).

В одном аспекте, состав может содержать грибковую чистящую целлюлазу, содержащую гликозилгидролазное семейство 45 с молекулярной массой от 17 kDa до 30 kDa, например эндоглюканазы, которые продают под торговой маркой Biotouch® NCD, DCC и DCL(АВ Enzymes, Darmstadt, Germany).

Другие приемлемые ферменты включают пектат лиазы, которые продают под торговыми марками Pectawash®, Pectaway® и маннаназы, которые продают под торговыми марками Mannaway® (все от Novozymes A/S, Bagsvaerd, Denmark), и Purabrite® (Genencor International Inc., Palo Alto, California).

В одном аспекте, состав содержит Guerbet неионное поверхностно-активное вещество. Guerbet неионное поверхностно-активное вещество является основанным на вторичном спирте моющим поверхностно-активным веществом следующей формулы:

,

где R1= линейный или разветвленный, замещенный или незамещенный, насыщенный или ненасыщенный C2-8 алкил;

где R2= линейный или разветвленный, замещенный или незамещенный, насыщенный или ненасыщенный C2-8 алкил,

где общее количество атомов углерода, присутствующих в R1+R2 фрагментах находится в диапазоне от 7 до 13; где ЕО/РО являются алкокси фрагментами выбранными из этокси, пропокси или их смесей;

где n является средней степенью алкоксилирования и находится в диапазоне от 4 до 10.

Структурообразователи

Коммерчески доступные моющие средства для стирки содержат сильные неорганические Структурообразователи, либо с фосфатным структурообразователем, типично, триполифосфатом натрия (STPP), или цеолитом, типично алюмосиликатом натрия, где структурообразователь используется в качестве основного сильного структурообразователя. Вообще такие сильные Структурообразователи присутствуют на относительно высоких уровнях, таких как от 15 до 20 мас% или даже выше, например, даже до 40 мас%. В соответствии с предпочтительным аспектом настоящего изобретения, количество сильного структурообразователя, выбранного из фосфатного и/или цеолитного структурообразователя, составляет не более, чем 10 мас% исходя из общей массы состава моющего средства, предпочтительно ниже 8 мас%, или даже более предпочтительно ниже 5 или 4 или 3 или 2 или 1 мас%.

Таким образом, предпочтительные составы в соответствии с настоящим изобретением являются составами низкого структурообразования, содержащими от 0 мас% до 10 мас% цеолитного структурообразователя, и от 0 мас% до 10 мас% фосфатного структурообразователя, общее количество фосфата и/или цеолита не превышает 10 мас%, а предпочтительно ниже 10 мас% как описано выше. Предпочтительно составы в соответствии с настоящим изобретением содержат от 0 мас% до 8 мас%, или от 0 мас% до 5 или 4 мас% или от 0 мас% до 3 или даже менее, чем 2 мас% цеолитного структурообразователя. Может даже быть предпочтительным для состава, по существу не содержать цеолитный структурообразователь. По существу не содержащий цеолитный структурообразователь, типично, означает, что состав не содержит специально добавленный цеолитный структурообразователь. Это особенно предпочтительно, если желательно, чтобы состав был очень хорошо растворимым, чтобы свести к минимуму количество нерастворимых в воде остатков (например, которые могут осаждаться на поверхности ткани), а также, когда крайне желательно иметь прозрачный промывной раствор. Цеолитные структурообразователи включают цеолит A, цеолит X, цеолит P и цеолит MAP.

Составы в соответствии с настоящим изобретением могут содержать от 0 мас% до 10 мас% фосфатного структурообразователя. Состав предпочтительно содержит от 0 мас% до 8 мас%, или от 0 мас% до 5 или 4 мас% или от 0 мас% до 3 или даже 2 мас% фосфатного структурообразователя. Может даже быть предпочтительным для состава по существу не содержать фосфатный структурообразователь. По существу не содержать фосфатный структурообразователь, типично, означает, что состав не содержит специально добавленный фосфатный структурообразователь. Это особенно предпочтительно, если желательно, чтобы состав имел очень хороший экологический профиль. Фосфатные структурообразователи включают триполифосфат натрия.

В дополнительном предпочтительном аспекте в соответствии с настоящим изобретением, общий уровень слабых структурообразователей выбирают из слоистого силиката (SKS-6), лимонной кислоты, цитратных солей и нитрило триуксусной кислоты или ее соли ниже 15 мас%, более предпочтительно ниже 8 мас%, более предпочтительно ниже 4 мас% или даже ниже 3 или 2 мас% исходя из общей массы состава моющего средства. Типично, уровень каждого из слоистого силиката, лимонной кислоты, цитратной соли и нитрило триуксусной кислоты или ее соли будет ниже 10 мас% или даже ниже 5 мас% или мас% исходя из общей массы состава.

Хотя структурообразователи имеют ряд преимуществ для разработчика, их основная роль заключается в секвестировании ионов двухвалентных металлов (например, ионов кальция и магния) из промывного раствора, которые могли бы негативно взаимодействовать с системой поверхностно-активных веществ. Структурообразователи также эффективны для удаления ионов металлов и неорганических загрязнений с поверхности ткани, что приведет к улучшению удаления твердых частиц и пятен напитков. Поэтому можно было бы ожидать, что снижение их уровней негативно повлияет на эффективность очистки и, следовательно, неожиданным является получение составов моющих средств, которые являются эффективными при заявленном снижении уровней фосфатных и цеолитных структурообразователей.

Остаточная щелочность

Как используют в данной заявке, термин «остаточная щелочность» является мерой буферной емкости состава моющего средства (г/NaOH/100 г состава моющего средства), определенного путем титрования 1% (мас./об.) раствора состава моющего средства с соляной кислотой до pH 7,5. т.е. для расчета остаточной щелочности, как определено в данной заявке:

T = титр (мл) до pH 7,5

M = молярность HCl=0,2

40 = молекулярная масса NaOH

Объем = общий объем (т.е. 1000 мл)

W = масса продукта (10 г)

Аликвота = (100 мл)

Получите 10 г пробы, точно взвесьте с точностью до второго знака, полностью сформулированный состав моющего средства. Проба должна быть получена при помощи семплера Паскаля в порошковой камере. Добавьте 10 г пробы в пластиковый стакан и добавьте 200 мл деионизированной воды, не содержащей диоксид водорода. Перемешайте при помощи магнитной мешалки на мешалке при 150 об./мин. до полного растворения и в течение, по меньшей мере, 15 минут. Перенесите содержимое стакана в волюметрическую колбу на 1 л и доведите до 1 литра деионизированной водой. Хорошо перемешайте и немедленно отберите 100 мл ±1 мл аликвоты пипеткой на 100 мл. Измерьте и зарегистрируйте pH температуру пробы при помощи pH-метра, способного считывать ±0,01 pH единицы, при перемешивании, обеспечивая температуру 21°C+/-2°C. Оттитруйте при перемешивании с 0,2M соляной кислотой до точного значения pH 7, 5. Отметьте, сколько миллилитров соляной кислоты было использовано. Отберите средний титр из трех идентичных повторений. Проведите расчеты, описанные выше, для расчета RA до pH 7,5.

RA составов моющих средств в соответствии с настоящим изобретением может предпочтительно превышать 7,5 и предпочтительно превышать 8. RA может превышать 9 или даже превышать 9, 5 или 10 или выше. RA может быть до 20 или выше.

Адекватная остаточная щелочность может быть обеспечена, например, одним или несколькими силикатами щелочных металлов (за исключением кристаллических слоистых силикатов), типично, аморфных силикатный солей, как правило, от 1, 2 до 2, 2 соотношения солей натрия, щелочных металлов, обычно карбоната натрия, бикарбоната и/или сесквикарбонатов. STPP и персоли, такие как пербораты и перкарбонаты, также вносят вклад в щелочность. Буферизация необходима для поддержания щелочного pH во время процесса мытья для противодействия кислотности загрязнений, особенно жирных кислот, высвобождаемых ферментом липазы.

Состав моющего средства предпочтительно содержит от 0 мас% до 50 мас% силикатной соли, более обычно от 5 до 30 мас% силикатной соли, или от 7 до 20 мас% силикатной соли, как правило, силиката натрия.

Для того чтобы обеспечить предпочтительную остаточную щелочность составы моющего средства в соответствии с настоящим изобретением могут содержать карбонатную соль, типично, от 1 мас% до 70 мас% или от 5 мас% до 50 мас% или от 10 мас% до 30 мас% карбонатной соли. Предпочтительные карбонатными солями являются карбонат натрия и/или бикарбонат натрия и/или сесквикарбонат натрия. Карбонатная соль может быть включена в состав моющего средства полностью или частично через смешанную соль, такую как буркеит. Весьма предпочтительной карбонатной солью является карбонат натрия. Предпочтительно, состав может включать от 5 мас% до 50 мас% карбоната натрия, или от 10 до 40 мас% или даже от 15 до 35 мас% карбоната натрия. Также может быть желательным, чтобы состав содержал от 1 мас% до 20 мас% бикарбоната натрия, или даже 2 до 10 или 8 мас%.

Если цеолит присутствует, может быть желательным массовое соотношение карбоната натрия и/или силиката натрия и цеолитного структурообразователя, по меньшей мере, 5:1, предпочтительно, по меньшей мере, 10:1, или, по меньшей мере, 15:1, или, по меньшей мере, 20:1 или даже, по меньшей мере, 25:1.

Карбонатная соль, или, по меньшей мере, ее часть, типично, находится в форме частиц, типично имеющих средневзвешенный размер частиц в диапазоне от 200 до 500 микрометров. Тем не менее, может быть предпочтительным для карбонатной соли, или, по меньшей мере, ее части, находиться в форме микронизированных частиц, типично имеющих средневзвешенный размер частиц в диапазоне от 4 до 40 микрометров, это особенно предпочтительно, когда карбонатная соль, или, по меньшей мере, ее часть, находится в форме смеси частиц с моющим поверхностно-активным веществом, таким как алкоксилированное анионное моющее поверхностно-активное вещество.

Для того, чтобы обеспечить необходимую остаточную щелочность, предпочтительные уровни карбонатных и/или силикатных солей, типично, карбоната натрия и силиката натрия будет составлять от 10 до 70 мас%, или от 10 или даже от 15 до 50 мас%, исходя из общей массы состава.

Вспомогательные материалы

В дополнение к материалам, ранее раскрытым в данной заявке, и не являясь существенным для целей настоящего изобретения, не ограничивающий список вспомогательных материалов, проиллюстрированных в данной заявке, является приемлемым для использования в данных потребительских товарах и может быть желательным для включения в определенные осуществления в соответствии с настоящим изобретением, например для содействия или повышения эффективности очистки, для обработки субстрата, подлежащего очистке, или изменения эстетики потребительского товара, как и в случае с отдушками, окрашивающими веществами, красителями и тому подобное. Уровни любых таких вспомогательных материалов включены в любой потребительский товар, в дополнение к любым материалам, ранее указанным для включения. Точная природа этих дополнительных компонентов/вспомогательных материалов, и уровни их включения, будут зависеть от физической формы потребительского товара и характера операции очистки, для которых они будут использоваться. Приемлемые вспомогательные материалы включают, но не ограничиваясь приведенным, поверхностно-активные вещества, структурообразователи, хелатирующие агенты, ингибиторы переноса красителя, диспергаторы, дополнительные ферменты и стабилизаторы ферментов, каталитические материалы, активаторы отбеливания, перекись водорода, источники перекиси водорода, предварительно сформированные перкислоты, полимерные диспергирующие агенты, агенты, удаляющие загрязнения и глину/агенты против повторных отложений, осветлители, подавители пенообразования, красители, отдушки, эластификаторы структуры, смягчители ткани, носители, гидротропные агенты, технологические добавки, растворители и/или пигменты. В дополнение к описанному в данной заявке ниже, приемлемые Примеры таких других вспомогательных материалов и уровни их использования можно найти в патентах США №№5,576,282, 6,306,812 B1 и 6,326,348 B1, которые включены путем ссылки.

Как уже упомянуто выше, вспомогательные ингредиенты не являются существенными для потребительских товаров Заявителя. Таким образом, некоторые осуществления потребительских товаров Заявителя не содержат один или более из следующих вспомогательных материалов: поверхностно-активные вещества, структурообразователи, хелатирующие агенты, ингибиторы переноса красителя, диспергаторы, дополнительные ферменты и стабилизаторы ферментов, каталитические материалы, активаторы отбеливания, перекись водорода, источники перекиси водорода, предварительно сформированные перкислоты, полимерные диспергирующие агенты, агенты, удаляющие загрязнения и глину/агенты против повторных отложений, осветлители, подавители ценообразования, красители, отдушки, эластификаторы структуры, смягчители ткани, носители, гидротропные агенты, технологические добавки, растворители и/или пигменты. Однако, когда один или более вспомогательных материалов присутствуют, такие один или несколько вспомогательных материалов могут присутствовать как указано ниже:

Отбеливающие агенты - Потребительские товары в соответствии с настоящим изобретением могут содержать один или больше отбеливающих агентов. Приемлемые отбеливающие агенты, кроме катализаторов отбеливания, включают фотоотбеливатели, активаторы отбеливания, перекись водорода, источники перекиси водорода, предварительно сформированные перкислоты и их смеси. В общем, когда используется отбеливающий агент, потребительские товары в соответствии с настоящим изобретением могут содержать от приблизительно 0,1% до приблизительно 50% или даже от приблизительно 0,1% до приблизительно 25% отбеливающего агента по массе рассматриваемого потребительского товара. Примеры приемлемых отбеливающих агентов включают:

(1) фотоотбеливатели, например, сульфированный фталоцианин цинка, сульфированный фталоцианин алюминия, ксантеновые красители и их смеси;

(2) предварительно сформированные кислоты: приемлемые предварительно сформированные кислоты включают, но не ограничиваясь приведенным, соединения, выбранные из группы, состоящей из перкарбоновых кислот и солей, перугольных кислот и солей, перимидиновых кислот и солей, пероксимоносерных кислот и солей, например, Oxone®, и их смесей. Приемлемые перкарбоновые кислоты включают гидрофобные и гидрофильные перкислоты, имеющие формулу R-(C=O)O-O-M, где R представляет собой алкильную группу, необязательно разветвленную, содержащую, когда перкислота является гидрофобной, от 6 до 14 атомов углерода, или от 8 до 12 атомов углерода, и, когда перкислота является гидрофильной, менее, чем 6 атомов углерода, или даже менее, чем 4 атома углерода, и M представляет собой противоион, например, натрий, калий или водород;

(3) источники перекиси водорода, например, неорганические пергидратные соли, включая соли щелочных металлов такие, как натриевые перборатные соли (обычно моно- или тетрагидрат), перкарбонат, персульфат, перфосфат, персиликатные соли и их смеси. В одном аспекте в соответствии с настоящим изобретением неорганические пергидратные соли выбирают из группы, состоящей из натриевых перборатных солей, перкарбонатных солей и их смесей. При использовании, неорганические пергидратные соли типично присутствуют в количествах от 0,05 до 40 мас%, или от 1 до 30 мас% от общего потребительского товара и, типично, включены в такие потребительские товары в виде кристаллического твердого вещества, которое может быть покрыто. Приемлемые покрытия включают неорганические соли, такие как силикат щелочных металлов, карбонатные или боратные соли или их смеси, или органические материалы, такие как водорастворимые или диспергируемые полимеры, воски, масла или жирные мыла; и

(4) активаторы отбеливания формулы R-(C=O)-L, где R является алкильной группой, необязательно разветвленной, содержащей, когда активатор отбеливания является гидрофобным, от 6 до 14 атомов углерода, или от 8 до 12 атомов углерода, и, когда активатор отбеливания является гидрофильным, менее, чем 6 атомов углерода, или даже менее, чем 4 атома углерода, и L является отходящей группой. Примерами приемлемых отходящих групп являются бензойная кислота и ее производные - особенно бензолсульфонат. Приемлемые активаторы отбеливания включают додеканоил оксибензол сульфонат, деканоил оксибензол сульфонат, деканоил оксибензойную кислоту или ее соли, 3,5,5-триметил гексаноилоксибензол сульфонат, тетраацетил этилендиамин (TAED) и нонаноилоксибензолсульфонат (NOBS). Приемлемые активаторы отбеливания также описаны в US 6,380,144. В то время как может быть использован любой приемлемый активатор отбеливания, в одном аспекте в соответствии с настоящим изобретением рассматриваемый потребительский товар может содержать NOBS, TAED или их смеси.

Если они присутствуют, перкислота и/или активатор отбеливания, как правило, присутствуют в потребительском товаре в количестве от приблизительно 0,1 до приблизительно 60 мас%, от приблизительно 0,5 до приблизительно 40 мас% или даже от приблизительно 0,6 до приблизительно 10 мас% исходя из потребительского товара. Одна или более гидрофобных перкислот или их предшественников могут быть использованы в комбинации с одной или более гидрофильными перкислотами или их предшественниками.

Количества источника перекиси водорода и перкислоты или активатора отбеливания могут быть выбраны таким образом, что молярное соотношение свободного кислорода (из источника пероксида) и перкислоты составляет от 1:1 до 35:1, или даже от 2:1 до 10:1.

Поверхностно-активные вещества - Потребительские товары в соответствии с настоящим изобретением могут содержать поверхностно-активное вещество или систему поверхностно-активных веществ, где поверхностно-активное вещество может быть выбрано из неионных поверхностно-активных веществ, анионных поверхностно-активных веществ, катионных поверхностно-активных веществ, амфолитических поверхностно-активных веществ, цвиттерионных поверхностно-активных веществ, семиполярных неионных поверхностно-активных веществ и их смесей. Если оно присутствует, поверхностно-активное вещество типично присутствует на уровне от приблизительно 0,1% до приблизительно 60%, от приблизительно 1% до приблизительно 50% или даже от приблизительно 5% до приблизительно 40% по массе рассматриваемого потребительского товара.

Приемлемые анионные моющие поверхностно-активные вещества включают сульфатные и сульфонатные моющие поверхностно-активные вещества.

Приемлемые сульфонатные моющие поверхностно-активные вещества включают алкил бензолсульфонат, в одном аспекте, С10-13 алкилбензолсульфонат. Приемлемый алкилбензолсульфонат (LAS) может быть получен путем сульфонирования коммерчески доступного линейного алкилбензола (LAB); приемлемые LAB включают низшие 2-фенил LAB, такие как поставляемые Sasol под торговой маркой Isochem® или поставляемые Petresa под торговой маркой Petrelab®, другие приемлемые LAB включают высшие 2-фенил LAB, такие, как поставляемые Sasol под торговой маркой Hyblene®. Приемлемое анионное моющее поверхностно-активное вещество является алкил бензолсульфонатом, который получают в процессе катализируемом DETAL, хотя другие пути синтеза, такие как HF, также могут быть приемлемыми.

Приемлемые сульфатные моющие поверхностно-активные вещества включают алкилсульфат, в одном аспекте, С8-18алкилсульфат или преимущественно С12алкилсульфат.

Другим приемлемым сульфатным моющим поверхностно-активным веществом является алкилалкоксилированный сульфат, в одном аспекте, алкилэтоксилированный сульфат, в одном аспекте, С8-18 алкилалкоксилированный сульфат, в другом аспекте С8-18 алкилэтоксилированный сульфат, типично, алкилалкоксилированный сульфат со средней степенью алкоксилирования от 0,5 до 20, или от 0,5 до 10, типично, алкилалкоксилированным сульфатом является C8-18 алкилэтоксилированный сульфат, имеющий среднюю степень этоксилирования от 0,5 до 10, от 0,5 до 7, от 0,5 до 5 или даже от 0,5 до 3.

Алкилсульфат, алкилалкоксилированный сульфат и алкилбензолсульфонаты могут быть линейными или разветвленными, замещенными или не-замещенными.

Моющее поверхностно-активное вещество может быть среднецепочечным разветвленным моющим поверхностно-активным веществом, в одном аспекте, среднецепочечным разветвленным анионным моющим поверхностно-активным веществом, в одном аспекте, среднецепочечным разветвленным алкилсульфатом и/или среднецепочечным разветвленным алкилбензолсульфонатом, например среднецепочечным разветвленным алкилсульфатом. В одном аспекте, среднецепочечные разветвления являются С1-4 алкильными группами, типично, метальными и/или этильными группами.

Приемлемые неионные моющие поверхностно-активные вещества выбирают из группы, состоящей из: C8-C18 алкилэтоксилатов, таких как, NEODOL® неионные поверхностно-активные вещества от Shell; С612 алкилфенолалкоксилатов, где алкоксилатные звенья могут быть этиленоксидными звеньями, пропиленоксидными звеньями или их смесью; C12-C18 спирта и С612 алкилфенолконденсатов с этиленоксидными/пропиленоксидньши блок полимерами, такими как Pluronic® от BASF; С1422 среднецепочечных разветвленных спиртов; С1422 среднецепочечных разветвленных алкил алкоксилатов, типично, имеющих среднюю степень алкоксилирования от 1 до 30; алкилполисахаридов, в одном аспекте, алкилполигликозидов; полигидроксиамидов жирных кислот; эфир-блокированных поли(оксиалкилированных) спиртовых поверхностно-активных веществ, и их смесей.

Приемлемые неионные моющие поверхностно-активные вещества включают алкилполиглюкозид и/или алкилалкоксилированный спирт.

В одном аспекте, неионные моющие поверхностно-активные вещества включают алкилалкоксилиро ванные спирты, в одном аспекте С8-18 алкилалкоксилированные спирты, например С8-18 алкилэтоксилированный спирт, алкилалкоксилированный спирт может иметь среднюю степень алкоксилирования от 1 до 50, от 1 до 30, от 1 до 20 или от 1 до 10. В одном аспекте, алкилалкоксилированный спирт может быть С8-18 алкилэтоксилированным спиртом, имеющим среднюю степень этоксилирования от 1 до 10, от 1 до 7, более от 1 до 5 или от 3 до 7. Алкилалкоксилированный спирт может быть линейным или разветвленным, и замещенным или незамещенным.

Приемлемые катионные моющие поверхностно-активные вещества включают соединения алкилпиридиния, соединения алкил четвертичного аммония, алкил четвертичные фосфониевые соединения, алкил тройные сульфониевые соединения и их смеси.

Приемлемыми катионными моющими поверхностно-активными веществами являются соединения четвертичного аммония, имеющие общую формулу:

(R)(R1)(R2)(R3)N+X-,

где R представляет собой линейный или разветвленный, замещенный или незамещенный с6-18 алкильный или алкенильный фрагмент, R1 и R2 независимо выбирают из метильного или этильного фрагментов, R3 является гидроксильным, гидроксиметильным или гидроксиэтильным фрагментом, X является анионом, обеспечивающим нейтральность заряда, приемлемые анионы включают: галиды, например хлорид; сульфат и сульфонат. Приемлемые катионные моющие поверхностно-активные вещества представляют собой моно-C6-18 алкилмоно-гидроксиэтилди-метил четвертичный аммоний хлориды. Высоко приемлемыми катионными моющими поверхностно-активными веществами являются моно-C8-10 алкилмоно-гидроксиэтилди-метил четвертичный аммоний хлорид, моно-C10-12 алкилмоно-гидроксиэтилди-метил четвертичный аммоний хлорид и моно-C10 алкилмоно-гидроксиэтилди-метил четвертичный аммоний хлорид.

Структурообразователи - Потребительские товары в соответствии с настоящим изобретением могут содержать один или более моющих структурообразователей или системы структурообразователей. Если используют структурообразователь, то рассматриваемый потребительский товар будет типично содержать, по меньшей мере, приблизительно 1%, от приблизительно 2% до приблизительно 60% или даже от приблизительно 5% до приблизительно 10% структурообразователя по массе рассматриваемого потребительского товара. Состав может даже по существу не содержать структурообразователя; по существу не содержать означает «отсутствие специально добавленного» цеолита и/или фосфата. Типичные цеолитные Структурообразователи включают цеолит A, цеолит P и цеолит MAP. Типичным фосфатным структурообразователем является натрий триполифосфат.

Хелатирующие агенты - Потребительские товары в данной заявке могут содержать хелатирующий агент. Приемлемые хелатирующие агенты включают медные, железные и/или марганцевые хелатирующие агенты и их смеси. Если используют хелатирующий агент, рассматриваемый потребительский товар может содержать от приблизительно 0,005% до приблизительно 15% или даже от приблизительно 3,0% до приблизительно 10% хелатирующего агента по массе рассматриваемого потребительского товара. Приемлемые хелатирующие агенты включают DTPA (диэтилентриаминпентауксусную кислоту), HEDP (гидроксиэтандифосфониевую кислоту), DTPMP (диэтилентриаминпента(метиленфосфониевую кислоту)), 1,2-дигидроксибензол-3,5-дисульфоновой кислоты динатриевой соли гидрат, этилендиамин, диэтилентриамин, этилендиаминдиянтарную кислоту (EDDC), N-гидроксиэтилэтилендиаминтриуксусную кислоту (HEDTA), триэтилентетраамингексауксусную кислоту (ТТНА), N-гидроксиэтилиминодиуксусную кислоту (HEIDA), дигидроксиэтилглицин (DHEG), этилендиаминтетрапропионовую кислоту (EDTP) и их производные.

Ингибиторы переноса красителя - Потребительские товары в соответствии с настоящим изобретением также могут включать один или несколько ингибиторов переноса красителя. Приемлемые полимерные ингибиторы переноса красителя включают, но не ограничиваясь приведенным, поливинилпирролидоновые полимеры, полиаминные N-оксидные полимеры, сополимеры N-винилпирролидона и N-винилимидазола, поливинилоксазолидоны и поливинилимидазолы или их смеси. При наличии в рассматриваемом потребительском товаре, ингибиторы переноса красителя могут присутствовать на уровнях от приблизительно 0,0001% до приблизительно 10%, от приблизительно 0,01% до приблизительно 5% или даже от приблизительно 0,1% до приблизительно 3% по массе потребительского товара.

Осветлители - Потребительские товары в соответствии с настоящим изобретением могут также содержать дополнительные компоненты, которые могут оттенять очищаемые изделия, такие, как флуоресцентные осветлители.

Состав может содержать C.I. флуоресцентный осветлитель 260, предпочтительно в альфа-кристаллической форме, имеющей следующую структуру:

В одном аспекте, осветлитель является растворимым осветлителем, таким как C.I. флуоресцентный осветлитель 260 в альфа-кристаллической форме.

В одном аспекте осветлитель главным образом находится в альфа-кристаллической форме, что означает, что типично, по меньшей мере, 50 мас%, по меньшей мере, 75 мас%, по меньшей мере, 90 мас%, по меньшей мере, 99 мас%, или даже по существу весь, C.I. флуоресцентный осветлитель 260 находится в альфа-кристаллической форме.

Осветлитель находится предпочтительно в форме микронизированных частиц, имеющих средневзвешенный размер основных частиц от 3 до 30 микрометров, от 3 микрометров до 20 микрометров, или от 3 до 10 микрометров.

Состав может содержать C.I. флуоресцентный осветлитель 260 в бета-кристаллической форме, и массовое соотношение: (i) C.I. флуоресцентного осветлителя 260 в альфа-кристаллической форме, и (ii) C.I. флуоресцентного осветлителя 260 в бета-кристаллической форме может составлять, по меньшей мере, 0,1, или, по меньшей мере, 0,6.

ВЕ680847 относится к способу получения C.I флуоресцентного осветлителя260 в альфа-кристаллической форме.

Приемлемые уровни флуоресцентного осветлителя включают нижние уровни от приблизительно 0,01, от приблизительно 0,05, от приблизительно 0,1 или даже от приблизительно 0,2 мас% до верхних уровней 0,5 или даже 0,75 мас%.

Карбоксилатный полимер - Потребительские товары в соответствии с настоящим изобретением могут также содержать один или более карбоксилатных полимеров, например малеатный/акрилатный статистический сополимер или полиакрилатный гомополимер. В одном аспекте, карбоксилатный полимер является полиакрилатным гомополимером, имеющим молекулярную массу от 4000 Da до 9000 Da, или от 6000 Da до 9000 Da.

Полимер, высвобождающий загрязнения - Потребительские товары в соответствии с настоящим изобретением могут также содержать один или более полимеров, высвобождающих загрязнения, имеющих структуру, как определено одной из следующих структур (I); (II) или (III):

(I) -[(OCHR1-CHR2)a-O-OC-Ar-CO-]d

(II) -[(OCHR3-CHR4)b-O-OC-sAr-CO-]e

(III) -[(OCHR5-CHR6)c-OR7]f

где:

a, b и c составляют от 1 до 200;

d, e и f составляют от 1 до 50;

Ar является 1,4-замещенным фениленом;

sAr является 1,3-замещенным фениленом, замещенным в положении 5 на SO3Me;

Me представляет собой Li, K, Mg/2, Ca/2, Al/3, аммоний-, моно-, ди-, три-, или тетраалкиламмоний, где алкильные группы представляют собой C1-C18 алкил или C2-C10 гидроксиалкил, или их смеси;

R1, R, R, R4, R5 и R6 независимо выбирают из H или C1-C18 н- или изо-алкила; и

R7 является линейной или разветвленной C1-C18 алкильной, или линейной или разветвленной C2-C30 алкенильной, или циклоалкильной группой с 5-9 атомами углерода, или C8-C30 арильной группой или C6-C30 арилалкильной группой.

Приемлемые полимеры, высвобождающие загрязнения, являются полиэфирными полимерами, высвобождающими загрязнения, такими как Repel-o-tex полимеры, в том числе Repel-o-tex SF, SF-2 и SRP6 от Rhodia. Другие приемлемые полимеры, высвобождающие загрязнения, включают Техсаге полимеры, в том числе Texcare SRA100, SRA300, SRN100, SRN170, SRN240, SRN300 и SRN325 от Clariant. Другие приемлемые полимеры, высвобождающие загрязнения, представляют собой Marloquest полимеры, такие как Marloquest SL от Sasol.

Целлюлозный полимер - Потребительские товары в соответствии с настоящим изобретением могут также включать один или более целлюлозных полимеров, включая выбранные из алкилцеллюлозы, алкилалкоксиалкилцеллюлозы, карбоксиалкилцеллюлозы, алкилкарбоксиалкилцеллюлозы. В одном аспекте, целлюлозные полимеры выбирают из группы, содержащей карбоксиметилцеллюлозу, метилцеллюлозу, метил-гидроксиэтил целлюлозу, метил-карбоксиметилцеллюлозу, и их смеси. В одном аспекте, карбоксиметилцеллюлоза имеет степень карбоксиметильного замещения от 0,5 до 0,9 и молекулярную массу от 100000 Da до 300000 Da.

Катализаторы отбеливания - Потребительские товары в соответствии с настоящим изобретением также могут включать один или более катализаторов отбеливания, таких, как катализаторы переходных металлов или лиганды, способные образовывать катализатор переходных металлов например, как описано в ЕР 1109965, или ЕР 1240378 или 9, или катализаторы отбеливания, способные принимать атом кислорода от пероксикислоты и/или ее соли, и передавать атом кислорода на окисляемую подложку. Приемлемые катализаторы отбеливания включают, но не ограничиваясь приведенным: иминий катионы и полиионы; иминий цвиттерионы; модифицированные амины; модифицированные аминоксиды; N-сульфонилимины; N-фосфонилимины; N-ацилимины; тиадиазолдиоксиды; перфторимины; циклические сахарные кетоны и их смеси, как описано в US PA 2007/0173430 A1.

В другом аспекте, состав моющего средства для стирки содержит отбеливающий ингредиент, отбеливающий ингредиент имеет logPo/w не более, чем 0, не более, чем -0,5, не более, чем -1,0, не более, чем -1,5, не более, чем -2,0, не более, чем -2,5, не более, чем -3,0, или даже не более, чем -3,5. Способ определения logPo/w описан более подробно ниже.

Типично, отбеливающий ингредиент способен генерировать отбеливающие виды, имеющие XSO от 0,01 до приблизительно 0,30, от 0,05 до приблизительно 0,25, или даже от приблизительно 0,10 до 0,20. Способ определения XSO описан более подробно ниже. Например, отбеливающие ингредиенты, имеющие изохинолиниевые структуры, способны генерировать отбеливающие виды, которые имеют оксазиридиниевые структуры. В этом Примере, XSO является оксазиридиниевым отбеливающим видом.

Не имея желания быть связанными теорией, изобретатели полагают, что контроль электрофильности и гидрофобности описанным выше образом позволяет доставку отбеливающего ингредиента по существу только в участки ткани, которые являются более гидрофобными, и которые содержат электронно обогащенные загрязнения, в том числе видимые хромофоры, которые являются восприимчивыми к отбеливанию высоко электрофильными окислителями.

В одном аспекте, катализатор отбеливания имеет структуру, соответствующую приведенной ниже общей формуле:

,

где R13 выбирают из группы, состоящей из 2-этилгексила, 2-пропилгептила, 2-бутилоктила, 2-пентилнонила, 2-гексилдецила, н-додецила, н-тетрадецила, н-гексадецил, н-октадецила, изо-нонила, изо-децила, изо-тридецила и изо-пентадецила;

Способ определения logPo/w

logPo/w определен в соответствии со способом, описанным в Brooke, D.N., Dobbs, A.J., Williams, N, Ecotoxicology и Environmental Safety (1986) 11 (3): 251-260.

Способ определения XSO

Параметр XSO определен в соответствии со способом, описанным в Adam, W., Haas, W., Lohray, В.В. Journal of the American Chemical Society (1991) 113(16) 6202-6208.

Силикатные соли - Потребительские товары в соответствии с настоящим изобретением могут также содержать силикатные соли, такие как силикат натрия или калия. Состав может содержать от 0 мас% до менее, чем 10 мас% силикатной соли, до 9 мас%, или до 8 мас%, или до 7 мас%, или до 6 мас%, или до 5 мас%, или до 4 мас%, или до 3 мас%, или даже до 2 мас%, а предпочтительно от более 0 мас%, или от 0,5 мас%, или даже от 1 мас% силикатной соли. Приемлемой силикатной солью является силикат натрия.

Диспергаторы - Потребительские товары в соответствии с настоящим изобретением могут также содержать диспергаторы. Приемлемые растворимые в воде органические материалы включают гомо- или со-полимерные кислоты или их соли, в которых поликарбоновая кислота включает, по меньшей мере, два карбоксильных радикала, отделенных друг от друга не более, чем на два атома углерода.

Стабилизаторы ферментов - ферменты для использования в моющих средствах могут быть стабилизированы разными способами. Ферменты, используемые в данной заявке, могут быть стабилизированы присутствием растворимых в воде источников ионов кальция и/или магния в готовых потребительских товарах, которые предоставляют такие ионы ферментам. В случае водных потребительских товаров, содержащих протеазу, обратимый ингибитор протеазы, такой, как соединение бора, или соединения, такие как формиат кальция, формиат натрия и 1,2-пропандиол могут быть добавлены для дальнейшего улучшения стабильности.

Каталитические комплексы металлов - Составы Заявителей могут включать каталитические комплексы металлов. Один тип металл-содержащих катализаторов отбеливания является каталитической системой, содержащей катион переходного металла с определенной каталитической активностью отбеливания, такой, как катионы меди, железа, титана, рутения, вольфрама, молибдена, марганца, вспомогательный катион металла, имеющий малую или вообще не имеющий каталитической активности отбеливания, такой как катионы цинка или алюминия, и секвестрант, имеющий определенные константы стабильности для каталитических и вспомогательных катионов металлов, в частности, этилендиаминтетрауксусную кислоту, этилендиаминтетра(метиленфосфоновую кислоту) и их растворимые в воде соли. Такие катализаторы раскрыты в U.S. 4,430,243.

При желании, составы в данной заявке могут быть катализируемыми соединением марганца. Такие соединения и уровни использования хорошо известны в данной области техники и включают, например, катализаторы на основе марганца, описанные в патенте США 5,576,282.

Кобальтовые катализаторы отбеливания, полезные в данной заявке, известны и описаны, например, в патенте США 5,597,936, патенте США 5,595,967. Такие кобальтовые катализаторы легко получают известными методами, такими, как описанные например в U.S. 5,597,936 и U.S. 5,595,967.

Составы в данной заявке также могут приемлемо включать комплекс переходного металла с лигандами, такими, как биспидоны (US 7,501,389) и/или макрополициклические жесткие лиганды - сокращенно «MRLs». С практической точки зрения, а не путем ограничений, составы и способы в данной заявке могут регулироваться для обеспечения порядка, по меньшей мере, одной части на сто миллионов активных видов MRL в водной среде мытья, и, типично, обеспечивают от приблизительно 0,005 м.д. до приблизительно 25 м.д., от приблизительно 0,05 м.д. до приблизительно 10 м.д., или даже от приблизительно 0,1 м.д. до приблизительно 5 м.д., из MRL в промывном растворе.

Приемлемые переходные металлы в данных катализаторах отбеливания переходных металлов включают, например, марганец, железо и хром. Приемлемые MRLs включают 5,12-диэтил-1,5,8,12-тетраазабицикло[6.6.2]гексадекан.

Приемлемые MRLs переходных металлов легко получают известными методами, такими, как описано например в U.S. 6,225,464.

Растворители - Приемлемые растворители включают воду и другие растворители, такие как липофильные жидкости. Примеры приемлемых липофильных жидкостей включают силоксаны, другие силиконы, углеводороды, эфиры гликолей, производные глицерина, такие как простые эфиры глицерина, перфторированные амины, перфторированные и гидрофторэфирные растворители, нефторированные органических растворители с низкой летучестью, диольные растворители, другие экологичные растворители и их смеси.

Способы получения потребительских товаров

Потребительские товары в соответствии с настоящим изобретением могут быть составлены в любой приемлемой форме, и получены любым способом, выбранным разработчиком, не ограничивающие Примеры которых описаны в Примерах заявителей и в U.S. 4,990,280; U.S. 20030087791 A1; U.S. 20030087790 A1; U.S. 20050003983 A1; U.S. 20040048764 A1; U.S. 4,762,636; U.S. 6,291,412; U.S. 20050227891 A1; EP 1070115 A2; U.S. 5,879,584; U.S. 5,691,297; U.S. 5,574,005; U.S. 5,569,645; U.S. 5,565,422; U.S. 5,516,448; U.S. 5,489,392; U.S. 5,486,303 все из которых включены в данную заявку путем ссылки.

Способ использования

Настоящее изобретение включает способ очистки и/или обработки в частности поверхности ткани. Такой способ включает стадии контактирования осуществления чистящего потребительского товара заявителей в чистом виде или разбавленным в промывном растворе, с, по меньшей мере, частью поверхности и необязательное промывание такого участка поверхности ткани. Участок может быть подвергнут стадии мытья до вышеупомянутой стадии промывания. В целях настоящего изобретения, мытье включает, но не ограничивается приведенным, очистку и механическое перемешивание. Соответственно, настоящее изобретение включает способ для мытья ткани. Способ включает стадии контактирования ткани для стирки с указанным чистящим раствором для стирки, содержащим, по меньшей мере, одно из осуществлений потребительского товара Заявителей. Ткань может включать любую ткань способную быть отмытой в нормальных условиях использования потребителем. Раствор типично имеет pH от приблизительно 7 до приблизительно 11. Потребительские товары могут быть использованы при концентрациях от приблизительно 500 м.д. до приблизительно 15000 м.д. в растворе. Температуры воды типично находятся в диапазоне от приблизительно 5°C до приблизительно 90°C. Соотношение воды и ткани составляет, типично, от приблизительно 1:1 до приблизительно 30:1.

В одном аспекте, описан участок, который обрабатывают любым из потребительских товаров, раскрытых в данной заявке.

Тестовые методы

Тестовый метод 1

Протокол для определения того, является ли краситель или пигмент оттеночным агентом для ткани в соответствии с настоящим изобретением приведен здесь:

1) Заполните два терготометрических горшочка 800 мл Newcastle от Tyne, UK, City Water (-12 гран на галлон США общей жесткости, поставляемый Northumbrian Water, Pity Me, Durham, Co. Durham, UK).

2) Вставить горшочки в терготометр, с температурой воды, контролируемой при 30°C и перемешивании, установленном на 40 об./мин. в течение эксперимента.

3) Добавьте 4,8 г IEC-B моющего средства (IEC 60456 Washing Machine Reference Base Моющее средство типа В), от wfk, Briiggen-Bracht, Germany, в каждый горшочек.

4) Через две минуты, добавьте 2,0 мг активного красителя в первый горшочек.

5) Через одну минуту, добавьте 50 г развернутых хлопковых маек (от Warwick Equest, Consett, County Durham, UK), разрежьте на 5 см x 5 см образцы, в каждый горшочек.

6) Через 10 минут, осушите горшочки дренажом и повторно заполните (16°C) с жесткостью воды 14,4 градусов жесткости по английской шкале жесткости Кларка при молярном соотношении 3:1 кальция и магния.

7) Через 2 минуты прополощите, удалите ткань.

8) Повторите стадии 3-7 в течение еще трех циклов с использованием той же самой обработки.

9) Соберите и высушите ткань на линейной сушилке в помещении в течение 12 часов.

10) Проанализируйте образцы при помощи спектрометра Hunter Miniscan оснащенного источником света D65 и УФА обрезным фильтром, с получением значений Hunter а (красно-зеленая ось) и Hunter b (желто-синяя ось).

11) Усредните значения Hunter a и Hunter b для каждого набора тканей. Если ткани, обработанные красителем, который оценивают, показывают среднюю разность оттенков более, чем 0,2 единиц на любой из осей a или b, то его рассматривают как оттеночный агент для ткани для целей в соответствии с настоящим изобретением.

Тестовые методы 2-6

Все представленные отклонения от протокола указаны в соответствующих Примерах.

Анализы проводились с использованием Biomek FX Robot (Beckman Coulter) или многоканального дозатора (например, Rainin PipetLite, Mettler-Toledo) и SpectraMAX MTP Reader (тип 340, Molecular Devices).

TCA анализ для определения содержания белка в 96-луночных планшетах для микротитрования

B. subtilis культуры выращивали 2-3 дня при 37°C, при встряхивании при 250-300 оборотов в минуту с продуванием увлажненным воздухом. Клетки были удалены из фермент-содержащей супернатантной культуры, путем центрифугирования и/или фильтрования. Концентрацию протеазы определяли с помощью TCA анализа осадка. Аликвоту (20-25 мкл) супернатантной культуры переносили в 96-луночнуй плоскую планшету для микротитрования (MTP; Costar 9017 прозрачный полистирольный планшет со связывающей средой), содержащий 100 мкл/лунку 0,25 N HCl. «Базовые» считывания были определены путем считывания рассеяния/поглощения света при 405 нм через 5 сек. смешивания. 100 мкл/лунку 30% (мас./об.) трихлоруксусную кислоту (TCA) добавляли в HCl-содержащий планшет и инкубировали в течение 10 минут при комнатной температуре для облегчения осаждения белков. Рассеяние/поглощение света при 405 нм этого «тестового» планшета было определено через 5 сек. смешивания. Увеличение в образцах мутности/рассеяния света коррелирует с общим количеством осажденного белка в супернатантной культуре. Расчеты проводили путем вычитания «базового» считывания (полученного после добавления HCl) из «тестового» считывания (полученного после добавления TCA), чтобы обеспечить относительно измерение общего присутствующего белка. При желании стандартная кривая может быть создана путем калибровки TCA считываний с AAPF анализами протеазы (см. ниже) клонов с известной удельной активностью. Тем не менее, TCA результаты являются линейными по отношению к концентрации белка от 50 до 500 частей на миллион (м.д.) белка (где 1 м.д. соответствует 1 мг/л) и поэтому могут быть нанесены непосредственно по сравнению с характеристиками фермента с целью выбора вариантов с желаемыми характеристиками.

AAPF протеазный анализ в 96-луночных планшетах для микротитрования

Для определения протеазной активности сериновых вариантов протеаз измеряли гидролиз N-сукцинил-L-аланил-L-аланил-L-пролил-L-фенил-п-нитроанилида (suc-AAPF-pNA). Растворы реагентов представляли собой: 100 мМ Трис/HCl, pH 8,6, содержащего 0,005% TWEEN®-80 (Трис разбавляющий буфер); 100 мМ Трис буфера, pH 8,6, содержащего 1 мМ CaCl2 и 0,005% TWEEN®-80 (Трис/Ca буфер); и 160 мМ suc-AAPF-pNA в ДМСО (suc-AAPF-pNA маточный раствор) (Sigma: S-7388). Для получения suc-AAPF-pNA рабочего раствора, 1 мл suc-AAPF-pNA маточного раствора добавляли в 100 мл Трис/Ca буфера и тщательно смешивали в течение, по меньшей мере, 10 секунд. Анализ проводили путем добавления 10 мкл разбавленного протеазного раствора в каждую лунку 96-луночного МТР, с немедленным добавлением 190 мкл 1 мг/мл suc-AAPF-pNA рабочего раствора. Растворы смешивали в течение 5 секунд и изменение поглощения в кинетическом режиме (25 считываний за 5 минут) считывали при 405 нм в МТР ридере при 25°C. Протеазную активность выражали как AU (активность = AOD-мин-1 мл-1).

Анализ ингибирования Eglin С

Как описано в данной заявке, концентрация сериновой протеазы и удельная активность были определены путем титрования с ингибитором под названием eglin С. Eglin С из пиявки Hirudo medicinalis является сильно связывающим белковым ингибитором субтилизинов и ASP протеазы (Heinz et al., Biochemistry, 31: 8755-66 [1992]), и поэтому может быть использован для измерения протеазной ферментной концентрации, что в свою очередь позволяет расчет удельной активности. Ген для eglin C синтезировали и экспрессировали в Е. coli стандартными способами. Его свойства и ингибиторная эффективность были аналогичны eglin c, приобретенному от Sigma.

(i) Определение концентрации маточного раствора Eglin C

Пробу Bacillus lentus субтилизина известной удельной активности разбавляли в 100 мМ Трис буфера, pH 8,6, содержащего 1 мМ CaCl2 и 0,005% TWEEN®-80 (Трис/Ca буфер), до концентрации, соответствующей AAPF протеазному анализу, описанному выше. Несколько разведении маточного раствора eglin c также производили в Трис/Ca буфере. Аликвоту каждого разбавленного раствора eglin c смешивали с равным объемом разбавленного раствора Bacillus lentus субтилизина. Аликвоту только Трис/Ca буфера, без eglin c, также смешивали с равным объемом разбавленного раствора Bacillus lentus субтилизина, для измерения активности неингибиорованного субтилизина в отсутствие eglin c. Смешанные растворы инкубировали при комнатной температуре в течение 15-30 минут и протеазную активность каждой пробы затем измеряли при помощи AAPF анализа, описанного выше. Используя известную удельную активность Bacillus lentus субтилизина, определяли концентрацию активной протеазы в каждой пробе. Концентрация eglin c в каждой пробе была затем рассчитана, исходя из уменьшения наблюдаемой протеазной активности сравнительно с неингибированной пробой субтилизина, которую затем смешивали только с Трис/Ca буфером (без eglin c). Таким образом, используя известные развбавления и объемы растворов eglin c, концентрация of eglin c в маточном растворе была определена.

(ii) Определение концентрации и удельной активности вариантов субтилизина

Образцы вариантов субтилизина разводили в 100 мМ Трио-буфера, рН 8,6, содержащем 1 мМ CaCL2 и 0,005% Tween®-80 (Трис/Ca буфера). Некоторые разбавления маточного раствора eglin C известной концентрации были также получены в Трис/Ca буфере. Аликвоту каждого разбавленного раствора yglin C смешивали с равным объемом раствора варианта субтилизина. Смешанные растворы инкубировали при комнатной температуре в течение 15-30 минут и протеазную активность каждой пробы измеряли с помощью анализа AAPF. Используя наблюдаемое снижение протеазной активности при добавлении каждой пробы eglin C и известную концентрацию eglin C, была рассчитана концентрация в eglin С необходимая для полного ингибирования каждого варианта фермента субтилизина. Эта концентрация соответствует концентрация фермента в пробе. Аликвоту только Трис/Ca буфера, без eglin C, также смешивали с каждой пробой варианта субтилизина и протеазную активность в отсутствие Eglin C измеряли с помощью анализа AAPF. Удельную активность вариантов субтилизина затем рассчитывали с помощью концентраций фермента, как это определено выше.

BMI Анализ микрообразцов (BMI анализ)

Предварительно промытые и перфорированные запачканные кровью, молоком и чернилами (BMI) микрообразцы (ЕМРА116) 5,5 миллиметров диаметра окружности в 96-луночных планшетах для микротитрования (МТР; Coming 3641) были получены от Center for Testmaterials BV (Vlaardingen, The Netherlands).

Моющие средства получали путем смешивания в течение, по меньшей мере, 30 минут в растворе 2 мМ карбоната натрия, отбуферированного до pH 10,3 с соответствующим уровнем жесткости воды (3:1 Ca:Mg. - CaCl2:MgCl2·H2O) в Milli-Q воде, как описано в Таблице 1-1 и Таблице 6-4. Отбирали аликвоты моющих средств в 50 мл конические пробирки (Falcon), центрифугировали для удаления осадка и замораживали на льду в течение 30 минут перед использованием.

Концентрации ферментов были уравнены до желаемой фиксированной концентрации в диапазоне 20-50 м.д. относительно стандартного очищенного GG36 (фермент SEQ ID NO:1). Удельная активность GG36 с использованием AAPF в качестве субстрата была использована для преобразования базовых вычтеных ТСА значений в концентрацию фермента в ppm. После того, как концентрация фермента была определена в ppm, использовали простую формула для расчета объема каждого варианта, который необходимо добавить к фиксированному объему буфера (300-600 мкл) для того, чтобы достичь желаемой концентрации маточного фермента:

x=(целевая м.д.)(vb)/(у-целевая м.д.)

Где x = объем фермента, у = концентрация фермента, vb = объем буфера

Perkin-Elmer Janus робот с Versispan 8-пролетной рукой был использован для выдачи переменных объемов фермента из планшета источника (Axygen планшеты с лунками половинной глубины с объединенными собранными вариантами, используемыми в TCA анализе концентрации фермента) в заполненные буфером целевые планшеты с использованием проводящих наконечников. Пробы были смешаны три раза с помощью движений пипетки вверх и вниз. Точность ферментных разбавлений была подтверждена измерением AAPF активности уравненного планшета и сравнения с AAPF активностью планшета источника для проверки правильности разбавлений.

После выравнивания, 5-15 мкл ферментного раствора добавляют к заполненному моющим средством планшету микрообразцов для достижения конечного объема ~200 мкл. В некоторых случаях, ферментные образцы не уравнены, а вместо этого все равно разбавляют из маточного планшета, для получения рабочего диапазона 0,1-5 м.д.. Оптимальные целевые концентрации для каждого анализа были определены из кривой доза-ответ измерения активности очистки в этом диапазоне для данного моющего средства.

МТР была запечатана фольгой (Bio-Rad) и инкубирована в iEMS инкубаторе/шейкере (Thermo/Labsystems), предварительно установленном при 16°C в холодной комнате при 4°C или при 32°C на крышке в течение 30 минут при 1400 оборотах в минуту. После инкубации, 120 мкл супернатанта переносили в свежую MTP (Corning 9017) и считывали при 600 нм с помощью ридера SpectraMax. Правильные считывания поглощения были получены путем вычитания холостого контроля (без ферментов) из каждого значения.

Показатель эффективности (PI) рассчитывается для каждого варианта. Показатель эффективности является отношением поглощения супернатанта производимого вариантом чистящего фермента и поглощения, производимого чистящим GG36 при фиксированной концентрации фермента. Для уравненных планшет, PI значения рассчитывают путем деления поглощения варианта на контрольный на данном планшете. Для не уравненных планшет, стандартная кривая (например Ленгмюра или логистической нелинейной модели приемлемой регрессии с четырьмя параметрами) формируется из активности и концентрации фермента в контроле. С помощью этой стандартной кривой, характеристики вариантов могут быть непосредственно сравнены с контролем в любой концентрации фермента. PI определяется путем деления поглощения вариантов на расчитанное поглощение для контроля при той же концентрации фермента. Показатель эффективности (PI), который больше, чем 1 (PI>1) показывает превосходную очистку вариантом, по сравнению со стандартной (например, GG36), а PI равный 1 (PI=1) определяет вариант, который имеет те же характеристики, что и стандарт, и PI, который менее, чем 1 (PI<1) определяет вариант, который имеет характеристики хуже, чем стандарт.

ТАБЛИЦА 1-1:
Конечное моющее средство, жесткость воды и концентрации буфера, используемые для BMI анализа микрообразцов
Моющее средство Конечная концентрация моющего средства (г/л) Конечная жесткость воды* (гпг) Конечная концентрация буфера карбоната натрия (мМ)
Пример 26 0,808 6 2
Пример 27 1 3 2
Пример 28 2,3 12 2
Пример 29 5,9 12 2
Пример 30 8,3 12 2
*(3:1 Ca:Mg) концентрация, как подробно описано в тексте.

Тестовый метод 2 - Для тестового метода 2, BMI анализ микрообразцов проводили с использованием моющего средства Примера 29. Моющее средство растворяли в воде с жесткостью 12 гпг и доводили до температуры 16°C. Характеристики вариантов ферментов затем определяли согласно описанного BMI анализа микрообразцов. Показатель эффективности определяли путем сравнения характеристик варианта с характеристиками фермента SEQ ID NO:1, во всех случаях диапазон дозировок ферментов составлял 0,1-5 м.д.. Ферменты, имеющие показатель эффективности 1,1 или более рассматривали как протеазы для холодной воды.

Тестовый метод 3 - Для тестового метода 3, BMI анализ микрообразцов проводили с использованием моющего средства Примера 26. Моющее средство растворяли в воде с жесткостью 6 гпг и доводили до температуры 16°C. Характеристики ферментных вариантов затем определяли согласно описанного BMI анализа микрообразцов. Показатель эффективности определяли путем сравнения характеристик варианта с характеристиками фермента SEQ ID NO:1, во всех случаях диапазон дозировок ферментов составлял 0,1-5 м.д.. Ферменты, имеющие показатель эффективности 1,1 или более рассматривали как протеазы для холодной воды.

Тестовый метод 4 - Для тестового метода 4, BMI анализ микрообразцов проводили с использованием моющего средства Примера 26. Моющее средство растворяли в воде с жесткостью 6 гпг и доводили до температуры 16°C. Характеристики ферментных вариантов затем определяли согласно описанного BMI анализа микрообразцов. Показатель эффективности определяли путем сравнения характеристик варианта с характеристиками реперного фермента, указанный реперный фермент является ферментом SEQ ID NO:1, состоящим из А158Е мутации, во всех случаях диапазон дозировок ферментов составлял 0,1-5 м.д.. Ферменты, имеющие показатель эффективности 1,1 или более рассматривали как протеазы для холодной воды.

Тестовый метод 5 - Электропроводность водного раствора анализировали в соответствии со стандартным методом ASTM D1125 и сообщали в единицах миллиСименс/см, сокращенно мСм/см в данном патенте.

Тестовый метод 6 - Для Тестового метода 6, BMI анализ микрообразцов проводили с использованием одного из моющих средств Примеров 36a-36n. Моющее средство растворяли в воде с жесткостью, указанной в Таблице 6-4, и доводили до температуры 16°C. Характеристики ферментных вариантов затем определяли согласно описанного BMI анализа микрообразцов. Показатель эффективности определяли путем сравнения характеристик варианта с характеристиками фермента SEQ ID NO:1, во всех случаях диапазон дозировок ферментов составлял 0,1-5 м.д.. Ферменты, имеющие показатель эффективности 1,1 или более рассматривали как протеазы для холодной воды.

ПРИМЕРы

Примеры 1-8

Жидкие составы моющих средств для стирки, приемлемые для автоматических стиральных машин с фронтальной загрузкой.

Ингредиент Состав (мас% состава)
1 2 3 4 5 6 7 8
Алкилбензолсульфоновая кислота 7 11 4,5 1,2 1,5 12,5 5,2 4
Натрий С12-14алкил этокси 3 сульфат 2,3 3,5 4,5 4,5 7 18 1,8 2
C14-15 алкил 8-этоксилат 5 8 2,5 2,6 4,5 4 3,7 2
C12 алкил диметиламиноксид 0,2
C12-14 алкил гидроксиэтил диметиламмоний хлорид 0,5
C12-18 жирная кислота 2,6 4 4 2,6 2,8 11 2,6 1,5
Лимонная кислота 2,6 3 1,5 2 2,5 3,5 2,6 2
Протеаза* 0,05 0,03 0,04 0,03 0,04 0,03 0,03 0,02
Амилаза (Natalase®) 0,1 0,2 0,15 - 0,05 0,5 0,1 0,2
Маннаназа (Mannaway®) 0,05 0,1 0,05 - - 0,1 0,04 -
Статистический привитой сополимер1 1 0,2 1 0,4 0,5 2,7 0,3 1
Соединение, имеющее следующую общую структуру: бис((C2H5O)(C2H4O)n)(CH3)-N+-CxH2x-N+-(CH3)-бис((C2H5O)(C2H4O)n), где n = от 20 до 30, и x = от 3 до 8, или его сульфатированные или сульфированные варианты 0,4 2 0,4 0,6 1,5 1,8 0,7 0,3
Этоксилированный полиэтиленимин2 0,5
Амфифильный алкоксилированный очищающий жир полимер3 0,1 0,2 0,1 0,2 0,3 0,3 0,2 0,3
Диэтоксилиро ванный поли(1,2 пропилен терефталат) короткий блочный полимер, высвобождающи и загрязнения 0,3
Диэтилентриаминпента 0,2 0,3 - - 0,2 - 0,2 0,3
(метиленфосфоновая) кислота
Гидроксиэтандифосфоновая кислота 0,45 1,5 0,1
FWA 0,1 0,2 0,1 - - 0,2 0,05 0,1
Растворители (1,2 пропандиол, этанол), стабилизаторы 3 4 1,5 1,5 2 4,3 2 1,5
Структурообразователь производное гидрогенизованного касторового масла 0,4 0,4 0,3 0,1 0,3 0,4 0,5
Борная кислота 1,5 2,5 1,5 1,5 0,5 1,5 1,5
Na формиат - - - 1 - - - -
Обратимый ингибитор протеазы4 0,002
Отдушка 0,5 0,7 0,5 0,5 0,8 1,5 0,5 0,8
Суспензия микрокапсул отдушки (30% ат) 0,2 0,3 0,7 0,2 0,05 0,4 0,9 0,7
Этоксилированный тиофен оттеночный краситель5 0,005 0,007 0,010 0,008 0,008 0,007 0,007 0,008
Буферы (гидроксид натрия, моноэтаноламин) До pH 8,2
Вода и незначительные добавки (противопенные, эстетические) До 100%

Примеры 9-16

Жидкие составы моющих средств для стирки, приемлемые для автоматических стиральных машин с вертикальной загрузкой.

Ингредиент Состав (мас% состава)
9 10 11 12 13 14 15 16
Cl2-15 Алкилэтокси(1,8)сульфат 20,1 15,1 20,0 15,1 13,7 16,7 10,0 9,9
C11,8 Алкилбензол сульфонат 2,7 2,0 1,0 2,0 5,5 5,6 3,0 3,9
C16-17 разветвленный алкилсульфат 6,5 4,9 4,9 3,0 9,0 2,0
C12-14 Алкил-9-этоксилат 0,8 0,8 0,8 0,8 8,0 1,5 0,3 11,5
C12 диметиламиноксид 0,9
Лимонная кислота 3,8 3,8 3,8 3,8 3,5 3,5 2,0 2,1
C12-18 жирная кислота 2,0 1,5 2,0 1,5 4,5 2,3 0,9
Протеаза* 0,1 0,2 0,1 0,1 0,1 0,1 0,1 0,1
Амилаза (Natalase®) 0.7 0,3 0,6 0,3 0,6 0,4
Амилаза (Termamyi Ultra®) 1,1
Маннаназа (Mannaway®) 0,1 0,1
Пектат лиаза (Pectawash®) 0,1 0,2
Borax 3,0 3,0 2,0 3,0 3,0 3,3
Na&Ca формиат 0,2 0,2 0,2 0,2 0,7
Соединение, имеющее следующую общую структуру: бис((C2H5O)(C2H4O)n)(CH3)-N+-CxH2x,-N+-(CH3)-бис((C2H5O)(C2H4O)n), где n= от 20 до 30, и x= от 3 до 8, или его сульфатированные или сульфированные варианты 1,6 1,6 3,0 1,6 2,0 1,6 1,3 1,2
Статистический привитой сополимер1 0,4 0,2 1,0 0,5 0,6 1,0 0,8 1,0
диэтилентриамин пентауксусная кислота 0,4 0,4 0,4 0,4 0,2 0,3 0,8
Tinopal AMS-GX 0,2 0,2 0,2 0,2 0,2 0,3 0,1
Tinopal CBS-X 0,1 0,2
Амфифильный алкоксилированный очищающий жир полимер3 1,0 1,3 1,3 1,4 1,0 1,1 1,0 1,0
Texcare 240N (Clariant) 1,0
Этанол 2,6 2,6 2,6 2,6 1,8 3,0 1,3
Пропиленгликоль 4,6 4,6 4,6 4,6 3,0 4,0 2,5
Диэтиленгликоль 3,0 3,0 3,0 3,0 3,0 2,7 3,6
Полиэтиленгликоль 0,2 0,2 0,2 0,2 0,1 0,3 0,1 1,4
Моноэтаноламин 2,7 2,7 2,7 2,7 4,7 3,3 1,7 0,4
Триэтаноламин 0,9
NaOH до pH 8,3 до pH 8,3 до pH 8,3 до pH 8,3 до pH 8,3 до pH 8,3 до pH 8,3 до pH 8,5
Подавители пенообразования
Краситель 0,01 0,01 0,01 0,01 0,01 0,01 0,0
Отдушка 0,5 0,5 0,5 0,5 0,7 0,7 0,8 0,6
Суспензия микрокапсул отдушки (30%ат) 0,2 0,5 0,2 0,3 0,1 0,3 0,9 1,0
Этоксилированный тиофеновый оттеночный краситель5 0,003 0,002 0,002 0,005 0,002 0,004 0,004 0,003
Вода равновесие равновесие равновесие равновесие равновесие равновесие равновесие равновесие

Примеры 17-22

Ниже представлены гранулированные составы моющих средств, полученные в соответствии с настоящим изобретением и приемлемые для стирки тканей.

17 18 19 20 21 22
Линейный алкилбензолсульфонат с длиной алифатической углеродной цепи С11-12 15 12 20 10 12 13
Другие поверхностно-активные вещества 1,6 1,2 1,9 3,2 0,5 1,2
Фосфатный структурообразователь(и) 2 3 4
Цеолит 1 1 4 1
Силикат 4 5 2 3 3 5
Карбонат натрия 2 5 5 4 0 3
Полиакрилат(MW 4500) 1 0,6 1 1 1,5 1
Карбоксиметилцеллюлоза (Finnfix BDA ex CPKelco) 1 - 0,3 - 1,1 -
Celluclean® (15,6 мг/г) 0,23 0,17 0,5 0,2 0,2 0,6
Протеаза* 0,23 0,17 0,05 0,2 0,03 0,1
StainzymePlus®(14 мг/г) 0,23 0,17 0,5 0,2 0,2 0,6
Mannaway 4,0T (4 мг/г) 0,1 0,1 0,1
Lipex 100T(18,6 мг/г) 0,2 0,1 0,3
Флуоресцентный осветлитель(и) 0,16 0,06 0,16 0,18 0,16 0,16
Диэтилентриаминпент ауксусная кислота или этилендиаминтетра уксусная кислота 0,6 0,6 0,25 0,6 0,6
MgSO4 1 1 1 0,5 1 1
Отбеливатель(и) и 6,88 6,12 2,09 1,17 4,66
активатор(ы) отбеливания
Этоксилированный тиофеновый оттеночный краситель5 0,002 0,001 0,003 0,003
Прямой фиолетовый 9 ex Ciba Specialty Chemicals 0,0006 0,0004 0,0006
Сульфат/лимонная кислота/бикарбонат натрия/влага/отдушка Равновесие до 100%

1Статистический привитой сополимер является поливинилацетатным привитым полиэтиленоксидным сополимером, имеющим полиэтиленоксидный каркас и множество поливинилацетатных боковых цепей. Молекулярная масса полиэтиленоксидного каркаса составляет приблизительно 6000 и массовое соотношение полиэтиленоксида и поливинилацетата составляет приблизительно 40 к 60 и не более, чем 1 точка прививки на 50 этиленоксидных звеньев.

2Полиэтиленимин (MW=600) с 20 этоксилатными группами на -NH.

3Амфифильный алкоксилированный очищающий жир полимер представляет собой полиэтиленимин (MW=600) с 24 этоксилатными группами на -NH и 16 пропоксилатными группами на -NH.

4Обратимый ингибитор протеазы структуры:

Этоксилированный тиофеновый оттеночный краситель является таким, как описано в US 7,208,459 B2.

*Примечание: все уровни ферментов выражены как % сырья фермента, кроме протеазы (в соответствии с настоящим изобретением), который выражен как % активного белка добавленного к продукту.

Примеры 23-25

Ниже представлены жидкие составы моющих средств для стирки, приемлемые для автоматических стиральных машин с вертикальной загрузкой (23 и 24) и стиральных машин с фронтальной загрузкой (25).

Ингредиент Состав (мас% состава)
23 24 25
C12-15 алкилэтокси(1,8)сульфат 14,7 11,6
C11.8 алкилбензолсульфонат 4,3 11,6 8,3
C16-17 разветвленный алкил сульфат 1,7 1,29
C12-14 алкил-9-этоксилат 0,9 1,07
C12 диметиламиноксид 0,6 0,64
Лимонная кислота 3,5 0,65 3
C12-18 жирная кислота 1,5 2,32 3,6
Борат натрия (Borax) 2,5 2,46 1,2
Натрий C12-14алкил этокси 3 сульфат 2,9
C14-15 алкил 7-этоксилат 4,2
C12-14 алкил-7-этоксилат 1,7
Ca формиат 0,09 0,09
Соединение, имеющее следующую общую структуру: бис((C2H5O)(C2H4O)n)(CH3)-CxH2x-N+-(CH3)-бис((C2H5O)(C2H4O)n), где n= от 20 до 30, и x= от 3 до 8, или его сульфатированные или сульфированные варианты 1,2
Статистический привитой сополимер1 1,46 0,5
Этоксилированный полиэтиленимин2 1,5 1,29
Диэтилентриаминпентауксусная кислота 0,34 0,64
Диэтилентриаминпента(метиленфосфорная кислота) 0,3
Tinopal AMS-GX 0,06
Tinopal CBS-X 0,2 0,17
Амфифильный алкоксилированный очищающий жир полимер3 1,28 1 0,4
Этанол 2 1,58 1,6
Пропиленгликоль 3,9 3,59 1,3
Диэтиленгликоль 1,05 1,54
Полиэтиленгликоль 0,06 0,04
Моноэтаноламин 3,05 2,41 0,4
NaOH 2,44 1,8
Натрий кумол сульфонат 1
Формиат натрия 0,11
Вода, эстетические добавки (красители, отдушки) и незначительные добавки (ферменты, растворители, структурообразователи) равновесие равновесие равновесие

1Статистический привитой сополимер является поливинилацетатным привитым полиэтиленоксидным сополимером, имеющим полиэтиленоксидный каркас и множество поливинилацетатных боковых цепей. Молекулярная масса полиэтиленоксидного каркаса составляет приблизительно 6000 и массовое соотношение полиэтиленоксида и поливинилацетата составляет приблизительно 40 к 60 и не более, чем 1 точка прививки на 50 этиленоксидных звеньев.

2Полиэтиленимин (MW=600) с 20 этоксилатными группами на -NH.

3Амфифильный алкоксилированный очищающий жир полимер представляет собой полиэтиленимин (MW=600) с 24 этоксилатными группами на -NH и 16 пропоксилатными группами на -NH.

Примеры 26-30

Ниже приведены гранулированные составы моющих средств для стирки, приемлемые для автоматических стиральных машин с вертикальной загрузкой (26-28) и стиральных машин с фронтальной загрузкой (29-30).

Протеазу в соответствии с настоящим изобретением отдельно добавляют в эти составы.

26 27 28 29 30
Поверхностно-активные вещества
C16-17 разветвленный алкил сульфат 3,55
C12-14 алкил сульфат 1,5
Натрий линейный алкилбензолсульфонат с длиной алифатической цепи C11-C12 9,6 15,8 10,6 7,5 9
Натрий C14/15 спирт этокси-3-сульфат 1,15 2,88
Натрий C14/15 алкил сульфат 2,37
C14/15 спирт этоксилат со в среднем 7 молями этоксилирования 1,17 1
Моно-C8-10 алкил моно-гидроксиэтил диметил четвертичный аммоний хлорид 0,45
Диметилгидроксилэтиллаурил аммоний хлорид 0,18
Цеолит A 13,9 4,7 0,01 2,9 1,8
Силикат натрия 1,6, соотношение 4 0,2 4 4
Силикат натрия 2,35, соотношение 8
Лимонная кислота 2,5 1,4
Натрий триполифосфат 5
Карбонат натрия 24,1 30 16,9 24,4 21
Нонаноилоксибензолсульфонат 5,78 2,81 0,96
Усилитель отбеливания на основе оксазиридиния 0,03 0,017
Тетранатрий S,S,-этилендиаминдисукцинат 0,2
Диэтилентриамин пента (метиленфосфониевая кислота), гептанатриевая соль 0,61 0,33
Гидроксиэтан диметиленфосфониевая кислота 0,29 0,45
Этилендиаминтетраацетат 0,27
MgSO4 0,47 0,5994 0,782
Перкарбонат натрия 7 4,4 15,9 19,1
Тетраацетилэтилендиамин 3,3 4,6
Натрий перборат моногидрат 1,2
Карбоксиметилцеллюоза (например Finnfix BDA ex CPKelco) 0,1 0,17 1,69 0,23
Сополимер натрий акриловой кислоты/малеиновой кислоты (70/30) 0,0236 3,8 2 2,5
Полиакрилат натрия (Sokalan PA30 CL) 4 0,84
Терефталатный полимер 0,23
Полиэтиленгликоль/винилацетатный статистический привитой сополимер 0,89 0,89 0,91
Фотоотбеливатель-цинк фталоцианин тетрасульфонат 0,005 0,001 0,002
C.I. Флуоресцентный осветлитель 260 0,11 0,15 0,04 0,23 0,15
C.I.Флуоресцентный осветлитель 351 (Tinopal® CBS) 0,1
Гранулы подавителей пенообразования 0,25 0,07 0,04
Гидрофобно модифицированная карбоксиметилцеллюлоза (Finnifix® SH-1) 0,019 0,028
Бентонит 8,35
Различные добавки (красители, отдушки, технологические добавки, влага и сульфат натрия) Равновесие Равновесие Равновесие Равновесие Равновесие

Примечания к Примерам 26-30:

Ингредиенты поверхностно-активных веществ могут быть получены от BASF, Ludwigshafen, Germany (Lutensol®); Shell Chemicals, London, UK; Stepan, Northfield, Illinois, USA; Huntsman, Huntsman, Salt Lake City, Utah, USA; Clariant, Sulzbach, Germany (Praepagen®).

Цеолит может быть получен от Industrial Zeolite(UK) Ltd, Grays, Essex, UK.

Лимонная кислота и цитрат натрия могут быть получены от Jungbunzlauer, Basel, Switzerland.

Перкарбонат натрия, карбонат натрия, бикарбонат натрия и сесквикарбонат натрия могут быть получены от Solvay, Brussels, Belgium.

Акрилатные/малеатные сополимеры могут быть получены от BASF, Ludwigshafen, Germany.

Карбоксиметилцеллюлоза и гидрофобно модифицированная карбоксиметилцеллюлоза может быть получена от CPKelco, Arnhem, The Netherlands.

C.I. Флуоресцентный осветлитель 260 может быть получен от 3V Sigma, Bergamo, Italy как Optiblanc®, Optiblanc® 2M/G, Optiblanc® 2MG/LT Extra, или Optiblanc® Ecobright.

Тетранатрий S,S-этилендиамин дисукцинат может быть получен от Innospec, Ellesmere Port, UK.

Терефталатный сополимер может быть получен от Clariant под торговой маркой Repelotex SF2.

1-гидроксиэтан-1,1-дифосфониевая кислота может быть получена от Thermphos, Vlissingen-Oost, The Netherlands.

Усилитель отбеливания на основе оксазиридиния имеет следующую структуру, где R1=2-бутилоктил, и был получен в соответствии с US 2006/0089284 A1.

Ферменты Natalase®, Termamyi®, Stainzyme Plus®, Celluclean® и Mannaway® могут быть получены от Novozymes, Bagsvaerd, Denmark.

Цинк фталоцианин тетрасульфонат может быть получен от Ciba Specialty Chemicals, Basel, Switzerland, как Tinolux® BMC.

Гранулы подавителя пены могут быть получены от Dow Coming, Barry, UK.

Статистический привитый сополимер является поливинилацетатным привитым полиэтиленоксидным сополимером, имеющим полиэтиленоксидный каркас и множество поливинилацетатных боковых цепей. Молекулярная масса полиэтиленоксидного каркаса составляет приблизительно 6000 и массовое соотношение полиэтиленоксида и поливинилацетата составляет приблизительно 40 к 60 и не более, чем 1 точка прививки на 50 этиленоксидных звеньев.

Пример 31

Получение библиотек оценки сайта GG36 (SELs)

Конструирование GG36 SELs, описанных в данном Примере, выполняли при помощи GENEART с использованием их собственных способов и технологической платформы для генной оптимизации, генного синтеза, генерации библиотек и анализа (WO 2004/059556 A3, европейские патенты №№0200362 и 0201184; и патенты США №№4,683,195, 4,683,202 и 6,472,184). GG36 SELs были получены в положениях, предварительно выбранных изобретателями при помощи pHPLT-GG36 B. subtilis плазмида экспрессии (См. ФИГ.2). Данный B. subtilis плазмид экспрессии содержит GG36 кассету экспрессии, показанную ниже, B. licheniformis LAT промотор (Plat) и дополнительные элементы из pUB110 (McKenzie et al., Plasmid, 15:93-103, 1986) включая репликазный ген (reppUB), неомицин/канамицин резистентный ген (neo) и блеомицин резистентный маркер (bleo) (Фигура 4 в патенте США 6,566,112).

ДНК последовательность GG36 (сигнальная последовательность показана строчными буквами, пропептид показан строчными буквами, подчеркнутый текст, и GG36 зрелая последовательность показана прописными буквами) gtgagaagcaaaaaattgtggatcgtcgcgtcgaccgcactactcatttctgttgctttcagttcatcgatcgcatcggctgctgaagaagcaaaagaaaaatatttaattggctttaatgagcaggaagctgtcagtgagtttgtagaacaagtagaggcaaatgacgaggtcgccattctctctgaggaagaggaagtcgaaattgaattgcttcatgaatttgaaacgattcctgttttatccgttgagttaagcccagaagatgtggacgcgcttgagctcgatccagcgatttcttatattgaagaggatgcagaagtaacgacaatgGCGCAATCAGTGCCATGGGGAATTAGCCGTGTGCAAGCCCCAGCTGCCCATAACCGTGGATTGACAGGTTCTGGTGTAAAAGTTGCTGTCCTCGATACAGGTATTTCCACTCATCCAGACTTAAATATTCGTGGTGGCGCTAGCTTTGTACCAGGGGAACCATCCACTCAAGATGGGAATGGGCATGGCACGCATGTGGCCGGGACGATTGCTGCTTTAAACAATTCGATTGGCGTTCTTGGCGTAGCGCCGAGCGCGGAACTATACGCTGTTAAAGTATTAGGGGCGAGCGGTTCAGGTTCGGTCAGCTCGATTGCCCAAGGATTGGAATGGGCAGGGAACAATGGCATGCACGTTGCTAATTTGAGTTTAGGAAGCCCTTCGCCAAGTGCCACACTTGAGCAAGCTGTTAATAGCGCGACTTCTAGAGGCGTTCTTGTTGTAGCGGCATCTGGAAATTCAGGTGCAGGCTCAATCAGCTATCCGGCCCGTTATGCGAACGCAATGGCAGTCGGAGCTACTGACCAAAACAACAACCGCGCCAGCTTTTCACAGTATGGCGCAGGGCTTGACATTGTCGCACCAGGTGTAAACGTGCAGAGCACATACCCAGGTTCAACGTATGCCAGCTTAAACGGTACATCGATGGCTCTCCTCATGTTGCAGGTGCAGCAGCCCTTGTTAAACAAAAGAACCCATCTTGGTCCAATGTACAAATCCGCAATCATCTAAAGAATACGGCAACGAGCTTAGGAAGCACGAACTTGTATGGAAGCGGACTTGTCAATGCAGAAGCTGCAACTCGTTAA SEQ DD NO:4 является полноразмерной последовательностью, включая полипептид и сигнальный пептид.

Белковая последовательность GG36 (сигнальная последовательность показана строчными буквами, пропептид показан строчными буквами, подчеркнутый текст, и GG36 зрелая протеазная последовательность показана прописными буквами) vrskklwivastallisvafsssiasaaeeakekyligfneqeavsefveqveandevailseeeeveiellhefetipvlsvelspedvdaleldpaisvieedaevttmAOSVPWGISRVOAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR SEQ ID NO:1 является зрелой последовательностью и SEQ ID NO:3 также включает сигнал и пропептид.

Способ мутагенеза основан на подходе кодон-специфичных мутаций, в котором все возможные аминокислотные замещения одновременно создаются на специфичном рассматриваемом кодоне при использовании праймеров прямого и обратного мутагенеза, содержащих дегенеративный кодон, NNS ((A, C, T или G), (A, C, T или G), (С или G)) в рассматриваемом сайте. Для конструирования каждого из GG36 SELs, были выполнены три ПЦР реакции: две мутагенезные реакции (первичная ПЦР1 и ПЦР2) для введения мутированного рассматриваемого ко дона в зрелую GG36 ДНК последовательность с использованием NNS праймеров прямого и обратного мутагенеза (25-45 нуклеотидов длиной), и третья реакция для гибридизации двух мутагенезных ПЦР продуктов вместе для создания pHPLT-GG36 вектора экспрессии, имеющего желательные мутированные кодоны в зрелой GG36 последовательности.

Праймерные последовательностей, использованные в данном Примере, приведены ниже:

CGCGCTTGAGCTCGATCCAGCGATTTC Sacl-Fw
GTCTCCAAGCTTTAACGAGTTGCAG HindIII-Rv
GCAATTCAGATCTTCCTTCAGGTTATGACC pHPLT-BglII-Fw
GCATCGAAGATCTGATTGCTTAACTGCTTC pHPLT-BglII-Rv

Phusion High-Fidelity ДНК полимеразу (Finnzymes каталог № F-530L) использовали для всех ПЦР и реакции выполняли в соответствии с протоколами производителя, которые поставляли вместе с полимеразой. В особенности, для первичной ПЦР1, использовали 1 мкл (10 мкМ) каждого pHPLT-BglII-Fw праймера и NNS праймер обратного мутагенеза и для первичной ПЦР2, использовали 1 мкл (10 мкМ) pHPLT-BglII-Rv праймера и NNS праймер прямого мутагенеза. Каждая реакция также включала 1 мкл pHPLT-GG36 плазмидной темплаты ДНК (0,1-1 нг/мкл). MJ Research PTC-200 Пельтье термоячейку для реакций использовали для ПЦР. Реакции привели к получению двух фрагментов приблизительно от 2 до 3 kb, имеющих приблизительно 30 нуклеотидное перекрывание вокруг рассматриваемого GG36 кодона. Полученные фрагменты гибридизовали в третьем ПЦР аналогично описанным выше с использованием 1 мкл первичной ПЦР1 реакционной смеси, 1 мкл первичной ПЦР2 реакционной смеси и 1 мкл (10 мкМ) каждого из прямого и обратного SacI-Fw и HindIII-Rv праймеров. Амплифицированный линейный 859 bp фрагмент, кодирующий GG36 вариантный ген, был очищен (с использованием набора для очистки QIAGEN® Qiaquick PCR) и дигестирован рестриктазой Sad и HindIIII для создания когезивных концов на обеих сторонах фрагмента гибридизации. Приблизительно 50 нг плазмида pHPLT-GG36 также очищали после дигестии Sad и HindIIII, приводя к получению 3,9 kb фрагмента каркаса вектора. Дигестированный фрагмент вектора лигировали 50 нг дигестированного 859 bp фрагмента, кодирующего вариантный фермент при помощи Т4 ДНК лигазы (Invitrogen) в соответствии с инструкциями производителя для клонирования когезивных концов. Затем лигирующую смесь использовали для трансформации клеток В. subtilis (ΔaprE, ΔnprE, oppA, ΔspoIIE, degUHy32, ΔamyE::[xylR,pxylA-comK]) как описано (WO 2002/014490).

Для экспрессии вариантных белков для дополнительных биохимических анализов, штаммы B. subtilis, которые несут GG36 вариантные плазмиды, инокулировали в микротитрующие планшеты, содержащие 150 мкл Luria бульонной среды с дополнением 10 пг/мл неомицина. Планшеты выращивали всю ночь при 37°C с 300 об./мин. при встряхивании и 80% влажности с использованием Enzyscreen крышек для микротитрующих планшет (Enzyscreen). Десять микролитров из культивированной всю ночь планшеты использовали для инокуляции новой микротирующей планшеты, содержащей 190 мкл MBD среды (определенной среды на основе MOPS) с 10 мкг/мл неомицина. MBD среду получали существенно так, как известно из уровня техники (См., Neidhardt el al., J. Bacteriol., 119: 736-747 [1974]), кроме NH4Cl, FeSO4 и CaCl не добавляли в основную среду, использовали 3 мМ K2HPO4 и в основную среду добавляли 60 мМ мочевины, и 100 мл раствора состояли из 210 г/л глюкозы и 350 г/л мальтодекстрина. Микронутриенты были составлены как 100Х маточный раствор, содержащий в одном литре, 400 мг FeSO4 7H2O, 100 мг MnSO4·H2O, 100 мг ZnSO4 7H2O, 50 мг CuCl2 2H2O, 100 мг CoCl2 6H2O, 100 мг NaMoO4 2H2O, 100 мг Na2B4O7 10H2O, 10 мл 1M CaCl2 и 10 мл 0,5М цитрата натрия. MBD среда, содержащая микротитровальные планшеты, была вырощена в течение 68 часов при 37°C, 300 об./мин. и 80% влажности с использованием крышек Enzyscreen (Enzyscreen) для определения экспрессии белков. На следующий день, культуры были отфильтрованы через микрофильтровальную планшету (0,22 мкл; Millipore) и полученный в результате фильтрат был использован для биохимического анализа. ТСА, LAS/EDTA и BMI анализы микрообразцов были проведены как описано в Разделе Тестовые методы. Значения показателя эффективности также рассчитаны, как описано под описанием BMI анализа в Разделе Тестовые методы, и они показаны в Таблице 2-1.

Таблица 2-1:
Значения показателя эффективности (PI) GG36 вариантов относительно GG36 в BMI анализе микрообразцов с использованием Тестового метода 3
Мутация относительно SEQ ID NO:1 (BPN' нумерация) BMI, моющее средство Примера 26 16C.PI
Q2S 1,1
V4R 1,1
V4S 1,1
R10S 1,1
P14K 1,1
A16S 1,1
T22A 1,1
T22R 1,1
S24R 1,2
G25V 1,1
V26F 1,1
L42I 1,2
P52F 1,2
P52E 1,1
P52N 1,1
N62E 1,1
N62Q 1,1
V68A 1,1
V68C 1,1
T71G 1,2
I72C 1,2
A74C 1,1
L75A 1,1
L75F 1,1
S78R 1,1
E89P 1,2
E89T 1,2
E89G 1,1
E89H 1,1
E89W 1,1
Y91N 1,3
K94N 1,1
G100S 1,1
S101A 1,2
S101N 1,1
S101G 1,1
S101D 1,1
S103G 1,3
S103N 1,2
V104L 1,1
V104I 1,1
A108I 1,1
L111V 1,5
E112V 1,2
G115K 1,1
N117F 1,1
V121F 1,1
S128D 1,2
S128F 1,1
S128L 1,1
S128N 1,1
Р129Е 1,1
L148I 1,1
A158E 1,1
G159E 1,1
S160D 1,2
S166D 1,2
N185E 1,1
R186H 1,1
S188E 1,2
S188D 1,1
V203E 1,2
Y209S 1,2
Y209N 1,2
Y209F 1,1
Y209T 1,1
Y209E 1,1
Y209H 1,1
Y209G 1,1
P210R 1,1
S212I 1,2
Y214F 1,1
A215N 1,1
A215D 1,1
A215E 1,1
L217E 1,1
L217N 1,1
T224A 1,1
А230Е 1,1
A231I 1,1
Q236F 1,1
N238R 1,1
N238K 1,1
P239K 1,2
P239G 1,2
P239R 1,1
N248V 1,1
H249R 1,1
L250I 1,1
L262D 1,1
Y263F 1,1
S265F 1,1
L267V 1,2
L267N 1,1
N269I 1,1
E271I 1,1
Е271Н 1,1
A272F 1,2

Показатель эффективности приведенных ниже вариантов был проанализирован с использованием Тестового метода 2 при 16C.

Таблица 2-2:
Значения показателя эффективности (PI) GG36 вариантов относительно GG36 в BMI анализе микрообразцов с использованием моющего средства Примера 29
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI
V4R 1,1
H17R 1,1
N18R 1,1
G20R 1,1
T22R 1,1
S24R 1,1
S24W 1,1
G25R 1,1
N43R 1,1
N43A 1,1
G46R 1,1
P52F 1,1
P52N 1,1
T57R 1,1
Q59A 1,1
N62Q 1,1
T71G 1,2
L75R 1,1
N76D 1,1
S78R 1,1
L82R 1,1
P86W 1,1
E89P 1,2
E89W 1,1
E89T 1,1
E89I 1,1
E89H 1,1
E89V 1,1
V104L 1,1
S106V 1,1
S106G 1,1
G115R 1,1
G118I 1,2
V121F 1,1
S144R 1,1
N185I 1,1
D197F 1,1
Y209N 1,1
Y209S 1,1
L217E 1,1
A231I 1,1
P239R 1,1
P239S 1,1
W241R 1,1
S242R 1,1
S242L 1,1
N243R 1,2
V244R 1,1
N248I 1,1
H249R 1,1
N252R 1,1
T253R 1,1
E271T 1,2
E271V 1,1
E271L 1,1
E271H 1,1
E271F 1,1
E271P 1,1

Пример 32

Конструирование и чистящие характеристики NHJ1 и WCE1 набора GG36 вариантов

NHJ1 и WCE1 набор GG36 вариантов, описанных в данной заявке, конструировали при DNA2.0, Inc. (Menio Park, CA) их собственными способами с использованием pHPLT-GG36 В. subtilis плазмида экспрессии, описанного выше (Фигура 2). Варианты экспрессировали в клетках В. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo) как описано в Примере 31, и дополнительно характеризовали при помощи ТСА и BMI анализов микрообразцов, как описано в Разделе Тестовые методы.

Таблица 3-1:
Значения показателя эффективности (PI) NHJ1 вариантов относительно GG36 в Тестовом методе 3
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI, определенный в моющем средстве Примера 26 при 16С
N062E-P129E 1,2
N062E-G159E 1,2
A016S-L148I 1,2
A158E-H249R 1,2
A016S-N062E 1,2
L111V-S188D 1,2
T022A-N062E 1,2
N062E-L148I 1,2
T022A-P129E 1,1
N062E-E271F 1,1
N062E-A158E 1,1
A016S-G159E 1,1
N062E-R186H 1,1
S128N-G159E 1,1
N062E-S188D 1,1
N062E-S128N 1,1
L148I-G159E 1,1
S103G-A158E 1,1
L111V-G159E 1,1
A158E-E271F 1,1
A016S-S188D 1,1
T022A-L111V 1,1
S128N-A158E 1,1
A016S-A158E 1,1
V104L-A158E 1,1
S128N-R186H 1,1
G159E-Y209E 1,1
N062E-S101A 1,1
L111V-Y209E 1,1
L148I-S188D 1,1
S101A-Y209E 1,1
T022A-S188D 1,1
A016S-T022A 1,1
S128N-P129E 1,1
A016S-Y209E 1,1
A016S-S128N 1,1
T022A-E089P 1,1
S128N-Y209E 1,1
E089P-A158E 1,1
N062E-S103G 1,1
R186H-E271F 1,1
A016S-P129E 1,1
E089P-G159E 1,1
L111V-H249R 1,1
S101A-P129E 1,1
L148I-Y209E 1,1
T022A-G159E 1,1
P129E-H249R 1,1
P129E-Y209E 1,1
V104L-P129E 1,1
S128N-S188D 1,1
L111V-A158E 1,1
T022A-A158E 1,1
N062E-Y209E 1,1
N062E-H249R 1,1
S101A-R186H 1,1
E089P-P129E 1,1
P129E-E271F 1,1
Таблица 3-2:
Значения показателя эффективности (PI) WCE1 вариантов относительно GG36 в BMI анализе микрообразцов с использованием Тестового метода 2
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI при 16С с использованием моющего средства Примера 29
T022R-S024R 1,2
S009A-E271L 1,1
N018R-W241R 1,1
N018R-G115R 1,1
N043R-H249R 1,1
G020R-H249R 1,1
V004R-H249R 1,1
G020R-S024R 1,1
N018R-H249R 1,1
S009A-G020R 1,1
G020R-W241R 1,1
S009A-S078R 1,1
G020R-G115R 1,1
N018R-S024R 1,1
S024R-S242R 1,1
T022R-G115R 1,1
N018R-N043R 1,1
G020R-N043R 1,1
N018R-S242R 1,1
S242R-N269R 1,1
N018R-V244R 1,1
S024R-N269R 1,1
G020R-E271L 1,1
S024R-E271L 1,1
V004R-S009A 1,1
G020R-N269R 1,1
A001R-S024R 1,1
V244R-E271L 1,1
S009A-N018R 1,1
W241R-E271L 1,1
V004R-S024R 1,1
S009A-H249R 1,1
S009A-T022R 1,1

Пример 33

Конструирование и чистящие характеристики NHJ4 набора GG36 вариантов NHJ4 набор GG36 вариантов, описанный в Таблице 4-4 ниже, был сконструирован с использованием pHPLT-GG36 В. subtilis плазмида экспрессии (Фигура 2) с использованием ПЦР гибридизации или QuikChange® Multi набора сайт-направленного мутагенеза («QCMS набор»; Stratagene) как описано ниже.

a) Конструирование NHJ4 вариантов при помощи QuikChange® Multi сайт-направленного мутагенеза (QCMS)

Варианты, созданные при помощи QuikChangeτ Multi сайт-направленного мутагенеза показаны в Таблице 4-4. Родительский плазмид pHPLT-GG36 (темплатная ДНК) был метилирован при помощи двух микрограмм ДНК и Dam метилазы (New England Biolabs), в соответствии с инструкциями производителя. Сайт-направленные мутанты были получены при помощи QuikChange® Multi набора сайт-направленного мутагенеза («QCMS набор»; Stratagene) в соответствии с протоколом производителя (См., Таблица 4-1 для праймерных последовательностей). Для эффективной транформации B. subtilis, ДНК из QCMS реакции амплифицировали путем образующей окружности амплификации (RCA) при помощи набора Illustra Templiphi (GE Healthcare) в соответствии с протоколом производителя. Один микролитр 10-кратно разведенной амплифицированной ДНК был использован для трансформации 50 мкл компетентных B. subtilis клеток (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo). Трансформационную смесь встряхивали при 37°C в течение 1 часа. Аликвоты в 10 миллилитров трансформационной смеси высевали на планшеты на содержащие снятый латекс (1,6%) Luria агаровые планшеты с добавлением 10 мкг/мл неомицина. Затем, колонии с гало инокулировали в 120 мкл Luria бульонных средах, содержащих 10 мкг/мл неомицина для экстракции плазмидной ДНК (QIAprep Spin Miniprep набор, Qiagen). Экстрагированные плазмиды секвенировали для подтверждения наличия желательных мутаций.

Таблица 4.1
Праймерные последовательности, используемые в конструировании NHJ4 вариантов QCMS способом
Введенные мутации (BPN' нумерация) Название праймера Праймерная последовательность (5'-фосфорилированная)
S101A
S103G AAAGTATTAGGGGCGAGCGGTGCAGGTGGACTTAGCTCGA
V104L Р5939 TTGCCCAAGGATTG (SEQ ID NO:5)
CATCTGGAAATTCAGGTGCAGAATCAATCAGCTATCCGGCC
G159E Р5940 CGTTA (SEQ ID NO:6)
T22A Р5941 CTGCCCATAACCGTGGATTGGCAGGTTCTGGTGTAAAAGTT
Таблица 4.1
Праймерные последовательности, используемые в конструировании NHJ4 вариантов QCMS способом
Введенные мутации (BPN' нумерация) Название праймера Праймерная последовательность (5'-фосфорилированная)
GCTG(SEQIDNO:7)
Y209E Р5942 AGGTGTAAACGTGCAGAGCACAGAACCAGGTTCAACGTAT GCCAG(SEQIDNO:8)
E271F Р5943 GAAGCGGACTTGTCAATGCATTCGCTGCAACTCGTTAAAGC TTG (SEQ ID NO:9)
S101A Р5944 AAAGTATTAGGGGCGAGCGGTGCAGGTTCGGTCAGCTCGA TTGCCCAA (SEQ ID NO:10)
S103G Р5945 TATTAGGGGCGAGCGGTTCAGGTGGAGTCAGCTCGATTGCC CAAGGA (SEQ ID NO:11)
L111V Р5946 GTCAGCTCGATTGCCCAAGGAGTAGAATGGGCAGGGAACA ATGGCA (SEQ ID NO:12)
S128N Р5947 CGTTGCTAATTTGAGTTTAGGAAACCCTTCGCCAAGTGCCA CACTTGA (SEQ ID NO:13)
N62E Р5948 GAACCATCCACTCAAGATGGGGAAGGGCATGGCACGCATG TG (SEQ ID NO: 14)
S188D Р5949 ACCAAAACAACAACCGCGCCGACTTTTCACAGTATGGCGC AGGGCTT (SEQ ID NO:15)

b) Конструирование NHJ4 вариантов при помощи расширения ПЦР

Десять комбинаторных мутантов GG36 создавали при помощи расширения ПЦР (Таблица 4-4). Список мутаций, введенных в pHPLT-GG36 плазмид и праймеры, использованные для этого, показаны в Таблице 4-2. Для создания каждого мутанта, несколько фрагментов (Таблица 4-3) амплифицировали при помощи праймеров, показанных в Таблице 4-2. Каждая реакция амплификации ПЦР содержала 30 пмоль каждого праймера и 100 нг ДНК темплаты, pHPLT-GG36 плазмида. Амплификации проводили с использованием Vent ДНК полимеразы (New England Biolabs). ПЦР реакцию (20 мкл) первоначально нагревали при 95°C в течение 2,5 минут с последующими 30 циклами денатурации при 94°C в течение 15 секунд, гибридизуя при 55°C в течение 15 секунд и расширении при 72°C в течение 1 минуты. После амплификации, 2-4 ПЦР фрагментов (Таблица 4-3) для каждого варианты очищали гелем при помощи набора QIAGEN® гель-зонной очистки и смешивали (50 нг каждого фрагмента). Эти смеси служили ДНК темплатами для расширения ПЦР при помощи праймеров Р5954 и Р5955 для получения полноразмерного генного фрагмента. Условия ПЦР были такими же, как описано выше, кроме фазы расширения, которую проводили при 72°C в течение 2 минут. Полноразмерный ДНК фрагмент очищали гелем при помощи набора QIAGEN® гель-зонной очистки, дигестировали при помощи ферментов BamHI и HindIII рестрикции, и лигировали pHPLT-GG36 вектором, дигестированным теми же рестриктазами. Лигирующие смеси амплифицировали при помощи образующей окружность амплификации и трансформировали в B. subtilis клетки, как описано в QCMS способе выше. Варианты GG36, которые были получены, секвенировали для подтверждения наличия желаемых мутаций. Варианты, созданные расширением ПЦР, показаны в Таблице 4-4.

Таблица 4-2:
Список праймеров, использованных для конструирования NHJ4 вариантов при помощи расширения ПЦР
Мутация (BPN' нумерация) Название праймера Прямой или обратный Праймерная последовательность
P5950 flanking Прямой CATATGAGTTATGCAGTTTGTAG (SEQ ID NO:16)
P5951 flanking Обратный TGTTTTTCTTGGAATTGTGCTGT (SEQ ID NO:17)
P5954 flanking Прямой CAGTTTGTAGAATGCAAAAAGTG (SEQ ID NO:18)
P5955 flanking Обратный GACAAGGTAAAGGATAAAACAGC (SEQ ID NO:19)
T22A P5956 Прямой CATAACCGTGGATTGGCAGGTTCTGGTGTAAA AGTTGCTG (SEQ ID NO:20)
T22A P5957 Обратный ACTTTTACACCAGAACCTGCCAATCCACGGTT ATGGGCAG (SEQ ID NO:21)
S103G P5960 Прямой GCGAGCGGTTCAGGTGGAGTCAGCTCGATTG CCCAAGGA (SEQ ID NO:24)
S103G P5961 Обратный TGGGCAATCGAGCTGACTCCACCTGAACCGCT CGCCCCTA (SEQ ID NO:25)
Таблица 4-2:
Список праймеров, использованных для конструирования NHJ4 вариантов при помощи расширения ПЦР
Мутация (BPN' нумерация) Название праймера Прямой или обратный Праймерная последовательность
S103G GTGGAGTCAGCTCGATTGCCCAAGGAGTAGA
L111V P5962 Прямой ATGGGCAGGGAACAATGGCAT (SEQ ID NO:26)
S103G CATTCTACTCCTTGGGCAATCGAGCTGACTCC
L111V P5963 Обратный ACCTGAACCGCTCGCCCCTA (SEQ ID NO:27)
S101G
S103A GCGAGCGGTGGAGGTGCGATCAGCTCGATTG
V1041 P5964 Прямой CCCAAGGATTG (SEQ ID NO:28)
S101G
S103A CTTGGGCAATCGAGCTGATCGCACCTCCACCG
V104I P5965 Обратный CTCGCCCCTAATACTTTA (SEQ ID NO:29)
S101A
S103G GCGAGCGGTGCAGGTGGACTTAGCTCGATTG
V104L P5966 Прямой CCCAAGGATTG (SEQ ID NO:30)
S101A
S103G CTTGGGCAATCGAGCTAAGTCCACCTGCACCG
V104L P5967 Обратный CTCGCCCCTAATACTTTA (SEQ ID NO:31)
TATTAGGGGCGAGCGGTGCAGGTTCGGTCAG
S101A P5968 Прямой CTCGATTGC (SEQ ID NO:32)
ATCGAGCTGACCGAACCTGCACCGCTCGCCCC
S101A P5969 Обратный TAATACTTTA (SEQ ID NO:33)
CTAATTTGAGTTTAGGAAACCCTTCGCCAAGT
S128N P5970 Прямой GCCACACTT (SEQ ID NO:34)
GCACTTGGCGAAGGGTTTCCTAAACTCAAATT
S128N P5971 Обратный AGCAACGTG (SEQ ID NO:35)
GAAATTCAGGTGCAGACTCAATCAGCTATCC
G159D P5972 Прямой GGCCCGTT (SEQ ID NO:36)
GGATAGCTGATTGAGTCTGCACCTGAATTTCC
G159D P5973 Обратный AGATGC (SEQ ID NO:37)
G159E P5974 Прямой GAAATTCAGGTGCAGAATCAATCAGCTATCC
Таблица 4-2:
Список праймеров, использованных для конструирования NHJ4 вариантов при помощи расширения ПЦР
Мутация (BPN' нумерация) Название праймера Прямой или обратный Праймерная последовательность
GGCCCGTT (SEQ ID NO:38)
GGATAGCTGATTGATTCTGCACCTGAATTTCC
G159E P5975 Обратный AGATGC (SEQ ID NO:39)
AACGTGCAGAGCACAGAACCAGGTTCAACGT
Y209E P5976 Прямой ATGCCAGCTT (SEQ ID NO:40)
CATACGTTGAACCTGGTTCTGTGCTCTGCACG
Y209E P5977 Обратный TTTACACC (SEQ ID NO:41)
TCGATTGCCCAAGGAGTAGAATGGGCAGGGA
L111V P5978 Прямой ACAATGGCAT (SEQ ID NO:42)
CATTGTTCCCTGCCCATTCTACTCCTTGGGCA
L111V P5979 Обратный ATCGAGCTGAC (SEQ ID NO:43)
Таблица 4-3:
Комбинаторные варианты, созданные при помощи расширения ПЦР
Вариант № Варианты (BPN нумерация) Фрагмент ПЦР1 фрагменты
NHJ4-1 S101GS103A V104I 1 P5950+P5965
2 P5964+P5951
NHJ4-2 S101GS103A V104I 3 P5950+P5965
G159D 4 P5964+P5973
5 P5972+P5951
NHJ4-3 S101AS103G V104L 6 P5950+P5967
7 P5966+P5951
NHJ4-4 S101AS103G V104L 8 P5950+P5967
G159E 9 P5966+P5975
10 P5974+P5951
NHJ4-5 S101AS103G V104L 11 P5950+P5957
Т22А 12 P5956+P5967
13 P5966+P5951
NHJ4-10 T22AS101A Y209E 14 P5950+P5957
Таблица 4-3:
Комбинаторные варианты, созданные при помощи расширения ПЦР
Вариант № Варианты (BPN нумерация) Фрагмент ПЦР1 фрагменты
15 P5956+P5969
16 P5968+P5977
17 P5976+P5951
NHJ4-12 T22AS103G G159E 21 P5950+P5957
22 P5956+P5961
23 P5960+P5975
24 P5974+P5951
NHJ4-20 S101AS103G V104L 29 P5950+P5967
S128N 30 P5966+P5971
31 P5970+P5951

Для экспрессии NHJ4 набора вариантных белков для дополнительных биохимических анализов, штаммы В. Subtilis, несущие вариантные плазмиды, инокулировали в микротитрующие планшеты, содержащие 150 мкл Luria бульонной среды с добавлением 10 мкг/мл неомицина. Культуры выращивали для экспрессии белка, как описано в Примере 31, и фильтровали через микрофильтровальную планшету (0,22 мкл; Millipore) также как описано в Примере 31. Полученный в результате фильтрат использовали для биохимического анализа. Анализ ингибирования eglin с для определения содержания белков и BMI анализы микрообразцов, протестированных в различных моющих средствах, проводили так, как описано в разделе Тестовые методы. Показатели эффективности также рассчитывали так, как описано в описании BMI анализа микрообразцов в разделе Тестовые методы.

Таблица 4-4:
NHJ4 множественные варианты мутации, показатель эффективности (PI) относительно GG36 (определены Тестовым методом 3 - моющее средство Примера 26, 16C)
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI Название варианта (способ конструирования)
T22A-L111V-G159E 1,4 NHJ4-13(QCMS)
S101A-S103G-V104L-Y209E 1,3 NHJ4-6 (QCMS)
S101A-S103G-V104L-G159E 1,3 NHJ4-4 (расширение ПЦР)
S101A-S103G-V104L-S188D 1,2 NHJ4-19 (QCMS)
Таблица 4-4:
NHJ4 множественные варианты мутации, показатель эффективности (PI) относительно GG36 (определены Тестовым методом 3 - моющее средство Примера 26, 16C)
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI Название варианта (способ конструирования)
S101G-S103A-V104I-G159D 1,2 NHJ4-2 (расширение ПЦР)
T22A-S103G-G159E 1,2 NHJ4-12 (расширение ПЦР)
T22A-S 128N-E271F-Y209E 1,2 NHJ4-14(QCMS)
T22A-Y209E-E271F 1,2 NHJ4-7 (QCMS)
T22A-S101A-Y209E 1,1 NHJ4-10 (расширение ПЦР)
S101A-Y209E-E271F 1,1 NHJ4-9 (QCMS)
T22A-L111V-S128N 1,1 NHJ4-17 (QCMS)
T22A-S101A-G159E 1,1 NHJ4-24 (QCMS)
S101A-S103G-V104L 1,1 NHJ4-3 (расширение ПЦР)
T22A-S101A-S103G-V104L 1,1 NHJ4-5 (расширение ПЦР)
S101A-S103G-V104L 1,1 NHJ4-1 (расширение ПЦР)
S101G-S103A-V104I 1,1 NHJ4-20 (расширение ПЦР)
S101A-S103G-V104L-S128N 1,1 NHJ4-13 (QCMS)

Пример 34

Конструирование и чистящие характеристики NHJ3 набора GG36 вариантов

NHJ3 набор вариантов, описанных в данной заявке, основан на варианте GG36 (имеющем название GG36-9) содержащем следующие мутации: S101G, S103A, V104I, G159D, A232V, Q236H, Q245R, N248D и N252K (BRN' нумерация). Эти варианты были созданы при помощи QuikChange Lightning Multi набора сайт-направленного мутагенеза (QCLMS набор; Stratagene), с pRA68 плазмидом (См., Фигура 3) в качестве ДНК темплаты. Плазмид pRA68 был получен из pBN3 вектора (См., Babe et al., Biotech. Appl. Biochem. 27:117-124 [1998]).

ДНК последовательность GG36-9 варианта (сигнальная последовательность показана строчными буквами, полипептид показан строчными буквами, подчеркнутый текст и GG36-9 зрелая последовательность показана прописными буквами) представлена ниже:

GtgagaagcaaaaaattgtggatcgtcgcgtcgaccgcactactcatttctgttgcttttagttcatcgatcgcatcggctgctgaagaagcaaaagaaaaatatttaattggctttaatgagcaggaagctgtcagtgagtttgtagaacaagtagaggcaaatgacgaggtcgccattctctctgaggaagaggaagtcgaaattgaattgcttcatgaatttgaaacgattcctgttttatccgttgagttaagcccagaagatgtggacgcgcttgaactcgatccagcgatttcttatattgaagaggatgcagaagtaacgacaatgGCGCAATCAGTGCCATGGGGAATTAGCCGTGTGCAAGCCCCGGCTGCCCATAACCGTGGATTGACAGGTTCTGGTGTAAAAGTTGCTGTCCTCGATACAGGTATTTCCACTCATCCAGACTTAAATATTCGTGGTGGCGCTAGCTTTGTACCAGGGGAACCATCCACTCAAGATGGGAATGGGCATGGCACGCATGTGGCCGGGACGATTGCTGCTCTAAACAATTCGATTGGCGTACTTGGCGTAGCGCCGAGCGCGGAACTATACGCTGTTAAAGTATTAGGGGCGAGCGGTGGGGGCGCCATCAGCTCGATTGCCCAAGGATTGGAATGGGCAGGGAACAATGGCATGCACGTTGCTAATTTGAGTTTAGGAAGCCCTTCGCCAAGTGCCACACTTGAGCAAGCTGTTAATAGCGCGACTTCTAGGGGCGTTCTTGTTGTAGCGGCATCTGGAAATTCGGGTGCAGACTCAATCAGCTATCCGGCCCGTTATGCGAACGCAATGGCAGTCGGAGCTACTGACCAAAACAACAACCGCGCCAGCTTTTCACAGTATGGCGCAGGGCTTGACATCGTCGCACCAGGTGTAAACGTGCAGAGCACATACCCAGGTTCAACGTATGCCAGCTTAAACGGTACATCGATGGCTACTCCTCATGTTGCAGGTGCAGCAGTCCTTGTTAAACATAAGAACCCATCTTGGTCCAATGTACGAATCCGCGATCATCTAAAGAAAACGGCAACGAGCTTAGGAAGCACGAACTTGTATGGAAGCGGACTTGTCAATGCCGAAGCTGCAACTCGTTAA (SEQ ID NO:44)

Белковая последовательность GG36-9 варианта (сигнальная последовательность показана строчными буквами, полипептид показан строчными буквами, подчеркнутый текст и GG36-9 зрелая протеазная последовательность показана прописными буквами) представлена ниже:

vrskklwivastallisvafsssiasaaeeakekyligfneqeavsefveqveandevailseeeeveiellhefetipvlsvelspedvdaleldpaisvieedaevttmAOSVPWGISRVOAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGGGAISSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGADSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAVLVKHKNPSWSVRIRDHLKKTATSLGSTNLYGSGLVNAEAATR (SEQ ID NO:45)

Для создания NHJ3 вариантов при помощи QCLMS набора, мутагенные праймеры были разработаны так, как показано в Таблице 5-1 для каждого варианта. Реакция мутагенеза для каждого варианта состояла из 0,5 мкл pRA68 плазмидной ДНК (168 нг/мл), 0,5 мкл прямого «f» мутагенного праймера (25 мкМ), 0,5 мкл обратного «r» мутагенного праймера (25 мкМ), 1 мкл dNTPs (из набора QCLMS), 1,5 мкл Quik раствора (из набора QCLMS), 1 мкл ферментной смеси (из набора QCLMS) и 39,5 мкл дистиллированной деионизированной воды для получения 50 мкл реакционного объема в соответствии с инструкциями производителя. Циклическую программу составляли 1 цикл при 95°C в течение 2 минут, 18 циклов при 95°C в течение 20 секунд, 60°C в течение 10 секунд и 68°C в течение 3 минут 22 секунд, и конечный цикл при 68°C в течение 5 минут. Затем, 1 мкл DpnI рестриктазы из набора использовали для дигестии плазмидной ДНК в реакции, и затем 2 мкл реакции использовали для трансформации ТОР 10 E.coli компетентных клеток (Invitrogen). Трансформанты E.coli отбирали на планшетах LB, содержащих 50 мкг/мл (м.д.) карбенициллина после выращивания в течение всей ночи при 37°C. Плазмидную ДНК экстрагировали из 4-8 Е. coli колоний, выращенных в LA среде, содержавшей 50 мкг/мл (м.д.) карбенициллина при помощи QIAprep spin miniprep набора (Qiagen). Плазмиды секвенировали для подтверждения наличия желаемых мутаций. Вариантные плазмиды затем трансформировали в В. subtilis клетки, как описано в Примере 31. Вариантные штаммы В. subtilis выращивали так, как описано в Примере 31, для дополнительного биохимического анализа, например определения содержания белков при помощи анализа ингибирования eglin с (раздел Тестовые методы) и BMI анализа очистки микрообразцов (раздел Тестовые методы). Чистящие характеристики NHJ3 вариантов показаны в Таблицах 5-2 и 5-3.

ТАБЛИЦА 5-1:
Список мутагенных праймеров, используемых для создания NHJ3 набора вариантов (* «f» относится к прямому праймеру и «r» относится к обратному праймеру)
Вариант Введенная мутация (BPN' нумерация) Название мутагенного праймера Последовательность мутагенных праймеров 5'-3'
NHJ3-1 G101S p138_G101S f GTATTAGGGGCGAGCGGTGGCGGCGCCATCAGCT CGATTGC (SEQ ID NO:46)
p139_G101S r* GCAATCGAGCTGATGGCGCCGCCACCGCTCGCCCC TAATAC (SEQ ID NO:47)
NHJ3-2 A103S р140_А1013 f GGGGCGAGCGGTGGGGGCGGCATCAGCTCGATTG CCCAAG (SEQ ID NO:48)
р141_А1013 r CTTGGGCAATCGAGCTGATGCCGCCCCCACCGCTC GCCCC (SEQ ID NO:49)
NHJ3-3 I104V p142_I104V f GGGCGAGCGGTGGGGGCGCCGTTAGCTCGATTGC
Таблица 5-1:
Список мутагенных праймеров, используемых для создания NHJ3 набора вариантов (* «f» относится к прямому праймеру и «r» относится к обратному праймеру)
Вариант Введенная мутация (BPN' нумерация) Название мутагенного праймера Последовательность мутагенных праймеров 5'-3'
CCAAGGATTG (SEQ ID NO:50)
p143_I104V r CAATCCTTGGGCAATCGAGCTAACGGCGCCCCCACCGCTCGCCC (SEQ ID NO:51)
NHJ3-4 D159G p144_D159G f GCATCTGGAAATTCGGGTGCAGGCTCAATCAGCTATCCGGCCCGT (SEQ ID NO:52)
p145_D159G r ACGGGCCGGATAGCTGATTGAGCCTGCACCCGAATTTCCAGATGC (SEQ ID NO:53)
NHJ3-5 V232A p146_V232A f CTCATGTTGCAGGTGCAGCAGCACTTGTTAAACATAAGAACCC (SEQ ID NO:54)
p147_V232A r GGGTTCTTATGTTTAACAAGTGCTGCTGCACCTGCAACATGAG (SEQ ID NO:55)
NHJ3-6 H236Q p148_H236Q f GTGCAGCAGTCCTTGTTAAACAAAAGAACCCATCTTGGTCCAAT (SEQ ID NO:56)
p149_H236Q r ATTGGACCAAGATGGGTTCTTTTGTTTAACAAGGACTGCTGCAC (SEQ ID NO:57)
NHJ3-7 R245Q p150_R245Q f CCATCTTGGTCCAATGTACAAATCCGCGATCATCTAAAGAAAAC (SEQ ID NO:58)
p151_R245Q r GTTTTCTTTAGATGATCGCGGATTTGTACATTGGACCAAGATGG (SEQ ID NO:59)
NHJ3-8 D248N P152_D248N f GGTCCAATGTACGAATCCGCAATCATCTAAAGAAAACGGCAAC (SEQ ID NO:60)
P153_D248N r GTTGCCGTTTTCTTTAGATGATTGCGGATTCGTACA
Таблица 5-1:
Список мутагенных праймеров, используемых для создания NHJ3 набора вариантов (* «f» относится к прямому праймеру и «r» относится к обратному праймеру)
Вариант Введенная мутация (BPN' нумерация) Название мутагенного праймера Последовательность мутагенных праймеров 5'-3'
TTGGACC (SEQ ID NO:61)
NHJ3-9 K252N P154K252Nf GAATCCGCGATCATCTAAAGAATACGGCAACGAG CTTAGGAAG (SEQ ID NO:62)
P155K252Nr CTTCCTAAGCTCGTTGCCGTATTCTTTAG ATGATC GCGGATTC (SEQ ID NO:63)
Таблица 5-2:
Чистящие характеристики NHJ3 вариантов в Тестовом методе 3. Показатель эффективности (PI) относительно GG36
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI Название варианта
S103A-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K 1,8 NHJ3-1
S101G-V104I-G159D-A232V-Q236H-Q245R-N248D-N252K 1,9 NHJ3-2
S101G-S103A-G159D-A232V-Q236H-Q245R-N248D-N252K 2,0 NHJ3-3
S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K 1,5 NHJ3-4
S101G-S103A-V104L-G159D-Q236H-Q245R-N248D-N252K 1,9 NHJ3-5
S101G-S103A-V104L-G159D-A232V-Q245R-N248D-N252K 2,0 NHJ3-6
S101G-S103A-V104L-G159D-A232V-Q236H-N248D-N252K 1,6 NHJ3-7
S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K 1,8 NHJ3-8
S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N248D 1,7 NHJ3-9
Таблица 5-3:
Чистящие характеристики NHJ3 вариантов в Тестовом методе 2. Показатель эффективности (PI) относительно GG36
Вариант Вариантная последовательность относительно GG36 (BPN' нумерация) PI
NHJ3-4 S101G-S103A-V104L-A232V-Q236H-Q245R-N248D-N252K 1,1
NHJ3-8 S101G-S103A-V104L-G159D-A232V-Q236H-Q245R-N252K 1,1

Пример 35

Конструирование и чистящие характеристики NHJ5 набора GG36 вариантов

NHJ5 набор вариантов, описанный в данной заявке, основан на варианте GG36 (под названием GG36-7), содержащем следующие мутации: S101G, S103A, V104I, G159D, A232V, Q245R, N248D (BPN' нумерация). Данные варианты были созданы так, как описано в Примере 34 при помощи OuikChange® Lightning Multi набора сайт-направленного мутагена (QCLMS набор; Stratagene) с pRA96 плазмидом в качестве ДНК темплаты (Фигура 4; плазмид pRA96 был получен из pBN3 вектора, описанного в Babe et al, Biotech. Appl. Biochem. 27:117-124, 1998). Мутации, включенные в последовательности праймеров, использованных для введения мутаций в GG36-7, показаны в Таблице 6-1. Варианты генерировали при помощи способов, описанных в Примере 34. Вариантные штаммы B. subtilis были выращены так, как описано в Примере 31 для дополнительного биохимического анализа, например, определения содержания белка, с использованием анализа ингибирования eglin с (раздел Тестовые методы) и BMI анализа очистки микрообразцов (раздел Тестовые методы). Чистящие характеристики NHJ5 набора вариантов показаны в Таблицах 6-2 и 6-3.

SEQ ID NO:64 ДНК последовательность GG36-7 варианта (сигнальная последовательность показана строчными буквами, полипептид показан строчными буквами, подчеркнутый текст и GG36-7 зрелая протеазная последовательность показана прописными буквами).

GtgagaagcaaaaaattgtggatcgtcgcgtcgaccgcactactcatttctgttgcttttagttcatcgatcgcatcggctgctgaagaagcaaaagaaaaatatttaattggctttaatgagcaggaagctgtcagtgagtttgtagaacaagtagaggcaaatgacgaggtcgccattctctctgaggaagaggaagtcgaaattgaattgcttcatgaatttgaaacgattcctgttttatccgttgagttaagcccagaagatgtggacgcgcttgaactcgatccagcgatttcttatattgaagaggatgcagaagtaacgacaatgGCGCAATCAGTGCCATGGGGAATTAGCCGTGTGCAAGCCCCGGCTGCCCATAACCGTGGATTGACAGGTTCTGGTGTAAAAGTTGCTGTCCTCGATACAGGTATTTCCACTCATCCAGACTTAAATATTCGTGGTGGCGCTAGCTTTGTACCAGGGGAACCATCCACTCAAGATGGGAATGGGCATGGCACGCATGTGGCCGGGACGATTGCTGCTCTAAACAATTCGATTGGCGTACTTGGCGTAGCGCCGAGCGCGGAACTATACGCTGTTAAAGTATTAGGGGCGAGCGGTGGGGGCGCCATCAGCTCGATTGCCCAAGGATTGGAATGGGCAGGGAACAATGGCATGCACGTTGCTAATTTGAGTTTAGGAAGCCCTTCGCCAAGTGCCACACTTGAGCAAGCTGTTAATAGCGCGACTTCTAGGGGCGTTCTTGTTGTAGCGGCATCTGGAAATTCGGGTGCAGACTCAATCAGCTATCCGGCCCGTTATGCGAACGCAATGGCAGTCGGAGCTACTGACCAAAACAACAACCGCGCCAGCTTTTCACAGTATGGCGCAGGGCTTGACATCGTCGCACCAGGTGTAAACGTGCAGAGCACATACCCAGGTTCAACGTATGCCAGCTTAAACGGTACATCGATGGCTACTCCTCATGTTGCAGGTGCAGCAGTCCTTGTTAAACAAAAGAACCCATCTTGGTCCAATGTACGAATCCGCGATCATCTAAAGAATACGGCAACGAGCTTAGGAAGCACGAACTTGTATGGAAGCGGACTTGTCAATGCCGAAGCTGCAACTCGT

SEQ ID NO:65 белковая последовательность GG36-7 варианта (сигнальная последовательность показана строчными буквами, полипептид показан строчными буквами, подчеркнутый текст и GG36-7 зрелая протеазная последовательность показана прописными буквами)

vrskklwivastallisvafsssiasaaeeakekyligfneqeavsefveqveandevailseeeeveiellhefetipvlsvelspedvdaleldpaisvieedaevttmAOSVPWGISRVOAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGGGAISSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGADSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAVLVKQKNPSWSNVRIRDHLKNTATSLGSTNLYGSGLVNAEAATR

Таблица 6-1:
Список праймеров, использованных для создания NHJ5 набора вариантов
Праймер № Мутации, использующие GG36 нумерацию (BPN' нумерация показана в скобках) Праймерная последовательность
168 H243R (H249R) GTACGAATCCGCGATAGACTAAAGAATACGGCAACGAG (SEQ ID NO:66)
170 E265F (E271F) GCGGACTTGTCAATGCCTTTGCTGCAACTCGTTAAAGCTTACAT (SEQ ID NO:67)
172 D157E (D159E) GGAAATTCGGGTGCAGAATCAATCAGCTATCCGGCCCGTTA (SEQ ID NO:68)
174 A156E (A158E) CTGGAAATTCGGGTGAAGACTCAATCAGCTATCCGGCC (SEQ ID NO:69)
176 A156E-D157G (A158E-D159E) CGGCATCTGGAAATTCGGGTGAAGGCTCAATCAGCTATCCGGCCCGTTATG (SEQ ID NO:70)
178 T22A CATAACCGTGGATTGGCAGGTTCTGGTGTAAAAGTTGCTGTC (SEQ ID NO:71)
Таблица 6-1:
Список праймеров, использованных для создания NHJ5 набора вариантов
Праймер № Мутации, использующие GG36 нумерацию (BPN' нумерация показана в скобках) Праймерная последовательность
180 N60E (N62E) TCCACTCAAGATGGGGAAGGGCATGGCACGCATGTGGC (SEQ ID NO:72)
182 N232R (N238R) CTTGTTAAACAAAAGAGACCATCTTGGTCCAATGTACGAATC (SEQ ID NO:73)
186 T247R (T253R) AATGTACGAATCCGCAGACATCTAAAGAATACGGCAACGAGC (SEQ ID NO:74)
188 S24R CGATCATCTAAAGAATAGAGCAACGAGCTTAGGAAGCACGAAC (SEQ ID NO:75)
190 N74D (N76D) GTGGATTGACAGGTAGAGGTGTAAAAGTTGCTGTCCTCGATA (SEQ ID NO:76)
Таблица 6-2:
Чистящие характеристики NHJ5 вариантов с использованием Тестового метода 3. Показатель эффективности (PI) относительно GG36.
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI Название варианта
N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F 1,6 NHJ5-14
N62E-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R 1,3 NHJ5-13
T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R 1,3 NHJ5-11
S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R 1,3 NHJ5-5
S101G-S103A-V104I-G159D-A232V-Q245R-N248D-T253R 1,3 NHJ5-4
S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R 1,3 NHJ5-9
T22A-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F 1,3 NHJ5-12
S101G-S103A-V104I-G159E-A232V-Q245R-N248D-H249R 1,2 NHJ5-7
S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N238R 1,2 NHJ5-2
S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F 1,2 NHJ5-10
S101G-S103A-V104I-G159D-A232V-Q245R-N248D 1,2 GG36-7
S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F 1,2 NHJ5-1
Мутации относительно SEQ ID NO:1 (BPN' нумерация) PI Название варианта
S101G-S103A-V104I-G159D-A232V-Q245R-N248D-N76D 1,2 NHJ5-6
S101G-S103A-V104I-G159E-A232V-Q245R-N248D-E271F 1,1 NHJ5-8
Таблица 6-3:
Чистящие характеристики NHJ3 вариантов в Тестовом методе 2. Показатель эффективности (PI) относительно GG36
Вариант Вариантная последовательность относительно GG36 (BPN' нумерация) PI
NHJ5-1 S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F 1,1
NHJ5-5 S101G-S103A-V104I-G159D-A232V-Q245R-N248D-S24R 1,1
NHJ5-9 S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R 1,2
NHJ5-10 S101G-S103A-V104I-A158E-A232V-Q245R-N248D-E271F 1,1

Пример 36

Показанная ниже таблица (6-4) иллюстрирует использованные концентрации моющих средств и буферов, а Примеры 36a-36n демонстрируют использованные типы моющих средств.

Таблица 6-4:
Конечное моющее средство, жесткость воды и концентрации буферов, использованные для BMI анализов микрообразцов
Состав моющего средства Конечная концентрация моющего средства (г/л) Конечная жесткость воды* (gPg) Конечная концентрация натрий карбонатного буфера (мМ)
36a 0,75 6 2
36b 0,808 6 2
36c 0,808 6 2
36d 2,25 12 2
36e 1 3 2
36f 1,2 12 2
36g 3,96 12 2
36h 7,69 20 2
36i 5 10 2
36j 7,69 20 2
Таблица 6-4:
Конечное моющее средство, жесткость воды и концентрации буферов, использованные для BMI анализов микрообразцов
Состав моющего средства Конечная концентрация моющего средства (г/л) Конечная жесткость воды* (gPg) Конечная концентрация натрий карбонатного буфера (мМ)
36k 7,69 20 2
36l 6,15 10 2
36m 7,69 20 2
36n 6,15 20 2

Ниже представлены гранулированные составы моющих средств для стирки. Протеазу в соответствии с настоящим изобретением отдельно добавляют в данные составы.

36а 36b 36с 36d 36e
Поверхностно-активные вещества
C10 неионное вещество 0,1843
C16-17 разветвленный алкил сульфат 3,53 3,53 3,53
C12-14 алкилсульфат
Натрий линейный алкилбензолсульфонат с длиной алифатической цепи C11-C12 8,98 8,98 8,98 13,58 14,75
Натрий C14/15 спирт этокси-3-сульфат 1,28 1,28 1,28
Натрий C14/15 алкил сульфат 2,36 2,36 2,36
C14/15 спирт этоксилат со в среднем 7 молями этоксилирования
моно-C8-10 алкил моно-гидроксиэтил диметил четвертичный аммоний хлорид
Диметилгидроксилэтиллаурила ммоний хлорид 0,1803
Цеолит A 15,31 15,31 15,31 4,47
Бентонит 8,35
Силикат натрия 1,6 соотношение 0,16
Силикат натрия 2,0 соотношение 3,72 3,72 3,72 8,41
Силикат натрия 2,35 соотношение
Лимонная кислота 0,0066
Натрий триполифосфат 5,06
Карбонат натрия 26,1 26,18 26,1 15,9 29,0
Нонаноилоксибензолсульфонат 5,78 5,78 5,78 1,17 1,86
Усилитель отбеливания на основе оксазиридиния 0,037 0,037 0,037
Тетранатрий S,S,-этилендиаминдисукцинат
Диэтилентриамин пента (метиленфосфониевая кислота), гептанатриевая соль 0,62 0,62 0,62
Гидроксиэтандиметиленфосфониевая кислота
Этилендиаминтетраацетат 0,2701
MgSO4 0,056 0,056 0,056 0,47
Натрий перкарбонат 7,06 7,06 3,64
Тетраацетилэтилендиамин
Натрий перборат моногидрат 1,47
Карбоксиметилцеллюоза, (например Finnfix BDA ex CPKelco) 0,38 0,38 0,38 0,173
Сополимер натрий акриловой кислоты/малеиновой кислоты (70/30) 3,79 3,78 3,79 3,64
Полиакрилат натрия (Sokalan РА30 CL) 3,78 3,78 3,78 0,842
Терефталатный полимер
Полиэтиленгликоль/винилацет атный статистический привитой сополимер 0,89
Фотоотбеливатель-цинк фталоцианин тетрасульфонат
С.I. Флуоресцентный осветлитель 260 0,1125 0,1125 0,1125 0,043 0,15
C.I. Флуоресцентный осветлитель 351 (Tinopal® CBS) 0,0952
Гранулы подавителей пенообразования 0,015 0,015 0,015 0,031
Гидрофобно модифицированная карбоксиметилцеллюлоза (Finnifix® SH-1)
Бентонит
Различные добавки (красители, отдушки, технологические добавки, влага и сульфат натрия) Равновесие Равновесие Равновесие Равновесие Равновесие
36f 36g 36h 36i 36j
Поверхностно-активные вещества
C10 неионное вещество 0,1142 0,2894 0,1885 0,1846 0,1885
C16-17 разветвленный алкил сульфат
C12-14 алкил сульфат
Натрий линейный алкилбензолсульфонат с 12,94 15,69 9,01 8,42 9,51
длиной алифатической цепи C11-C12
Натрий C14/15 спирт этокси-3-сульфат
Натрий C14/15 алкил сульфат
C12/14 спирт этоксилат со в среднем 7 молями этоксилирования 2,9
C12/14 спирт этоксилат со в среднем 3 молями этоксилирования 2,44
C14/15 спирт этоксилат со в среднем 7 молями этоксилирования 0,97 1,17 0,97
моно-C8-10 алкил моно-гидроксиэтил диметил четвертичный аммоний хлорид 0,45
Диметилгидроксилэтиллауриламмоний хлорид 0,195 0,45
Цеолит A 2,01 0,39 1,83 2,58 0,59
Силикат натрия 1,6 соотношение 4,53 5,62 4,53
Силикат натрия 2,0 соотношение 10,1
Силикат натрия 2,35 соотношение 7,05
Лимонная кислота 1,4 1,84 1,0
Натрий триполифосфат 5,73
Карбонат натрия 12,65 15,93 21,0 27,31 20,2
Нонаноилоксибензолсульфонат 1,73
Усилитель отбеливания на основе оксазиридиния 0,0168 0,0333 0,024
Тетранатрий S,S,-этилендиаминдисукцинат
Диэтилентриамин пента (метиленфосфониевая кислота), гептанатриевая соль 0,327 0,3272
Гидроксиэтандиметиленфосфониевая кислота 0,45 0,2911 0,45
Этилендиаминтетраацетат 0,28 0,1957
MgSO4 0,54 0,79 0,6494 0,793
Натрий перкабонат 19,1 15,85 22,5
Тетраацетилэтилендиамин 4,554 3,71 5,24
Натрий перборат моногидрат 5,55
Карбоксиметилцеллюлоза, (например Finnfix BDA ex CPKelco) 0,62 0,21 0,23 1,07 0,2622
Сополимер натрий акриловой кислоты/малеиновой кислоты (70/30) 0,40 2,61 2,5 2,00 1,75
Полиакрилат натрия (Sokalan РА30 CL) 0,0055 0,011 0,008
Терефталатный полимер 0,231
Полиэтиленгликоль/винилацета тный статистический привитой сополимер 0,55 1,40 0,911 0,8924 0,911
Фотоотбеливатель-цинк фталоцианин тетрасульфонат
С.I. Флуоресцентный осветлитель 260 0,1174 0,048 0,1455 0,2252 0,1455
С.I. Флуоресцентный осветлитель 351 (Tinopal® CBS) 0,1049
Гранулы подавителей пенообразования 0,04 0,0658 0,04
Гидрофобно модифицированная Карбоксиметилцеллюлоза
(Finnifix® SH-1)
Бентонит
Различные добавки (красители, отдушки, технологические добавки, влага и сульфат натрия) Равновесие Равновесие Равновесие Равновесие Равновесие
36k 36l 36m 36n
Поверхностно-активные вещества
C10 неионное вещество 0,1979 0,1979 0,1979 0,1979
C16-17 разветвленный алкил сульфат
C12-14 алкил сульфат
Натрий линейный алкилбензолсульфонат с длиной алифатической цепи C11-C12 8,92 8,92 11,5 11,5
Натрий C14/15 спирт этокси-3-сульфат 1,62 1,62 1,125 1,125
Натрий C14/15 алкил сульфат
C14/15 спирт этоксилат со в среднем 7 молями этоксилирования 1,0 1,0 1,5 1,5
моно-C8-10 алкил моно-гидроксиэтил диметил четвертичный аммоний хлорид
Диметилгидроксилэтиллаурил аммоний хлорид
Цеолит A 1,63 1,63 2,0 2,0
Силикат натрия 1,6 соотношение 4,75 4,75 4,75 4,75
Силикат натрия 2,0 соотношение 0,06 0,06
Силикат натрия 2,35
соотношение
Лимонная кислота 1,10 1,10 1,1 1,1
Натрий триполифосфат
Карбонат натрия 23,3 23,3 23,3 23,3
Нонаноилоксибензолсульфонат
Усилитель отбеливания на основе оксазиридиния 0,021 0,021 0,015 0,015
Тетранатрий S,S,-этилендиаминдисукцинат 0,26 0,26 0,26 0,26
Диэтилентриамин пента (метиленфосфониевая кислота), гептанатриевая соль
Гидроксиэтан диметиленфосфониевая кислота
Диэтилентриамин пента (метиленфосфониевая кислота), гептанатриевая соль 0,47 0,47 0,47 0,47
Этилендиаминтетраацетат
MgSO4 0,83 0,83 0,82 0,82
Натрий перкарбонат 19,35 19,35 19,35 19,35
Тетраацетилэтилендиамин 4,51 4,51 4,51 4,51
Натрий перборат моногидрат
Карбоксиметилцеллюлоза, (например Finnfix BDA ex CPKelco) 1,01 1,01 1,01 1,01
Сополимер натрий акриловой кислоты/малеиновой кислоты (70/30) 1,84 1,84 1,84 1,84
Полиакрилат натрия (Sokalan РА30 CL) 0,007 0,007 0,005 0,005
Терефталатный полимер 0,179 0,179 0,179 0,179
Полиэтиленгликоль/винилацета тный статистический привитой сополимер 0,96 0,96 0,96 0,96
Фотоотбеливатель-цинк фталоцианин тетрасульфонат
С.I. Флуоресцентный осветлитель 260 0,153 0,153 0,171 0,171
С.I. Флуоресцентный осветлитель 351 (Tinopal® CBS)
Гранулы подавителей пенообразования 0,042 0,042 0,042 0,042
Гидрофобно модифицированная карбоксиметилцеллюлоза (Finnifix® SH-1)
Бентонит
Различные добавки (красители, отдушки, технологические добавки, влага и сульфат натрия) Равновесие Равновесие Равновесие Равновесие

Примечания к примерам 36a-n:

Ингредиенты поверхностно-активных веществ могут быть получены от BASF, Ludwigshafen, Germany (Lutensol®); Shell Chemicals, London, UK; Stepan, Northfield, Illinois, USA; Huntsman, Huntsman, Salt Lake City, Utah, USA; Clariant, Sulzbach, Germany (Praepagen®).

Цеолит может быть получен от Industrial Ceolite(UK) Ltd, Grays, Essex, UK.

Лимонная кислота и цитрат натрия могут быть получены от Jungbunzlauer, Basel, Switzerland.

Перкарбонат натрия, карбонат натрия, бикарбонат натрия и сесквикарбонат натрия могут быть получены от Solvay, Brussels, Belgium.

Акрилатные/малеатные сополимеры могут быть получены от BASF, Ludwigshafen, Germany.

Карбоксиметилцеллюлоза и гидрофобно модифицированная карбоксиметилцеллюлоза может быть получена от CPKelco, Arnhem, The Netherlands.

C.I. флуоресцентный осветлитель 260 может быть получен от 3V Sigma, Bergamo, Italy как Optiblanc®, Optiblanc® 2M/G, Optiblanc® 2MF/LT Extra или Optiblanc® Ecobright.

Тетранатрий S,S-этилендиамин дисукцинат может быть получен от Innospec, Ellesmere Port, UK.

Терефталатный сополимер может быть получен от Clariant под торговой маркой Repelotex SF 2.

1-гидроксиэтан-1,1-дифосфониевая кислота может быть получена от Thermphos, Vlissingen-Oost, The Netherlands.

Усилитель отбеливания на основе оксазиридиния имеет следующую структуру, где R1= 2-бутилоктил, и был получен в соответствии с US 2006/0089284 A1.

Ферменты Natalase®, Termamyi®, Stainzyme Plus®, Celluclean® и Mannaway®, могут быть получены от Novozymes, Bagsvaerd, Denmark.

Цинк фталоцианин тетрасульфонат может быть получен от Ciba Specialty Chemicals, Basel, Switzerland, как Tinolux® BMC.

Гранулы подавителя пенообразования могут быть получены от Dow Coming, Barry, UK.

Статистический привитой сополимер является поливинилацетатным привитым полиэтиленоксидным сополимером, имеющим полиэтиленоксидный каркас и множество поливинилацетатных боковых цепей. Молекулярная масса полиэтиленоксидного каркаса составляет приблизительно 6000 и массовое соотношение полиэтиленоксида и поливинилацетата составляет составляет приблизительно 40 к 60 и не более, чем 1 точка прививки на 50 этиленоксидных звеньев.

Пример 37

Конструирование NHJ2 комбинаторной библиотеки Данный Пример описывает конструирование GG36 комбинаторной библиотеки, включающей одну или более из следующих мутаций: A016S, T022A, S101A, S103G, V104L, L111V, S128N и L148I (BRN' нумерация). pHPLT-GG36 B. subtilis плазмид экспрессии обеспечен для DNA2.0 Inc., для генерации NHJ2 комбинаторной библиотеки. Реакция лигирования сконструированной NHJ2 библиотеки была обеспечена при помощи DNA2.0, Inc. для трансформации в B. subtilis штамм (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo). Полученные варианты, содержащие одну или несколько мутаций, описанных в данной заявке, анализировали на применения для очистки в холодной воде при помощи способов и составов моющих средств, описанных в данной заявке.

Пример 38 Конструирование дополнительных библиотек и GG36 вариантов

Дополнительные библиотеки и варианты конструировали при помощи следующего набора мутаций: A001R, A230E, E271L, G115R, G020R, H249R, K235F, K027V/F/L, L075E, L082R, N018R, N269R, N043D, N043R, N076D, R045T, S212F, S242R, S024R, S078R, S009A, T022R, V121E, V244R, V028E, V030E, V004R, W241R (BPN' нумерация). Полученные варианты, содержащие одну или несколько этих мутаций, анализировали на очистку в холодной воде в BMI анализе очистки микрообразцов (Пример 1) при помощи способов и составов моющих средств, описанных в данной заявке. Результаты представлены ниже в Таблице 8-1. В следующих Таблицах, составы моющих средств («Моющ.») соответствуют показанным в Примере 36, выше. Также, как указано, аминокислотные положения перечислены в соответствии с BPN' нумерацией.

Дополнительные наборы GG36 вариантов, показанные ниже, были сконструированы и проанализированы на очистку в холодной воде в BMI анализе очистки микрообразцов (Тестовый метод 6) при помощи способов и составов моющих средств, описанных в данной заявке. Результаты представлены ниже в Таблице 8-1. GG36 варианты, которые были проанализированы: G020R-N043R-H249R, G020R-T022R-N043R, G020R-N043R-S242R, G020R-N043R-E271L, G020R-N043R-V244R, G020R-S024R-N043R-S242R, S009A-T022R-S078R-S212F-W241R, S009A-G020R-N043R-S212F, S009A-N043R-S212F, G020R-N043R-S212F, G020R-T022R-N043R-S212F, S024R-S078R-S212F, S009A-N043R-S078R, S009A-N043R-S078R-S242R, S009A-G020R-N043R-S078R, G020R-S024R-N043R-S078R-S242R, T022R-S024R-S078R-S212F, S009A-G020R-N043R-S078R-S242R, G020R-N043R-S078R-H249R, G020R-N043R-S078R, S009A-S078R-S212F, S009A-T022R-N043R-S078R, S009A-G020R-S024R-N043R, S009A-T022R-S078R-S212F, V004R-S009A-T022R-S078R-S212F, G020R-S024R-N043R, A001R-S009A-N043R, G020R-S024R-N043R-G115R, S009A-S024R-N043R, G020R-T022R-S024R-N043R, A001R-S024R-N043R, S009A-G020R-S024R-N043R-S242R, S009A-G020R-T022R-S078R-S212F, S009A-S024R-N043R-V244R, S009A-S024R-N043R-S242R, V004R-S009A-T022R-S024R-S212F и T022R-S024R-N043R (BRN' нумерация).

Таблица 8-1:
BMI чистящие характеристики WCE4 вариантов.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 1
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36k или l, BMI анализ, 16C
V004R-S009A-G020R-S242R +++
G020R-N043R-W241R +++
G020R-S242R-N269R +++
V004R-S009A-G020R-N043R- +++
V004R-G020R-H249R- +++
N018R-S024R-V244R +++
S009A-T022R-S212F-W241R +++
G020R-N043R-N269R- +++
N018R-S024R-S242R +++
V004R-S009A-N043R-W241R- +++
G020R-N043R-V244R- +++
G020R-T022R-S242R- +++
V004R-G020R-N043R- +++
V004R-S009A-G020R-N043R-S242R- +++
G020R-N043R-S242R- +++
G020R-N043R-S242R-H249R- +++
G020R-S212F-H249R- +++
V004R-S009A-W241R- +++
A001R-S009A-N043R- +++
G020R-N043R-H249R- +++
S009A-G020R-N043R-W241R +++
G020R-T022R-N043R- +++
G020R-H249R-N269R- +++
G020R-T022R-W241R- +++
V004R-S009A-S024R-N043R-W241R- +++
S009A-N043R-S078R +++
V004R-G020R-S024R-V244R- +++
G020R-T022R-S078R-S242R- +++
G020R-S024R-S242R-H249R- +++
V004R-S009A-S078R-W241R- +++
S009A-N043R-S078R-S242R +++
Таблица 8-1:
BMI чистящие характеристики WCE4 вариантов.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или l
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36k или l, BMI анализ, 16C
V004R-G020R-S024R- +++
S009A-N043R-S212F +++
G020R-N043R-S212F- +++
S024R-S078R-S212F- +++
S009A-G020R-S024R-N043R +++
S009A-T022R-N043R-S078R +++
G020R-T022R-S212F-W241R- +++
G020R-N043R-S212F-W241R- +++
S009A-N043R-W241R +++
G020R-N043R-E271L +++
G020R-T022R-S078R-W241R- +++
G020R-S024R-N043R-S242R- +++
G020R-T022R-N043R-W241R- +++
S009A-G020R-N043R-S212F +++
V004R-S009A-G020R-S024R-S242R- +++
G020R-N043R-H249R-E271L +++
G020R-T022R-S024R-S242R- +++
S009A-T022R-S078R-S212F +++
G020R-N043R-S242R-E271L +++
S009A-T022R-S078R-S212F-W241R +++
V004R-G020R-S024R-H249R- +++
G020R-T022R-E271L +++
G020R-T022R-N043R-S212F- +++
V004R-G020R-S024R-N043R-S242R- +++
V004R-G020R-S024R-N043R- +++
V004R-S009A-T022R-S078R-S212F- +
G020R-T022R-S078R-S212F-W241R- +
G020R-T022R-N269R- +

Пример 39

Конструирование и чистящие характеристики GG36 библиотеки WCE2 WCE2 комбинаторная библиотека была получена при помощи DNA2.0, Inc., с использованием pHPLT-GG36 B. subtilis плазмида экспрессии. Реакцию лигирования сконструированной WCE2 библиотеки обеспечивали при помощи DNA2.0, Inc. для трансформации в штамм B. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo). Набор мутаций, используемых для получения библиотеки WCE2 представляет собой A230E, G020R, H249R, N018R, N043R/D, N076D, R045T, S242R и S024R (BPN' нумерация). Полученные варианты, содержащие одну или более таких мутаций анализировали на очистку в холодной воде в BMI анализе очистки микрообразцов (ТЕСТОВЫЙ МЕТОД 6) при помощи способов и составов моющих средств, описанных в данной заявке. Результаты представлены ниже в Таблице 9-1. В приведенных ниже Таблицах, составы моющих средств («Моющ.») соответствуют показанным в Примере 36, выше. Также, как показано, аминокислотные положения приведены в соответствии с BPN' нумерацией.

Таблица 9-1:
BMI чистящие характеристики вариантов GG36 библиотеки WCE2. PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство 36h или 36i, 16°C
N018R-G020R-N043D-R045T-A230E +++
N018R-N043R-R045T-S242R-H249R +++
S024R-N043D-H249R +++
N018R-G020R-R045T +++
G020R-S024R-N076D-H249R +++
S024R-N043R-A230E-S242R +++
N018R-S024R-N043D-A230E ++
G020R-N076D ++
N018R-S024R-N043D-N076D-H249R ++
S024R-N043R-N076D-H249R +++
N018R-S024R-R045T-S242R ++
Таблица 9-1:
BMI чистящие характеристики вариантов GG36 библиотеки WCE2.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство 36h или 36i, 16°C
G020R-N043D-N076D-A230E-H249R ++
G020R-N043R-R045T-S242R +++
N018R-S024R-N076D-H249R ++
N018R-G020R-S024R-N043D-R045T-L233I-S242R +++
S024R-N043R-A230E +++
N018R-G020R-N043D +++
N043R-S242R-H249R +++
G020R-N043R-R045T-A230E +++
N043R-N076D-S242R-H249R +++
G020R-S024R-R045T-A230E-S242R +++
S024R-R045T-N076D-A230E-S242R-H249R +++
S024R-R045T +++
S024R-N043R-R045T-N076D-A230E-H249R ++
N018R-S024R-N043D-R045T-H249R ++
N018R-N043R-R045T-H249R +++
S024R-N043R-S242R +++
N018R-G020R-N043R-N076D-H249R +++
G020R-S024R-N043D-H249R +++
G020R-N043R-A230E-S242R +++
G020R-N043R-S242R +++
N018R-N043R-N076D-A230E ++
G020R-S024R-N043D-S242R +++
G020R-N043R-A230E +++
N018R-G020R-N043R-N076D-S242R-H249R +++
N043D-R045T-N076D-H249R +
N018R-N043R-S242R-H249R +++
N018R-G020R-N043R-R045T-S242R +++
Таблица 9-1:
BMI чистящие характеристики вариантов GG36 библиотеки WCE2.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство 36h или 36i, 16°С
N018R-G020R-N043D-A230E-S242R +++
G020R-S024R-N043R-R045T-H249R +++
S024R-N043R-H249R +++
G020R-S024R-K027E-N043R-N076D-A230E +++
S024R-N043R-R045T-S242R +++
N018R-G020R-S024R-N043R-R045T-N076D-A230E +++
G020R-N043R-N076D-A230E-H249R +++
N018R-N043R-R045T-S242R +++
G020R-S242R-H249R +++
N018R-N043R-N076D-A230E-S242R-H249R ++
N018R-S024R-N076D ++
G020R-S024R-K27R-N043D-S242R-H249R +++
N018R-G020R-S024R-N043D-N076D-S242R ++
N018R-N043R-N076D-S242R-H249R +++
N018R-S024R-N043D-A230E-H249R +++
N018R-G020R-N043D-H249R ++
N018R-G020R-N043D-R045T-N076D-S242R +++
S024R-N043R-N076D-A230E-S242R +++
G020R-S024R-T38I-N043R-R045T-N076D-S242R-H249R +++
N018R-G020R-N043R +++
N018R-S024R-R045T-A230E-S242R ++
N018R-G020R-H249R +++
S024R-N043R-N076D +++
N018R-G020R-S024R-N043R-R045T-N076D-H249R ++
N018R-N043D-R045T-N076D-S242R-H249R +++
S024R-N043D-S242R-H249R +++
Таблица 9-1:
BMI чистящие характеристики вариантов GG36 библиотеки WCE2.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство 36h или 36i, 16°C
N018R-G020R-S024R-N043D-R045T-S242R ++
G020R-S024R-N043R-N076D ++
N018R-G020R-N043D-R045T-A230E-S242R ++
G020R-S024R-N043R-R045T-N076D-S242R-H249R ++
N018R-N043R-R045T-N076D-S242R ++
N018R-G020R-N043R-N076D-A230E-S242R ++
N018R-S024R-N043D-H249R ++
N018R-S024R-N043R-R045T-A230E-H249R ++
N018R-G020R-N043R-R045T-N076D-H249R +++
N018R-S024R-S242R ++
N018R-N043R-R045T-N076D-A230E-S242R ++
R045T-S242R-H249R +++
N018R-S024R-N043D-S242R +++
N018R-G020R-N043D-R045T-S240P ++
S024R-N043R-R045T-S242R-H249R ++
N018R-S024R-V30S-L31S-D32I-T33Q-G34V-I35F ++
N018R-G020R-N043R-N076D +++
G020R-N043D-R045T-N076D-S242R-H249R ++
N018R-S024R-N043D-A230E-S242R ++
N018R-S024R-N043D-S242R-H249R +++
S024R-N043D-R045T-S242R-H249R ++
N043R-A230E-H249R +
N043R-A230E-H249R +
G020R-S024R-N043D-N076D-H249R ++
S024R-R045T-S242R-A273V +
G020R-S024R-R045T-N076D-S242R-H249R +
N018R-S024R-N043D-N076D-S242R +
Таблица 9-1:
BMI чистящие характеристики вариантов GG36 библиотеки WCE2.
PI= Показатель эффективности относительно GG36
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство 36h или 36i, 16°С
N018R-N043R-N076D-A230E-H249R +
N018R-G020R-N043R-R045T-H249R +
N018R-N043R-R045T-A230E-S242R +
G020R-S024R-N043D-R045T-A230E-S242R +
N018R-N043D-A230E-H249R +
N018R-N043R-N076D-S242R +++
N018R-G020R-N076D +
N018R-G020R-N043D-N076D-S242R-H249R +
G020R-S024R-N043D-N076D-S242R-H249R +++
N043D-S242R-H249R +++
N018R-G020R-S024R-N043R-N076D +
N018R-G020R-N043D-R045T-N076D-H249R +
N018R-G020R-N043R-R045T-N076D-A230E-H249R +
N018R-N076D-S242R +
G020R-N043R-H249R +
N018R-N076D-S242R-H249R +
N018R-S024R-R045T-A230E-H249R +
A230E-H249R +++
N018R-R045T-H249R +
G020R-N043R-N076D +++
N043R-R045T-H249R +++
N018R-N043D-N076D-S242R-H249R +
N043R-N076D-H249R +++
G020R-S024R-N043D-R045T +++
S024R-N043D-N076D-S242R-H249R +++
N043R-N076D-A230E-H249R +++

Пример 40

Конструирование и чистящие характеристики WCE3 набора GG36 вариантов Данный пример описывает WCE3 набор мутантов, основанных на GG36 вариантах, GG36-7 (Пример 5) и GG36-9 (Пример 4). Этими вариантами являются: S101G-S103A-V104I-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R, S101G-S103A-V104I-G159R-A232V-Q245R-N248D, S101G-S103A-V104I-G159D-A232V-Q245R-N248R, S101G-S103A-V104I-A232V-Q245R, S101G-S103A-V104I-A232V-Q245R-N248R, S101G-S103A-V104I-G159R-A232V-Q245R-N248R и S101G, S103A, V104I, A232V, Q236H, Q245R и N252K. Эти варианты были созданы при помощи набора QuikChange® Lightning Multi сайт-направленного мутагенеза (QCLMS набор; Stratagene) с pRA96 плазмидом в качестве ДНК темплаты, описанном в Примере 34. Полученные варианты были проанализированы на очистку в холодной воде в BMI анализе микрообразцов (Тестовый метод 6) с использованием способов и составов моющих средств, описанных в данной заявке.

Таблица 10-1.
BMI чистящие характеристики WCE3 вариантов.
PI= Показатель эффективности относительно GG36
PI> или=1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве 36h или 36i
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36h или 36i, 16C
S101G-S103A-V104I-A232V-Q236H-0245R-N252K ++
S101G-S103A-V104I-A232V-Q245R-N248R ++
S101G-S103A-V104I-G159R-A232V-Q245R-N248D ++
S101G-S103A-V104I-G159D-A232V-Q245R-N248R +
S101G-S103A-V104I-A232V-Q245R +
S101G-S103A-V104I-G159D-A232V-Q245R +
S101G-S103A-V104I-A232V-Q245R-N248D +

Пример 41

Конструирование дополнительных библиотек и вариантов GG36 Данный пример описывает очистку в холодной воде GG36 комбинаторных вариантов, содержащих одну или более из следующих мутаций: A016S, T022A, S024R, N062E, N076D, E089P, S101A/G. S103G/A, V104L/I, L111V, S128N, P129E, A232V, L148I, A158E, G159D/E, S166D, R186H, S188D, Y209E, Q236H, N238R, Q245R, N248D/R, H249R, N252K/R, T253R, E271F (BPN' нумерация). Комбинаторные варианты были сконструированы при помощи DNA2.0, Inc., с использованием плазмида экспрессии В. subtilis (например, pHPLT-GG36; ФИГ.2) и штамма B. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo). В случае ДНК библиотек, реакция лигирования каждой сконструированной библиотеки с использованием плазмида экспрессии B. subtilis (например, pHPLT-GG36; ФИГ.2) была обеспечена при помощи DNA 2.0, Inc. для трансформации в штамм B. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo). Полученные варианты, содержащие одну или более мутаций, указанных выше, анализировали на очистку в холодной воде в BMI анализе микрообразцов (ТЕСТОВЫЙ МЕТОД 6) с использованием способов и составов моющих средств, описанных в данной заявке.

Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R +++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
S024R-S101G-S103A-V104I-S128N-P129E-A158E-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-L148I-A158E-S188D-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-S128N-P129E-A232V-Q245R-N248D +++
S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-L148I-A158E-A232V-Q245R-N248D +++
A016S-S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D-H249R +++
T022A-S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R +++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
T022A-S024R-S101G-S103A-V104I-S128N-A158E-S188D-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-A158E-S188D-A232V-N238R-Q245R-N248D +++
T022A-S101G-S103A-V104I-S128N-P129E-S188D-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-S128N-S188D-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-S128N-P129E-A158E-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D +++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
T022A-S101G-S103A-V104I-S128N-P129E-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-S188D-A232V-N238R-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S101G-S103A-V104I-P129E-A158E-A232V-N238R-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D +++
T022A-S101G-S103A-V104I-A158E-G159E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D +++
T022A-S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-N238R-Q245R-N248D +++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
S101G-S103A-V104I-P129E-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-S128N-A158E-A232V-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D +++
T022A-S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D +++
S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D-H249R +++
T022A-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-P129E-L148I-A158E-S188D-A232V-Q245R-N248D ++
T022A-S101G-S103A-V104I-P129E-G159E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-G159E-S188D-A232V-N238R-Q245R-N248D ++
S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D ++
S024R-S101G-S103A-V104I-S128N-G159E-S188D-A232V-Q245R-N248D ++
T022A-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D-H249R ++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16С
S024R-S101G-S103A-V104I-P129E-G159E-S188D-A232V-N238R-Q245R-N248D ++
S101G-S103A-V104I-A158E-A232V-N238R-Q245R-N248D ++
T022A-S101G-S103A-V104I-P129E-G159E-S188D-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-P129E-L148I-S188D-A232V-Q245R-N248D ++
S024R-S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R ++
T022A-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D ++
S024R-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D ++
T022A-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129E-A158E-S188D-A232V-N238R-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D ++
S101G-S103A-V104I-S188D-A232V-N238R-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R ++
T022A-S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D ++
S101G-S103A-V104I-P129E-A158E-G159E-A232V-N238R-Q245R-N248D ++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
T022A-S101G-S103A-V104I-G159E-S188D-A232V-N238R-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-G159E-S188D-A232V-Q245R-N248D-H249R ++
T022A-S101G-S103A-V104I-P129E-A232V-N238R-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129E-A158E-G159E-A232V-Q245R-N248D-H249R ++
T022A-S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D ++
S024R-S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D ++
S101G-S103A-V104I-S128N-P129E-A232V-Q245R-N248D ++
S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D ++
S101G-S103A-V104I-A158E-G159E-S188D-A232V-N238R-Q245R-N248D ++
S024R-S101G-S103A-V104I-A232V-Q245R-N248D-H249R ++
T022A-S024R-S101G-S103A-V104I-P129E-L148I-A232V-Q245R-N248D ++
Таблица 11-1.
BMI чистящие характеристики вариантов библиотеки NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве b, d или е
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36b, 36d или 36e, 16C
T022A-S024R-S101G-S103A-V104I-A158E-A232V-N238R-Q245R-N248D ++
S101G-S103A-V104I-S128N-P129E-A232V-N238R-Q245R-N248D ++
T022A-S101G-S103A-V104I-S128N-G159E-A232V-Q245R-N248D +
T022A-S101G-S103A-V104I-S128N-P129E-A158E-A232V-N238R-Q245R-N248D +
S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D-H249R +
T022A-S024R-S101G-S103A-V104I-S128N-P129E-A158E-S188D-A232V-Q245R-N248D-H249R +
S024R-S101G-S103A-V104I-S128N-A158E-G159E-S188D-A232V-Q245R-N248D +
T022A-S024K-S101G-S103A-V104I-S128N-A158E-G159E-A232V-Q245R-N248D +
S101G-S103A-V104I-P129E-L148I-S188D-A232V-Q245R-N248D +
S024R-S101G-S103A-V104I-L148I-A232V-Q245R-N248D +
T022A-S101G-S103A-V104I-L148I-S188D-A232V-Q245R-N248D +
S024R-S101G-S103A-V104I-S128N-P129E-S188D-A232V-Q245R-N248D +
S101G-S103A-V104I-S128N-P129E-A158E-A232V-N238R-Q245R-N248D +
Таблица 11-2.
BMI чистящие характеристики вариантов библиотек NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36g, 16С
T022A-S024R-S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-A158E-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-G159E-S188D-A232V-Q245R-N248D-H249R +++
T022A-S024R-S101G-S103A-V104I-A158E-A232V-N238R-Q245R-N248D +++
S024R-S101G-S103A-V104I-G159E-S188D-A232V-N238R-Q245R-N248D +++
T022A-S024R-S101G-S103A-V104I-P129E-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-L148I-A232V-Q245R-N248D +++
S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D-H249R ++
A016S-S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-P129E-G159E-A232V-N238R-Q245R-N248D ++
S024R-S101G-S103A-V104I-P129E-S188D-A232V-Q245R-N248D- ++
Таблица 11-2.
BMI чистящие характеристики вариантов библиотек NHJ6.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36g, 16C
H249R
T022A-S101G-S103A-V104I-P129E-A232V-N238R-Q245R-N248D ++
T022A-S024R-S101G-S103A-V104I-L148I-A158E-A232V-Q245R-N248D +
S024R-S101G-S103A-V104I-P129E-S188D-A232V-N238R-Q245R-N248D +
T022A-S024R-S101G-S103A-V104I-A158E-G159E-S188D-A232V-N238R-Q245R-N248D +
T022A-S101G-S103A-V104I-A158E-G159E-A232V-N238R-Q245R-N248D +
T022A-S024R-S101G-S103A-V104I-P129E-A158E-A232V-Q245R-N248D +
S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R+ +
T022A-S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D-H249R +
S024R-S101G-S103A-V104I-A158E-G159E-A232V-Q245R-N248D +
Таблица 11-3.
BMI чистящие характеристики NHJ7 комбинаторных вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36b, 36d или 36e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36b, 36d или 36e, 16C
V104L-S128N-A158E-R186H-H249R +++
S128N-A158E-S188D-H249R +++
N062E-S128N-A158E-G159E-E271F +++
N062E-A158E-S188D-H249R-E271F +++
Таблица 11-3.
BMI чистящие характеристики NHJ7 комбинаторных вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36b, 36d или 36e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36b, 36d или 36e, 16C
N062E-A158E-R186H-H249R-E271F +++
S128N-A158E-S188D-Y209E-E271F +++
N062E-G159E-S188D-H249R +++
A016S-N062E-A158E-R186H-H249R +++
N062E-A158E-G159E-H249R +++
S101A-S128N-A158E-Y209E-H249R +++
S128N-A158E-R186H-E27IF +++
N062E-A158E-S188D-H249R +++
N062E-A158E-R186H-E271F +++
N062E-A158E-R186H-H249R +++
N062E-S101A-R186H-H249R +++
N062E-S101A-A158E-R186H-E271F +++
N062E-V104L-A158E-S188D-H249R-E271F +++
N062E-G159E-R186H-H249R +++
N062E-G159E-H249R +++
S128N-A158E-R186H-H249R +++
S128N-A158E-S188D-E271F +++
N062E-A158E-H249R +++
N062E-R186H-S188D-H249R-E271F +++
S128N-A158E-Y209E- +++
N062E-S101A-A158E-H249R +++
V104L-S128N-A158E-R186H-E271F +++
N062E-S101A-A158E-R186H-H249R-E271F +++
A016S-N062E-A158E-H249R +++
N062E-S101A-G159E-H249R +++
S128N-A158E-R186H-S188D-E27IF +++
S101A-S128N-A158E-R186H-E271F +++
Таблица 11-3.
BMI чистящие характеристики NHJ7 комбинаторных вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36b, 36d или 36e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36b, 36d или 36e, 16C
N062E-S101A-S188D-H249R +++
S101A-V104L-A158E-R186H-S188D-H249R +++
N062E-G159E-H249R-E271F +++
S128N-A158E-G159E-E271F +++
A016S-N062E-V104L-A158E-R186H-E271F +++
T022A-S128N-A158E-H249R +++
S128N-A158E-H249R +++
N062E-S101A-V104L-A158E-R186H-E271F +++
A016S-N062E-A158E-R186H-E271F +++
V104L-S128N-A158E-H249R +++
V104L-S128N-A158E-S188D-H249R +++
T022A-N062E-A158E +++
N062E-S101A-S188D-H249R-E271F +++
N062E-A158E-H249R-E271F ++
V104L-S128N-A158E-R186H-S188D-E271F ++
N062E-S101A-R186H-E271F ++
N062E-V104L-G159E-H249R ++
N062E-R186H-H249R ++
N062E-S101A-R186H-H249R-E271F ++
S101A-A158E-R186H-S188D-H249R ++
N062E-S101A-R186H ++
S101A-S128N-P129E-R186H-H249R ++
S101A-S103G-A158E-R186H-H249R ++
A016S-N062E-V104L-R186H-S188D-E271F ++
V104L-A158E-R186H-H249R ++
S101A-S128N-A158E-S188D-Y209E-E27IF ++
N062E-S101A-R186H-S188D-E271F ++
Таблица 11-3.
BMI чистящие характеристики NHJ7 комбинаторных вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36b, 36d или 36e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36b, 36d или 36e, 16C
A016S-N062E-A158E-H249R-E271F ++
N062E-S128N-A158E ++
N062E-S128N-G159E-H249R ++
N062E-S101A-A158E-S188D-H249R ++
S101A-S128N-A158E-H249R ++
N062E-A158E-R186H-S188D-H249R ++
A016S-V104L-A158E-R186H-E271F ++
N062E-L148I-G159E ++
N062E-S101A-A158E-R186H-H249R ++
N062E-S101A-R186H-S188D-H249R ++
VI04L-A158E-R186H-S188D-H249R ++
N062E-S101A-V104L-R186H-S188D-E271F ++
T022A-S101A-A158E-R186H-H249R ++
S101A-S128N-A158E-Y209E ++
A158E-R186H-S188D-H249R-E271F ++
V104L-A158E-R186H-S188D-H249R-E271F ++
S101A-V104L-A158E-R186H-H249R ++
V104L-A158E-H249R ++
S101A-V104L-S128N-A158E-R186H-E271F ++
A016S-V104L-S188D-H249R ++
S101A-V104L-A158E-R186H-S188D-E271F ++
V104L-S128N-G159E-E271F ++
V104L-A158E-R186H-H249R-E271F ++
A158E-R186H-H249R ++
S101A-A158E-R186H-H249R ++
V104L-A158E-S188D-H249R-E271F ++
A016S-S128N-A158E-R186H ++
Таблица 11-3.
BMI чистящие характеристики NHJ7 комбинаторных вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36b, 36d или 36e
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36b, 36d или 36e, 16С
V104L-S128N-R186H-S188D-H249R ++
A016S-S101A-S128N-R186H ++
A016S-N062E-S128N-R186H-E271F ++
A016S-S128N-R186H-E271F +
S128N-P129E-R186H +
A158E-R186H-H249R-E271F +
A016S-A158E-H249R +
A016S-A158E-R186H-H249R +
A016S-T022A-A158E-R186H-E271F +
E089P-S101A-P129E-R186H +
T022A-S128N-A158E-R186H +
S101A-V104L-S128N-A158E-R186H +
T022A-S128N-R186H-S188D- +
N062E-V104L-A158E-R186H-S188D-H249R +
Т022А-A158E-R186H-H249R-E271F +
T022A-V104L-A158E-H249R +
S101A-L111V-P129E +
A016S-A158E-H249R-E271F +
A016S-L111V-S188D- +
T022A-V104L-R186H-S188D-H249R +

Пример 42

Конструирование дополнительных библиотек и вариантов GG36 Данный Пример описывает конструирование GG36 вариантов и библиотек в B. subtilis при помощи одной или более из следующих мутаций (BPN' нумерация): A001R, Q002S, Q002M, Q002A, Q002R, Q002W, S003R, V004R, V004S, V004C, I008A, S009A, S009F, S009W, R010S, R010A, R010H, R010M, Q012F, Q012R, P014K, P014F, P014Q, A015R, A015F, A016S, H017R, H017M, H017F, N018R, N018K, G020F, G020K, G020R, T022A, T022R, T022Y, T022V, T022Q, T022L, T022W, G023A, G023S, G023F, S024R, S024F, S024W, S024Q, S024H, S024L, G025V, G025F, G025R, V026F, K027L, K027F, K027R, K027V, V028A, V028N, V028E, A029T, V030E, L031F, T033S, T033G, T033D, G034P, I035M, S036T, S036F, S036R, T038L, T038F, T038R, P040N, P040L, P040T, P040W, P040H, P040R, L042I, N043A, N043F, N0431, N043S, N043R, N043M, N043W, N043D, R045T, G046R, A048R, F050C, V051W, V051F, V051H, P052F, P052E, P052N, P055Y, T057R, Q059A, Q059F, Q059R, D060P, D060Q, D060A, N062E, N062Q, G063V, G063M, G063T, G063I, G063A, G063S, G063H, G063Q, G063D, G063E, G063P, H064F, H064T, V068A, V068C, A069N, A069T, A069P, A069W, T071G, I072C, A074C, L075A, L075F, L075E, L075R, N076D, S078R, S078N, S078I, I079W, I079Q, V081R, L082F, L082T, L082V, L082R, L082M, A085M, P086W, P086L, P086I, E089P, E089T, E089G, E089H, E089L, E089V, E089W, E089F, E089I, Y091N, Y091F, A092F, K094N, S099F, S099T, S099P, S099G, S099M, G100S, G100N, G100Q, G100I, S101A, S101N, S101G, S101T, S101D, S101E, S101P, S101F, G102A, G102T, G102N, G102H, G102E, S103G, S103N, S103D, S103A, V104L, V104I, V104E, V104D, S105T, S105E, S105Q, S106G, S106T, S106E, S106D, S106A, S106V, S106F, I107M, I107F, A108I, A108G, Q109M, L111V, L111I, E112V, E112L, E112Q, A114G, G115K, G115R, N116K, N116A, N116L, N117F, G118R, G118I, M119C, H120A, H120F, H120R, V121F, V121E, N123G, N123E, L124S, S128D, S128F, S128L, S128N, S128H, S128M, S128I, S128Q, P129E, S132A, S132E, A138G, S144R, V147L, L148I, A158E, G159D, G159E, G159C, S160D, S166D, S166E, Y167W, M175V, V177C, D181A, Q182R, N1831, N183D, N183M, N183F, N183R, N185E, N185V, N1851, R186H, R186K, S188E, S188D, S188R, Y192H, Y192W, A194E, A194V, A194F, D197F, I198L, I198F, V203E, V203C, T208S, Y209S, Y209N, Y209F, Y209T, Y209E, Y209H, Y209G, Y209L, P210R, P210V, P210L, G211Q, G211R, S212I, S212M, S212F, T213A, Y214F, A215N, A215D, A215E, A215H, A215F, S216F, S216A, L217E, L217N, L217D, N218D, N218P, N218E, T224A, T224G, V227I, A230E, A231I, A231C, A232V, L233C, V234F, K235F, Q236F, Q236N, Q236H, N238R, N238K, N238L, P239K, P239G, P239R, P239H, P239T, P239N, P239S, P239F, S240R, W241R, S242L, S242R, N243F, N243R, V244R, Q245R, I246S, N248D, N248V, N2481, N248R, H249R, H249T, L250I, K251R, K251S, N2521, N252F, N252R, N252K, N252H, T253I, T253R, T253F, A254C, S256N, G258R, T260V, T260I, L262D, L262H, Y263F, S265F, L267V, L267N, L267M, N269I, N269R, A270C, E271I, E271V, E271H, E271M, E271L, E271P, E271A, E271F, E271T, A272F, A272F, A272R, A273F, A273I и T274G. Варианты и библиотеки были сконструированы при помощи DNA2.0, Inc., как описано в Примере 41. Полученные варианты содержали одну или более из этих мутаций и были протестированы на очистку в холодной воде в BMI анализе микрообразцов с использованием способов и составов моющих средств, описанных в данной заявке в тестовом методе 6.

Таблица 12-1:
BMI чистящие характеристики WCE6 и WCE8 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
A001R-S101G-S103A-V104I-A232V-Q245R +++
V004R-S101G-S103A-V104I-A232V-Q245R +++
N043R-S101G-S103A-V104I-A232V-Q245R-E271L +++
S078R-S101G-S103A-V104I-A232V-Q245R +++
V004R-N043R-S101G-S103A-V104I-A232V-Q245R +++
N018R-N043R-S101G-S103A-V104I-A232V-Q245R +++
G020R-S101G-S103A-V104I-A232V-Q245R +++
S101G-S103A-V104I-A232V-Q245R-E271L +++
G020R-N043R-S101G-S103A-V104I-A232V-Q245R +++
S024R-N043R-S101G-S103A-V104I-A232V-Q245R +++
G020R-G025R-N116A-Y167W +++
N018R-S101G-S103A-V104I-A232V-Q245R +++
T022R-S101G-S103A-V104I-A232V-Q245R +++
S078R-S103N-S106G-Y167W-Q236N +++
N018R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043R-S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-S101A-H120F-A194F-H249R +++
G020R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
S101G-S103A-V104I-S212F-A232V-Q245R +++
G020R-S144R-N185I-L233C-Q236N +++
G023A-S078R-S216F-Q236N-H249R +++
S101G-S103A-V104I-A232V-Q245R-N269R +++
S101G-S103A-V104I-G115R-A232V-Q245R +++
P052N-S078R-S103N-L148I-T213A +++
Таблица 12-1:
BMI чистящие характеристики WCE6 и WCE8 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
N018R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R +++
S024R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R +++
S024R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
G025R-E089I-N116A-P239S-A270C +++
S024R-S101G-S103A-V104I-A232V-Q245R +++
L148I-T213A-N252R +++
S024R-G025R-N183D-Y192W-P239S +++
G046R-A194F-S212M +++
V104L-L217E-T224A-H249R-N252R +++
G023A-Y091F-V121F-Y192W-Q236N +++
S101G-S103A-V104I-A232V-V244R-Q245R +++
S099F-S144R-Y167W-N252R +++
S101G-S103A-V104I-A232V-Q245R-H249R +++
N043R-S101G-S103A-V104I-A232V-Q245R +++
T022W-S078R-Y167W-S212M-A270C +++
V121F-N252R-A270C +++
G020R-S103N-S216F-Q236N-N252R +++
N043R-S101G-S103A-V104I-A232V-Q245R-H249R +++
G023A-P052N-Y192W-1198L-N252R +++
G025R-G046R-V121F +++
S024R-S078R-V104L-N116A-N183D +++
G046R-Q059A-S103N-G211Q-S212M +++
G020R-P052N-N062Q-Y091F-Y192W +++
G023A-P052N-S144R-Y192W-S216F +++
S101G-S103A-V104I-A232V-S242R-Q245R +++
P052N-S103N-N116A-L148I-Y192W +++
Таблица 12-1:
BMI чистящие характеристики WCE6 и WCE8 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
E089I-N116A-N117F-T224A-H249R +++
S144R-G211Q-N238L-P239S-H249R +++
N043A-N062Q-A194F-G211Q +++
G020R-S024R-P052N-Q059A-S216F +++
S024R-Y167W-T224A-H249R +++
T057R-Y167W-H249R +++
G025R-S103N-R186K-A194F-T224A +++
S105T-S128N-S144R-L1481-S212M +++
G020R-Q059A-S144R-Y192W-T224A +++
S024R-N043A-N117F-A194F-G211Q +++
N117F-A194F-T213A-A270C +++
S078R-Y091F-V121F-L233C-N252R +++
T057R-S099F-S105T-I198L-T213A +++
G023A-Y091F-S101A-1198L-N252R +++
N062Q-S103N-V121F-S144R-H249R +++
N043R-S101G-S103A-V104I-A232V-S242R-Q245R +++
G023A-S024R-N117F-S212M-S216F +++
V104L-T213A-S216F +++
A194F-G211Q-Q236N +++
N062Q-S103N-N117F-A194F +++
S024R-N062Q-V104L-S106G-H249R +++
T057R-E089I-I198L +++
G046R-Q059A-S106G-L217E-H249R +++
N117F-T213A-A215F +++
S101A-H120F-Y192W-A215F-T224A +++
N043A-T057R-N117F-S144R-N183D +++
Таблица 12-1:
BMI чистящие характеристики WCE6 и WCE8 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G046R-N183D-N238L +++
G025R-N043A-E089I-N117F +++
S078R-V104L-T213A-A215F-T224A +++
Y091F-S099F-S101A-S105T-Y167W +++
S106G-N117F-N238L +++
G046R-E089I-Y091F-S101A-N116A +++
G020R-N062Q-E089I-R186K-S212M +++
T057R-S099F-V121F-N1851-Y192W +++
G046R-E089I-Y192W-L233C-A270C +++
E089I-N117F-N185I-A215F-L233C ++
P052N-V104L-N183D-S216F-H249R ++
S078R-S099F-N116A-R186K-T224A ++
G025R-S105T-S128N-S144R-A270C ++
S105T-G211Q-S216F ++
S024R-G046R-Y091F-V121F ++
S106G-N185I-S216F-Q236N ++
N062Q-S101A-Q236N-N252R-A270C ++
G025R-N043A-Y091F-1198L-A270C ++
G020R-G023A-V104L-Y192W-L233C ++
S024R-N043A-S105T-S106G-1198L ++
G020R-E089I-L217E ++
S024R-Y091F-1198L-A215F-P239S ++
G046R-E089I-S099F-R186K-S212M ++
V104L-H120F-R186K-S216F-N252R ++
T022W-A194F-T213A-L233C-N238L +
S099F-S105T-S106G-A194F-S212M +
Таблица 12-1:
BMI чистящие характеристики WCE6 и WCE8 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
E089I-S105T-N116A-A215F-S216F +
G025R-N116A-H120F-T224A-A270C +
N043A-Q059A-S101A-S216F-T224A +
T057R-N183D-Q236N +
G025R-N062Q-S128N-S144R-N185I +
S103N-H120F-Y167W-I198L-L233C +
T022W-E089I-S216F +
S024R-S106G-N116A-S212M-Т224А +
G020R-P052N-S101A-1198L-L233C +
E089I-Y091F-N185I-G211Q-A270C +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-T022W-S078R-S101A-S103A-V104I-N116S-T213A-A215F-A232V-Q245R +++
N018R-S078R-S101G-S103A-V104I-A232V-Q245R +++
S024R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R +++
G020R-T022W-S078R-S101G-S103A-V104I-N116A-A232V-Q245R +++
G020R-T22W-S101G-S103A-V104I-A232V-Q245R +++
N018R-N043R-S101G-S103A-V104I-A232V-Q245R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-T022W-S024R-N076D-S101A-N116A-A232V-Q245R +++
N018R-V104I-A232V-H249R +++
N018R-S024R-N076D-S101A-N116A-G211Q-H249R +++
N018R-N043D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +++
N018R-N043R-S101G-S103A-V104I-A232V-Q245R-N269R +++
N018R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
N018R-S103A-A232V-H249R +++
N018R-S101G-V104I-A232V-Q245R +++
G020R-S024R-S101G-S103A-V104I-L217E-A232V-Q245R-H249R +++
N018R-T22K-N043D-S101G-S103A-V104I-A232V-Q245R +++
N043R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R +++
G020R-T22W-S101G-S103A-V104I-G211Q-A232V-Q245R +++
S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-A232V +++
N018R-S024R-N076D-N116A-A215F-H249R +++
N018R-N043R-R045T-S101G-S103A-V104I-A232V-Q245R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
S024R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R +++
G020R-T022W-S101G-S103A-V104I-A232V-Q245R +++
G020R-T022W-S101G-S103A-V104I-G211Q-A232V-Q245R +++
G020R-T022W-S078R-S101G-S103A-V104I-N116A-T213A-A215F-A232V-Q245R +++
N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
N018R-S024R-N076D-S101A-N116A-T213A-H249R +++
N018R-S024R-N076D-N116A-G211Q-H249R +++
N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-S101G-Q245R +++
G020R-T22W-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R +++
G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
G020R-S078R-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R +++
R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N018R-S101G-S103A-H249R +++
N018R-T22W-S024R-N076D-S101A-N116A-A232V-Q245R +++
N018R-S101G-V104I-A232V-H249R +++
G020R-T22W-S101A-S103A-V104I-A215F-A232V-Q245R +++
N018R-S024R-N076D-G211Q-T213A-H249R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-T022W-S024R-N076D-S101A-1198L-H249R +++
S024R-S101G-S103A-V104I-A232V-Q245R +++
G020R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R
G020R-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043D-S078R-S101G-S103A-V104I-A232V-Q245R +++
G020R-S101G-V104I-T213A-A215F-A232V-Q245R +++
G020R-S101G-S103A-V104I-N116A-A215F-A232V-Q245R +++
S024R-S103A-V104I-H249R +++
N018R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-S101G-V104I-Q245R +++
G020R-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R +++
S024R-S103A-V104I-A232V-H249R +++
N018R-S024R-N076D-N116A-G211Q-A215F-H249R +++
N018R-Q245R +++
S024R-S103A-Q245R +++
S024R-S103A-V104I-Q245R +++
G020R-S078R-S101G-A232V-Q245R +++
N018R-S024R-N076D-V104I-H249R +++
N018R-S024R-V104I-H249R +++
S024R-S101G-S103A-V104I-A232V-Q245R +++
N018R-S024R-N076D-G211Q-A215F-H249R +++
RO19H-G020R-T022W-S078R-S101G-S103A-V104I-G211Q-A232V-Q245R +++
N018R-S024R-N076D-S101A-1198L-G211Q-T213A-H249R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-S024R-N043D-S101G-S103A-V104I-A232V-Q245R +++
G020R-T22W-S103A-V104I-A232V-Q245R +++
N018R-S103A-V104I-H249R +++
N018R-T022W-S024R-N076D-S101A-1198L-A215F-H249R +++
N018R-S024R-S101G-V104I-A232V +++
S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-G020R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R +++
N018R-T22W-S024R-N076D-N116A-T213A-H249R +++
N018R-S024R-S101G-V1041 +++
G020R-S101A-S103A-V104I-A215F-A232V-Q245R +++
N018R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-S101G-S103A-Q245R +++
N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
G020R-T022W-S101A-S103A-V104I-G211Q-A215F-A232V-Q245R +++
G020R-T22W-S078R-S101G-S103A-V104I-N116A-T213A-A215F-A232V-Q245R +++
G020R-S078R-S101G-S103A-V104I-A215F-A232V-Q245R +++
G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R +++
N076D-S101G-S103A-V104I-A232V-Q245R +++
N076D-S101G-S103A-V104I-A232V-Q245R-N269R +++
G020R-T22W-S101A-S103A-V104I-A232V-Q245R +++
G020R-S101G-S103A-A232V-Q245R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R +++
N018R-G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-S101G-V104I-H249R +++
G020R-T22W-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R +++
G020R-T022W-S101G-S103A-V104I-I198L-G211Q-T213A-A232V-Q245R +++
G020R-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +++
S024R-N076D-V104I-A232V-Q245R +++
N018R-G020R-N076D-S101G-S103A-V104I-A232V-Q245R +++
N018R-S024R-N076D-S101G-V104I-A232V-H249R +++
N018R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R +++
A001T-N018R-S024R-N076D-N116A-T213A-H249R +++
N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
G020R-S078R-S101G-S103A-V104I-N116A-A232V-Q245R +++
N043R-N076D-S101G-S103A-V104I-A232V-Q245R +++
N018R-R045T-S101G-S103A-V104I-A232V-Q245R +++
N018R-N076D-S101G-V104I-A232V-Q245R +++
G020R-S078R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R +++
N018R-S024R-N076D-S101A-G211Q-T213A-A215F-H249R +++
R045T-S078R-S101G-S103A-V104I-A232V-Q245R +++
N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +++
G020R-T022W-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +++
G020R-S101G-I198L-A215F-A232V-Q245R +++
N018R-S024R-N076D-T213A-A215F-H249R +++
G020R-S078R-S101G-S103A-V104I-N116A-G211Q-A232V-Q245R +++
G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R +++
G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +++
S024R-A232V-Q245R +++
N018R-S024R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N018R-S024R-N076D-S101A-A215F-H249R +++
N018R-T022W-S024R-N076D-N116A-T213A-H249R +++
S101G-S103A-V104I-A232V-Q245R+
N018R-S024R-N076D-G211Q-T213A-A215F-H249R +++
N018R-S024R-N076D-N116A-T213A-A215F-H249R +++
N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +++
G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R +++
N018R-S024R-N076D-S101A-I198L-G211Q-A215V-H249R +++
N018R-T022W-S024R-N076D-N116A-G211Q-H249R +++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-S103A-V104I-A232V-Q245R ++
G020R-T22W-S101A-S103A-V104I-G211Q-A215F-A232V-Q245R ++
S024R-N076D-S101G-S103A-V104I-A232V-Q245R ++
G020R-S101G-S103A-V104I-N116A-A232V-Q245R ++
N018R-T22W-S024R-N076D-I198L-A215F-H249R ++
G020R-T022W-S103A-V104I-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R ++
G020R-T022W-S101G-S103A-V104I-G211Q-T213A-A215F-A232V-Q245R ++
N018R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R ++
N018R-T022W-S024R-N076D-S101A-I198L-T213A-A215F-H249R ++
N018R-T22W-S024R-N076D-S101A-A215F-H249R ++
G020R-R045T-S101G-S103A-V104I-A232V-Q245R ++
G020R-S078R-S101G-S103A-V104I-T180A-A232V-Q245R ++
G020R-T022W-S078R-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R ++
N018R-S101G-S103A-V104I ++
G020R-T22W-S101A-S103A-V104I-N116A-G211Q-T213A-A215F-A232V-Q245R ++
N018R-S024R-N076D-S103A-A232V-Q245R ++
G020R-S078R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R ++
N018R-S024R-N076D-G211Q-H249R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
G020R-S101A-S103A-V104I-T213A-A215F-A232V-Q245R ++
N018R-G020R-N043D-S101G-S103A-V104I-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-G211Q-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-N116A-G211Q-A215F-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-N116A-G211Q-A232V-Q245R ++
N018R-S024R-N076D-A232V-H249R ++
N018R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-N076D-Q245R ++
S024R-V104I-Q245R ++
S101G-A232V ++
G020R-T22W-S101A-S103A-V104I-N116A-G211Q-A215F-A232V-Q245R ++
N018R-G020R-T022W-S024R-N076D-N116A-N183D-I198L-T213A-H249R ++
G020R-T022W-S078R-S101A-S103A-V104I-A232V-Q245R ++
G020R-T022W-S078R-S101A-S103A-V104I-I198L-A232V-Q245R ++
S024R-Q245R-H249R ++
G020R-S101G-S103A-V104I-N116A-G211Q-A232V-Q245R ++
N018R-T22W-S024R-N076D-N116A-G211Q-H249R ++
S024R-S101G-V104I-H249R ++
N018R-S024R-N076D-N116A-I198L-G211Q-T213A-A215F-H249R ++
N018R-S024R-V104I ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-T022W-S078R-S101A-S103A-V104I-N183D-I198L-T213A-A215F-A232V-Q245R ++
N018R-G020R-T22W-S024R-N076D-N116A-N183D-I198L-T213A-H249R ++
G020R-T022W-S101A-S103A-V104I-A232V-Q245R ++
QO12H-G020R-S078R-S101G-S103A-V104I-I198L-G211Q-T213A-A232V-Q245R ++
N018R-S024R-N076D-S101A-G211Q-A215F-H249R ++
N018R-S024R-N076D-T213A-H249R ++
S024R-V104I-H249R ++
N018R-T022W-S024R-N076D-G211Q-H249R ++
N018R-N076D-S103A-V104I-H249R ++
N043R-N076D-S101G-S103A-V104I-L217E-A232V-Q245R ++
G020R-S078R-S101G-S103A-V104I-N183D-G211Q-T213A-A232V-Q245R-E271G ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-A215F-H249R ++
N018R-S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R ++
N018R-S024R-N076D-S101A-I198L-A215F-H249R ++
N018R-T022W-S024R-N076D-N116A-I198L-G211Q-T213A-H249R ++
N018R-S024R-N076D-S101A-N116A-T213A-A215F-H249R ++
G020R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R ++
R045T-S078R-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-T22W-S024R-N076D-S101A-N116A-A215F-H249R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
N043D-S101G-S103A-V104I-A232V-Q245R-N269R ++
G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R ++
N018R-S024R-N076D-N116A-G211Q-T213A-A215F-H249R ++
S024R-S103A-M175L-A232V-H249R ++
N018R-S024R-N076D-N116A-T213A-H249R ++
G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +++
G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R ++
S024R-N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R ++
N018R-S024R-N076D-S101A-N116A-I198L-T213A-A215F-H249R ++
N043R-R045T-S101G-S103A-V104I-A232V-Q245R ++
N018R-T022W-S024R-N076D-S101A-I198L-G211Q-Q245R ++
G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R ++
S024R-A232V ++
G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R ++
S024R-N076D-S101G-A232V-Q245R ++
N018R-N076D-S101G-S103A-V104I-H249R ++
N018R-S024R-N076D-I198M-G211Q-T213A-A215F-H249R ++
N018R-T22W-S024R-N076D-S101A-I198L-A215F-H249R ++
N018R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
G020R-T022W-S103A-G211Q-T213A-A215F-A232V-Q245R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R ++
R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-T22W-S024R-N076D-S101A-G211Q-T213A-H249R ++
N018R-S024R-N076D-N116A-I198L-A215F-H249R-V268G ++
N018R-T022W-S024R-N076D-S101A-G211Q-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-H249R ++
S101G-S103A-V104I-Q245R ++
N018R-N076D-S101G-A232V-Q245R ++
N018R-G020R-R045T-S101G-S103A-V104I-A232V-Q245R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-H249R ++
N018R-T022W-S024R-N076D-N116A-I198L-T213A-H249R ++
S078R-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-S078R-S101G-S103A-V104I-L217E-A232V-Q245R ++
G020R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
R045T-S101G-S103A-V104I-A232V-Q245R-N269R ++
S024R-S103A-A232V ++
N018R-S024R-N076D-S101A-G211Q-H249R ++
N043D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-N043R-R045T-N076D-S076T-S101G-S103A-V104I-A232V-Q245R-A273T ++
N018R-G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-S078R-S101A-S103A-V104I-N183D-A215F-A232V-Q245R ++
N018R-S024R-N076D-S101G-A232V ++
A232V-Q245R ++
N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-V234I-Q245R ++
S024R-N076D-S103A-V104I-Q245R ++
G020R-S078R-S101A-S103A-V104I-G211Q-T213A-A232V-Q245R ++
N043D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R-A272V ++
N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-H249R ++
N018R-S103A-V104I-A232V ++
G020R-T022W-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R ++
S024R-N043R-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-T022W-S024R-N076D-T213A-A215F-H249R ++
N018R-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-H249R ++
G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R ++
G020R-T022W-S078R-S101G-S103A-V104I-G211Q-T213A-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-A215F-A232V-Q245R ++
N018R-G020R-S024R-N076D-N116A-N183D-A215F-H249R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-S024R-N076D-N116A-M117I-N183D-T213A-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-T213A-H249R ++
N018R-T22W-S024R-N076D-S101A-I198L-T213A-A215F-H249R ++
N018R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
G020R-T022W-S101G-S103A-V104I-N116A-N183D-I198L-A232V-Q245R ++
N018R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-S024R-N076D-N116A-I198L-Y209H-T213A-H249R ++
G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R ++
S024R-N076D-S101G-M175L-A232V-Q245R ++
N018R-N043D-R045T-S101G-S103A-V104I-A232V-Q245R ++
R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R ++
G020R-S078R-S101A-S103A-V104I-N116A-N183D-I198L-A215F-A232V-Q245R ++
N043R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-S024R-N076D-I198L-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-I198L-A215F-H249R ++
N018R-T022W-S024R-N076D-N116A-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-N116A-G211Q-T213A-H249R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-S024R-Q245R ++
N018R-T022W-S024R-N076D-S101A-N116A-A215F-H249R ++
S024R-N076D-V104I-Q245R ++
K027R-N043R-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-S024R-N076D-NU6A-I198L-G211Q-T213A-H249R ++
N018R-S024R-N076D-N116A-I198L-H249R ++
N018R-S024R-N076D-N183D-I198L-G211Q-T213A-A215F-++H249R ++
G020R-T022W-S101A-S103A-V104I-N116A-G211Q-T213A-A215F-A232V-Q245R ++
N018R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R ++
N043R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-T22W-S024R-N076D-N116A-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-N116A-G211Q-A215F-H249R ++
G020R-S078R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R ++
N018R-N076D-S101G-S103A-V104I-A232V-Q245R ++
N018R-S101G-V104I ++
G020R-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R ++
G020R-S078R-S101A-S103A-V104I-A232V-Q245R ++
N018R-S024R-N076D-S101A-I198L-G211Q-H249R ++
N018R-S024R-N076D-I198L-G211Q-T213A-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-H249R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-N076D-H249R ++
N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-H249R ++
N018R-S024R-N076D-S101A-N116A-G211Q-T213A-H249R ++
G020R-T022W-S078R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R ++
G020R-T022W-S101G-S103A-V104I-A114T-T213A-A215F-A232V-Q245R ++
N018R-T22W-S024R-N076D-N116A-G211Q-T213A-H249R ++
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-H249R ++
G020R-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R ++
N018R-T022W-S024R-N076D-S101A-G211Q-T213A-H249R ++
N018R-T022K-N043D-S101G-S103A-V104I-A232V-Q245R ++
N018R-S101G-S103A-V104I-A232V-Q245R-N269R ++
G020R-S078R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V ++
N018R-S024R-N076D-N116A-H249R ++
G020R-S024R-N076D-S101G-S103A-V104I-A232V-Q245R ++
N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-S024R-N076D-S101A-N116A-I198L-G211Q-H249R ++
N018R-T022W-S024R-N076D-I198L-T213A-A215F-H249R ++
N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R ++
G020R-T22W-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
G020R-S101G-S103A-V104I-N183D-G211Q-A232V-Q245R- ++
N018R-S024R-N076D-S101A-I198L-T213A-H249R ++
N018R-S024R-N076D-S101A-I198L-H249R ++
N018R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-S024R-N076D-S101A-N183D-T213A-H249R ++
N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R ++
G020R-S078R-S101G-S103A-V104I-N116A-A131V-N183D-T213A-A232V-Q245R ++
N018R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R ++
N018R-S024R-N076D-S101A-N183D-G211Q-H249R ++
N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
S024R-S101G-Q245R ++
S024R-N076D-S101G-Q245R ++
N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-G020R-S024R-N076D-S101A-N183D-G211Q-A215F-H249R ++
S024R-S101G ++
N018R-T22W-S024R-N076D-T213A-A215F-H249R ++
G020R-N043D-S101G-S103A-V104I-A232V-Q245R ++
G020R-T022W-S101G-S103A-V104I-N183D-I198L-T213A-A215F-A232V-Q245R ++
N018R-N043D-R045T-S101G-S103A-V104I-A232V-Q245R-N269R ++
N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R ++
S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R- ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N269R
G020R-T022W-S101A-S103A-V104I-I198L-G211Q-A215F-A232V-Q245R ++
G020R-T022W-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R ++
N018R-G020R-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-T022W-S024R-N076D-S101A-A215F-H249R ++
N018R-V104I ++
N018R-S024R-N076D-N116A-I198L-A215F-H249R ++
N018R-S024R-N076D-L088I-S101A-N116A-I198L-G211Q-A215F-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-G211Q-T213A-H249R ++
N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R ++
N018R-N076D-S101G-V104I-H249R ++
N018R-T022W-S024R-N076D-S101A-T213A-A215F-H249R ++
N018R-T22W-S024R-N076D-S101A-N116A-I198L-A215F-H249R ++
N018R-G020R-S101G-S103A-V104I-A232V-Q245R-H249R ++
S101G-S103A-V104I-A232V-Q245R-H249R-N269R ++
S024R-N076D-Q245R ++
N018R-G020R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R ++
N018R-G020R-S024R-N076D-A215F-H249R ++
N018R-S024R-N076D-S101A-N116A-N183D-I198L-T213A- ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
H249R
N018R-G020R-S024R-N076D-G211Q-A215F-H249R ++
N043D-S101G-S103A-V104I-A232V-Q245R ++
G020R-T22W-S078R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R ++
N018R-S024R-N076D-I198L-G211Q-A215F-H249R ++
N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R ++
N043R-S078R-S101G-S103A-V104I-A232V-Q245R-N269R ++
G020R-N043D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-T022W-S024R-N076D-S101A-T213A-H249R ++
G020R-T022W-S101A-N116A-I198L-G211Q-T213A-A215F-H249R ++
N043R-R045T-S078R-S101G-S103A-V104I-N218S-A232V-Q245R ++
N018R-S103A ++
G020R-T22W-S101G-S103A-V104I-N116A-N183D-A215F-A232V-Q245R ++
N018R-S024R-N076D-S101A-H249R ++
N018R-T022W-S024R-N076D-G211Q-T213A-H249R ++
S024R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R ++
G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R ++
G020R-S101A-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R ++
K027R-R045T-N076D-S078R-S101G-S103A-V104I-A232V- ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16C
Q245R-N269R
G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R ++
N018R-G020R-S024R-N076D-N116A-N183D-T213A-A215F-H249R ++
N018R-S024R-N076D-V104I ++
S101G-S103A-V104I-A232V-H249R ++
N018R-S024R-N076D-N116A-N183D-G211Q-H249R ++
N018R-G020R-S024R-N076D-N116A-A215F-H249R ++
N018R-S024R-N076D-N183D-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-I198L-G211Q-H249R ++
N043D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R-R275S ++
G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R ++
N018R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-A215F-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-A215F-H249R ++
N018R-G020R-S024R-N076D-N183D-H249R ++
N018R-S024R-N076D-N116A-I198L-T213A-H249R ++
N018R-T022W-S024R-N076D-S101A-N116A-G211Q-H249R ++
V004M-N018R-S024R-N076D-N116A-I198L-G211Q-T213A-H249R ++
VI04I-A232V-H249R ++
G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R ++
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
G020R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R-T274I +
G020R-S101A-S103A-V104I-T213A-A232V-Q245R +
G020R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A232V-Q245R +
G020R-S024R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R +
N018R-S024R-N076D-S103A-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-N183D-G211Q-A215F-H249R +
N018R-G020R-S024R-N076D-N116A-N183D-I198L-H249R +
N018R-T022W-S024R-N076D-N116A-I198L-A215F-H249R +
N018R-S024R-N076D-S101A-G211Q-T213A-A215F-H249R-A270V +
N018R-N043D-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +
G020R-T022W-S101G-S103A-V104I-N183D-A232V-Q245R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-T213A-H249R +
N018R-T022W-S024R-N076D-I198L-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-I198L-T213A-H249R +
G020R-T022W-S101G-S103A-V104I-N116A-N183D-A232V-Q245R +
N018R-T22W-S024R-N076D-N116A-I198L-T213A-H249R +
N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-S024R-N076D-S101G-S103A-V104I-A232V +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
S101G-H249R +
S024R-N076D-S101G-S103A-V104I-M175L-H249R +
G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R-N269S +
N018R-S024R-N076D-S101A-N116A-I198L-H249R +
N018R-T022W-S024R-N076D-N116A-H249R +
N018R-G020R-S024R-N076D-S101A-N183D-I198L-A215F-H249R +
N018R-S024R-N076D-T213A-A215F-H249R-T260K +
N018R-S024R-N076D-N116A-G211Q-T213A-H249R +
N018R-G020R-T022W-S024R-N076D-N116A-I198L-H249R +
S024R-N076D-S101G-S103A-V104I-Q245R +
S024R-N076D-S103A-H249R +
N018R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-I198L-G211Q-H249R +
N018R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-H249R +
G020R-S024R-R045T-S101G-S103A-V104I-A232V-Q245R +
N018R-G020R-S024R-N076D-N183D-G211Q-T213A-H249R +
N018R-N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-A272D +
N018R-S024R-N076D-N116A-I198L-T213A-A215F-H249R +
N018R-T22W-S024R-N076D-S101A-I198L-H249R +
N018R-T022W-S024R-N076D-N116A-I198L-H249R +
S024R-N076D-S101G-S103A-A232V +
S024R-S103A-V104I +
N018R-S024R-N076D-S101A-N116A-N183D-G211Q-A215F- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
H249R
S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R +
G020R-S101G-S103A-V104I-N116A-N183D-A232V-Q245R +
S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +
G020R-T022W-S101A-S103A-V104I-N183D-G211Q-T213A-A215F-A232V-Q245R +
G020R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-S024R-N076D-S101A-N116A-I198L-G211Q-A215F-H249R +
G020R-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R +
N018R-N043R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-I198L-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-T213A-H249R +
G020R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +
S024R-N076D-S103A-Q245R +
N018R-T022W-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R +
S103A-V104I-Q245R +
N018R-T022W-S024R-N076D-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-H249R +
N018R-T022W-S024R-N076D-I198L-G211Q-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-G211Q-T213A-A215F-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-G020R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-G020R-T022W-S024R-N076D-S101A-G211Q-T213A-A215F-H249R +
A016T-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-T022W-S024R-N076D-N116A-A215F-H249R +
N043R-N076D-S101G-S103T-V104I-A232V-Q245R-H249R-N269R +
G020R-S078R-S101A-S103A-V104I-G115E-N116A-N183D-G211Q-T213A-A232V-Q245R +
N018R-S024R-N076D-I198L-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-H249R +
G020R-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R +
N018R-S024R-N076D-S101G +
N076D-S101G-A232V-Q245R +
N018R-N076D-S101G-S103A-V104I-Q245R +
N018R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-A215F-H249R +
N018R-V104I-A232V +
N043D-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +
S024R-N076D-S101G-A232V-H249R +
S103A-A232V-Q245R +
G020R-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-I198L-G211Q-A215F-H249R +
S024R-N076D-S103A-V104I-H249R +
S024R-S101G-S103A-V104I +
G020R-S101G-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-A215F-H249R. +
G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-T213A-A215F-A232V-Q245R +
G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +
N018R-T022W-S024R-N076D-N116A-N183D-T213A-H249R +
N018R-G020R-S024R-N076D-A131T-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-I198L-A215F-H249R +
N018R-T022W-S024R-N076D-N183D-G211Q-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-T213A-A215F-H249R +
N018R-G020R-S024R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +
N043R-S101G-S103A-V104I-Q245R-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-N076D-A232V-H249R +
N018K-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R-N269R +
N018R-G020R-S024R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +
N018R-T022W-S024R-N076D-S101A-N116A-T213A-A215F-H249R-L267I +
A232V-H249R +
N018R-G020R-S024R-N076D-N116A-G211Q-T213A-A215F-H249R +
N076D-V104I-Q245R +
N018R-G020R-S024R-N076D-N183D-I198L-G211Q-A215F-H249R +
N018R-S024R-N076D-S101A-G211Q-T213A-H249R +
S024R-S101G-S103A-A232V +
N018R-G020R-T022W-S024R-N076D-N116A-N183D-I198L-T213A-A215F-H249R +
N018R-G020R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-A215F-H249R +
G020R-T022W-S101A-S103A-V104I-N116A-N183D-G211Q-A215F-A232V-Q245R +
N018R-S024R-N076D-N116A-I198L-G211Q-H249R +
S103A-A232V-H249R +
N018R-G020R-S024R-N076D-N116A-N183D-I198L-A215F-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-T213A-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-T022W-S024R-N076D-N183D-T213A-H249R +
N018R-S024R-N076D-S101A-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-H249R +
N018R-R045T-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-G020R-R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R +
N018R-T022W-S024R-N076D-N116A-I198L-T213A-A215F-H249R +
G020R-T022W-S101G-S103A-V104I-N116A-N183D-G2110-T213A-A232V-Q245R +
N018R-G020R-S024R-N076D-I198L-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-G211Q-H249R +
G020R-T022W-S101A-S103A-V104I-N116A-N183D-A232V-Q245R-T274I +
S024R-S103A-Q245R-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-H249R +
N018R-S024R-N076D-S101A-I198L-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-I198L-G211Q-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-N116A-N183D-T213A-H249R +
N018R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-T022W-S024R-N076D-N116A-G211Q-T213A-A215F- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
H249R
N018R-S024R-N076D-S101A-N183D-I198L-T213A-H249R +
N043D-N076D-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-I198L-G211Q-T213A-A215F-H249R +
N018R-G020R-S024R-N076D-N116A-N183D-T213A-H249R +
S103A-A232V +
N018R-T022W-S024R-N076D-N116A-N183D-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-H249R +
N018R-N043R-S078R-S101G-S103A-V104I-A232V-Q245R +
N018R-G020R-T022W-S024R-N076D-S101A-N183D-G211Q-A215F-H249R +
N043R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-T213A-H249R +
N018R-S024R-N076D-N183D-I198L-T213A-H249R +
N018R-T022W-S024R-N076D-S101A-N183D-G211Q-H249R +
N018R-G020R-S024R-N076D-I198L-T213A-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-N183D-G211Q-T213A-H249R +
N018R-T022W-S024R-N076D-I198L-H249R +
N018R-S024R-N076D-N183D-I198L-G211Q-H249R +
G020R-T022W-S101A-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +
N018R-G020R-S024R-N076D-N116A-N183D-G211Q-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
A215F-H249R
G020R-T022W-S101A-S103A-V104I-N116A-N183D-A215F-A232V-Q245R +
N018R-S024R-N076D-S101A-N183D-H249R +
N018R-S024R-N076D-A232V +
N018R-T022W-S024R-N076D-S101A-N116A-H249R +
G020R-S101A-S103A-V104I-N116A-N183D-I158L-G211Q-T213A-A215F-A232V-Q245R +
G020R-T022W-S101G-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R-N263S +
S024R-N076D-S101G-V104I-A232V-H249R +
N043R-S078R-S101G-S103A-V104I-A232V-Q245R +
S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-T213A-A215F-H249R +
N018R-G020R-S024R-N076D-I198L-A215F-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-T213A-H249R +
N018R-S024R-N076D-S101A-V197A-T213A-A215F-H249R +
S024R-S101G-S103A +
N018R-S024R-N076D-S101A-N116A-G211Q-A215F-H249R +
N043R-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
S024R-V104I-A232V +
N018R-S024R-N076D-N183D-G211Q-H249R +
G020R-N043R-R045T-S078R-S101G-S103A-V104I-A232V-Q245R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16С
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-H249R +
N018R-S024R-N076D-N116A-А150Т-T213A-H249R +
N018R-S024R-N076D-N183D-T213A-H249R +
N018R-G020R-S024R-N076D-N116A-N183D-G211Q-A215F-H249R +
N018R-G020R-S024R-N076D-G211Q-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-I198L-H249R +
S024R-N076D-A232V-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-T213A-H249R +
N018R-T022W-S024R-N076D-S101A-N116T-I198L-A215F-H249R +
N018R-S024R-N076D-N183D-I198L-G211Q-A215F-H249R +
N018R-T022R-S024R-N076D-S101A-N116A-N183D-G211Q-H249R +
R045T-S101G-S103A-V104I-A232V-Q245R +
N018R-G020R-S024R-N076D-S101A-N183D-G211Q-H249R +
G020R-S101G-S103A-V104I-N116A-N183D-T213A-A232V-Q245R +
N076D-S101G-S103A-Q245R +
G020R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-N116A-N183D-H249R +
N018R-S024R-N076D-S101A-N183D-G211Q-T213A-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-I198L- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
H249R
N018R-T22W-S024R-N076D-G211Q-T213A-H249R +
N018R-G020R-S024R-N076D-N183D-G211Q-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-N183D-T213A-H249R +
N043R-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
N018R-T022W-S024R-N076D-S101A-A215F-H249R +
N018R-G020R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-H249R +
N076D-S101G-V104I-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-H249R +
N018R-S024R-N076D-N183D-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-A215F-H249R +
N018R-T022W-S024R-N076D-N183D-I198L-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-I198L-G211Q-H249R +
G020R-S101A-S103A-V104I-N116A-N183D-A232V-Q245R +
N018R-S024R-N076D-N116A-N183D-I198L-G211Q-H249R +
N018R-G020R-S024R-S101G-S103A-V104I-A232V-Q245R +
N018R-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
G020R-S101A-S103A-V104I-N116A-N183D-G211Q-A232V-Q245R +
N018R-T022W-S024R-N076D-S101A-N183D-I198L-Y209H-H249R +
N018R-S024R-N076D-N183D-I198L-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36k или 36l, 16С
H249R
N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-H249R +
N018R-S024R-N076D-N183D-I198L-H249R +
N018R-S024R-N076D-N183D-A215F-H249R +
N018R-G020R-S024R-N076D-G211Q-T213A-A215F-H249R +
N076D-Q245R +
N076D-S101G-V104I-Q245R +
N018R-T022W-S024R-N076D-S101A-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-G211Q-T213A-H249R +
G020R-S024R-N043R-S101G-S103A-V104I-A232V-Q245R +
N018R-S024R-N076D-N116A-N183D-G211Q-A215F-H249R +
G020R-S101A-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R +
S101G-S103A-V104I +
N018R-G020R-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-H249R +
N018R-G020R-S024R-N076D-N204D-T213A-H249R +
N018R-T022W-S024R-N076D-N183D-I198L-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-A209V-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-S024R-N076D-S101A-N116A-I198L-T213A-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-G211Q-T213A-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-G211Q-T213A-H249R +
N018R-N043R-R045T-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
N018R-S024R-N076D-N183D-G211Q-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-A215F-H249R +
N018R-G020R-S024R-N076D-N116A-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-G211Q-A215F-H249R +
N018R-G020R-S024R-N076D-N183D-G211Q-T213A-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-I198L-T213A-H249R +
N018R-G020R-S024R-N076D-S101A-G211Q-A215F-H249R-N269D +
N018R-G020R-N043D-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-T022W-S024R-N076D-S101A-N183D-I198L-T213A- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
H249R
G020R-T022W-S101G-S103A-V104I-N183D-A215F-A232V-Q245R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-Y209H-G211Q-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-G211Q-H249R +
N076D-A232V-Q245R +
N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R +
N018R-G020R-S024R-N076D-N116A-I198L-G211Q-A215F-Q245R +
N018R-G020R-T022W-S024R-N076D-T213A-H249R +
G020R-S024R-N043D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-I198L-A215F-H249R +
G020R-A090S-S101G-S103A-V104I-N116A-N183D-T213A-A215F-A232V-Q245R +
N018R-G020R-T022W-S024R-N076D-S101A-I198L-G211Q-T213A-A215F-H249R +
N018R-G020R-S024R-N076D-S101A-N183D-T213A-A215F-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-G211Q-T213A-H249R +
N043D-R045T-S078R-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-S024R-N076D-S101A-N183D-A215F-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-G020R-S024R-N076D-S101A-N183D-I198L-T213A-H249R +
G020R-T022W-S101A-S103A-V104I-N116A-N183D-I198L-G211Q-T213A-A215F-A232V-Q245R +
N018R-G020R-S024R-N043D-N076D-S101G-S103A-V104I-A232V-Q245R-N269R +
N018R-S024R-N076D-S101A-N183D-T213A-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-I198L-G211Q-T213A-A215F-H249R +
N018R-G020R-N043D-S101G-S103A-V104I-L217E-A232V-Q245R +
N076D-S103A-V104I-A232V-Q245R +
R045T-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-T022W-S024R-N076D-S101A-N183D-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R +
N018R-G020R-N043D-N076D-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
N076D-S103A-V104I-Q245R +
N018R-G020R-S024R-N076D-S101A-N116A-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-A215F-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-S024R-N076D-N116A-N183D-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q-H249R +
N018R-S024R-N076D-S101G-Q245R +
N018R-S024R-N076D-S101A-N116A-N183D-I198L-T213A-A215F-H249R +
N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +
N018R-G020R-T022W-S024R-N076D-N116A-I198L-T213A-A215F-H249R +
N076D-V104I-A232V-Q245R +
K027R-N043R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +
N018R-T022W-S024R-N076D-S101A-N183D-T213A-A215F-H249R +
N018R-S024R-N076D-S103A-V104I-L135I-A232V +
N018R-G020R-T022W-S024R-N076D-N183D-I198L-G211Q-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-A215F-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-G211Q-H249R +
N018R-T022W-S024R-N076D-N183D-G211Q-T213A-A215F-H249R +
N076D-S101G-S103A-V104I-A232V-H249R +
P005S-N018R-T022W-S024R-N076D-S101A-T213A-A215F-H249R +
N018R-S024R-N076D-N116A-N183D-A215F-H249R +
N018R-S024R-N076D-N183D-I198L-A215F-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
N018R-G020R-S024R-N076D-S101A-N116A-N183D-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-G211Q-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N116A-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-T213A-H249R +
N018R-T022W-S024R-N076D-S101A-N183D-G211Q-T213A-H249R +
N018R-G020R-S024R-N076D-N116A-I198L-H249R +
N018R-S024R-N076D-N183D-G211Q-T213A-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-A215F-H249R +
N018R-T022W-S024R-N076D-N183D-I198L-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-N183D-H249R +
N018R-T022W-S024R-N076D-S101A-N183D-I198L-A215F-H249R +
N018R-G020R-N043D-R045T-N076D-S101G-S103A-V104I-A232V-Q245R +
G020R-T022W-S101A-S103A-V104I-N183D-I198L-A215F-A232V-Q245R +
N076D-S101G-S103A-V104I-H249R +
N018R-G020R-S024R-N076D-N183D-I198L-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-S101A-N183D-A215F-H249R +
N018R-G020R-S024R-N076D-G211Q-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-G211Q-T213A-H249R +
N018R-S024R-N076D-N116A-N183D-I198L-H249R +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-G020R-S024R-N076D-G211Q-N243D-H249R +
N018R-G020R-R045T-N076D-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-T022W-S024R-N076D-N183D-I198L-G211Q-T213A-H249R +
N018R-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-T213A-H249R +
N018R-T022W-S024R-N076D-N116A-I198L-G211Q-T213A-A215F-H249R +
S024R-N076D-S101G +
N018R-G020R-S024R-N076D-S101A-I198L-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-H249R +
N018R-G020R-S024R-N076D-N183D-A215F-H249R +
N018R-N043D-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-Q245R +
G020R-S024R-N076D-S078R-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-G020R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-S024R-N076D-S101A-N183D-I198L-G211Q-H249R +
N018R-T022W-S024R-N076D-N183D-G211Q-T213A-H249R +
N018R-G020R-S024R-N076D-N116A-I198L-G211Q-A215F-H249R-N269S +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
N018R-G020R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-A215F-H249R +
G020R-T022W-S101A-S103A-V104I-N183D-T213A-A215F-A232V-Q245R +
N018R-S024R-N076D-A086V-S101A-N183D-I198L-G211Q-H249R +
N018R-N076D-S101G-1198T-A232V +
N018R-G020R-S024R-N076D-S101A-N116A-N183D-I198L-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-S101A-N183D-G211Q-T213A-A215F-H249R +
N018R-S024R-N076D-N183D-H249R-A248T +
N018R-N076D-V104I-Q245R-H249R +
N018R-T022W-S024R-N076D-S101A-N116A-N183D-I198L-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-T213A-A215F-H249R +
N018R-G020R-T022W-S024R-N076D-N116A-N183D-G211Q-T213A-A215F-H249R +
N018R-G020R-S024R-N076D-S101A-H249R +
N018R-G020R-S024R-N076D-S101A-N116A-T213A-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-G211Q-A215F-H249R +
N018R-T022W-S024R-N076D-N116A-N183D-I198L-G211Q- +
Таблица 12-2:
BMI чистящие характеристики вариантов библиотек WCE10-WCE14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16С
T213A-H249R
N043R-R045T-S078R-S101G-S103A-V104I-L217E-A232V-Q245R +
N043R-R045T-S101G-S103A-V104I-A232V-Q245R-H249R +
N018R-N076D-S101G-V104I +
Таблица 12-3:
BMI чистящие характеристики WCE15 и WCE16 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36m, BMI, 16C
N018R-S024R-N043R-N076D-H249R-N269R +++
N018R-T022R-S024R-N043R-N076D-H249R +++
N018R-N043D-S101G-S103A-V104I-A232V-Q245R +++
G020R-N043D-S101G-S103A-V104I-A232V-Q245R +++
N043D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N043R-N076D-S101G-S103A-V104I-A232V-Q245R +++
T022R-N043R-S101G-S103A-V104I-A232V-Q245R +++
N043R-S078R-S101G-S103A-V104I-A232V-Q245R +++
G020R-N076D-S101G-S103A-V104I-A232V-Q245R +++
N043R-N076D-S101G-S103A-V104I-A232V-Q245R +++
T022R-N076D-S101G-S103A-V104I-A232V-Q245R +++
N076D-S078R-S101G-S103A-V104I-A232V-Q245R +++
N018R-S024R-N043R-N076D-H249R +++
Таблица 12-3:
BMI чистящие характеристики WCE15 и WCE16 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36m, BMI, 16C
N018R-S024R-N076D-S242R-H249R +++
N018R-S024R-N076D-H249R-N269R +++
N018R-T022R-S024R-N076D-H249R +++
N018R-S024R-N076D-S078R-H249R +++
N018R-S024R-N043D-N076D-H249R-N269R +++
N018R-T022R-S024R-N043D-N076D-H249R +++
N018R-S024R-N043D-N076D-S078R-H249R +++
G020R-S101G-S103G-V104I-A232V-Q245R +++
G020R-S101G-S103A-V104L-A232V-Q245R +++
G020R-S101G-S103A-V104V-A232V-Q245R +++
G020R-S101G-S103S-V104I-A232V-Q245R +++
G020R-S101G-S103S-V104L-A232V-Q245R +++
G020R-S101S-S103S-V104I-A232V-Q245R +++
G020R-S101S-S103S-V104L-A232V-Q245R +++
G020R-S101A-S103A-V104L-A232V-Q245R +++
G020R-S101S-S103S-V104V-A232V-Q245R +++
G020R-S101S-S103A-V104I-A232V-Q245R +++
G020R-S101S-S103A-V104V-A232V-Q245R +++
G020R-S101S-S103G-V104I-A232V-Q245R +++
G020R-S101S-S103G-V104V-A232V-Q245R +++
G020R-S101A-S103A-V104V-A232V-Q245R +++
G020R-S101A-S103S-V104I-A232V-Q245R +++
G020R-S101A-S103S-V104V-A232V-Q245R +++
N018R-S024R-N043R-N076D-S078R-H249R ++
S024R-N043D-S101G-S103A-V104I-A232V-Q245R ++
N043D-S101G-S103A-V104I-A232V-Q245R-H249R ++
S024R-N076D-S101G-S103A-V104I-A232V-Q245R ++
Таблица 12-3:
BMI чистящие характеристики WCE15 и WCE16 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36m, BMI, 16C
N076D-S101G-S103A-V104I-A232V-S242R-Q245R ++
NO18R-G020R-S024R-N076D-L217E-H249R ++
N018R-S024R-N043R-N076D-L217E-H249R
N018R-S024R-N043D-N076D-S242R-H249R ++
N018R-G020R-S024R-N043R-N076D-H249R ++
G020R-S101A-S103G-V104V-A232V-Q245R ++
N043D-S101G-S103A-V104I-A232V-Q245R +
N018R-S024R-N076D-L217E-H249R-N269R +
Таблица 12-4:
BMI чистящие характеристики вариантов библиотек WCE20 и WCE21. PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m или 36n
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36m или 36n, 16C
G020R-S101A-S103A-V104I-G118R-A232V-Q245R +++
G020R-S024R-N116A-T213A +++
N043R-S101A-N116A-A215F-N269R +++
S024R-N043R-S101A-N116A +++
S024R-N043R-S101A-N116A-A215F-N269R +++
G020R-S101G-S103A-V104I-A215F-A232V-Q245R +++
N043R-S101A-N269R +++
S024R-N043R-N116A-T213A-N269R +++
G020R-S024R-N043R-R045T-S101A-T213A +++
S024R-N043R-N116A-A215F-N269R +++
G020R-S024R-T213A-A215F +++
Таблица 12-4:
BMI чистящие характеристики вариантов библиотек WCE20 и WCE21. PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m или 36n
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36m или 36n, 16C
G020R-N116A-N269R +++
S024R-N116A-T213A-N269R +++
N043R-S101A-N116A-N269R +++
S101G-S103A-V104I-N116A-T213A-A232V-Q245R-N269R +++
S024R-N043R-R045T-S101A-N116A-A215F-N269R +++
G020R-N043R-S101A-N269R +++
S101A-S103A-V104I-T213A-A232V-Q245R-N269R +++
S024R-A215F-N269R +++
N043R-S101A-N116A-T213A-A215F-N269R +++
N043R-S101A-T213A-N269R +++
G020R-S024R-N043R-R045T-N116A-Т21ЗА +++
S101G-S103A-V104I-A232V-Q245R-N269R +++
S024R-N043R-R045T-S101A-N116A-T213A-N269R +++
S024R-N043R-R045T-N269R +++
G020R-N043R-R045T-S101A-N269R +++
S024R-N043R-N116A-N269R +++
G020R-S024R-N043R-R045T +++
N043R-N116A-N269R +++
S024R-N043R-S101A-A215F-N269R +++
S024R-N043R-R045T-T213A-A215F-N269R +++
G020R-S024R-R045T-N269R +++
G020R-N043R-S101A-N116A-T213A-A215F +++
G020R-S101G-S103A-V104I-T213A-A215F-A232V-Q245R +++
G020R-S024R-R045T-N116A-N269R +++
G020R-S101A-N116A-N269R +++
Таблица 12-4:
BMI чистящие характеристики вариантов библиотек WCE20 и WCE21. PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m или 36n
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36m или 36n, 16C
S024R-N043R-A215F +++
G020R-S024R-T213A +++
S024R-N043R-S101A-A215F +++
G020R-S024R-N043R-R045T-N116A +++
G020R-S024R-N043R-R045T-S101A-N269R +++
G020R-S024R-S101A-A215F +++
G020R-S024R-N116A-T213A-A215F +++
G020R-S024R-N116A +++
G020R-S024R-S101A-N116A +++
N043R-T213A-A215F-N269R +++
S024R-S101A-N269R +++
S024R-N043R-N116A-A215F +++
G020R-T038A-N043R-S101A +++
G020R-S024R-N116A-A215F +++
S024R-N043R-S101A-T213A ++
P014L-G020R-S024R-N043R-R045T-S101A-A215F ++
G020R-S024R-A215F ++
G020R-N116A-A215F-N269R ++
G020R-R045T-N116A-N269 ++
G020R-S024R-N043R-R045T-A215F ++
G020R-S024R-N043R-R045T-N116A-T213A-A215F ++
Таблица 12-5:
BMI чистящие характеристики вариантов библиотек NHJ8.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2 =++; PI от 1,19 до 1,1 =+ в моющем средстве Примера 36f
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36f 16С
N043R-N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F +++
S024R-N043R-N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R +++
S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F-E271F +++
S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F ++
N076D-S101G-S103A-V104I-A114V-A158E-S188D-A232V-Q245R-N248D-H249R-E271F ++
S024R-N076D-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F +
S024R-N043R-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R +
S024R-N043R-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +.
Таблица 12-6.
BMI чистящие характеристики вариантов библиотек NHJ8, NHJ9, NHJ14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36c 16C
T022A-S101G-S103A-V104I-G159D-L217E-A232V-Q245R-N248D-E271F +++
T022A-N043R-S101G-S103A-V104I-G159D-S188D-L217E-A232V-Q245R-N248D-E271F +++
T022A-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D- +++
Таблица 12-6.
BMI чистящие характеристики вариантов библиотек NHJ8, NHJ9, NHJ14.
PI= Показатель эффективности PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36 с 16С
E271F
N043R-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R +++
N043R-N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F +++
S024R-S101G-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R+ ++
S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +++
T022A-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F ++
T022A-N043R-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F ++
T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F ++
T022A-S1OIG-S103A-V104I-G159D-A232V-Q245R-N248D-E271F ++
N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F ++
N043R-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R
S024R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F ++
N076D-S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D- ++
Таблица 12-6.
BMI чистящие характеристики вариантов библиотек NHJ8, NHJ9, NHJ14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36 с 16С
H249R
S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F ++
N043R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F ++
S101G-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F ++
S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R-E271F ++
S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R ++
N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F ++
S101G-S103A-V104I-A158E-N183D-S188D-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-S128L-A158E-S188D-A232V-Q245R-N248D-H249R ++
N076D-S101G-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R-E271F +
N043R-N076D-S101A-S103A-V104I-A158E-S166D-S188D-A232V-Q245R-N248D-H249R +
N076D-S101A-S103A-V104I-A158E-S188D-L217E-A232V-Q245R-N248D-H249R-E271F +
Таблица 12-6.
BMI чистящие характеристики вариантов библиотек NHJ8, NHJ9, NHJ14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ; Моющее средство Примера 36f 16С
H017R-T022A-N076D-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F +++
T022A-N043R-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F ++
T022A-S101G-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-H249R-E271F ++
H017R-T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-E271F ++
T022A-N076D-S101G-S103A-V104I-G159D-A232V-Q245R-N248D-H249R-E271F +
T022A-S101G-G102A-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F +
Таблица 12-8.
BMI чистящие характеристики NHJ11 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36a или 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a или 36cl в отбеливателе 16C
S101S-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101S-S103G-V104V-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101A-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
Таблица 12-8.
BMI чистящие характеристики NHJ11 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36a или 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a или 36cl в отбеливателе 16C
S101A-S103A-V104L-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103G-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101S-S103G-V104I-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101S-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101S-S103S-V104V-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101A-S103S-V104I-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101A-S103S-V104I-G159E-A232V-Q245R-N248D-H249R ++
S101S-S103A-V104I-G159E-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104L-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101A-S103A-V104L-G159E-A232V-Q245R-N248D-H249R +
S101A-S103S-V104L-G159E-A232V-Q245R-N248D-H249R +
S101G-S103S-V104L-G159E-A232V-Q245R-N248D-H249R +
S101S-S103A-V104L-G159E-A232V-Q245R-N248D-H249R +
Таблица 12-9.
BMI чистящие характеристики NHJ12 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
V026F-V051W-V104L-S106E +++
V026F-L031F-S078N-G102A-S160D +++
G020K-G100S-N116L-A158E-S166D-N243F +++
T033S-N043W-N218D-P239G-N243F +++
Таблица 12-9.
BMI чистящие характеристики NHJ12 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
T022L-T038F-A048R-N062E-G100S-R186K +++
S101D-S103N-N116L-S144R-A215D +++
V104L-S105T-T213A-L217E-S256N +++
N043W-S101D-S212M-N243F +++
V026F-A048R-S105T-T213A-N218D-T224A +++
S024F-S101D-G118R-A215D-L250I-A272F ++
V121F-N185E-T224A-P239G ++
T022L-L031F-G102A-S128D-T224A-N243F ++
N062E-S078N-G102A-N116L-S144R-L250I ++
T022L-T038F-V121F-S160D-A272F ++
V026F-S078N-G159C-R186K-N243F ++
S024F-A048R-G118R-S166D-L217E ++
G023A-T038F-S078N-G100S-S212M-A215D ++
G100S-N116L-A158E-T213A ++
S078N-V104L-G118R-S128D ++
G102A-S103N-S105T-A194E ++
T022L-S078N-S128D-T213A +
K027R-G1OOS-G118R-S160D-S188D-N243F +
S024F-G102A-R186K-T213A-L217E-N243F +
T033S-S105T-S188D-S216F +
G023A-G100S-A194E-S212M +
A048R-S128D-N185E-P239G +
G020K-S024F-T033S-P129E-A194E +
G020K-K027R-P129E-S166D-P239G +
T022L-G023A-K027R-S101D-V104L-S216F +
T033S-G118R-P129E-A194E-P239G +
T022L-S078N-N116L-P129E-S256N +
Таблица 12-9.
BMI чистящие характеристики NHJ12 вариантов.
PI= Показатель эффективности PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
K027R-S101D-S103N-S105T-A272F +
A048R-S078N-N116L-N185E-L217E-P239G +
G023A-S024F-K027R-N062E +
S024F-S103N-V104L-G118R-S188D +
V026F-V104L-S256N-A272F +
S024F-N043W-V104L-V121F-P129E +
N062E-S078N-N116L-T224A +
Таблица 12-10.
BMI чистящие характеристики вариантов библиотек NHJ15.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
T022A-S024R-S101D-S103A-V104I-G118R-G159D-S188D-A232V-N248D-E271F +++
T022A-S024R-S103A-V104I-P129E-G159D-S188D-A232V-N248D-E271F +++
T022A-S024R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D +++
T022A-S024R-S101D-S103A-V104I-G118R-P129E-G159D-S188D-A232V-Q245R-N248D +++
T022A-S024R-S101D-S103A-V104I-G159D-S188D-A232V-Q245R-N248D +++
T022A-N043R-S103A-V104I-G118R-P129E-G159D-S188D-A232V- +++
Таблица 12-10.
BMI чистящие характеристики вариантов библиотек NHJ15.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
Q245R-N248D
T022A-N043R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D++ ++
T022A-N043R-S101D-S103A-V104I-G118R-P129E-G159D-S188D-A232V-N248D-E271F ++
T022A-S024R-N043R-S101D-S103A-V104I-G159D-S188D-A232V-Q245R-N248D ++
T022A-S103A-V104I-G159D-S188D-A232V-N248D ++
T022A-S024R-S103A-V104I-G118R-P129E-G159D-S188D-A232V-N248D-E271F
T022A-S024R-S103A-V104I-G159D-S188D-L217D-A232V-Q245R-N248D-E271F ++
T022A-N043R-N062E-S103A-V104I-G159D-S188D-A232V-Q245R-N248D-E271F ++
T022A-N043R-S103A-V104I-P129E-G159D-S188D-A232V-Q245R-N248D ++
T022A-S024R-S103A-V104I-G159D-S188D-L217D-A232V-N248D-E271F ++
T022A-S103A-V104I-G118R-G159D-S188D-L217D-A232V-Q245R-N248D ++
T022A-S024R-S101D-S103A-V104I-G118R-S128I-G159D-S188D-A232V-Q245R-N248D ++
T022A-S024R-N043R-S103A-V104I-G159D-S188D-L217D-A232V-N248D-E271F ++
T022A-N043R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D-E271F ++
Таблица 12-10.
BMI чистящие характеристики вариантов библиотек NHJ15.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a 16C
T022A-N043R-S103A-V104I-G118R-G159D-S188D-A232V-N248D-E271F +
T022A-S103A-V104I-S128I-P129E-G159D-S188D-A232V-N248D-E271F +
T022A-S103A-V104I-G159D-S188D-L217D-A232V-Q245R-N248D-E271F +
T022A-N043R-S103A-V104I-S128I-G159D-S188D-A232V-Q245R-N248D +
T022A-S101D-S103A-V104I-G118R-G159D-S188D-L217D-A232V-Q245R-N248D-E271F +
T022A-S103A-V104I-G118R-P129E-G159D-S188D-A232V-Q245R-N248D-E271F +
T022A-S024R-N043R-S103A-V104I-G118R-G159D-S188D-L217D-A232V-N248D +
Таблица 12-11.
BMI чистящие характеристики вариантов библиотек NHJ16.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36a 16С
G020K-S024F-N062E-S188D-P239G +++
S024F-N062E-N116L-P239G +++
G020K-G023A-N062E-S188D +++
G020K-G023A-S024F-N062E-G118R-S188D-T213A +++
Таблица 12-11.
BMI чистящие характеристики вариантов библиотек NHJ16.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; Моющее средство Примера 36a 16C
G020K-N043W-N062E-N116L-S188D-T213A-P239G +++
G023A-N062E-N116L-G118R +++
G023A-S024F-N062E-N116L-G118R +++
S024F-N116L +++
S024F-N062E-S188D-T213A +++
G023A-N062E-N116L-G118R-S188D-P239G +++
G020K-S024F-N062E ++
G020K-N043W-N062E-N116L-P239G ++
S024F-N062E-N116L-T213A-P239G ++
G020K-S024F-N043W-N062E-N116L-T213A ++
G020K-G023A-S024F-N062E-N116L-S188D-T213A ++
S024F-N062E-S188D-P239G ++
G023A-N043W-N062E-N116L-G118R-T213A ++
N062E-S188D-P239G ++
G020K-S024F-N062E-P239G +
S024F-N116L-G118R-S188D-P239G +
G020K-G023A-N062E-N116L-G118R-T213A +
G020K-G023A-S024F-N062E-S188D-T213A-P239G +
S024F-N043W-G118R-S188D +
G023A-S024F-N116L-G118R-S188D-T213A +
G020K-G023A-N043W-N116L-S188D-T213A-P239G +
G023A-S024F-N116L-S188D-P239G +
G023A-N043W-N116L-G118R-S188D +
G023A-S024F-G118R-S188D-P239G +
G023A-S024F-N043W-N062E-N116L-G118R +
Таблица 12-11.
BMI чистящие характеристики вариантов библиотек NHJ16.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI моющее средство Примера 36a, 36d или 36f 16C
G020K-G023A-N043W-G118R-S128I-P129E-G159D-S188D +++
S024F-G118R-S128I-P129E-G159D +++
G020K-S024F-N062E-N116L-G118R-S188D +++
G020K-N062E-N116L-S188D +++
N062E-N116L-G118R-T213A +++
G020K-G023A-N062E-N116L-S188D +++
N062E-N116L-G118R-S188D +++
G020K-N062E-N116L-T213A +++
G020K-G023A-N062E-N116L +++
G020K-N062E-S188D-T213A +++
G020K-N062E +++
G020K-S024F-N062E-N116L-S188D +++
G020K-N043W-N062E-N116L-S188D +++
G020K-S024F-N062E-S188D-T213A +++
N062E-N116L-S188D-T213A +++
G020K-N062E-N116L +++
G020K-G023A-N062E-N116L-S188D-T213A +++
G023A-S024F-N062E-N116L-T213A +++
T022A-N043R-S103A-V104I-S128I-P129E-G159D-S188D-A232V-Q245R-N248D +++
T022A-N043R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D-E271F +++
S024F-N062E-N116L-S188D +++
T022A-S024R-S103A-V104I-G118R-S128I-P129E-G159D-S188D-A232V-N248D +++
G023A-N062E-N116L-S188D +++
N043W-N062E-N116L +++
Таблица 12-11.
BMI чистящие характеристики вариантов библиотек NHJ16.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI моющее средство Примера 36a, 36d или 36f 16C
G020K-G023A-N116L-S188D ++
N043W-N062E-N116L-S188D ++
S024F-N062E-N116L ++
N062E-N116L-S188D ++
T022A-S024R-S103A-V104I-S128I-G159D-S188D-A232V-N248D +

Пример 13 Конструирование дополнительных библиотек и вариантов GG36 Данный пример описывает очистку в холодной воде дополнительных GG36 вариантов и библиотек, сконструированных в B. subtilis. Большинство ДНК библиотек было синтезировано при DNA2.0, Inc., с использованием pHPLT-GG36 B. subtilis плазмида экспрессии. Реакции лигирования сконструированных библиотек были трансформированы в штамм В. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo после амплификации ДНК с использованием образующей окружность амплификации, как описано в Примере 33. WCE9 NHJ10 библиотека и варианты были созданы путем расширения ПЦР или мутагенеза QuickChange (см. Пример 33 для описания способов). WCE9 и NHJ10 библиотека и варианты были также созданы при помощи pHPLT-GG36 В. subtilis плазмида экспрессии. Варианты были экспрессированы в клетках B. subtilis (генотип: ΔaprE, ΔnprE, amyE::xylRPxylAcomK-phleo) как описано в Примере 31, и были дополнительно охарактеризованы при помощи BMI анализа очистки микрообразцов, как описано в ТЕСТОВОМ МЕТОДЕ 6. Эти результаты приведены в Таблицах 13-1-13-6. В приведенных ниже Таблицах, составы моющих средств («Моющ.») соответствуют приведенным в Примере 36 выше. Также, как указано, положение аминокислоты соответствует BPN' нумерации.

Таблица 13-1:
BMI чистящие характеристики WCE5 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36k или 36l
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36k или 36l, 16C
S087R-S101G-S103A-V104I-Q109R-S212P-A232V-Q245R-E271V +++
S101G-S103A-V104I-Q109R-A232V-Q245R +++
S101G-S103A-V104I-Q109R-S212P-A232V-Q245R-E271V +++
S101G-S103A-V104I-Q109R-S212P-A232V-Q245R +++
N076D-S87R-S103A-V104I-S212P-E271V +++
N076D-S103A-V104I-Q109R +++
N076D-S103A-V104I-S212P-E271V +++
N076D-S103A-V104I-Q109R-Q245R +++
N076D-S103A-V104I-S212P-Q245L-E271V +++
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
S024R-P086W-G118R +++
S024R-S078R-P086W-N243F +++
S024R-T033S-P086S-S087N-Y209A +++
T033S-G118R +++
S024R-S078R-P086W-G118R-A270T +++
S024R-T033S-P086W-G118R +++
S078R-P086W-N243F +++
T033S-S078R-P086W-G118R-Y209A +++
T033S-S078R-Y209A +++
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
P086W-G118R-N243F +++
S024R-P086W +++
S078R-P086W-K235F +++
S024R-G118R +++
S024R-P086R +++
S101G-S103A-V104I-A232V +++
S024R-T033S-S078R-P086W-G118R +++
S024R-G118R-Y209A +++
Y209A-W241R +++
T033S-P086W-N243F +++
T033S-A172V-Y209A +++
G118R-Y209A-N243F +++
S024R-P086S-S141G +++
S024R-G118R-Y209A-N243F +++
S024R-T033S-P086S-S085N-K235F +++
S024R-T033S-A133V +++
S024R-T033S-S078R-P086W +++
S024R-P086W-Y209A +++
S024R-W241R +++
T033S-G118R-N243F +++
S024R-K235F +++
S024R-S078R-P086W +++
S024R-G118R-Y209A-K235F +++
S024R-Y209A-W241R +++
T033S-G118R-W241R +++
P086W-G118R-Y209A +++
T033S-G118R-G159D-Y209A +++
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
T033S-S078R-P086W +++
S024R-P086W-N243F +++
G118R-Y209A +++
S024R-P086W-G118R-V203I +++
S078R-Y209A-K235F +++
S024R-T033S-W241R +++
S078R-G118R +++
T033S-G118R-Y209A-N243F +++
L021M-S024R-T033S +++
S024R-T033S-P086W +++
T033S-K235F +++
S078R-P086W-Y209A +++
S024R-T033S-Y209A-K235F +++
T033S-P086W-G118R +++
S024R-T033S-S078R-Y209A +++
T033S-P086W-G118R-Y209A-N243F +++
P086W-Y209A-N243F +++
P005S-S078R-G118R-W241R +++
S024R-A174T +++
T033S-Y209A-N243F +++
P086W-G118R-A133V +++
S024R-T033S-G118R +++
S024R-P086W-Y209A-K235F ++
P086W-Y209A ++
I008T-S024R ++
P086W-G118R ++
T033S-W241R ++
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
P005S-S024R-T033S-N243F ++
S024R-Y209A-S242P ++
S024R-T033S-S078R-G118R ++
S024R-T033S-A194T ++
S024R-N243F ++
S024R-Y209A ++
S024R-T033S-G118R-Y209A ++
T033S-P086W ++
S024R-T033S ++
S024R-T033S-S078R-N243F ++
P086W-N243F ++
T033S-G118D-A138V-Y209A ++
T033S-Y209A-K235F ++
S024R-P086R-G118R ++
T033S-P201S ++
S024R-P239Q ++
T033S-G118R-Y209A- ++
S078R-P086W ++
K235F-N243F ++
S024R-Y209A-K235F ++
G118R-A172V ++
H017Y-S024R-T033S-P086W ++
T033S-L148F ++
S024R-G118R-K235F ++
T033S-S078R ++
T033S-N243F ++
S024C-T033S ++
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
G118R-A194T ++
T033S-Y209A ++
G118R-Y209A-K235F ++
S024R-T033S-Y209A-N243F ++
S024R-T033S-K235F ++
S024R-T033S-G118R-K235F ++
S024R-S141G ++
S024R-T274I ++
S024R-T033S-Y209A ++
P086W-K235F +
S024R-Y209A-N243F +
V004E-T033S-S078R +
P086W-Y209A-K235F +
A015T-T033S +
T033S-P086W-S 156L-Y209A +
S024R-G118R-N243F-R269H +
Y209A-K235F +
S024R-R247H +
S024R-T033S-A228T +
S078R-K235F +
S024R-T033S-A174V-K235F +
S024R-K235F-N243F +
S024R-T033S-K235F-W241R +
S024R-T033S-A151V +
S024R-V104A +
T033S-A048T +
Q012H-V104A-G118R +
Таблица 13-2:
BMI чистящие характеристики WCE9 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36j, 36d или 36e
Последовательность относительно GG36 (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36j, 36d или 36e, 16C
G118R-K235F +
T033S-T253A +
T143A-Y209A +
S024R-T033S-N243F +
T033S-P239T +
Таблица 13-3:
BMI чистящие характеристики WCE15 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36m, 16C
G020R-S087D-S101G-S103A-V104I-A232V-Q245R +++
G020R-S101G-S103A-V104I-V150L-A232V-Q245R +++
N018R-G020R-S024R-N076D-S087D-H249R +++
N018R-G020R-S024R-N076D-V150L-H249R +++
N018R-S024R-N043R-N076D-S087D-H249R +++
N018R-S024R-N043R-N076D-V150L-H249R +++
N018R-S024R-N076D-S078R-S087D-H249R +++
N018R-S024R-N076D-S078R-V150L-H249R +++
N018R-S024R-N076D-S087D-H249R-N269R +++
N018R-S024R-N076D-S087D-S242R-H249R +++
N018R-S024R-N076D-S087D-V150L-H249R +++
N018R-S024R-N076D-V150L-H249R +++
N018R-S087D-S101G-S103A-V104I-A232V-Q245R +++
Таблица 13-3:
BMI чистящие характеристики WCE15 вариантов.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36m
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36m, 16C
N018R-S101G-S103A-V104I-V150L-A232V-Q245R +++
N018R-T022R-S024R-N076D-S087D-H249R +++
NO18R-T022R-S024R-N076D-V150L-H249R +++
N043R-S087D-S101G-S103A-V104I-A232V-Q245R-N269R +++
N043R-S101G-S103A-V104I-V150L-A232V-Q245R +++
S024R-S087D-S101G-S103A-V104I-A232V-Q245R +++
S024R-S101G-S103A-V104I-V150L-A232V-Q245R +++
S078R-S087D-S101G-S103A-V104I-A232V-Q245R +++
S078R-S101G-S103A-V104I-V150L-A232V-Q245R +++
S087D-S101G-S103A-V104I-A232V-Q245R-N269R +++
S101G-S103A-V104I-V150L-A232V-Q245R-H249R +++
S101G-S103A-V104I-V150L-A232V-Q245R-N269R +++
T022R-S087D-S101G-S103A-V104I-A232V-Q245R +++
N018R-S024R-N043D-N076D-V150L-H249R ++
N043R-S087D-S101G-S103A-V104I-A232V-Q245R ++
T022R-S101G-S103A-V104I-V150L-A232V-Q245R ++
N018R-S024R-N043D-N076D-S087D-H249R +
N018R-S024R-N076D-S087D-H249R +
N018R-S024R-N076D-V150L-S242R-H249R +
N043R-S101G-S103A-V104I-V150L-A232V-Q245R-N269R +
N076D-S101G-S103A-V104I-V150L-A232V-Q245R +
S087D-S101G-S103A-V104I-A232V-S242R-Q245R +
S101G-S103A-V104I-V150L-A232V-Q245R +
Таблица 13-4:
BMI чистящие характеристики вариантов библиотек NHJ14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36c, 16C
S024R-S101G-S103A-V104I-P129Q-A158E-S188D-L217E-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-S130A-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-S130A-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129Q-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R ++
Таблица 13-4:
BMI чистящие характеристики вариантов библиотек NHJ14.
PI= Показатель эффективности
PI> или =1,5 является +++; PI от 1,49 до 1,3=++; PI от 1,29 до 1,1=+ в моющем средстве Примера 36c
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36c, 16С
S024R-K027R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
Таблица 13-5:
BMI чистящие характеристики NHJ10 вариантов.
PI= Показатель эффективности
PI> или =1,3 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36a
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ. Моющее средство Примера 36a, 16С
S 101 G-S 103A-V 104I-A232V-M222Q-Q245R +++
S 101 G-S 103A-V 104I-A158E-S 188D-M222S-A232V-Q245R-N248D-H249R +++
S 101 G-S 103A-V 104I-A 15 8E-S 188D-M222Q-A232V-Q245R-N248D-H249R +++
N076D-S 101 G-S 103A-V 104I-A232V-M222Q-Q245R +++
S 101 G-S 103A-V 104I-A232V-M222S-Q245R ++
N076D-S 101 G-S 103A-V 104I-A232V-M222S-Q245R ++
N076D-S 101 G-S 103A-V 104I-A158E-S 188D-M222S-A232V-Q245R-N248D-H249R +
Таблица 13-6:
BMI чистящие характеристики NHJ10 вариантов.
PI= Показатель эффективности
PI> или =1,3 является +++; PI от 1,29 до 1,2=++; PI от 1,19 до 1,1=+ в моющем средстве Примера 36f
Последовательность GG36 вариантов (BPN' нумерация) PI относительно GG36; BMI анализ, Моющее средство Примера 36f, 16C
S024R-S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R +++
S101G-S103A-V104I-S130A-A158E-S188D-A232V-Q245R-N248D-H249R +++
S024R-S101G-S103A-V104I-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-S130A-A158E-N183D-S188D-L217E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-S188D-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-P129Q-A158E-S188D-L217E-A232V-Q245R-N248D-H249R ++
S101G-S103A-V104I-S128L-S130A-A158E-S188D-L217E-A232V-Q245R-N248D-H249R ++
S024R-S101G-S103A-V104I-S128L-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +
S024R-S101G-S103A-V104I-S128L-P129Q-S130A-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +
S024R-S101G-S103A-V104I-S128L-P129Q-A158E-S188D-A232V-Q245R-N248D-H249R-E271G +
S101G-S103A-V104I-P129Q-A158E-N183D-S188D-A232V-Q245R-N248D-H249R +

Размеры и значения, описанные в данной заявке, не должны быть истолкованы как строго ограниченные точными численными указанными значениями. Вместо этого, если не указано иное, каждый такой размер предназначен для обозначения как указанного значения, так и функционально эквивалентного диапазона вокруг данного значения. Например, размер, описанный как «40 мм» предназначен для обозначения «приблизительно 40 мм».

1. Способ обработки и/или очистки поверхности, предпочтительно поверхности ткани, включающий стадии, на которых
(i) вводят в контакт указанную поверхность с составом в водном промывном растворе,
при этом указанный состав содержит вспомогательный материал и вариант протеазы, причем указанный вариант протеазы представляет собой вариант родительской протеазы, причем последовательность указанной родительской протеазы на, по меньшей мере, 90% идентична аминокислотной последовательности SEQ ID NO: 1, при этом аминокислотные положения указанного варианта протеазы пронумерованы в соответствии с нумерацией соответствующих аминокислотных положений в аминокислотной последовательности Bacillus amyloliquefaciens субтилизина BPN′, показанной в SEQ ID NO: 2,
при этом указанный вариант протеазы содержит мутацию T022R; и (и) промывают и/или высушивают поверхность, при этом предпочтительно температура водного промывного раствора составляет 5-30°С.

2. Способ по п. 1, отличающийся тем, что температура водного промывного раствора составляет 5-25°С.

3. Способ по п. 1 или 2, отличающийся тем, что указанный вариант протеазы имеет, по меньшей мере, одну, или даже две или более несущих заряд мутаций, выбранных из группы, состоящей из N062E, S101D, Р129Е, А158Е, G159D/E, S166D и/или S188D, и при этом предпочтительно имеет заряд 0, -1, -2, -3, -4 или -5, предпочтительно 0, -1, -2 или -3, наиболее предпочтительно -1 или -2 относительно фермента SEQ ID NO: 1.

4. Способ по п. 1 или 2, отличающийся тем, что указанный вариант протеазы имеет одну или две или более несущих заряд мутаций, выбранных из группы, состоящей из N018R, G020K/R, S024R, N043R, Q245R, H249R и/или N269R, и при этом предпочтительно имеет заряд 0, +1, +2, +3, +4 или +5, предпочтительно +1, +2 или +3, наиболее предпочтительно +2 относительно фермента SEQ ID NO: 1.

5. Способ по п. 1 или 2, отличающийся тем, что указанный промывной раствор моющего средства для стирки имеет проводимость от 0,1 мСм/см до 3 мСм/см, от 0,3 мСм/см до 2,5 мСм/см, или от 0,5 мСм/см до 2 мСм/см.

6. Способ по п. 1 или 2, отличающийся тем, что указанный промывной раствор имеет проводимость от более, чем 3 мСм/см до 30 мСм/см, от 3,5 мСм/см до 20 мСм/см или от 4 мСм/см до 10 мСм/см.

7. Способ по п. 1 или 2, отличающийся тем, что указанный вспомогательный материал содержит одно или более вещество, выбранное из:
a. инкапсулята, содержащего отдушку, при этом указанный инкапсулят предпочтительно содержит микрокапсулу отдушки;
b. оттеночного агента, предпочтительно содержащего материал, выбранный из группы, состоящей из основных, кислотных, гидрофобных, прямых и полимерных красителей, и конъюгатов красителей, имеющих длину волны пика поглощения от 550 нм до 650 нм и их смесей;
c. моющего поверхностно-активного вещества, предпочтительно содержащего материал, выбранный из группы, состоящей из анионных моющих поверхностно-активных веществ, неионного моющего поверхностно-активного вещества, катионных моющих поверхностно-активных веществ, цвиттерионных моющих поверхностно-активных веществ и амфотерных моющих поверхностно-активных веществ и их смесей;
d. структурообразователя, предпочтительно содержащего материал, выбранный из группы, состоящей из цеолитов, фосфатов и их смесей;
e. силикатной соли, предпочтительно содержащей материал, выбранный из группы, состоящей из силиката натрия, силиката калия и их смесей;
f. осветлителя, содержащего материал, выбранный из группы, состоящей из растворимых в холодной воде осветлителей и их смесей;
g. карбоксилатного полимера, предпочтительно содержащего материал, выбранный из группы, состоящей из малеатного/акрилатного статистического сополимера или полиакрилатного гомополимера и их смесей;
h. полимера, высвобождающего загрязнения, предпочтительно содержащего материал, выбранный из группы, состоящей из терефталатных сополимеров и их смесей;
i. целлюлозного полимера, предпочтительно содержащего материал, выбранный из группы, состоящей из алкилцеллюлозы, алкилалкоксиалкилцеллюлозы, карбоксиалкилцеллюлозы, алкилкарбоксиалкилцеллюлозы и их смесей;
j. катализатора отбеливания, предпочтительно содержащего материал, выбранный из группы, состоящей из иминий катионов, иминий полиионов; иминий цвиттерионов; модифицированных аминов; модифицированных аминоксидов; N-сульфонилиминов; N-фосфонилиминов; N-ацилиминов; тиадиазолдиоксидов; перфториминов; циклических сахарных кетонов и катализаторов переходных металлов или лигандов для их образования, или их смесей;
k. активатора отбеливания предпочтительно содержащего материал, выбранный из группы, состоящей из додеканоилоксибензолсульфоната, деканоилоксибензолсульфоната, деканоилоксибензойной кислоты или ее солей, 3,5,5-триметилгексаноилоксибензолсульфоната, тетраацетилэтилендиамина (TAED), нонаноилоксибензолсульфоната (NOBS) и их смесей;
l. источника перекиси водорода, предпочтительно содержащего материал, выбранный из группы, состоящей из неорганических пергидратных солей, включая соли щелочных металлов, такие как натриевые соли пербората (обычно моно- или тетрагидрата), перкарбоната, персульфата, перфосфата, персиликатные соли и их смеси;
m. хелатирующего агента, предпочтительно содержащего материал, выбранный из группы, состоящей из DTPA (диэтилентриаминпентауксусной кислоты), HEDP (гидроксиэтандифосфониевой кислоты), DTPMP (диэтилентриаминпента(метиленфосфониевой кислоты)), этилендиаминдиянтарной кислоты (EDDS), 1,2-дигидроксибензол-3,5-дисульфоновой кислоты динатриевой соли гидрата, производных указанных хелатирующих агентов;
n. дополнительного фермента, выбранного из группы, состоящей из: (а) липаз первого промывания; (b) бактериальных чистящих целлюлаз; (с) альфа-амилаз; и (d) их смесей; и
о. их смесей.

8. Способ по п. 1 или 2, отличающийся тем, что указанный состав является разовой дозой с одним или множеством отделений, предпочтительно разовой дозой со множеством отделений, причем вариант протеазы предпочтительно находится в 4
отделении, не содержащем какой-либо источник перекиси водорода и/или хелатирующий агент.

9. Способ по п. 1 или 2, отличающийся тем, что водный промывной раствор содержит от 0,1 г/л до 3 г/л поверхностно-активного вещества.



 

Похожие патенты:

Изобретение относится к области биохимии. Представлено применение модифицированной протеазы в качестве средства для повышения стабильности при хранении амилазы в жидком моющем или чистящем средстве, включающем амилазу и протеазу.

Изобретение относится к области микробиологии и касается применения штамма Bacillus cereus ГИСК №279 в качестве продуцента ингибитора цитокина ФНО-α. Штамм выделен из испражнений пациента с дисбактериозом кишечника и депонирован в Коллекции Государственного научно-исследовательского института стандартизации и контроля медицинских биологических препаратов им.

Изобретение относится к биотехнологии и представляет собой вариант субтилизина для применения в очистке, представляющий собой последовательность аминокислот, указанную в SEQ ID NO: 5.

Изобретение относится к биотехнологии и представляет собой выделенный вариант субтилизина Bacillus. Изобретение относится также к выделенной нуклеиновой кислоте, кодирующей вариант субтилизина, вектору экспрессии, содержащему нуклеиновую кислоту, клетке-хозяину, способной экспрессировать вариант субтилизина, а также к чистящей композиции, содержащей вариант субтилизина и способу очистки.

Настоящее изобретение относится к биохимии и представляет собой детергентную композицию, которая включает вариант субтилизина, имеющий аминокислотную последовательность, которая приведена в SEQ ID NO 1, и по меньшей мере один дополнительный ингредиент, выбранный из: i) средств для отбеливания, которые выбраны из перкарбонатов, персульфатов и органических надкислот, ii) аминокарбоксилатов, или iii) сульфированных полимеров, или iv) фосфорорганических кислот или их солей и их смесей.

Изобретение относится к биотехнологии и представляет собой варианты субтилизина, сохраняющие его активность. Изобретение относится также к чистящей композиции, содержащей вариант субтилизина, и к способу очистки поверхности и/или изделия, включающего ткань, с помощью указанной композиции.

Группа изобретений относится к биотехнологии. Предложен вариант термолизина, обладающий повышенной эффективностью по сравнению с термолизином дикого типа.

Изобретение относится к области биотехнологии и касается способа мытья посуды. Охарактеризованный способ заключается в обеспечении композиции для мытья посуды и посуды, нуждающейся в очистке, приведении указанной посуды в контакт с указанной композицией для мытья посуды при условиях, эффективно обеспечивающих очистку указанной посуды, где указанная композиция для мытья посуды содержит модифицированный субтилизин, где указанный модифицированный субтилизин, по меньшей мере, на 70% гомологичен последовательности AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR и содержит (i) замену G116V и, по меньшей мере, одну дополнительную мутацию или (ii) замену S126R.

Изобретение относится к биотехнологии и представляет собой выделенный модифицированный полинуклеотид, кодирующий модифицированную полноразмерную протеазу. При этом часть указанного модифицированного полинуклеотида, которая кодирует про-участок указанной полноразмерной протеазы, содержит мутацию, кодирующую замену в одном аминокислотном положении, выбранном из положений, эквивалентных аминокислотным положениям 28-108 и 109 SEQ ID NO:5, 13 или 244, где указанный полинуклеотид имеет нуклеотидную последовательность, идентичную, по меньшей мере, приблизительно на 95% полинуклеотидной последовательности SEQ ID NО:4, 12 или 243 с учетом вырожденности генетического кода, где указанная модифицированная полноразмерная протеаза представляет собой сериновую протеазу, где указанная модифицированная полноразмерная протеаза представляет собой щелочную сериновую протеазу, полученную из предшественника щелочной сериновой протеазы дикого типа, где указанный предшественник щелочной сериновой протеазы представляет собой щелочную сериновую протеазу В.

Изобретение относится к области биотехнологии. .

Настоящее изобретение относится к жидкой моющей композиции для текстильных изделий. Описана жидкая моющая композиция, содержащая неионное поверхностно-активное вещество (А), катионное поверхностно-активное вещество (В) и пероксид водорода (D) в пределах определенных интервалов и воду, где компонент (А) содержит неионное соединение (А1), представленное формулой (А1) в количестве от 0,5 до 10% масс.

Изобретение относится к композиции для отбеливания пятен или загрязнений на текстильных материалах. Композиция содержит H2O2 или предшественник H2O2 и от 0,00001 до 1% мас., в пересчете на общую массу композиции, соединения формулы (1).

Изобретение относится к композиции для отбеливания пятен или загрязнений на текстильных материалах. Композиция содержит H2O2 или предшественник H2O2 и от 0,00001 до 1% мас., в пересчете на общую массу композиции, соединения формулы (1).

Изобретение относится к частицам перкарбоната натрия с покрытием, которые могут использоваться в качестве отбеливающего компонента в композициях моющих средств для бытовой стирки тканей или мойки посуды.

Изобретение относится к применению композиции, содержащей Н2О2, предшественник Н2О2 или надкислоту, и соединение формулы (1) или (2) для отбеливания пятен или загрязнения текстильных материалов в контексте процесса очистки или путем непосредственного нанесения пятновыводителя при pH, равном от 7 до 11.

Изобретение относится к применению композиции, содержащей Н2О2, предшественник Н2О2 или надкислоту, и соединение формулы (1) или (2) для отбеливания пятен или загрязнения текстильных материалов в контексте процесса очистки или путем непосредственного нанесения пятновыводителя при pH, равном от 7 до 11.

Изобретение относится к изделию для стирки со стандартной дозой моющего средства, содержащему: a) поверхностно-активное вещество, выбранное из анионного, неионного поверхностно-активного вещества и их смесей; и b) отбеливающую систему, содержащую: (i) органический катализатор отбеливания, состоящий из арилиминий иона, выбранного из группы, состоящей из цвиттерионов; и (ii) источник активированного пероксигена, выбранный из группы, состоящей из: предварительно сформированной перкислоты; источника перекиси водорода; и их смесей; заключенное в водорастворимую или диспергируемую пленку, при этом, по меньшей мере, приблизительно 50% по массе анионного и/или неионного поверхностно-активного вещества и, по меньшей мере, приблизительно 50% по массе арилиминий ионов содержатся в, по меньшей мере, одной жидкой композиции, при этом арилиминий ион является цвиттерионом, имеющим структуру, выбранную из группы, состоящей из а) где: в (1) (i) R1 выбран из группы, состоящей из: 2-пропилгептила, 2-бутилоктила, 2-пентилнонила, 2-гексилдецила, н-гексила, н-октила, н-децила, н-додецила, н-тетрадецила, н-гексадецила, н-октадецила, изо-нонила, изо-децила, изо-тридецила и изо-пентадецила; (ii) R2 независимо выбран из группы, состоящей из: Н, разветвленной алкильной группы, содержащей от 3 до 12 атомов углерода, и линейной алкильной группы, содержащей от 1 до 12 атомов углерода; предпочтительно R2 независимо выбран из Н и метальных групп; (iii) n означает целое число от 0 до 1; b) 3-(3,4-дигидроизохинолиний)пропансульфоната; с) и их смесей.

Изобретение относится к моющей композиции для обработки керамической поверхности, содержащей (a) по меньшей мере один усилитель адгезии, выбранный из полиэтиленгликоля, целлюлозы, полисахаридов, полиакрилатов, поливиниловых спиртов, поливинилпирролидонов или полиалкоксиалканов и присутствующий в количестве от 18 до 80 масс.

Изобретение относится к отбеливанию субстратов. Описан способ обработки субстрата путем приведения субстрата в контакт с водной средой, содержащей по меньшей мере 1% воды и от 1 до 1500 мМ перекиси водорода для образования среды.
Изобретение относится к частице отбеливателя, имеющей а) сердцевину, содержащую более 70 мас.% перкарбоната натрия, б) внутреннюю оболочку, содержащую сульфат натрия в виде тенардита или буркеита в количестве по меньшей мере 50 мас.%, и в) наружную оболочку, содержащую водорастворимое связующее и по меньшей мере один активатор отбеливания, выбранный из способных к пергидролизу N-ацильных и О-ацильных соединений.

Изобретение относится к области биохимии. Предложено устройство для размещения чипа биосенсора для осуществления способа восстановления чувствительной поверхности чипа биосенсора путем обработки его восстанавливающим раствором.
Наверх