Гуманизированные антитела, которые распознают альфа-синуклеин



Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
Гуманизированные антитела, которые распознают альфа-синуклеин
C07K2317/64 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2642262:

ПРОТЕНА БИОСАЙЕНСИС ЛИМИТЕД (IE)

Изобретение относится к биотехнологии. Описано антитело, содержащее зрелую вариабельную область тяжелой цепи, содержащую три CDR по Кабату (Kabat), из последовательности SEQ ID NO: 44, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 44, и легкую цепь, содержащую три CDR по Кабату, из последовательности SEQ ID NO: 45, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 45, где антитело специфически связывается с человеческим альфа-синуклеином. Также описана фармацевтическая композиция, содержащая описанное антитело. Представлен способ лечения пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания или способ обнаружения телец Леви у пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания, содержащий назначение пациенту эффективной схемы введения описанного антитела. Изобретение обеспечивает антитела которые связываются с человеческим альфа-синуклеином и могут применяться для лечения и диагностики болезни с тельцами Леви. 7 н. и 73 з.п. ф-лы, 6 ил., 5 табл., 2 пр.

 

[0001] Для настоящей заявки испрашивается приоритет по предварительной заявке на патент США №61/591835, поданной 27 января 2012, и предварительной заявке на патент США №61/711207, поданной 8 октября 2012, которые включены сюда посредством ссылки во всей их полноте для всех целей.

УРОВЕНЬ ТЕХНИКИ

[0002] Синуклеинопатии, включая болезни с тельцами Леви (Lewy body diseases (LBD)), характеризуются дегенерацией дофаминергической системы, моторными изменениями, когнитивными нарушениями и образованием телец Леви (LB) и/или нейритов Леви. (McKeith et al., Neurology (1996) 47:1113-24). Синуклеинопатии включают болезнь Паркинсона (включая идиопатическую болезнь Паркинсона), болезнь диффузных телец Леви (Lewy Body Disease (DLBD)), также известную как деменция с тельцами Леви (Dementia with Lewy Bodies (DLB)), вариант болезни Альцгеймера с образованием телец Леви (Lewy body variant (LBV)), объединенные болезнь Альцгеймера и болезнь Паркинсона (Parkinson disease (PD)), чисто вегетативную недостаточность и синдром Шая - Дрейджера (Shy-Drager); например, оливопонтоцеребральную атрофию, стриатонигральную дегенерацию и синдром Шая - Дрейджера. Некоторые немоторные признаки и симптомы, как полагают, являются предвестниками синуклеинопатий в продромальной фазе заболевания (т.е., пресимптоматичический, субклинический, доклинический или премоторный период). Такие ранние признаки включают в себя, например, нарушения поведения во время REM-сна (sleep behavior disorder (RBD)), потерю обоняния и запоры (Mahowald et al., Neurology (2010) 75:488-489). Заболевания, сопровождающиеся образованием телец Леви, часто являются причиной двигательных нарушений и когнитивных расстройств у пожилых людей (Galasko et al., Arch. Neurol. (1994) 51:888-95).

[0003] Альфа-синуклеин относится к большому семейству белков, включая бета- и гамма-синуклеин и синоретин. Альфа-синуклеин экспрессируется в норме в синапсе и, как считается, отвечает за нервную пластичность, обучение и память. Некоторые исследования показали, что центральную роль в патогенезе PD играет синаптический белок альфа-синуклеин. Белок может агрегировать с образованием нерастворимых фибрилл в патологических условиях. Например, синуклеин откладывается в LB (Spillantini et al., Nature (1997) 388:839-40; Takeda et al., J. Pathol. (1998) 152:367-72; Wakabayashi et al., Neurosci. Lett. (1997) 239:45-8). Мутации в гене альфа-SN ассоциированы с редкими семейными формами паркинсонизма (Kruger et al., Nature Gen. (1998) 18:106-8; Polymeropoulos, et al., Science (1997) 276:2045-7). Гиперэкспрессия синуклеина у трансгенных мышей (Masliah et al., Science (2000) 287:1265-9) и у мух вида Drosophila (Feany et al., Nature (2000) 404:394-8) имитирует некоторые патологические аспекты болезни с тельцами Леви. Кроме того, было высказано предположение, что растворимые олигомеры синуклеина могут быть нейротоксическими (Conway et al., Proc. Natl. Acad. Sci. USA (2000) 97:571-576; Volles et al., J. Biochemistry (2003) 42:7871-7878). Накопление альфа-синуклеина с одинаковыми морфологическими и неврологическими изменениями у различных видов животных, таких как люди, мыши и мухи, позволяет сделать предположение о том, что именно данная молекула способствует развитию болезни с тельцами Леви.

СУЩНОСТЬ ЗАЯВЛЕННОГО ИЗОБРЕТЕНИЯ

[0004] Настоящее изобретение относится к антителам, содержащим зрелую вариабельную область тяжелой цепи, содержащую три определяющие комплементарность области (Complementarity Determing Region (CDR)), положение и длина которых определены в соответствии со схемой Кабата (Kabat), из SEQ ID NO:44, и по меньшей мере на 90% идентичную SEQ ID NO:44, и легкую цепь, содержащую три CDR, положение и длина которых определены в соответствии со схемой Kabat, из SEQ ID NO:45, и по меньшей мере на 90% идентичную SEQ ID NO:45. В некоторых антителах зрелая вариабельная область тяжелой цепи по меньшей мере на 95%, 96%, 97%, 98% или 99% идентична SEQ ID NO:44 и зрелая вариабельная область легкой цепи по меньшей мере на 95%, 96%, 97%, 98% или 99% идентична SEQ ID NO:45. В некоторых антителах положение L46 (система нумерации по Кабату) может быть занято F; положение L49 (система нумерации по Кабату) может быть занято С; положение L83 (система нумерации по Кабату) может быть занято А; положение Н11 (система нумерации по Кабату) может быть занято L; положение Н28 (система нумерации по Кабату) может быть занято S; положение Н38 (система нумерации по Кабату) может быть занято К; положение Н48 (система нумерации по Кабату) может быть занято I; положение Н67 (система нумерации по Кабату) может быть занято А; положение Н69 (система нумерации по Кабату) может быть занято L; положение Н71 (система нумерации по Кабату) может быть занято А; и/или положение Н91 (система нумерации по Кабату) может быть занято F. В некоторых из таких антител положение Н97 (система нумерации по Кабату) может быть занято S. В некоторых из таких антител аминокислотная последовательность зрелой вариабельной области тяжелой цепи представляет собой SEQ ID NO:44 и аминокислотная последовательность зрелой вариабельной области легкой цепи представляет собой SEQ ID NO:45, за исключением условия, что положение L46 (система нумерации по Кабату) может быть занято L или F, и/или положение L49 (система нумерации по Кабату) может быть занято Y или С, и/или положение L83 (система нумерации по Кабату) может быть занято F или А, и/или положение Н11 (система нумерации по Кабату) может быть занято V или L, и/или положение Н28 (система нумерации по Кабату) может быть занято Т или S, и/или положение Н38 (система нумерации по Кабату) может быть занято R или К, и/или положение Н48 (система нумерации по Кабату) может быть занято М или I, и/или положение Н67 (система нумерации по Кабату) может быть занято V или А, и/или положение Н69 (система нумерации по Кабату) может быть занято М или L, и/или положение Н71 (система нумерации по Кабату) может быть занято Т или А, и/или положение Н91 (система нумерации по Кабату) может быть занято Y или F, и/или Н97 (система нумерации по Кабату) может быть занято Cor S. В некоторых из таких антител положение Н71 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение Н67 (система нумерации по Кабату) занимает А, положение Н71 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y. В некоторых из таких антител положение Н67 (система нумерации по Кабату) занимает А, положение Н71 (система нумерации по Кабату) занимает А, положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение Н11 (система нумерации по Кабату) занимает L и положение Н38 (нумерация Kabat) занимает К. В некоторых из таких антител положение Н11 (система нумерации по Кабату) занимает V и положение Н38 (система нумерации по Кабату) занимает R. В некоторых из таких антител положение Н28 (система нумерации по Кабату) занимает S, положение Н48 (система нумерации по Кабату) занимает I, положение Н69 (система нумерации по Кабату) занимает L, положение Н91 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М, положение Н91 (система нумерации по Кабату) занимает Y. В некоторых из таких антител положение L83 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н97 (система нумерации по Кабату) занимает S. В некоторых из таких антител положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С и положение L83 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С и положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н11 (система нумерации по Кабату) занимает L, положение Н28 (система нумерации по Кабату) занимает S, должность Н38 (система нумерации по Кабату) занимает К, положение Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает S, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение H11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и положение Н97 (нумерация Kabat) занимает С. В некоторых из таких антител положение H11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает S, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает S. В некоторых из таких антител положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и положение Н97 (система нумерации по Кабату) занимает S. В некоторых из таких антител аминокислотная последовательность зрелой вариабельной области тяжелой цепи является иной, чем SEQ ID NO:44, и аминокислотная последовательность зрелой вариабельной области легкой цепи является иной, чем SEQ ID NO:45.

[0005] Настоящее изобретение дополнительно относится к антителу, содержащему гуманизированную тяжелую цепь, содержащую три CDR, положение и длина которых определены в соответствии со схемой Кабата, из SEQ ID NO:44, и гуманизированную легкую цепь, содержащую три CDR из SEQ ID NO:45, при условии, что положение L46 (система нумерации по Кабату) занимает F, и/или положение L49 (система нумерации по Кабату) занимает С, и/или положение L83 (система нумерации по Кабату) занимает F, и/или положение Н11 (система нумерации по Кабату) занимает V, и/или положение Н28 (система нумерации по Кабату) занимает Т, и/или положение Н38 (система нумерации по Кабату) занимает R, и/или положение Н48 (система нумерации по Кабату) занимает М, и/или положение Н67 (система нумерации по Кабату) занимает А, и/или положение Н69 (система нумерации по Кабату) занимает М, и/или положение Н71 (система нумерации по Кабату) занимает А, и/или положение Н91 (система нумерации по Кабату) занимает Y, и/или положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение Н67 (система нумерации по Кабату) занимает А и положение Н71 (система нумерации по Кабату) занимает А. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение Н67 (система нумерации по Кабату) занимает А, положение Н71 (система нумерации по Кабату) занимает А и положение L49 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение H11 (система нумерации по Кабату) занимает V и положение Н38 (система нумерации по Кабату) занимает R. В некоторых из таких антител положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М и положение Н91 (система нумерации по Кабату) занимает Y. В некоторых из таких антител положение L49 (система нумерации по Кабату) занимает С и положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М, положение Н91 (система нумерации по Кабату) занимает Y, положение L49 (система нумерации по Кабату) занимает С и положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С, положение L83 (система нумерации по Кабату) занимает F, положение H11 (система нумерации по Кабату) занимает V, Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и Н97 (система нумерации по Кабату) занимает С.

[0006] Настоящее изобретение дополнительно относится к антителу, содержащему зрелую вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, которая по меньшей мере на 90% идентична SEQ ID NO:23, и зрелую вариабельную область легкой цепи, которая по меньшей мере на 90% идентична SEQ ID NO:37. В некоторых из таких антител зрелая вариабельная область тяжелой цепи содержит три CDR, положение и длина которых определены в соответствии со схемой, из SEQ ID NO:23, и зрелая вариабельная область легкой цепи содержит три CDR, положение и длина которых определены в соответствии со схемой Кабата, из SEQ ID NO:37, и положение Н67 (система нумерации по Кабату) занимает А, Н71 (система нумерации по Кабату) занимает А, положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител последовательность зрелой тяжелой цепи идентична по меньшей мере на 95% последовательности SEQ ID NO:23 и последовательность зрелой легкой цепи идентична по меньшей мере на 95% последовательности SEQ ID NO:37. В некоторых из таких антител любые различия в областях CDR зрелой вариабельной области тяжелой цепи и зрелой вариабельной области легкой цепи из последовательностей SEQ ID NO:52 и SEQ ID NO:60, соответственно, находятся в положениях от Н60 до Н65. У некоторых из таких антител величина KD (константа диссоциации), характерная для антитела и альфа-синуклеина, превышает в от около 0,5 раз до 2 раз величину KD, характерную для мышиного или химерного антитела 1Н7 и альфа-синуклеина. В некоторых из таких антител положение L83 (система нумерации по Кабату) занимает F или А, положение H11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител положение L83 (система нумерации по Кабату) занимает F. В некоторых из таких антител положение Н97 (система нумерации по Кабату) занимает С. В некоторых из таких антител любое различие между каркасным участком вариабельной области зрелой вариабельной области тяжелой цепи и последовательностью SEQ ID NO:23 представляет собой одно или более из положения Н11 (система нумерации по Кабату), занимаемого V, положения Н28 (система нумерации по Кабату), занимаемого Т, положения Н38 (система нумерации по Кабату), занимаемого R, положения Н48 (система нумерации по Кабату), занимаемого М, положения Н69 (система нумерации по Кабату), занимаемого М, и положения Н91 (система нумерации по Кабату), занимаемого Y. В некоторых из таких антител любое различие между каркасным участком вариабельной области зрелой вариабельной области легкой цепи и последовательностью SEQ ID NO:37 заключается в том, что положение L83 (система нумерации по Кабату) занимает F или А. В некоторых из таких антител зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:23, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:37.

[0007] В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:19, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:21, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:23, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:25, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:27, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:45, 33, 35, 37 или 39.

[0008] В любом из упомянутых выше антител зрелая вариабельная область тяжелой цепи может быть слита с константной областью тяжелой цепи и зрелая константная область легкой цепи может быть слита с константной областью легкой цепи.

[0009] В любом из упомянутых выше антител константная область тяжелой цепи может представлять собой мутантную форму природной константной области человека, которая хуже связывается с рецептором Fcγ по сравнению с природной константной областью человека.

[0010] В любом из упомянутых выше антител константная область тяжелой цепи может представлять собой изотип IgG1 человека. В некоторых антителах аллотип представляет собой G1m3. В некоторых антителах аллотип представляет собой G1m1.

[0011] В некоторых антителах константная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:52, при условии, что С-концевой остаток лизина может быть опущен. В некоторых антителах константная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:49. В некоторых антителах зрелая вариабельная область тяжелой цепи слита с константной областью тяжелой цепи, имеющей аминокислотную последовательность, определенную последовательностью SEQ ID NO:52, при условии, что С-концевой остаток лизина может быть опущен, и зрелая константная область легкой цепи слита с константной областью легкой цепи, имеющей аминокислотную последовательность, определенную последовательностью SEQ ID NO:49. В некоторых антителах зрелая легкая цепь содержит последовательность SEQ ID NO:53 и зрелая тяжелая цепь содержит последовательность SEQ ID NO:56.

[0012] Настоящее изобретение дополнительно относится к нуклеиновой кислоте, кодирующей любую из вышеупомянутых зрелых вариабельных областей тяжелой цепи и/или любую из вышеупомянутых зрелых вариабельных областей зрелой легкой цепи, например, SEQ ID NO:18, 20, 22, 24, 26, 32, 34, 36 или 38.

[0013] Настоящее изобретение дополнительно относится к клетке-хозяину, содержащей вектор, содержащий любую из нуклеиновых кислот, описанных выше.

[0014] Настоящее изобретение дополнительно относится к фармацевтической композиции, содержащей любое из вышеуказанных антител.

[0015] Настоящее изобретение дополнительно относится к способу лечения пациента с болезнью телец Леви или имеющего риск развития данного заболевания, включающему эффективную схему введения пациенту любого из вышеуказанных антител. Согласно некоторым способам, болезнь представляет собой болезнь Паркинсона. Согласно некоторым способам, у пациента подавляется снижение когнитивной функции. Согласно некоторым способам, уменьшаются агрегаты альфа-синуклеина в нейритных бляшках и/или в аксонах. Согласно некоторым способам, у пациента уменьшается нейритная дистрофия. Согласно некоторым способам, сохраняется синаптическая и/или дендритная плотность. Согласно некоторым способам, способ сохраняет у пациента синаптофизин и/или МАР2.

[0016] Настоящее изобретение дополнительно относится к способу уменьшения образования телец Леви у пациента с болезнью телец Леви или имеющего риск развития данного заболевания, включающему введение пациенту эффективного количества любого из вышеупомянутых антител. Согласно некоторым способам, болезнь представляет собой болезнь Паркинсона. Согласно некоторым способам, у пациента подавляется снижение когнитивной функции. Согласно некоторым способам, агрегаты альфа-синуклеина в нейритных бляшках и/или в аксонах уменьшаются. Согласно некоторым способам, у пациента уменьшается нейритная дистрофия. Согласно некоторым способам, сохраняется синаптическая и/или дендритная плотность. Согласно некоторым способам, способ сохраняет у пациента синаптофизин и/или МАР2.

[0017] Настоящее изобретение дополнительно относится к способу ингибирования агрегации синуклеина или растворения телец Леви или агрегатов синуклеина у пациента с болезнью телец Леви или имеющего риск развития данного заболевания, включающему введение пациенту эффективного количества любого из вышеупомянутых антител. Согласно некоторым способам, болезнь представляет собой болезнь Паркинсона. Согласно некоторым способам, у пациента подавляется снижение когнитивной функции. Согласно некоторым способам, агрегаты альфа-синуклеина в нейритных бляшках и/или в аксонах уменьшаются. Согласно некоторым способам, у пациента уменьшается нейритная дистрофия. Согласно некоторым способам, сохраняется синаптическая и/или дендритная плотность. Согласно некоторым способам, способ сохраняет у пациента синаптофизин и/или МАР2.

[0018] Настоящее изобретение дополнительно относится к способам определения телец Леви у больного с болезнью телец Леви или имеющего риск развития данного заболевания, включающим введение пациенту эффективного количества любого из вышеупомянутых антител, причем антитело связывается с тельцами Леви и связанное антитело обнаруживают. Согласно некоторым способам, болезнь представляет собой болезнь Паркинсона. Согласно некоторым способам, антитело метят.

[0019] Настоящее изобретение дополнительно относится к способу получения антитела, включающему культивирование клеток, трансформированных нуклеиновыми кислотами, кодирующими тяжелые и легкие цепи антитела, так что клетка секретирует антитело; и очистку антитела из среды для культивирования клеток; причем антитело представляет собой любое из антител, описанных выше.

[0020] Настоящее изобретение дополнительно относится к способу получения клеточной линии, продуцирующей антитело, включающему введение вектора, кодирующего тяжелые и легкие цепи антитела, и селектируемого маркера в клетки; разращивание клеток в условиях для отбора клеток, имеющих повышенное количество копий вектора; отделение отдельных клеток от отобранной клетки; и сохранение клеток, клонированных из одной клетки, отобранной на основе выхода антитела; где антитело представляет собой любое из антител, описанных выше. Некоторые из таких способов дополнительно содержат разращивание клеток в селективных условиях и скрининг с целью отбора клеточных линий, экспрессирующих в природных условиях и секретирующих по меньшей мере 100 мг/л/106 клеток/24 часа.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

[0021] На фиг. 1 показано выравнивание аминокислотных последовательностей m1H7 с четырьмя вариантами зрелой вариабельной области гуманизированной тяжелой цепи 1Н7. ВАС02037 (SEQ ID NO:42) представляет собой последовательность акцептора VH человека. Последовательности CDR, определенные по Кабату, подчеркнуты и выделены жирным шрифтом.

[0022] На фиг. 2 показано выравнивание аминокислотных последовательностей m1H7 с четырьмя вариантами зрелой вариабельной области гуманизированной легкой цепи 1Н7. AAY33358 (SEQ ID NO:43) представляет собой последовательность акцептора VL человека. Последовательности CDR, определенные по Кабату, подчеркнуты и выделены жирным шрифтом.

[0023] На фиг. 3 А-С приведен кинетический анализ Biacore связывания мышиного 1Н7 (а), химерного 1Н7 (В) и гуманизированного 1Н7 Hu1H7VHv3-Hu1H7VLv3, соответственно.

[0024] На фиг. 4 А-С приведены кинетические параметры связывания (ForteBio) для гуманизированного 1Н7 (Hu1H7VHv2-Hu1H7VLv4, Hu1H7VHv3-Hu1H7VLv1, Hu1H7VHv3-Hu1H7VLv2, Hu1H7VHv3-Hu1H7VLv3, Hu1H7VHv3-Hu1H7VLv4, Hu1H7VHv4-Hu1H7VLv1) и химерного 1H7.

[0025] На фиг. 5 показаны результаты воздействия пассивной иммунотерапии с 1Н7 на производительность памяти в тесте с водным лабиринтом Морриса.

[0026] На фиг. 6 показаны результаты воздействия пассивной иммунотерапии с 1Н7 на скорость и ошибки в тесте с круглой балкой.

КРАТКОЕ ОПИСАНИЕ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

[0027] SEQ ID NO:1 представляет собой природную аминокислотную последовательность человеческого альфа-синуклеина дикого типа.

[0028] SEQ ID NO:2 представляет собой домен неамилоидного компонента (non-amyloid component (NAC)) альфа-синуклеина, по сообщению Jensen et al. (Biochem. J. 310 (Pt 1): 91-94, 1995; GenBank, номер доступа S56746).

[0029] SEQ ID NO:3 представляет собой домен неамилоидного компонента (NAC) альфа-синуклеина, по сообщению Uéda et al. (Proc. Natl. Acad. Sci. USA, 90:11282-6, 1993).

[0030] SEQ ID NO:4 представляет собой вариабельную нуклеотидную последовательность тяжелой цепи мышиного антитела 1Н7 (m1H7).

[0031] SEQ ID NO:5 представляет собой вариабельную аминокислотную последовательность тяжелой цепи m1H7.

[0032] SEQ ID NO:6 представляет собой вариабельную нуклеотидную последовательность легкой цепи m1H7.

[0033] SEQ ID NO:7 представляет собой вариабельную аминокислотную последовательность легкой цепи m1H7.

[0034] SEQ ID NO:8 представляет собой вариабельную нуклеотидную последовательность зрелой тяжелой цепи m1H7.

[0035] SEQ ID NO:9 представляет собой вариабельную аминокислотную последовательность зрелой тяжелой цепи mlH7.

[0036] SEQ ID NO:10 представляет собой вариабельную нуклеотидную последовательность зрелой легкой цепи m1H7.

[0037] SEQ ID NO:11 представляет собой вариабельную аминокислотную последовательность зрелой легкой цепи m1H7.

[0038] SEQ ID NO:12 представляет собой CDR1 тяжелой цепи из m1H7 (определение по Kabat).

[0039] SEQ ID NO:13 представляет собой CDR2 тяжелой цепи из m1H7 (определение по Kabat).

[0040] SEQ ID NO:14 представляет собой CDR3 тяжелой цепи из m1H7 (определение по Kabat).

[0041] SEQ ID NO:15 представляет собой CDR1 легкой цепи из m1H7 (определение по Kabat)

[0042] SEQ ID NO:16 представляет собой CDR2 легкой цепи из m1H7 (определение по Kabat).

[0043] SEQ ID NO:17 представляет собой CDR3 легкой цепи из m1H7 (определение по Kabat).

[0044] SEQ ID NO:18 представляет собой нуклеиновокислотную последовательность Hu1H7VHv1.

[0045] SEQ ID NO:19 представляет собой аминокислотную последовательность Hu1H7VHv1.

[0046] SEQ ID NO:20 представляет собой нуклеиновокислотную последовательность Hu1H7VHv2.

[0047] SEQ ID NO:21 представляет собой аминокислотную последовательность Hu1H7VHv2.

[0048] SEQ ID NO:22 представляет собой нуклеиновокислотную последовательность Hu1H7VHv3.

[0049] SEQ ID NO:23 представляет собой аминокислотную последовательность Hu1H7VHv3.

[0050] SEQ ID NO:24 представляет собой нуклеиновокислотную последовательность Hu1H7VHv4.

[0051] SEQ ID NO:25 представляет собой аминокислотную последовательность Hu1H7VHv4.

[0052] SEQ ID NO:26 представляет собой нуклеиновокислотную последовательность Hu1H7VHv5.

[0053] SEQ ID NO:27 представляет собой аминокислотную последовательность Hu1H7VHv5.

[0054] SEQ ID NO:28 представляет собой нуклеиновокислотную последовательность сигнального пептида Hu1H7VH.

[0055] SEQ ID NO:29 представляет собой аминокислотную последовательность сигнального пептида Hu1H7VH.

[0056] SEQ ID NO:30 представляет собой нуклеиновокислотную последовательность сигнального пептида Hu1H7VH.

[0057] SEQ ID NO:31 представляет собой аминокислотную последовательность сигнального пептида Hu1H7VH.

[0058] SEQ ID NO:32 представляет собой нуклеиновокислотную последовательность Hu1H7VLv1.

[0059] SEQ ID NO:33 представляет собой аминокислотную последовательность Hu1H7VLv1.

[0060] SEQ ID NO:34 представляет собой нуклеиновокислотную последовательность Hu1H7VLv2.

[0061] SEQ ID NO:35 представляет собой аминокислотную последовательность Hu1H7VLv2.

[0062] SEQ ID NO:36 представляет собой нуклеиновокислотную последовательность Hu1H7VLv3.

[0063] SEQ ID NO:37 представляет собой аминокислотную последовательность Hu1H7VLv3.

[0064] SEQ ID NO:39 представляет собой аминокислотную последовательность Hu1H7VLv4.

[0065] SEQ ID NO:40 представляет собой нуклеиновокислотную последовательность сигнального пептида Hu1H7VL.

[0066] SEQ ID NO:41 представляет собой аминокислотную последовательность сигнального пептида Hu1H7VL.

[0067] SEQ ID NO:42 представляет собой аминокислотную последовательность акцептора человека ВАС02037 (GI-21670055), которая используется для каркасного участка тяжелой цепи.

[0068] SEQ ID NO:43 представляет собой аминокислотную последовательность акцептора человека AAY33358 (GI-63102905), которая используется для каркасного участка легкой цепи.

[0069] SEQ ID NO:44 представляет собой последовательность Hu1H7VH, не имеющую обратную мутацию или мутацию в CDR.

[0070] SEQ ID NO:45 представляет собой последовательность Hu1H7VL, не имеющую обратную мутацию или мутацию в CDR.

[0071] SEQ ID NO:46 представляет собой последовательность для альтернативных вариантов Hu1H7VH.

[0072] SEQ ID NO:47 представляет собой последовательность для альтернативных вариантов Hu1H7VL.

[0073] SEQ ID NO:48 представляет собой последовательность для альтернативных вариантов CDR3 Hu1H7VH.

[0074] SEQ ID NO:49 представляет собой константную область легкой цепи Hu1H7 (с аргинином) (общую для v1-v4).

[0075] SEQ ID NO:50 представляет собой константную область тяжелой цепи Hu1H7 (IgG1; общую для v1-v5).

[0076] SEQ ID NO:51 представляет собой константную область легкой цепи Hu1H7 (без аргинина) (общую для v1-v4).

[0077] SEQ ID NO:52 представляет собой константную область тяжелой цепи Hu1H7 (аллотип G1m3).

[0078] SEQ ID NO:53 представляет собой версию 3 легкой цепи Hu1H7 (вариабельная область+константная область с аргинином).

[0079] SEQ ID NO:54 представляет собой версию 3 легкой цепи Hu1H7 (вариабельная область+константная область без аргинина).

[0080] SEQ ID NO:54 представляет собой версию 3 тяжелой цепи Hu1H7 (вариабельная область+константная область).

[0081] SEQ ID NO:56 представляет собой версию 3 тяжелой цепи Hu1H7 (вариабельная область+константная область; аллотип G1m3).

[0082] SEQ ID NO:57 представляет собой константную область тяжелой цепи Hu1H7 (IgG2).

[0083] SEQ ID NO:58 представляет собой константную область тяжелой цепи Hu1H7 (аллотип G1m1).

ОПРЕДЕЛЕНИЯ

[0084] Моноклональные антитела, как правило, предоставляются в выделенной форме. Это означает, что антитело является, как правило, по меньшей мере на 50% мас./мас. очищенным от белков и других макромолекул после его продукции или очистки, но не исключает возможность того, что моноклональное антитело объединяют с избытком фармацевтически приемлемого носителя(ей) или другого носителя, предназначенного для облегчения его применения. Иногда моноклональные антитела являются по меньшей мере на 60%, 70%, 80%, 90%, 95 или 99% мас./мас. очищенными от белков и других макромолекул после продукции или очистки.

[0085] Специфическое связывание моноклонального антитела с его целевым антигеном означает сродство, составляющее по меньшей мере 106, 107, 108, 109 или 1010 М-1. Детектируемое специфическое связывание больше по величине и отличаемо от неспецифического связывания, которое происходит по меньшей мере с одной неродственной мишенью. Специфическое связывание может возникать в результате образования связей между отдельными функциональными группами или определенного пространственного расположения (например, по типу "замок и ключ"), тогда как неспецифическое связывание является обычно результатом действия сил Ван-дер-Ваальса. Однако, специфическое связывание не обязательно означает, что моноклональное антитело связывается с одной и только одной мишенью.

[0086] Основная структурная единица антитела представляет собой тетрамер из субъединиц. Каждый тетрамер состоит из двух идентичных пар полипептидных цепей, причем каждая пара имеет одну "легкую" (около 25 кДа) и одну "тяжелую" цепь (около 50-70 кДа). Амино-концевой участок каждой цепи включает вариабельную область, составляющую примерно от 100 до 110 или более аминокислот, в первую очередь, ответственную за распознавание антигена. Данная вариабельная область первоначально экспрессируется связанной с отщепляемым сигнальным пептидом. Вариабельную область без сигнального пептида иногда называют зрелой вариабельной областью. Так, например, зрелая вариабельная область легкой цепи означает вариабельную область легкой цепи без сигнального пептида легкой цепи. Карбокси-концевой участок каждой цепи определяет константную область, ответственную, главным образом, за эффекторную функцию.

[0087] Легкие цепи классифицируют как каппа или лямбда. Тяжелые цепи классифицируют как гамма, мю, альфа, дельта или эпсилон, и они определяют изотип антитела, такой как IgG, IgM, IgA, IgD и IgE, соответственно. В легких и тяжелых цепях вариабельные и константные области соединены областью "J", состоящей из около 12 или более аминокислот, с тяжелой цепью, также включающей область "D", состоящую из около 10 или более аминокислот. (Смотри для общего представления Fundamental Immunology (Paul, W., ed., 2nd ed. Raven Press, N.Y., 1989, Ch. 7, включена посредством ссылки во всей своей полноте для всех целей).

[0088] Зрелые вариабельные области каждой пары легкой/тяжелой цепей образуют сайт связывания антитела. Таким образом, интактное антитело имеет два сайта связывания. За исключением бифункциональных или биспецифических антител, два сайта связывания являются одинаковыми. Все цепи имеют одинаковую общую структуру из относительно консервативных каркасных участков (framework regions (FR)), соединенных тремя гипервариабельными областями, также называемыми определяющие комплементарность области или CDR (complementarity determining region). Последовательности CDR из двух цепей каждой пары выровнены каркасными участками, обладающими способностью связываться со специфическим эпитопом. От N-конца к С-концу, как легкие, так и тяжелые цепи содержат домены FR1, CDR1, FR2, CDR2, FR3, CDR3 и FR4. Приписывание аминокислот к каждому домену происходит в соответствии с определениями Кабата для последовательностей белков, представляющих иммунологический интерес (Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD, 1987 and 1991)), или по Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989). Кабат также предложил широко используемое соглашение о нумерации (система нумерации по Кабату), в которой соответствующим остаткам в различных тяжелых цепях или в различных легких цепях присвоен одинаковый номер (например, Н83 означает положение 83 по системе нумерации Кабата в зрелой вариабельной области тяжелой цепи; аналогично положение L36 означает положение 36 система нумерации по Кабату в зрелой вариабельной области легкой цепи). Нумерация по Кабату используется на всем протяжении описания, со ссылкой на положения в вариабельной области антитела, если явно не указано иное.

[0089] Термин "антитело" включает интактные антитела и их фрагменты со связывающей способностью. Как правило, фрагменты конкурируют с интактным антителом, из которого они были получены, за специфическое связывание с мишенью, включая отдельные тяжелые цепи, легкие цепи Fab, Fab', F(ab')2, F(ab)c, диатела, Dab, нанотела и Fv. Фрагменты могут быть получены способами получения рекомбинантной ДНК или ферментативным или химическим разделением интактных иммуноглобулинов. Термин "антитело" также включает в себя биспецифическое антитело и/или гуманизированное антитело. Биспецифическое или бифункциональное антитело представляет собой искусственное гибридное антитело, имеющее две различных пары тяжелых/легких цепей и два различных сайта связывания (смотри, например, Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol. 148:1547-53 (1992)). В некоторых биспецифических антителах две различные пары тяжелых/легких цепей включают пару тяжелая цепь/легкая цепь гуманизированного 1Н7 и пару тяжелая цепь/легкая цепь, специфичную для эпитопа на альфа-синуклеине, отличного от того, который связан с 1Н7.

[0090] В некоторых биспецифических антителах одна пара тяжелая цепь/легкая цепь представляет собой гуманизированное антитело 1Н7, как дополнительно раскрыто ниже, и пара тяжелая цепь/легкая цепь происходит от антитела, которое связывается с рецептором, экспрессируемым на гематоэнцефалическом барьере, таким как инсулиновый рецептор, рецептор инсулиноподобного фактора роста (ИФР), рецептор лептина, или рецептор липопротеинов, или рецептор трансферрина (Friden et al., PNAS 88:4771-4775, 1991; Friden et al., Science 259:373-377, 1993). Такое биспецифическое антитело может быть перенесено через гематоэнцефалический барьер посредством рецептор-опосредованного трансцитоза. Поглощение мозгом биспецифического антитела можно дополнительно увеличить за счет конструирования биспецифического антитела с целью уменьшения его сродства к рецептору гематоэнцефалического барьера. Снижение сродства к рецептору приводит к более широкому распределению в мозге (см, например, Atwal. et al. Sci. Trans. Med. 3, 84ra43, 2011; Yu et al. Sci. Trans. Med. 3, 84ra44, 2011).

[0091] Примерами биспецифических антител могут также служить (1) антитело с двойными вариабельными доменами (DVD-Ig), где каждая легкая цепь и тяжелая цепь содержит два вариабельных домена в тандеме, соединенные коротким пептидным линкером (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig™) Molecule, B: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) Tandab, который является продуктом слияния двух одноцепочечных диантител (diabodies), давая четырехвалентное биспецифическое антитело, которое имеет два сайта связывания для каждого из целевых антигенов; (3) флекситело (flexibody), которое представляет собой сочетание scFv-фрагментов с диантителом, давая поливалентную молекулу; (4) так называемая молекула "dock and lock", получаемая на основе домена димеризации/докинга ("dimerization and docking domain") в протеинкиназе А, которая при применении с Fab-фрагментами может дать трехвалентный биспецифический связывающий белок, состоящий из двух одинаковых Fab-фрагментов, связанных с отличающимся Fab-фрагментом; (5) так называемая молекула Scorpion, содержащая, например, два scFv-фрагмента, слитые с обоими концами Fc-области человека. Примеры платформ, подходящих для получения биспецифических антител, включают, но без ограничения, BiTE (Micromet), DART (MacroGenics), Fcab и Mab2 (F-star), IgG1 с генно-инженерным Fc (Xencor) или DuoBody (на основе обмена Fab-плеча, Genmab).

[0092] Термин "эпитоп" относится к участку на антигене, с которым связывается антитело. Эпитоп может быть образован из смежных аминокислот или несмежных аминокислот, которые соприкасаются между собой при третичной укладке одного или нескольких белков. Эпитопы, образованные из смежных аминокислот, обычно устойчивы при воздействии денатурирующих растворителей, в то время как эпитопы, образованные при третичной укладке белка, обычно разрушаются при обработке денатурирующими растворителями. Эпитоп обычно включает по меньшей мере 3 и чаще по меньшей мере 5 или от 8 до 10 аминокислот в уникальной пространственной конформации. Способы определения пространственной конформации эпитопов включают, например, рентгеновскую кристаллографию и двумерный ядерный магнитный резонанс. Смотри, например, Epitope Mapping Protocols, in Methods in Molecular Biology, Vol.66, Glenn E. Morris, Ed. (1996).

[0093] Антитела, которые распознают одинаковые или перекрывающиеся эпитопы, могут быть идентифицированы с помощью обычного иммунного анализа, показывающего способность одного антитела блокировать связывание другого антитела с антигеном-мишенью. Эпитоп антитела может быть также определен с помощью рентгеновской кристаллографии антитела, связанного со своим антигеном для идентификации контактных остатков. Альтернативно, два антитела имеют один и тот же эпитоп, если все аминокислотные мутации в антигене, которые уменьшают или устраняют связывание одного антитела, снижают или устраняют связывание другого. Два антитела имеют перекрывающиеся эпитопы, если некоторые аминокислотные мутации, которые уменьшают или устраняют связывание одного антитела, снижают или устраняют связывание другого.

[0094] Конкуренцию между антителами определяют с помощью анализа, в котором испытуемое антитело ингибирует специфическое связывание эталонного антитела с общим антигеном (смотри, например, Junghans et al., Cancer Res. 50:1495, 1990). Испытуемое антитело конкурирует с эталонным антителом, если избыток испытуемого антитела (например, по меньшей мере 2-кратный, 5-кратный, 10-кратный, 20-кратный или 100-кратный) ингибирует связывание эталонного антитела по меньшей мере на 50%, например, на 75%, 90% или 99%, как измерено в анализе конкурентного связывания. Антитела, идентифицированные конкурентным анализом (конкурирующие антитела), включают антитела, связывающиеся с тем же эпитопом в качестве эталонного антитела, и антитела, связывающиеся с соседним эпитопом, расположенным достаточно проксимально по отношению к эпитопу, связанному с эталонным антителом, для того чтобы возникло пространственное затруднение.

[0095] Термин "пациент" включает человека или другое млекопитающее, которые получают либо профилактическое, либо терапевтическое лечение.

[0096] В целях классификации аминокислотных замещений как консервативных или неконсервативных аминокислоты группируются следующим образом: Группа I (гидрофобные боковые цепи): met, ala, val, leu, ile; Группа II (нейтральные гидрофильные боковые цепи): cys, ser, thr; Группа III (кислые боковые цепи): asp, glu; Группа IV (основные боковые цепи): asn, gln, his, lys, arg; Группа V (остатки, влияющие на ориентацию цепи): gly, pro; и Группа VI (ароматические боковые цепи): trp, tyr, phe. Консервативные замены включают замены между аминокислотами в пределах одного и того же класса. Неконсервативные замещения представляют собой замену члена одного из данных классов на член другого.

[0097] Идентичность последовательностей в процентах определяют с последовательностями антител, максимально выровненными по соглашению о нумерации Кабата. После выравнивания, если область антитела субъекта (например, вся зрелая вариабельная область тяжелой или легкой цепи) сравнивают с такой же областью эталонного антитела, процент идентичности последовательностей между областью антитела субъекта и областью эталонного антитела представляет собой число положений, занимаемых одной и той же аминокислотой как в области антитела субъекта, так и в области эталонного антитела, деленное на общее число выровненных положений двух областей, с неучитываемыми пробелами, умноженное на 100, чтобы преобразовать в проценты.

[0098] Композиции или способы, "содержащие" один или более перечисленных элементов, могут включать другие элементы, не перечисленные специально. Например, композиция, которая содержит антитело, может содержать антитело отдельно или в сочетании с другими ингредиентами.

[0099] Обозначение диапазона значений включает все целые числа в диапазоне или при определении диапазона и все поддиапазоны, определенные целыми числами в диапазоне.

[0100] Если из контекста не следует иное, термин "около" охватывает значения в пределах стандартной погрешности измерения (standard margin of error of measurement (SEM)) заявленной величины.

[0101] Индивид находится в группе повышенного риска заболевания, если данный субъект имеет по меньшей мере один известный фактор риска (например, генетический, биохимический, семейный анамнез, ситуационное воздействие), помещая индивиды с таким фактора риска в группу со статистически значимым более высоким риском развития болезни, чем индивиды без данного фактора риска.

[0102] Термин "симптом" относится к субъективным признакам болезни, таким как измененная походка, в восприятии пациента. "Признак" относится к объективным свидетельствам болезни, наблюдаемым врачом.

[0103] Статистическая значимость означает 0.05≤р.

[0104] "Когнитивная функция" относится к психическим процессам, таким как некоторые или все из внимания, памяти, языковых проблем, решения проблем и проявления интереса к своему окружению и самообслуживания.

[0105] "Повышенные когнитивные функции" или "улучшенные когнитивные функции" относится к улучшению по сравнению с исходными данными, например, диагностикой или началом лечения. "Снижение когнитивной функции" относится к снижению функции по отношению к такой базовой линии.

[0106] В модельных системах животных, таких как крысы или мыши, когнитивные функции могут быть измерены способами, включая применение лабиринта, в котором субъекты используют пространственную информацию (например, водный лабиринт Морриса (Morris), круговой лабиринт Барнса (Barnes), лабиринт с приподнятым радиальным рукавом, Т-лабиринт и другие), ситуацию создания тревожности, ситуацию активного избегания, тест освещенное "открытое поле", измерение активности в темноте, приподнятый крестообразный лабиринт, двухкамерный исследовательский тест или тест принудительного плавания.

[0107] У человека когнитивные функции могут быть измерены с помощью одного или более из нескольких стандартных тестов. Примеры теста или испытания для определения когнитивной функции были описаны (Ruoppila, 1. and Suutama, Т. Scand. J. Soc. Med. Suppl. 53, 44-65, 1997) и включают стандартизированные психометрические тесты (например, шкала памяти Векслера, шкала Векслера для оценки интеллекта у взрослых, стандартные последовательные матрицы Рэйвена, тест оценки умственной способности взрослых Шайе-Терстона), нейропсихологические тесты (например, тест Лурия-Небраска), метакогнитивные самооценки (например, анкета оценки памяти), тесты зрительно-пространственных фильтраций (фигуры Поппелрейтера, распознавание часов, рисование и вычеркивание сот), тесты когнитивной фильтрации (например, мини-тесты ментального статуса Фольштейна) и тесты времени реагирования. Другие стандартные тесты для оценки когнитивной деятельности включают оценочную шкалу нарушений при болезни Альцгеймера - когнитивную подшкалу (Alzheimer's Disease Assessment Scale-cognitive subscale (ADAS-cog)); шкалу общего впечатления врача о происходящих изменениях, включая информацию лица, осуществляющего уход за больными (clinical global impression of change scale (шкала CIBIC-plus)); совместное исследование болезни Альцгеймера - элементарных действий по самообслуживанию (Alzheimer's Disease Cooperative Study Activities of Daily Living Scale (ADCS-ADL)); мини-тест исследования психического состояния (Mini Mental State Exam (MMSE)); критерии по психоневрологическому опроснику (Neuropsychiatric Inventory (NPI)); клиническую рейтинговую шкалу деменции (Clinical Dementia Rating Scale (CDR)); Кембриджскую нейропсихологическую автоматизированную батарею тестов (Cambridge Neuropsychological Test Automated Battery (CANTAB)) или шкалу клинической гериатрической оценки Сандоз (Sandoz Clinical Assessment - Geriatric (SCAG)), цветовой тест Струпа (Stroop Test), тест следования по маршруту (Trail Making), цифровой ряд Векслера (Wechsler Digit Span) и компьютеризированный когнитивный тест CogState. Кроме того, когнитивные функции могут быть измерены с использованием способов визуализации, таких как позитронно-эмиссионая томография (Positron Emission Tomography (PET)), функциональная магнитно-резонансная томография (MPT), однофотонная эмиссионная компьютерная томография (Single Photon Emission Computed Tomography (SPECT)) или любой другой способ визуализации, который позволяет измерять функцию мозга.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

I. ОБЩЕЕ

[0108] Настоящее изобретение относится к гуманизированным антителам 1Н7 (антителам Hu1H7). Данные антитела могут применяться для лечения и диагностики болезни с тельцами Леви.

II. МОЛЕКУЛЫ-МИШЕНИ

[0109] Природный человеческий альфа-синуклеин дикого типа представляет собой пептид из 140 аминокислот, имеющий следующую аминокислотную последовательность:

MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH

GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL

GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA (SEQ ID NO:1)

(Uéda et al., Proc. Natl. Acad. Sci. USA, 90:11282-6, 1993; GenBank, номер доступа: P37840). Белок имеет три общепризнанных домена, домен с повторами КТКЕ, охватывающий аминокислоты от 1 до 61, домен NAC (неамилоидный компонент), включающий аминокислоты от около 60 до около 95, и С-концевой кислотный домен, включающий аминокислоты от около 98 до 140. Jensen et al. было показано, что NAC имеет следующую аминокислотную последовательность: EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV (SEQ ID NO:2) (Jensen et al., Biochem. J. 310 (Pt 1): 91-94, 1995; GenBank, номер доступа S56746). Uéda et al. было показано, что NAC имеет следующую аминокислотную последовательность: KEQVTNVGGAVVTGVTAVAQKTVEGAGS (SEQ ID NO:3) (Uéda et al., Proc. Natl. Acad. Sci. USA, 90:11282-6, 1993).

[0110] Если из контекста не следует иное, ссылка на альфа-синуклеин или его фрагменты включает природные человеческие аминокислотные последовательности дикого типа, указанные выше, и их человеческие аллельные варианты, в частности те, которые связаны с болезнью с тельцами Леви (например, Е46К, А30Р и А53Т, где первая буква указывает на аминокислоту в SEQ ID NO:1, число соответствует положению кодона в SEQ ID NO:1 и вторая буква обозначает аминокислоту в аллельном варианте). Такие варианты могут необязательно присутствовать по отдельности или в любой комбинации. Индуцированные мутации E83Q, A90V, А76Т, которые усиливают агрегацию альфа-синуклеина, также могут присутствовать по отдельности или в комбинации друг с другом и/или аллельными вариантами Е46К А30Р и А53Т человека.

III. БОЛЕЗНИ С ТЕЛЬЦАМИ ЛЕВИ

[0111] Болезни с тельцами Леви (LBD) характеризуются дегенерацией дофаминергической системы, моторными изменениями, когнитивными нарушениями и образованием телец Леви (LB). (McKeith et al., Neurology (1996) 47:1113-24). Тельца Леви представляют собой сферические белковые отложения, найденные в нервных клетках. Их присутствие в мозге нарушает нормальную функцию мозга, прерывая действие химических посредников, включая ацетилхолин и дофамин. Болезни с тельцами Леви включают болезнь Паркинсона (включая идиопатическую болезнь Паркинсона), болезнь диффузных телец Леви (Lewy Body Disease (DLBD)), также известную как деменция с тельцами Леви (Dementia with Lewy Bodies (DLB)), вариант болезни Альцгеймера с образованием телец Леви (Lewy body variant (LBV)), объединенные болезнь Альцгеймера и болезнь Паркинсона и множественную системную атрофию (multiple system atrophy (MSA); например, оливопонтоцеребральную атрофию, стриатонигральную дегенерацию и синдром Шая - Дрейджера (Shy-Drager). DLBD разделяет симптомы как болезни Альцгеймера, так и болезни Паркинсона. DLBD отличается от болезни Паркинсона, в основном, местонахождением телец Леви. При DLBD тельца Леви образуются, главным образом, в коре головного мозга. При болезни Паркинсона они образуются, в основном, в черной субстанции. Другие болезни с тельцами Леви включают чисто вегетативную недостаточность, дисфагию с тельцами Леви, случайную LBD и унаследованную LBD (например, мутации гена альфа-синуклеина, PARK3 и PARK4).

IV. АНТИТЕЛА ПО ИЗОБРЕТЕНИЮ

A. Специфичность связывания и функциональные свойства

[0112] Гуманизированные антитела по изобретению специфически связываются с человеческим альфа-синуклеином. Сродство некоторых гуманизированных антител (т.е., Ка) может превосходить, например, в пять раз или в два раза сродство мышиных антител (m1H7). Некоторые гуманизированные антитела имеют такое же сродство, что и m1H7, с учетом SEM. Некоторые гуманизированные антитела имеют сродство больше, чем таковое у мышиного 1Н7. Предпочтительные гуманизированные антитела связываются с тем же эпитопом и/или конкурируют с m1H7 за связывание с человеческим альфа-синуклеином.

B. Гуманизированные антитела

[0113] Гуманизированное антитело представляет собой антитело, полученное способом генной инженерии, в котором последовательности CDR из нечеловеческого "донорного" антитела введены в "акцепторные" последовательности человеческих антител (см, например, Queen et al., US 5,530,101 и 5,585,089; Winter et al., US 5,225,539; Carter, US 6,407,213; Adair, US 5,859,205 и 6,881,557; и Foote, US 6,881,557). Последовательности акцепторного антитела могут представлять собой, например, последовательность зрелой вариабельной области человеческого антитела, композит таких последовательностей, консенсусную последовательность последовательностей вариабельных областей человеческого антитела (например, консенсусные последовательности вариабельных областей легких и тяжелых цепей по Кабату, 1991, выше) или последовательность вариабельной области зародышевой линии.

[0114] В качестве примера акцепторной последовательности для тяжелой цепи служит человеческая зрелая вариабельная область тяжелой цепи с NCBI кодом доступа ВАС02037 (GI: 21670055). Данная акцепторная последовательность включает в себя две последовательности CDR, имеющие такую же каноническую форму, что и тяжелая цепь мышиного 1Н7, и имеет 65,8% идентичности последовательности в каркасном участке вариабельной области тяжелой цепи. Если используется другая акцепторная последовательность, такой акцептор может представлять собой, например, другую зрелую вариабельную область тяжелой цепи, полученную из зародышевой линии VH1-18, или последовательность зрелой вариабельной области тяжелой цепи, включающую одну из данных последовательностей зародышевой линии.

[0115] Примером акцепторной последовательности для легкой цепи является зрелая вариабельная область легкой цепи с NCBI кодом доступа AAY33358 (GI: 63102905). Данная акцепторная последовательность включает в себя две последовательности CDR, имеющие такую же каноническую форму, что и легкая цепь мышиного 1Н7, и имеет 65,4% идентичности последовательности в каркасном участке вариабельной области легкой цепи. Если используется другой акцептор, такой акцептор предпочтительно представляет собой другую последовательность зрелой легкой цепи, полученной из зародышевой линии А30, или последовательность зрелой вариабельной области легкой цепи, включающей одну из данных последовательностей зародышевой линии.

[0116] Гуманизированное антитело по изобретению представляет собой антитело, имеющее по три последовательности CDR в легкой цепи и в тяжелой цепи, как определено Кабатом, полностью или по существу из донорного мышиного антитела 1Н7, и последовательности каркасного участка зрелой вариабельной области и константные области, если они присутствуют, полностью или по существу из последовательностей тяжелой цепи человеческого антитела. Точно так же гуманизированная тяжелая цепь представляет собой тяжелую цепь, имеющую три последовательности CDR из тяжелой цепи, как определено Кабатом, полностью или по существу из тяжелой цепи мышиного антитела 1Н7, и последовательность зрелой вариабельной области тяжелой цепи и последовательность константной области тяжелой цепи, если они присутствуют, полностью или по существу из последовательности тяжелой цепи человеческого антитела. Точно так же гуманизированная легкая цепь представляет собой легкую цепь, имеющую три последовательности CDR из легкой цепи, как определено Кабатом, полностью или по существу из легкой цепи антитела m1H7, и последовательность зрелой вариабельной области легкой цепи и последовательность константной области легкой цепи, если они присутствуют, полностью или по существу из последовательности легкой цепи человеческого антитела. CDR происходит по существу из m1H7, если по меньшей мере 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% остатков идентичны соответствующим остаткам в соответствующей CDR из m1H7. Последовательности каркасного участка зрелой вариабельной области цепи антитела или последовательность константной области цепи антитела происходят по существу из человеческой последовательности каркасного участка зрелой вариабельной области или из человеческой последовательности константной области, соответственно, когда по меньшей мере 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% соответствующих остатков, определенных по Kabat, являются идентичными.

[0117] Некоторые аминокислотные остатки из аминокислотных остатков каркасного участка человеческой зрелой вариабельной области могут быть выбраны для замещения, в силу их возможного влияния на конформацию CDR и/или на связывание с антигеном, опосредования ими взаимодействия между тяжелой и легкой цепями, их взаимодействия с константной областью, их функционирования в качестве сайтов для желательной или нежелательной посттрансляционной модификации, их необычности относительно положения в последовательности человеческой вариабельной области, что может обуславливать их потенциальную иммуногенность, а также других причин. Следующие 11 положений каркасного участка вариабельной области были рассмотрены в качестве кандидатов на замены по одной или более из данных причин, как дополнительно указано в примерах (L46F, Y49C, F83A, V11L, T28S, R38K, M48I, V67A, M69L, Т71А, Y91F).

[0118] Здесь, как и везде, упомянутый первым остаток представляет собой остаток гуманизированного антитела, образуемого введением последовательностей CDR по Кабату в каркасный участок акцептора человека, и упомянутый вторым остаток представляет собой остаток, рассматриваемый в качестве замены такого остатка. Таким образом, внутри каркасных участков вариабельной области упомянутый первым остаток является человеческим и в последовательностях CDR упомянутый первым остаток является мышиным (например, C97S).

[0119] Аминокислотные замены могут быть произведены в последовательностях CDR. Один возможный вариант заключается в замене определенных остатков в последовательностях CDR мышиного антитела 1Н7 соответствующими остатками из последовательностей CDR человека, как правило, из последовательностей CDR человеческих акцепторных последовательностей, используемых в проектировании примеров гуманизированных антител. В некоторых антителах только часть последовательностей CDR, а именно подмножество аминокислотных остатков последовательностей CDR, необходимых для связывания, называемых SDR (specificity determining regions), необходима, чтобы сохранить связывание в гуманизированном антителе. Аминокислотные остатки CDR, не контактирующие с антигеном и не относящиеся к аминокислотным остаткам SDR, могут быть определены на основе предыдущих исследований (например, остатки Н60-Н65 в CDR Н2 часто не требуются), из последовательностей CDR по Кабату, лежащих вне гипервариабельных петель по Chothia (Chothia, J. Mol. Biol 196:901, 1987), молекулярным моделированием и/или эмпирически, или как описано в публикации Gonzales et al., Mol. Immunol. 41:863 (2004). В таких гуманизированных антителах, в положениях, в которых один или более донорных аминокислотных остатков CDR отсутствует или в которых вся донорная последовательность CDR опущена, аминокислотный остаток, занимающий определенное положение, может быть аминокислотным остатком, занимающим соответствующее положение (по системе нумерации Кабата) в последовательности акцепторного антитела. Число таких замен акцепторных на донорные аминокислотные остатки для включения в последовательности CDR отражает баланс некоторых конкурирующих факторов. Такие замены потенциально выгодны с целью уменьшения количества мышиных аминокислотных остатков в гуманизированном антителе и, следовательно, уменьшения потенциальной иммуногенности. Однако, замены могут также вызвать изменения сродства, и значительное снижение сродства предпочтительно избегать. Положения для замещения в последовательностях CDR и аминокислоты для замены также могут быть выбраны эмпирически.

[0120] Одной из причин для выполнения замены в пределах последовательности CDR является то, что мышиный остаток представляет собой сайт посттрансляционной модификации, который может мешать экспрессии или сборке антитела. Здесь, положение Н97 в CDRH3, которое занимает С в мышином 1Н7, было идентифицировано в качестве сайта для замены.

[0121] 11 обратных мутаций каркасного участка вариабельной области и 1 замещение в последовательности CDR, упомянутые выше, могут быть включены в гуманизированные антитела 1Н7 во многих перестановках. Вариабельная область тяжелой цепи таких антител может быть представлена в виде последовательности, содержащей QVQLVQSGAE-X1-KKPGASVKVSCKASGY-X2-FTSYYIHWV-X3-QAPGQGLEW-X4-GWIYPGSGNTKYSEKFKGR-X5-T-X6-T-X7-DTSTSTAYMELRSLRSDDTAVY-X8-CARDG-X9-YGFAYWGQGTLVTVSS, где -Х1- представляет собой V или L; -Х2- представляет собой S или Т; -Х3- представляет собой R или К; -Х4- представляет собой М или I; -Х5- представляет собой V или А; -Х6- представляет собой М или L; -Х7- представляет собой Т или A; -X8- представляет собой Y или F; -Х9- представляет собой С, М, S или Т (SEQ ID NO:46). В некоторых вариабельных областях тяжелой цепи -Х9- представляет собой С. Некоторые вариабельные области легкой цепи могут быть представлены в виде последовательности, содержащей DIQLTQSPSSLSASVGDRVTITCKASQSVDYDGDSYMNWYQQKPGKAPK-Z1-LI-Z2-AASNLESGVPSRFSGSGSGTDFTLTISSLQPED-Z3-ATYYCQQSNEDPFTFGQGTKLEIK, где -Z1- представляет собой L или F; -Z2- представляет собой Y или С; -Z3- представляет собой F или A (SEQ ID NO:47). В некоторых антителах вариабельная область тяжелой цепи содержит последовательность SEQ ID NO:46 и вариабельная область легкой цепи содержит последовательность SEQ ID NO:47. Например, остатки X1 и Х3 из последовательности SEQ ID NO:48 представляют собой V и R, соответственно. Например, остатки Х5 и Х7 из последовательности SEQ ID NO:46 представляют собой А и остаток Z1 из последовательности SEQ ID NO:47 представляет собой F. Например, остатки -Х4, Х6 и X8 из последовательности SEQ ID NO:46 представляют собой М, М и Y, соответственно, и остатки Z2 и Z3 из последовательности SEQ ID NO:47 представляют собой С и F, соответственно. Например, остатки Х2 и Х9 из последовательности SEQ ID NO:48 представляют собой Т и С, соответственно.

[0122] Некоторые антитела содержат две замены в тяжелой цепи и две замены в легкой цепи. Например, положение Н67 занимает А, положение Н71 занимает А, положение L46 занимает F и положение L49 занимает С. В некоторых антителах зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:23. В некоторых антителах зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:37. Например, в H3L3 (Hu1H7VHv3 (SEQ ID NO:23)-Hu1H7VLv3 (SEQ ID NO:37)), зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:23, и зрелая вариабельная область легкой цепи имеет последовательность аминокислот, определенную последовательностью SEQ ID NO:37.

[0123] Настоящее изобретение относится к вариантам гуманизированного антитела H3L3, в которых зрелая вариабельная область гуманизированной тяжелой цепи показывает по меньшей мере 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности относительно SEQ ID NO:23 и зрелая вариабельная область гуманизированной легкой цепи показывает по меньшей мере 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности относительно SEQ ID NO:37. Некоторые такие гуманизированные антитела включают в себя три области CDR из тяжелой цепи и три области CDR из легкой цепи, полностью или по существу идентичные CDR-областям из H3L3, которые являются такими же, как и у мышиного донорного антитела. CDR-области могут быть определены любым традиционным определением (например, по Хотия (Chothia)), но предпочтительно, как определено Кабатом.

[0124] Некоторые варианты гуманизированного антитела H3L3 сохраняют некоторые или все из обратных мутаций в H3L3. Другими словами, по меньшей мере 1, 2, 3 или предпочтительно все 4 из следующего присутствуют: положение Н67 занимает А и положение Н71 занимает А, положение L46 занимает F и положение L49 занимает С.

[0125] В дополнение к сохранению по меньшей мере 1, 2, 3 или предпочтительно всех 4 из обратных мутаций в H3L3, гуманизированные антитела 1Н7 могут также содержать дополнительные обратные мутации в каркасных участках вариабельной области. Примеры таких обратных мутаций включают положение Н11, занимаемое L, Н28, занимаемое S, Н38, занимаемое К, Н48, занимаемое I, Н69, занимаемое L, Н91, занимаемое F, и/или L83, занимаемое А. При выборе обратных мутаций для терапевтического или диагностического продукта следует учитывать, до какой степени они вообще не улучшают сродство, и до какой степени включение большего количества мышиных аминокислотных остатков может привести к повышенному риску иммуногенности. Например, H3L1 содержит зрелую вариабельную область тяжелой цепи с последовательностью SEQ ID NO:23 и легкую цепь с последовательностью SEQ ID NO:33. Например, H4L1 содержит зрелую вариабельную область тяжелой цепи с последовательностью SEQ ID NO:25 и легкую цепь с последовательностью SEQ ID NO:33.

[0126] Еще одна возможность для изменения состоит в применении различных человеческих акцепторных последовательностей, как обсуждалось выше. Замены в CDR-областях возможны, как описано выше, например, в положении Н97, но перед выбором таких замен для терапевтического или диагностического продукта следует учитывать потенциальное воздействие на сродство и экспрессию антитела.

[0127] Если положение Н97 в мышиной последовательности CDRH3 представляет собой иное, чем цистеин, его предпочтительно занимает М, S или Т. Некоторые антитела содержат гуманизированную тяжелую цепь, содержащую последовательность CDR1 по Кабату из SEQ ID NO:12: SYYIH; последовательность CDR2 по Кабату из SEQ ID NO:13: WIYPGSGNTKYSEKFKG; последовательность CDR3 по Кабату из SEQ ID NO:48: DG-X9-YGFAY, в которой -Х9- представляет собой С, М, S или Т, более предпочтительно С. Некоторые антитела содержат гуманизированную легкую цепь, содержащую последовательность CDR1 по Кабату определяемую SEQ ID NO:15: KASQSVDYDGDSYMN; последовательность CDR2 по Кабату из SEQ ID NO:16: AASNLES; последовательность CDR3 по Кабату из SEQ ID NO:17: QQSNEDPFT. Некоторые антитела содержат гуманизированную тяжелую цепь, содержащую три последовательности CDR, положение и длина которых определены в соответствии со схемой Кабата последовательностями SEQ ID NO:12, 13 и 48 и гуманизированного легкую цепь, содержащую три последовательности CDR, положение и длина которых определены в соответствии со схемой Кабат последовательностями SEQ ID NO:15-17. В некоторых из таких антител гуманизированная тяжелая цепь содержит три последовательности CDR по Кабату определяемые последовательностями SEQ ID NO:12-14, и гуманизированная легкая цепь содержит три последовательности CDR по Кабату определяемые последовательностями SEQ с ID NO:15-17.

[0128] Настоящее изобретение дополнительно относится к гуманизированным антителам 1Н7, в которых зрелая вариабельная область гуманизированной тяжелой цепи показывает по меньшей мере 90%, 95%, 96%, 97%, 98% или 99% идентичности или на 100% идентична последовательностям SEQ ID NO. 19, 21, 23, 25 и 27, и зрелая вариабельная область гуманизированной легкой цепи показывает по меньшей мере 90%, 95%, 96%, 97%, 98% или 99% идентичности или на 100% идентична любой одной из последовательностей SEQ ID NO. 33, 35, 37 и 39.

[0129] Различные перестановки 11-ти обратных мутаций каркасного участка вариабельной области и 1 мутация в CDR, описанные выше, могут быть включены в гуманизированные антитела 1Н7. В некоторых из таких антител положение L46 занимает L или F (предпочтительно F), и/или положение L49 занимает Y или С (предпочтительно С), и/или положение L83 занимает F или А, и/или положение Н11 занимает V или L, и/или положение Н28 занимает Т или S, и/или положение Н38 занимает R или К, и/или положение Н48 занимает М или I, и/или положение Н67 занимает V или А (предпочтительно А), и/или положение Н69 занимает М или L, и/или положение Н71 занимает Т или А (предпочтительно А), и/или положение Н91 занимает Y или F, и/или положение Н28 занимает S или Т, и/или положение Н97 занимает С или М или S или Т (предпочтительно С).

[0130] В некоторых из таких антител сохраняются некоторые или все из обратных мутаций в Hu1H7VLv1-v4 и Hu1H7VHv1-v5. Предпочтительно, сохраняются обратные мутации в положениях L46, Н67 и Н71. Другими словами, положение L46 занимает F, положение Н67 занимает А и положение Н71 занимает А. Более предпочтительно, сохраняются обратные мутации в положениях L46, L49, Н67 и Н71. Другими словами, положение L46 занимает F, положение L49 занимает С, положение Н67 занимает А и положение Н71 занимает А. В некоторых антителах некоторые или все из положений Н11, Н28, Н38, Н48, Н67, Н69, Н71 и/или Н91 в тяжелых цепях заняты L, S, К, I, A, L и F, соответственно. Точно так же в некоторых антителах некоторые или все из положений L46, L49 и/или L83 в легких цепях занимают F, С и А, соответственно. В некоторых антителах 1, 2, 3, 4, 5, 6, 7, 8, 9 или все десять положений Н11, Н28, Н38, Н48, Н67, Н69, Н71, Н91, L46, L49 и L83 занимает/занимают L, S, К, I, A, L, A, F, F, С и А, соответственно. В некоторых антителах 0, 1, 2, 3, 4, 5, 6 или 7 положений изменены в каркасном участке зрелой вариабельной области тяжелой цепи по отношению к последовательности SEQ ID NO:44, и 0, 1, 2 или 3 положения изменены в каркасном участке зрелой вариабельной области легкой цепи по отношению к последовательности SEQ ID NO:45. В некоторых из таких антител положение Н97 занимает С. Предпочтительно, гуманизированное антитело имеет величину KD для альфа-синуклеина, превышающую от около 0,5 раз до 2 раз величину KD для мышиного или химерного антитела 1Н7.

[0131] В некоторых антителах положение L46 занимает F, положение Н67 занимает А, положение Н71 занимает А, положение Н11 занимает V и положение Н38 занимает R. В некоторых из таких антител положение L49 занимает Y. Более предпочтительно, в некоторых из таких антител положение L49 занимает С. В некоторых из таких антител положение L83 занимает F. В некоторых из таких антител положение L83 занимает А. В некоторых из таких антител положение Н97 занимает С. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает М, положение Н69 занимает М и положение Н91 занимает Y. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает М, положение Н69 занимает М и положение Н91 занимает F. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает М, положение Н69 занимает L и положение Н91 занимает Y. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает М, положение Н69 занимает L и положение Н91 занимает F. В некоторых таких антител положение Н28 занимает Т или S, положение Н48 занимает I, положение Н69 занимает М и положение Н91 занимает Y. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает I, положение Н69 занимает М и положение Н91 занимает F. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает I, положение Н69 занимает L и положение Н91 занимает Y. В некоторых из таких антител положение Н28 занимает Т или S, положение Н48 занимает I, положение Н69 занимает L и положение Н91 занимает F. В некоторых из таких антител положение H11 занимает L, и/или положение Н38 занимает К, и/или положение Н97 занимает S.

[0132] В любом из вышеупомянутых антител могут быть произведены другие аминокислотные замены в каркасном участке зрелой вариабельной области, например, в аминокислотных остатках, не вступающих в контакт с аминокислотными остатками CDR. Часто замены, произведенные в вариантах гуманизированных последовательностей, являются консервативными по отношению к замененным аминокислотам. В некоторых антителах замены по отношению к Hu1H7VLv1-v4 и Hu1H7VHv1-v5 (консервативные или неконсервативные) не оказывают существенного влияния на сродство или потенцию полученного антитела по отношению к Hu1H7VLv1-v4 и Hu1H7VHv1-v5, то есть на его способность связывать человеческий альфа-синуклеин.

[0133] Варианты, как правило, отличаются от последовательностей зрелых вариабельных областей тяжелой и легкой цепей из Hu1H7VLv1-v4 и Hu1H7VHv1-v5 небольшим числом (например, как правило, не более 1, 2, 3, 5 или 10 в каркасном участке зрелой вариабельной области либо легкой цепи, либо тяжелой цепи, или обеих типов цепей) замен, делеций или вставок.

С. Отбор константной области

[0134] Вариабельные области тяжелой и легкой цепей гуманизированных антител могут быть связаны, по меньшей мере, с частью константной области человека. Выбор константной области зависит, в частности, от того, желательны ли антителозависимая клеточно-опосредованная цитотоксичность, антителозависимый клеточный фагоцитоз и/или комплементзависимая цитотоксичность. Например, человеческие изотипы IgG1 и IgG3 обладают комплементзависимой цитотоксичностью, а человеческие изотипы IgG2 и IgG4 не обладают ею. Человеческие IgG1 и IgG3 также вызывают более сильные клеточно-опосредованные эффекторные функции, чем человеческие IgG2 и IgG4. Константные области легкой цепи могут быть лямбда или каппа. Пример константной области человеческой легкой цепи каппа имеет аминокислотную последовательность SEQ ID NO:49. N-концевой аргинин из последовательности SEQ ID NO:49 может быть опущен, и в этом случае константная область легкой цепи каппа имеет аминокислотную последовательность SEQ ID NO:51. Служащая примером константная область тяжелой цепи человеческого IgG1 имеет аминокислотную последовательность SEQ ID NO:50. Служащая примером константная область тяжелой цепи человеческого IgG2 имеет аминокислотную последовательность SEQ ID NO:57. Антитела могут быть экспрессированы в виде тетрамеров, содержащих две легкие и две тяжелые цепи, в виде отдельных тяжелых цепей, легких цепей, в виде Fab, Fab', F(ab')2 и Fv или в виде одноцепочечных антител, в которых зрелые вариабельные домены тяжелой и легкой цепи соединены через спейсер.

[0135] Человеческие константные области проявляют аллотипическую вариабельность и изоаллотипическую вариабельность для различных индивидов, то есть, константные области могут отличаться у разных индивидов по одному или нескольким полиморфным положениям. Изоаллотипы отличаются от аллотипов в том, что сыворотки, распознающие изоаллотип, связываются с неполиморфной областью одного или более других изотипов. Так, например, константные области тяжелой цепи могут быть аллотипами IgG1 G1m1 или IgG1 G1m3 и имеют аминокислотную последовательность SEQ ID NO:52 или SEQ ID NO:55. Еще одна константная область тяжелой цепи имеет аминокислотную последовательность SEQ ID NO:52 или SEQ ID NO:55, за исключением того, что в ней отсутствует С-концевой лизин.

[0136] Один или несколько аминокислотных остатков на амино- или карбокси-конце легкой и/или тяжелой цепи, такой как С-концевой лизин тяжелой цепи, может отсутствовать или быть дериватизированным в части молекул или во всех молекулах. Замены могут быть произведены в константных областях, чтобы уменьшить или увеличить эффекторную функцию, такую как комплемент-опосредованная цитотоксичность или ADCC (смотри, например, Winter et al., патент США №5624821; Tso et al., патент США №5834597; и Lazar et al., Proc. Natl. Acad. Sci. USA 103:4005, 2006), или продлить время полужизни в организме человека (смотри, например, Hinton et al., J. Biol. Chem. 279:6213, 2004). Примеры замен включают Gln в положении 250 и/или Leu в положении 428 (нумерация EU используется в данном параграфе для константной области) для увеличения времени полужизни антитела. Замена в любом или во всех положениях 234, 235, 236 и/или 237 уменьшает сродство к рецепторам Fcγ, в частности, к рецептору FcγRI (смотри, например, патент США 6624821). В некоторых антителах имеется замена аланина в положениях 234, 235 и 237 человеческого IgG1 для снижения эффекторных функций. Необязательно, в положениях 234, 236 и/или 237 в человеческом IgG2 произведена замена на аланин и в положении 235 произведена замена на глутамин (см, например, патент США 5624821).

[0137] В некоторых антителах константная область легкой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:49. В некоторых антителах константная область тяжелой цепи имеет аминокислотную последовательность, определенную последовательностью SEQ ID NO:52. Примеры легких цепей Hu1H7 имеют последовательность SEQ ID NO:53 или SEQ ID NO:54. Примеры тяжелых цепей Hu1H7 имеют аминокислотную последовательность SEQ ID NO:55 или SEQ ID NO:56. В некоторых антителах легкая цепь представляет собой SEQ ID NO:53. В некоторых антителах тяжелая цепь представляет собой SEQ ID NO:56.

D. Экспрессия рекомбинантных антител

[0138] Антитела могут быть получены рекомбинантной экспрессией. Нуклеиновые кислоты, кодирующие антитела, могут быть оптимизированы в отношении кодонов для экспрессии в желаемом типе клеток (например, СНО или Sp2/0). Рекомбинантные конструкции нуклеиновых кислот, как правило, включают в себя последовательность, контролирующую экспрессию, функционально связанную с кодирующими последовательностями цепей антител, включая ассоциированные естественным образом или гетерологичные промоторные области. Последовательности, контролирующие экспрессию, могут представлять собой эукариотические промоторные системы в векторах, способных к трансформации или трансфекции эукариотических клеток-хозяев. После того, как вектор был введен в соответствующего хозяина, хозяина выдерживают в условиях, подходящих для высокого уровня экспрессии нуклеотидных последовательностей и сбора и очистки кросс-реагирующих антител. Вектор или векторы, кодирующие цепи антитела, может также содержать селектируемый ген, такой как ген дигидрофолатредуктазы, чтобы позволить амплификацию числа копий нуклеиновых кислот, кодирующих цепи антитела.

[0139] E. coli является прокариотическим хозяином, особенно подходящим для экспрессии антител, в частности, фрагментов антител. Такие организмы, как дрожжи, также применимы для экспрессии. Saccharomyces служит примером дрожжевого хозяина, с подходящими векторами, имеющими последовательности, контролирующие экспрессию, точку начала репликации, последовательности терминации и тому подобное, как это необходимо. Типичные промоторы включают промоторы для 3-фосфоглицераткиназы и других гликолитических ферментов. Индуцируемые промоторы дрожжей включают, в частности, промоторы из генов алкогольдегидрогеназы, изоцитохрома С и ферментов, ответственных за утилизацию мальтозы и галактозы.

[0140] Клетки млекопитающих могут быть использованы для экспрессии нуклеотидных сегментов, кодирующих иммуноглобулины или их фрагменты. Смотри Winnacker, From Genes to Clones, (VCH Publishers, NY, 1987). В данной области был разработан ряд подходящих линий клеток-хозяев, способных секретировать интактные гетерологичные белки, и они включают в себя клеточные линии СНО, различные линии клеток COS, клетки HeLa, клетки НЕК293, L-клетки и клетки миеломы, которые не продуцируют антитело, включая SP2/0 и NS0. Может быть выгодным применять нечеловеческие клетки. Экспрессирующие векторы для таких клеток могут включать последовательности, контролирующие экспрессию, такие как точка начала репликации, промотор, энхансер (Queen et al., Immunol. Rev. 89:49 (1986)), и необходимые информационные сайты процессинга, такие как сайты связывания рибосомы, сайты сплайсинга РНК, сайты полиаденилирования, и последовательности терминации транскрипции. Подходящими последовательностями, контролирующие экспрессию, являются промоторы, полученные из эндогенных генов, цитомегаловируса, SV40, аденовируса, вируса папилломы крупного рогатого скота и тому подобное. Смотри Со et al., J. Immunol. 148:1149 (1992).

[0141] После введения вектора(ов) кодирования тяжелых и легких цепей антител в культуру клеток клеточные пулы могут быть подвергнуты скринингу на производительность роста и качество продукции в бессывороточной среде. Лучшие продуцирующие клеточные пулы могут быть подвергнуты основанному на FACS одноклеточному клонированию для генерации моноклональных линий. Специфические продуктивности, составляющие выше 50 пг или 100 пг на клетку в день, которые соответствуют титрам продукта, составляющим более 7,5 г/л культуры, могут быть предпочтительными. Антитела, продуцируемые отдельными клонами клеток, также могут быть проверены на мутность, фильтрационные свойства, электрофорезом в полиакриламидном геле (PAGE), изоэлектрическим фокусированием (IEF), УФ-сканированием, гель-фильтрацией (HP-SEC), картированием углеводов и олигосахаридов, масс-спектрометрией и анализом связывания, таким как ELISA или Biacore. Отобранный клон можно держать во многих флаконах и хранить в замороженном виде для последующего использования.

[0142] После экспрессии антитела могут быть очищены в соответствии со стандартными процедурами в данной области техники, включая способ, основанный на применении белка А для захвата, колоночную хроматографию (например, гидрофобное взаимодействие или ионный обмен), применение низкого значения pH для инактивации вирусов и тому подобное (см. для общего представления Scopes, Protein Purification (Springer-Verlag, NY, 1982)).

[0143] Способы коммерческого производства антител, включая оптимизацию кодонов, подбор промоторов, элементов транскрипции и терминаторов, одноклеточное клонирование в бессывороточной среде, сохранение клеток, использование маркеров селекции для амплификации числа копий, СНО-терминатор, одноклеточное клонирование в бессывороточной среде, улучшение белковых титров (см, например, патент США 5786464, патент США 5888809, патент США 6063598, патент США 6114148, патент США 7569339, WO 2004/050884, WO 2005/019442, WO 2008/012142, WO 2008/012142, WO 2008/107388 и WO 2009/027471).

Е. Нуклеиновые кислоты

[0144] Настоящее изобретение дополнительно относится к нуклеиновым кислотам, кодирующим любую из тяжелых и легких цепей, описанных выше. Как правило, нуклеиновые кислоты также кодируют сигнальный пептид, слитый со зрелыми тяжелыми и легкими цепями (например, сигнальные пептиды, имеющие аминокислотные последовательности SEQ ID NO:29, 31 и 41, которые могут быть закодированы последовательностями SEQ ID NO:28, 30 и 40). Кодирующие последовательности нуклеиновых кислот может быть функционально связаны с регуляторными последовательностями, такими как промотор, энхансер, сайт связывания с рибосомой, сигнал терминации транскрипции и тому подобное, чтобы обеспечить экспрессию кодирующих последовательностей. Нуклеиновые кислоты, кодирующие тяжелую и легкую цепи, могут находиться в изолированной форме или могут быть клонированы в одном или более векторе. Нуклеиновые кислоты могут быть синтезированы, например, твердофазным синтезом или с помощью ПЦР перекрывающихся олигонуклеотидов. Нуклеиновые кислоты, кодирующие тяжелую и легкую цепи, могут быть соединены в одну непрерывную нуклеиновую кислоту, например, в экспрессирующем векторе, или могут находиться раздельно, например, каждая клонирована в своем собственном векторе экспрессии.

V. ТЕРАПЕВТИЧЕСКИЕ ПРИМЕНЕНИЯ

[0145] Настоящее изобретение относится к нескольким способам лечения или осуществления профилактики болезни с тельцами Леви у пациентов, страдающих таким заболеванием или подверженных риску развития такого заболевания. Пациенты, поддающиеся лечению, включают лиц, подвергающихся риску развития заболевания LBD, но без симптомов, а также пациентов, имеющих в настоящее время симптомы или ранние предупреждающие знаки синуклеинопатии, например, замедление EEG, психоневрологические проявления (депрессия, слабоумие, галлюцинации, беспокойство, апатия, ангедония), вегетативные изменения (ортостатическая гипотензия, нарушения функции мочевого пузыря, запоры, недержание кала, слюнотечение, дисфагия, сексуальная дисфункция, изменения в мозговом кровотоке), сенсорные изменения (в обонянии, ощущении боли, необычные ощущения в цветоразличении), нарушения сна (нарушения поведения во время REM-стадии сна (RBD), синдром беспокойных ног/периодические движения конечностей, сонливость, бессонница) и различные другие признаки и симптомы (утомляемость, двоение в глазах, ухудшение зрения, себорея, потеря веса/набор веса). Поэтому настоящие способы можно применять профилактически для лиц, у которых имеется известный генетический риск развития LBD. К таким лицам относятся те, которые имеют родственников, переживших данную болезнь, и те, чей риск определяется анализом генетических или биохимических маркеров. Генетические маркеры риска в отношении PD включают мутации в генах альфа-синуклеина или паркина, UCHLI и CYP2D6; в частности, мутации в положениях 30 и 53 гена альфа-синуклеина. Лица, в настоящее время страдающие от болезни Паркинсона, могут быть распознаны на основе ее клинических проявлений, включая остаточный тремор, ригидность мышц, брадикинезию и постуральную нестабильность.

[0146] У бессимптомных пациентов лечение может начаться в любом возрасте (например, в возрасте 10-ти, 20-ти, 30-ти лет). Однако, обычно не следует начинать лечение до тех пор, пока пациент не достигнет 40, 50, 60 или 70 лет. Лечение, как правило, влечет за собой множество дозировок в течение определенного периода времени. Лечение может контролироваться анализом антител или ответов активированных Т-клеток или В-клеток на терапевтический агент (например, укороченная форма пептида альфа-синуклеина) с течением времени. Если ответ падает, назначается усиленная дозировка.

[0147] Антитела могут быть использованы для лечения или осуществления профилактики болезни с тельцами Леви у пациентов введением в условиях, которые генерируют положительный терапевтический ответ у пациента (например, уменьшение агрегатов альфа-синуклеина в нейритах и/или в аксонах, снижение нейритической дистрофии, улучшение когнитивных функций и/или обращение, лечение или профилактика когнитивных нарушений) у пациента. Согласно некоторым способам, области нейритической дистрофии в нейропиле коры головного мозга и/или базальных ганглиев у пациентов, получавших лечение, могут уменьшиться в среднем по меньшей мере на 10%, 20%, 30% или 40%, в сравнении с контрольной группой.

[0148] Когнитивные нарушения, прогрессирующее снижение когнитивных функций, изменения в морфологии мозга, а также изменения в цереброваскулярной функции обычно наблюдаются у пациентов, страдающих болезнью с тельцами Леви или подверженных риску развития данного заболевания. Введение настоящих антител может ингибировать или задерживать снижение когнитивной функции у таких больных.

[0149] Настоящее изобретение дополнительно относится к способам сохранения или увеличения синаптической плотности и/или дендритной плотности. Индекс изменений в синаптической или дендритной плотности может быть измерен маркерами формирования синапсов (синаптофизин) и/или дендритов (МАР2). Согласно некоторым способам, синаптическая или дендритная плотность может быть восстановлена до уровня синаптической или дендритной плотности у здорового человека. Согласно некоторым способам, средний уровень синаптической или дендритной плотности у пациентов, получавших лечение, может быть повышен на 5%, 10%, 15%, 20%, 25%, 30% или более по сравнению с группой контрольных пациентов, не получавших лечение.

VI. ФАРМАЦЕВТИЧЕСКИЕ КОМПОЗИЦИИ И СПОСОБЫ ЛЕЧЕНИЯ

[0150] В профилактических целях антитело или агент для индукции антитела или фармацевтическую композицию антитела или агента для индукции антитела вводят пациенту, подверженному заболеванию или в противном случае находящемуся под угрозой развития заболевания, в соответствии со схемой лечения (доза, частота и способ введения), эффективной для того, чтобы уменьшить риск, снизить тяжесть или задержать начало по меньшей мере одного признака или симптома заболевания. При некоторых профилактических применениях данная схема лечения является эффективной для ингибирования или задержки накопления альфа-синуклеина и усеченных фрагментов в головном мозге и/или для того, чтобы ингибировать или задержать его токсическое действие и/или ингибировать/или задержать развитие нарушений поведения. В терапевтических целях антитело или агент для индукции антитела вводят пациенту с подозрением на болезнь с тельцами Леви или уже страдающему заболеванием с тельцами Леви, в соответствии со схемой лечения (доза, частота и способ введения), эффективной для улучшения или, по меньшей мере, задержки дальнейшего ухудшения по меньшей мере одного признака или симптома заболевания. В некоторых терапевтических применениях схема лечения является эффективной для снижения или, по меньшей мере, ингибирования дальнейшего увеличения уровней альфа-синуклеина и усеченных фрагментов, связанных с этим токсичностей и/или нарушений поведения.

[0151] Схема лечения считается терапевтически или профилактически эффективной, если для пациента, получавшего индивидуальное лечение, достигается более благоприятный исход, чем средний результат в контрольной группе сравниваемых пациентов, не получавших лечение с помощью способов по настоящему изобретению, или если более благоприятный исход показан для получавших лечение пациентов в сравнении с пациентами контрольной группы в контролируемых клинических испытаниях (например, фаза II, фаза II/III или стадия III испытания) на уровне р<0,05 или 0,01 или даже 0,001.

[0152] Эффективные дозы варьируют в зависимости от многих факторов, включая способ введения, участок-мишень, физиологическое состояние пациента, включая тип болезни с тельцами Леви, такие факторы, как является ли пациент носителем АроЕ, является ли пациент человеком или животным, вводились ли другие препараты и является ли лечение профилактическим или терапевтическим.

[0153] Примерный диапазон дозировок для антител составляет от около 0,01 до 5 мг/кг и чаще от 0,1 до 3 мг/кг или от 0,15 до 2 мг/кг или от 0,15 до 1,5 мг/кг от массы тела пациента. Такие дозы антитела можно вводить ежедневно, через день, еженедельно, раз в две недели, ежемесячно, ежеквартально или в соответствии с любым другим графиком, определенным эмпирическим анализом. Пример лечения включает введение многократных дозировок в течение длительного периода, например, по меньшей мере на протяжении шести месяцев. Дополнительные примеры схем лечения включают введение один раз каждые две недели или один раз в месяц или один раз в каждые от 3 до 6 месяцев.

[0154] Антитела могут быть введены через периферийный путь (то есть, путь, по которому введенное или индуцированное антитело пересекает гематоэнцефалический барьер, чтобы достичь предназначенный участок в головном мозге). Способы введения включают в себя топикальный, внутривенный, пероральный, подкожный, внутриартериальный, внутричерепной, интратекальный, внутрибрюшинный, интраназальный или внутримышечный. Некоторые пути для введения антител представляют собой внутривенное и подкожное введение. Такой тип инъекции чаще всего выполняют в мышцы руки или ноги. Согласно некоторым способам, агенты вводят непосредственно в определенную ткань, где накоплены отложения, например, внутричерепной инъекцией.

[0155] Фармацевтические композиции для парентерального введения могут быть стерильными и по существу изотоническими и изготовленными в условиях GMP (должной медицинской практики (Good Manufacturing Practice)). Фармацевтические композиции могут быть представлены в стандартной лекарственной форме (например, дозировка для однократного введения). Фармацевтические композиции могут быть приготовлены с использованием одного или нескольких физиологически приемлемых носителей, разбавителей, наполнителей или вспомогательных веществ. Состав зависит от выбранного пути введения. Для инъекции антитела могут быть приготовлены в водных растворах, предпочтительно в физиологически совместимых буферах, таких как раствор Хэнкса, раствор Рингера или физиологический раствор или ацетатный буфер (чтобы уменьшить дискомфорт в месте инъекции). Раствор может содержать вспомогательные агенты, такие как суспендирующие, стабилизирующие и/или диспергирующие агенты. Альтернативно, антитела могут быть в лиофилизированной форме для смешивания перед использованием с подходящим носителем, например, стерильной апирогенной водой.

[0156] Настоящие назначения можно вводить в сочетании с другим агентом, эффективным в лечении или профилактике болезни, которую лечат. Например, в случае болезни Паркинсона, иммунотерапевтические препараты против альфа-синуклеина WO/2008/103472, леводопа, агонисты дофамина, ингибиторы СОМТ, ингибиторы МАО-В, амантадин или антихолинергические агенты могут быть использованы в сочетании с настоящими назначениями.

VII. ДРУГИЕ ПРИМЕНЕНИЯ

[0157] Антитела, описанные выше, могут применяться для обнаружения альфа-синуклеина в контексте клинической диагностики или лечения или в исследовании. Антитела также могут продаваться как исследовательские реагенты для лабораторных исследований с целью выявления клеток, несущих альфа-синуклеин, и их реакции на различные раздражители. В таких применениях моноклональные антитела могут быть помечены флуоресцентными молекулами, спин-мечеными молекулами, ферментами или радиоизотопами, и могут предоставляться в виде комплекта со всеми реагентами, необходимыми для выполнения анализа на альфа-синуклеин. Антитела также могут применяться для очистки альфа-синуклеина, например, аффинной хроматографией.

[0158] Антитела могут применяться для обнаружения LB у пациента. Такие способы могут применяться для диагностики или подтверждения диагноза PD или другого заболевания, связанного с наличием LB в мозге или предрасположенности к этому.

Например, данные способы могут применяться для пациента с симптомами деменции. Если пациент имеет LB, то пациент, скорее всего, страдает заболеванием с тельцами Леви, таким как болезнь Паркинсона. Данные способы также могут применяться у бессимптомных пациентов. Наличие телец Леви или других аномальных отложений альфа-синуклеина указывает на восприимчивость к будущей симптоматической болезни. Данные способы также могут применяться для мониторинга прогрессирования заболевания и/или ответа на лечение у пациентов, у которых ранее была диагностирована болезнь с тельцами Леви.

[0159] Данные способы можно осуществлять введением антитела с последующим обнаружением антитела после того, как оно связалось. При желании, можно избежать выведения антитела из организма, используя фрагмент антитела, у которого отсутствует полноразмерная константная область, например, Fab. Согласно некоторым способам, одно и то же антитело может служить в качестве реагента как для лечения, так и для диагностики.

[0160] Для диагностики (например, in vivo изображение), антитела можно вводить внутривенной инъекцией в тело пациента, или непосредственно в мозг внутричерепной инъекцией, или просверлив отверстие в черепе. Дозировка реагента должна быть в пределах тех же диапазонов, что и для способов лечения. Как правило, антитело помечено, хотя, согласно некоторым способам, антитело является немеченым и реагент для вторичного мечения используют для связывания с антителом. Выбор метки зависит от средства обнаружения. Например, флуоресцентная метка подходит для оптического обнаружения. Использование парамагнитных меток подходит для томографического обнаружения без хирургического вмешательства. Радиоактивные метки также могут быть обнаружены с помощью PET или SPECT.

[0161] Диагностика проводится путем сравнения количества, размера и/или интенсивности меченых локусов с соответствующими значениями базовой линии. Значения базовой линии могут представлять средние уровни в группе незаболевших индивидов. Значения базовой линии также могут представлять предыдущие уровни, определенные у того же пациента. Например, значения базовой линии можно определить у пациента до начала лечения, а измеренные после этого значения сравнить со значениями базовой линии. Уменьшение значений относительно базовой линии сигнализирует о положительном ответе на лечение.

[0162] Данные антитела могут применяться для генерирования антиидиотипических антител (смотри, например, Greenspan & Bona, FASEB J. 7(5):437-444, 1989; и Nissinoff, J. Immunol. 147:2429-2438, 1991). Такие антиидиотипические антитела могут применяться в фармакокинетике, фармакодинамике, исследованиях по биораспределению, а также в исследованиях клинических ответов человеческих античеловеческих антител (human-anti-human antibody (НАНА)) у лиц, получавших антитела. Например, антиидиотипические антитела специфически связываются с вариабельной областью гуманизированных антител 1Н7, и, следовательно, могут применяться для обнаружения гуманизированных антител 1Н7 в фармакокинетических исследованиях и для количественного определения ответов человеческого античеловеческого антитела (НАНА) у прошедших лечение индивидов.

[0163] Все заявки на патенты, сайт, другие публикации, номера доступа и т.п., упоминавшееся выше или ниже, включены посредством ссылки во всей их полноте для всех целей в той же степени, как если бы для каждого отдельного предмета было указано, что он конкретно и отдельно должен быть включен посредством ссылки. Если различные версии последовательности связаны с номерами доступа, выданными в разное время, то имеется в виду версия, связанная с номером доступа на действительную дату подачи данной заявки. Действительная дата подачи заявки означает более раннюю из двух дат, а именно фактической даты подачи или даты подачи приоритетной заявки со ссылкой на номер доступа, если это применимо. Аналогичным образом, если различные версии публикации, веб-сайта и т.п. опубликованы разное время, подразумевается версия, опубликованная наиболее близкая по времени публикации к действительной даты подачи заявки, если не указано иное. Любой признак, стадия, элемент, осуществление или аспект настоящего изобретения могут применяться в сочетании с любым другим, если специально не указано иное. Хотя настоящее изобретение было описано достаточно подробно с приведением иллюстраций и примеров для достижения ясности и понимания, очевидно, что объем прилагаемой формулы изобретения допускает осуществление определенных изменений и модификаций.

ПРИМЕРЫ

Пример I. Проектирование гуманизированных антител 1Н7

[0164] Отправная точка или антитело-донор для гуманизации представляет собой мышиное антитело 1Н7, продуцируемое гибридомой, имеющей номер доступа АТСС РТА-8220 и описанной в заявке на патент США №11/710248, опубликованной как US 2009/0208487. Полные аминокислотная и нуклеиновокислотная последовательности вариабельной области тяжелой цепи m1H7 представлены как SEQ ID NO:4 и 5, соответственно. Полные аминокислотная и нуклеиновокислотная последовательности вариабельной области легкой цепи m1H7 представлены как SEQ ID NO:6 и 7, соответственно. Аминокислотная и нуклеиновокислотная последовательности вариабельной области тяжелой цепи зрелого m1H7 представлены как SEQ ID NO:8 и 9, соответственно. Аминокислотная и нуклеиновокислотная последовательности вариабельной области легкой цепи зрелого m1H7 представлены как SEQ ID NO:10 и 11, соответственно. Аминокислотные последовательности CDR1, CDR2 и CDR3 тяжелой цепи представлены как SEQ ID NO:12, 13 и 14, соответственно. Аминокислотные последовательности CDR1, CDR2 и CDR3 легкой цепи представлены как SEQ ID NO:15, 16 и 17, соответственно. Система нумерации по Кабату (Kabat) используется во всем данном примере.

[0165] Вариабельная каппа (Vk) из m1H7 принадлежит мышиной подгруппе 3 (по Кабату), что соответствует человеческой подгруппе 1 (по Кабату). Вариабельная тяжелая цепь (Vh) из 1Н7 принадлежит мышиной подгруппе 5а (по Кабату), которая соответствует человеческой подгруппе 1 (по Кабату) (Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition. NIH Publication No.91-3242, 1991). 15-й остаток CDR-L1 принадлежит каноническому классу 5 (обратите внимание, что метионин в положении 33, как правило, соответствует лейцину в данном классе), 7-й остаток CDR-L2 принадлежит каноническому классу 1, 9-й остаток CDR-L3 принадлежит каноническому классу 1 в Vk (Martin & Thornton, J Mol Biol. 263:800-15, 1996). 5-й остаток CDR-H1 принадлежит каноническому классу 1, 17-й остаток CDR-H2 принадлежит каноническому классу 2 (Martin & Thornton, J Mol Biol. 263:800-15, 1996). CDR-H3 не имеет канонических классов, но петля из 8-ми остатков, вероятно, имеет изогнутое основание в соответствии с правилами Shirai et al., FEBS Lett. 455:188-97 (1999).

[0166] Остатки на интерфейсе между доменами Vh и Vk представляют собой обычно встречаемые аминокислотные остатки, за исключением того, что F46 в каппа-цепи, как правило, является остатком лейцина. Это делает данную позицию кандидатом для обратной мутации. Для того чтобы найти структуры, которые обеспечили бы приблизительную структурную модель 1Н7, был проведен поиск по белковым последовательностям в базе данных PDB (Deshpande et al., Nucleic Acids Res. 33: D233-7, 2005). Антитело 0.5B анти-HIV имеет в целом хорошее сходство с последовательностью Vk 1Н7, сохраняя те же канонические структуры для петель. ЯМР-структура антитела 0.5 В анти-HIV (pdb код 1QNZ; Tugarinov et al., Structure 8:385-95, 2000) была использована для структуры Vk в моделировании. Антитело против альфа-(2→8)-полисиаловой кислоты имеет в целом хорошее сходство последовательности со структурой Vh 1Н7. Оно также имеет область CDR-H3 аналогичной длины с изогнутым основанием. Структура антитела против альфа-(2→8)-полисиаловой кислоты (1PLG; Evans et al., Biochemistry 34:6737-44, 1995) имеет разумное разрешение (2,8 ангстрем), и была использована для структуры Vh в моделировании. Кроме того, CDR-H1 и CDR-H2 из антитела против альфа-(2→8)-полисиаловой кислоты имеют те же канонические структуры, что и Vh 1Н7. DeepView/Swiss-PdvViewer 3.7 (SP5) (Guex & Peitsch, Electrophoresis 18: 2714-2723, 1997) был использован для моделирования грубой структуры 1H7fv.

[0167] Поиск в базе данных из NCBI неповторяющихся белковых последовательностей позволил отобрать подходящие человеческие каркасные участки, в которые можно ввести мышиные CDR. Для Vk была выбрана человеческая легкая цепь каппа с NCBI кодом доступа AAY33358 (GI: 63102905; SEQ ID NO:43). (Kramer et al., Eur J Immunol. 35:2131-45, 2005). Она имеет те же канонические классы для CDR-L2 и CDR-L3 и принадлежит каппе зародышевой линии А30 человека, члену подгруппы 1 каппа человека по Кабату. Последовательность AAY33358 имеет 65,4% идентичности в каркасном участке вариабельной области легкой цепи с легкой цепью мышиного 1Н7. Для Vh была выбрана тяжелая цепь человеческого Ig ВАС02037 (GI: 21670055; SEQ ID NO:42), принадлежащая к тяжелой цепи человеческой зародышевой линии VH1-18. Она является членом подгруппы 1 человеческой тяжелой цепи по Кабату. Она разделяет каноническую форму CDR-H1 и CDR-H2 из 1Н7, и Н3 состоит из 8 остатков с предсказанным изогнутым основанием. Последовательность ВАС02037 имеет 65,8% идентичности в каркасном участке вариабельной области с тяжелой цепью мышиного 1Н7. Последовательности вариабельных областей гуманизированных тяжелой и легкой цепей 1Н7, не имеющие обратных мутаций или CDR-мутаций, представлены как последовательности SEQ ID NO:44-45.

[0168] Были построены четыре варианта вариабельной области гуманизированной легкой цепи и пять вариантов вариабельной области гуманизированной тяжелой цепи, содержащих различные перестановки вышеупомянутых замен (Hu1H7VLv1-v4; SEQ ID NO:32-39, и Hu1H7VHv1-v5; SEQ ID NO:18-27, соответственно) (фигуры 1-2 и таблица 1). Последовательности SEQ ID NO.19, 21, 23, 25, 27, 33, 35, 37 и 39 включают в себя обратные мутации, как показано в таблице 1. Кроме того, две гуманизированные тяжелые цепи (SEQ ID NO:25, 27) включают в себя мутацию C→S в положении Н97 (система нумерации по Кабату) из CDR3 тяжелой цепи (фигуры 1-2 и таблица 1). Аминокислотные остатки в положениях L46, L49, L83, Н11, Н28, Н38, Н48, Н67, Н69, Н71, Н91 и Н97 в Hu1H7VLv1-v4 и Hu1H7VHv1-v5 приведены в таблице 2.

[0169] Было обнаружено, что вариант H3L3 (hu1H7VHv3 (SEQ ID NO:23)-Hu1H7VLv3 (SEQ ID NO:37) дает самое низкое значение константы диссоциации (самое высокое значение константы ассоциации), такое же, как и мышиный 1Н7, в пределах SEM.

[0170] Обоснования для отбора указанных позиций в качестве кандидатов для замены состоят в следующем.

[0171] L46F (здесь, как и везде для обратных мутаций в каркасном участке, упоминаемый первым остаток представляет собой человеческий остаток и второй остаток является мышиным): Данная позиция соответствует остаткам интерфейса Vk/Vh.

[0172] Y49C: остаток цистеина в данном положении является необычным как в мышиной, так и в человеческой последовательности. Занимая положение в центре антигенсвязывающего сайта, данный остаток может связывать антиген или поддерживать конформацию петель.

[0173] F83A: В человеческом каркасном участке данную позицию занимает остаток фенилаланина, аминокислоты большего размера. Поэтому А83 был бы необычен в человеческих каркасных участках. В гуманизированном антителе константный домен будет человеческим, а не мышиным, так что человеческий F83 был бы обычен. Однако, данная позиция в Vk находится в непосредственной близости к константному домену и может помешать упаковке напротив константной области. Поэтому было бы интересно мутировать его обратно до А, чтобы убедиться в том, есть ли различие.

[0174] V11L: Данная позиция контактирует с константным доменом и поэтому может изменять топографию сайта связывания.

[0175] T28S: Данная позиция способствует конформации CDR-H1, но может также связывать антиген. Мутация T→S представляет собой консервативную мутацию.

[0176] R38K: Данная позиция лежит под CDR-H2, взаимодействуя с F63 в модели. Мутация R→K представляет собой консервативную мутацию.

[0177] M48I: Данная позиция находится под F63 в CDR-H2 в модели. Мутация М-I представляет собой консервативную мутацию.

[0178] V67A: Данная позиция лежит под CDR-H2. Мутация V→A не является консервативной мутацией.

[0179] M69L: Данная позиция лежит под CDR-H2. Мутация M→L представляет собой консервативную мутацию.

[0180] Т71А: Данная позиция соответствует каноническому остатку для CDR-H2. Мутация Т→А не является консервативной мутацией.

[0181] Y91F: Данная позиция соответствует аминокислотному остатку интерфейса, взаимодействующему с Р44 в легкой цепи. Мутация Y→F представляет собой консервативную мутацию.

[0182] C97S: Данная CDR-мутация в CDRH3 позволяет избежать посттрансляционной модификации цистеина.

[0183]> Hu1H7Vκ Версия 1

[0184]> Hu1H7Vκ Версия 2

[0185]> Hu1H7Vκ Версия 3

[0186]> Hu1H7Vκ Версия 4

[0001] >Hu1H7vh Версия 1

[0002] >Hu1H7vh Версия 2

[0003] >Hu1H7vh Версия 3

[0004] >Hu1H7vh Версия 4

[0005] >Hu1H7vh Версия 5

Пример II. Кинетический анализ связывания мышиных, химерных и гуманизированных антител 1Н7

[0192] Были охарактеризованы кинетики связывания гуманизированных антител 1Н7, содержащих тяжелую цепь, выбранную из Hu1H7VHv1-5, и легкую цепь, выбранную из Hu1H7VLv1-4.

[0193] Полный кинетический анализ связывания антител методом Biacore проводили с помощью прибора Biacore. Деталированные кинетические параметры связывания (скорость ассоциации, ka, скорость диссоциации, kd, и константа сродства, KD) были определены для мышиного 1Н7 (фиг. 3А), химерного 1Н7 (фиг. 3В) и гуманизированных 1Н7 (Hu1H7VHv3-Hu1H7VLv3, Hu1H7VHv3-Hu1H7VLv1, Hu1H7VHv4-Hu1H7VLv1) антител (фиг. 3С). Кинетические параметры связывания гуманизированных 1Н7, в частности, Hu1H7VHv3-Hu1H7VLv3, сопоставимы с таковыми для мышиного 1Н7.

[0194] Кинетические параметры связывания гуманизированных антител 1Н7 также были измерены бислойной интерферометрией (BLI) с использованием прибора ForteBio Октет QK (ForteBio, Menlo Park, СА). Деталированные кинетические параметры связывания (скорость ассоциации, кажущаяся ka, скорость диссоциации, кажущаяся kd, и константа сродства, кажущаяся KD) были определены для химерного 1Н7 и различных гуманизированных антител 1Н7 (таблицы 6-7, фигуры 4А-С). Кажущаяся ka, кажущаяся kd и кажущаяся KD представляют собой кинетические параметры связывания, полученные с использованием форматов анализа с помощью прибора ForteBio. Данные параметры отличаются от ka, kd и KD, измеряемых с помощью анализов по методу Biocore вследствие, например, эффектов авидности, связанных с форматами анализов на приборе ForteBio.

[0195] Гуманизированные антитела 1Н7, в частности, Hu1H7VHv3-Hu1H7VLv3 и Hu1H7VHv3-Hu1H7VLv1, окрашивали различные области (например, полосатое тело, пирамидальный слой клеток, кору головного мозга, черную субстанцию) мозга трансгенной или нетрансгенной мыши, аналогично мышиному 1Н7.

ПРИМЕР II. Пассивная иммунизация антителами к α-синуклеину

[0196] Целью данного эксперимента является определение эффективности антител против α-синуклеина в in vitro и in vivo исследованиях, а также проведение поведенческих тестов. Авторы использовали самок трансгенных мышей, экспрессирующих α-синуклеин (Line 61), самок мышей с нокаутом гена α-синуклеина и самок мышей дикого типа, в возрасте 3-4 месяца в момент инициации и n=14/группа. Испытуемые антитела включали 9Е4 (IgG1, эпитоп: аминокислотные остатки 118-126 из альфа-синуклеина), 5С1 (IgG1, эпитоп: аминокислотные остатки 118-126 из альфа-синуклеина, с-линкер), 5D12, IgG2 (SN118-126), 1Н7, IgG1 (SN 91-99) и контрольное IgG1 антитело 27-1. Мыши получали дозу в 10 мг/кг в течение 5 месяцев, в общей сложности 21 инъекций. Кроме того, животным вводили лентивирус (LV), экспрессирующий человеческий α-синуклеин (дикий тип) односторонним введением человеческого α-синуклеина (дикий тип) в гиппокамп.

[0197] Антитела для количественного анализа включают таковые от Chemicon (эпитоп: полноразмерный альфа-синуклеин), Millipore (эпитоп: полноразмерный альфа-синуклеин) и Neotope, ELADW 105 (эпитоп: аминокислотные остатки 121-124 полноразмерного альфа-синуклеина).

[0198] Конечные точки: Титры антител измеряли на протяжении фазы жизни. Поведенческие анализы включают тест водного лабиринта Морриса (Morris Water Maze test (MWW)) и тест с горизонтальной балкой. Тест с круглой балкой представляет собой проверку баланса при движении, координации и походки, проводимый с использованием двух балок различного диаметра. Балка А имеет больший диаметр (проще, считается балкой для обучения), и балка D имеет меньший диаметр (сложнее, считается балкой для тестирования). Данные представлены в виде "ошибок" (количество промахов/10 см) и "скорости" (время, затраченное на прохождение 10 см/сек). Определение производительности в водном лабиринте проводили через 10 недель после начала исследования и в конце исследования. Были выполнены следующие невропатологические измерения: агрегация альфа-синуклеина, синаптофизин и МАР2. Были выполнены следующие биохимические измерения: альфа-синуклеин, PSD95, синаптофизин. Селективное мультимаркирование и маркирование для конфокальной микроскопии проводили с использованием синаптических, нейрональных и глиальных маркеров.

[0199] Результаты показали, что воздействие всех антител, за исключением 5D12, приводило к значительному снижению накопления α-синуклеина и сохранению синаптических и дендритных плотностей, а также положительным результатам в производительности теста MWM. Антитело 9Е4 эффективно в in vitro и in vivo исследованиях, а также в поведенческих тестах. Показания свидетельствуют о том, что антитело может уменьшить нейритные/аксональные агрегаты альфа-синуклеина.

[0200] Поведенческие результаты: Антитело 1Н7 (а также антитела 9Е4 и 5С1) улучшило производительность при выполнении теста в водном лабиринте у трансгенных мышей, экспрессирующих α-синуклеин, в то время как 5D12 не подействовало. Антитела 9Е4 и 1Н7 улучшили производительность в тесте с балкой, измеренную как по скорости, так и по ошибкам, в то время как антитела 5D12 и 5С1 не подействовали (фиг. 6).

[0201] Невропатологические результаты: Антитела 9Е4, 1Н7 и 5С1 уменьшили ELADW-105 положительную нейритную дистрофию, в то время как антитело 5D12 не подействовало. В трансгенных мышах, экспрессирующих α-синуклеин, антитело 9Е4 уменьшило площадь нейропиля на 43% в коре головного мозга и на 40% в базальных ганглиях, по сравнению с контролем. Антитело 9Е4 также сохраняло синаптофизин и МАР2 в неокортексе и базальных ганглиях.

ДЕПОЗИТ

[0202] Следующие клеточные линии, продуцирующие моноклональные антитела, были депонированы следующим международным депозитарием: American Type Culture Collection (АТСС, P.O. Box 1549, Manassas, VA 20108), в соответствии с положениями Будапештского договора о международном признании депонирования микроорганизмов для целей патентной процедуры, в указанные даты:

[0203] Любому специалисту в данной области техники очевидно, что в данное описание могут быть внесены многие изменения и модификации без отхода от сущности или объема прилагаемой формулы изобретения. Если из контекста не очевидно иное, любая(ой) стадия, признак, осуществление, или аспект может быть использован в сочетании с любым другим. Все публикации и патентные заявки, упомянутые в данном описании, включены посредством ссылки в той же степени, как если бы каждая отдельная публикация или патентная заявка были конкретно и индивидуально указаны как включенные сюда посредством ссылки.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

SEQ ID NO:l Природный человеческий альфа-синуклеин дикого типа

SEQ ID NO:2 Домен неамилоидного компонента (NAC) альфа-синуклеина по сообщению Jensen et al.

SEQ ID NO:3 Домен неамилоидного компонента (NAC) альфа-синуклеина по сообщению Uéda et al.

SEQ ID NO:4 Нуклеотидная последовательность вариабельной области тяжелой цепи антитела m1H7 (сигнальный пептид подчеркнут, CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:5 Аминокислотная последовательность вариабельной области тяжелой цепи антитела m1H7 (сигнальный пептид подчеркнут, CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:6 Нуклеотидная последовательность вариабельной области легкой цепи антитела m1H7 (сигнальный пептид подчеркнут, CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:7 Аминокислотная последовательность вариабельной области легкой цепи антитела m1H7 (сигнальный пептид подчеркнут, CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:8 Нуклеотидная последовательность вариабельной области зрелой тяжелой цепи антитела m1H7 (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:9 Аминокислотная последовательность вариабельной области зрелой тяжелой цепи антитела m1H7 (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:10 Нуклеотидная последовательность вариабельной области зрелой легкой цепи (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:11 Аминокислотная последовательность вариабельной области зрелой легкой цепи антитела m1H7 (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:12 CDR1 тяжелой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:13 CDR2 тяжелой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:14 CDR3 тяжелой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:15 CDR1 легкой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:16 CDR2 легкой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:17 CDR3 легкой цепи антитела m1H7 (определение по Кабату)

SEQ ID NO:18 Hu1H7VHv1 (нуклеотидная посл.)

SEQ ID NO:19 Hu1H7VHv1 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:20 Hu1H7VHv2 (нуклеотидная посл.)

SEQ ID NO:21 Hu1H7VHv2 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:22 Hu1H7VHv3 (нуклеотидная посл.)

SEQ ID NO:23 Hu1H7VHv3 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:24 Hu1H7VHv4 (нуклеотидная посл.)

SEQ ID NO:25 Hu1H7VHv4 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:26 Hu1H7VHv5 (нуклеотидная посл.)

SEQ ID NO:27 Hu1H7VHv5 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:28 Сигнальный пептид Hu1H7VH (нуклеотидная посл.)

SEQ ID NO:29 Сигнальный пептид Hu1H7VH (аминокислотная посл.)

SEQ ID NO:30 Сигнальный пептид HulH7VH (нуклеотидная посл.)

SEQ ID NO:31 Сигнальный пептид Hu1H7VH (аминокислотная посл.)

SEQ ID NO:32 Hu1H7VLv1 (нуклеотидная посл.)

SEQ ID NO:33 Hu1H7VLv1 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:34 Hu1H7VLv2 (нуклеотидная посл.)

SEQ ID NO:35 Hu1H7VLv2 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:36 Hu1H7VLv3 (нуклеотидная посл.)

SEQ ID NO:37 Hu1H7VLv3 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:38 Hu1H7VLv4 (нуклеотидная посл.)

SEQ ID NO:39 Hu1H7VLv4 (аминокислотная посл.) (CDR выделены жирным шрифтом и подчеркнуты)

SEQ ID NO:40 Сигнальный пептид Hu1H7VL (нуклеотидная посл.)

SEQ ID NO:41 Сигнальный пептид Hu1H7VL (аминокислотная посл.)

SEQ ID NO:42 ВАС02037 (GI-21670055) Человеческая акцепторная последовательность, используемая для каркасного участка тяжелой цепи. Аминокислотная посл.

SEQ ID NO:43 AAY33358 GI-63102905) Человеческая акцепторная последовательность, используемая для каркасного участка легкой цепи Аминокислотная посл.

SEQ ID NO:44 Hu1H7VH без обратной мутации или мутации в CDR

SEQ ID NO:45 Hu1H7VL без обратной мутации или мутации в CDR

SEQ ID NO:46 Альтернативные варианты Hu1H7VH

где -X1- представляет собой V или L; -Х2- представляет собой S или Т; -Х3- представляет собой R или К; -Х4- представляет собой М или I; -Х5- представляет собой V или А; -Х6- представляет собой М или L; -Х7- представляет собой Т или A; -X8- представляет собой Y или F; -Х9- представляет собой С или S.

SEQ ID NO:47 Альтернативные варианты Hu1H7VL

где -Z1 представляет собой L или F; -Z2- представляет собой Y или С; -Z3- представляет собой F или А.

SEQ ID NO:48 Альтернативные варианты CDR3 Hu1H7VH

где -Х9- представляет собой С или М или S или Т, предпочтительно С.

SEQ ID NO:49 Константная область гуманизированной легкой цепи 1Н7 (с R) (общая для v1-v4)

SEQ ID NO:50 Константная область гуманизированной тяжелой цепи 1Н7 (общая для v1-v5) IgG1

SEQ ID NO:51 Константная область гуманизированной легкой цепи 1Н7 (без R) (общая для v1-v5)

SEQ ID NO:52 Константная область гуманизированной тяжелой цепи 1Н7 (аллотип G1m3)

SEQ ID NO:53 Версия 3 гуманизированной легкой цепи 1Н7 (вариабельная область+константная область с аргинином)

SEQ ID NO:54 Версия 3 гуманизированной легкой цепи 1Н7 (вариабельная область+константная область без аргинина)

SEQ ID NO:55 Версия 3 гуманизированной тяжелой цепи 1Н7 (вариабельная область+константная область)

SEQ ID NO:56 Версия 3 гуманизированной тяжелой цепи 1Н7 (вариабельная область+константная область, аллотип G1m3)

SEQ ID NO:57 Константная область гуманизированной тяжелой цепи 1Н7 (IgG2)

SEQ ID NO:58 Константная область гуманизированной тяжелой цепи 1Н7 (аллотип G1m1)

1. Антитело, содержащее зрелую вариабельную область тяжелой цепи, содержащую три CDR по Кабату (Kabat), из последовательности SEQ ID NO: 44, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 44, и легкую цепь, содержащую три CDR по Кабату, из последовательности SEQ ID NO: 45, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 45, где антитело специфически связывается с человеческим альфа-синуклеином.

2. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи по меньшей мере на 95% идентична последовательности SEQ ID NO: 44 и зрелая вариабельная область легкой цепи по меньшей мере на 95% идентична последовательности SEQ ID NO: 45.

3. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 98% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 45.

4. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 99% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 45.

5. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность последовательности SEQ ID NO: 44 и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 45.

6. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 98% идентичную последовательности SEQ ID NO: 45.

7. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 99% идентичную последовательности SEQ ID NO: 45.

8. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 95% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 45.

9. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 98% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 98% идентичную последовательности SEQ ID NO: 45.

10. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, по меньшей мере на 99% идентичную последовательности SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, по меньшей мере на 99% идентичную последовательности SEQ ID NO: 45.

11. Антитело по п. 1, при условии, что положение L46 (система нумерации по Кабату (Kabat)) занимает F.

12. Антитело по п. 1, при условии, что положение L49 (система нумерации по Кабату) занимает С.

13. Антитело по п. 1, при условии, что положение L83 (система нумерации по Кабату) занимает А.

14. Антитело по п. 1, при условии, что положение HI 1 (система нумерации по Кабату) занимает L.

15. Антитело по п. 1, при условии, что положение Н28 (система нумерации по Кабату) занимает S.

16. Антитело по п. 1, при условии, что положение Н38 (система нумерации по Кабату) занимает К.

17. Антитело по п. 1, при условии, что положение Н48 (система нумерации по Кабату) занимает I.

18. Антитело по п. 1, при условии, что положение Н67 (система нумерации по Кабату) занимает А.

19. Антитело по п. 1, при условии, что положение Н69 (система нумерации по Кабату) занимает L.

20. Антитело по п. 1, при условии, что положение Н71 (система нумерации по Кабату) занимает А.

21. Антитело по п. 1, при условии, что положение Н91 (система нумерации по Кабату) занимает F.

22. Антитело по п. 1, в котором аминокислотная последовательность зрелой вариабельной области тяжелой цепи представляет собой SEQ ID NO: 44 и аминокислотная последовательность зрелой вариабельной области легкой цепи представляет собой SEQ ID NO: 45, за исключением того, что положение L46 (система нумерации по Кабату) может быть занято L или F, и/или положение L49 (система нумерации по Кабату) может быть занято Y или С, и/или положение L83 (система нумерации по Кабату) может быть занято F или А, и/или положение Н11 (система нумерации по Кабату) может быть занято V или L, и/или положение Н28 (система нумерации по Кабату) может быть занято Т или S, и/или положение Н38 (система нумерации по Кабату) может быть занято R или К, и/или положение Н48 (система нумерации по Кабату) может быть занято М или I, и/или положение Н67 (система нумерации по Кабату) может быть занято V или А, и/или положение Н69 (система нумерации по Кабату) может быть занято М или L, и/или положение Н71 (система нумерации по Кабату) может быть занято Т или А, и/или положение Н91 (система нумерации по Кабату) может быть занято Y или F, и/или Н97 (система нумерации по Кабату) может быть занято С или S, и где антитело специфически связывается с человеческим альфа-синуклеином.

23. Антитело по п. 22, в котором положение Н71 (система нумерации по Кабату) занимает А.

24. Антитело по п. 22, в котором положение Н67 (система нумерации по Кабату) занимает А и положение Н71 (система нумерации по Кабату) занимает А.

25. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F.

26. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С.

27. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает Y.

28. Антитело по п. 22, в котором положение Н67 (система нумерации по Кабату) занимает А, положение Н71 (система нумерации по Кабату) занимает А, положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С.

29. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает положение L и положение Н38 (система нумерации по Кабату) занимает К.

30. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает положение V и положение Н38 (система нумерации по Кабату) занимает R.

31. Антитело по п. 22, в котором положение Н28 (система нумерации по Кабату) занимает S, положение Н48 (система нумерации по Кабату) занимает положение I, Н69 (система нумерации по Кабату) занимает L и положение Н91 (система нумерации по Кабату) занимает F.

32. Антитело по п. 22, в котором положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М и положение Н91 (система нумерации по Кабату) занимает Y.

33. Антитело по п. 22, в котором положение L83 (система нумерации по Кабату) занимает А.

34. Антитело по п. 22, в котором положение L83 (система нумерации по Кабату) занимает F.

35. Антитело по п. 22, в котором положение Н97 (система нумерации по Кабату) занимает S.

36. Антитело по п. 22, в котором положение Н97 (система нумерации по Кабату) занимает С.

37. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С и положение L83 (система нумерации по Кабату) занимает А.

38. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает А.

39. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает F.

40. Антитело по п. 22, в котором положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает F.

41. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает L, положение Н28 (система нумерации по Кабату) занимает S, положение Н38 (система нумерации по Кабату) занимает положение K, Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает С.

42. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает S, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает С.

43. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и положение Н97 (система нумерации по Кабату) занимает С.

44. Антитело по п. 22, в котором положение H11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает S, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает I, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает L, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает F и положение Н97 (система нумерации по Кабату) занимает S.

45. Антитело по п. 22, в котором положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А, положение Н91 (система нумерации по Кабату) занимает Y и положение Н97 (система нумерации по Кабату) занимает S.

46. Антитело, содержащее гуманизированную вариабельную область тяжелой цепи, содержащую три CDR по Кабату из последовательности SEQ ID NO: 44, и гуманизированную вариабельную область легкой цепи, содержащую три CDR по Кабату из последовательности SEQ ID NO: 45, при условии, что положение L46 (система нумерации по Кабату) занимает F и/или положение L49 (система нумерации по Кабату) занимает С, положение Н67 (система нумерации по Кабату) занимает А и положение Н71 (система нумерации по Кабату) занимает А, где антитело специфически связывается с человеческим альфа-синуклеином.

47. Антитело по п. 46, в котором положение Н11 (система нумерации по Кабату) занимает V и положение Н38 (система нумерации по Кабату) занимает R.

48. Антитело по п. 46, в котором положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М и положение Н91 (система нумерации по Кабату) занимает Y.

49. Антитело по п. 46, в котором положение L83 (система нумерации по Кабату) занимает F.

50. Антитело по п. 46, в котором положение Н28 (система нумерации по Кабату) занимает Т, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М, положение Н91 (система нумерации по Кабату) занимает Y и положение L83 (система нумерации по Кабату) занимает F.

51. Антитело по п. 46, в котором положение L83 (система нумерации по Кабату) занимает F, положение H11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А и положение Н91 (система нумерации по Кабату) занимает Y.

52. Антитело, содержащее зрелую вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, по меньшей мере на 90% идентичную последовательности SEQ ID NO: 23, и зрелую вариабельную область легкой цепи, по меньшей мере на 90% идентичную последовательности SEQ ID NO: 37, в котором любые различия в последовательностях CDR зрелой вариабельной области тяжелой цепи и зрелой вариабельной области легкой цепи из последовательностей SEQ ID NO: 23 и 37, соответственно, находятся в положениях от Н60 до Н65 и Н97, и где антитело специфически связывается с человеческим альфа-синуклеином.

53. Антитело по п. 52, в котором зрелая вариабельная область тяжелой цепи содержит три CDR по Кабату из последовательности SEQ ID NO: 23, и зрелая вариабельная область легкой цепи содержит три CDR по Кабату из последовательности SEQ ID NO: 37, и в котором положение Н67 (система нумерации по Кабату) занимает А, положение Н71 (система нумерации по Кабату) занимает А, положение L46 (система нумерации по Кабату) занимает F и положение L49 (система нумерации по Кабату) занимает С.

54. Антитело по п. 53, в котором дополнительно положение L83 (система нумерации по Кабату) занимает F.

55. Антитело по п. 53, в котором дополнительно положение Н97 (система нумерации по Кабату) занимает С.

56. Антитело по п. 52, в котором зрелая тяжелая цепь имеет последовательность, идентичную по меньшей мере на 95% с SEQ ID NO: 23, и зрелая легкая цепь имеет последовательность, идентичную по меньшей мере на 95% с SEQ ID NO: 37.

57. Антитело по п. 52, в котором положение L46 (система нумерации по Кабату) занимает F, положение L49 (система нумерации по Кабату) занимает С, положение L83 (система нумерации по Кабату) занимает F или А, положение Н11 (система нумерации по Кабату) занимает V, положение Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н67 (система нумерации по Кабату) занимает А, положение Н69 (система нумерации по Кабату) занимает М, положение Н71 (система нумерации по Кабату) занимает А и положение Н91 (система нумерации по Кабату) занимает Y.

58. Антитело по п. 57, в котором дополнительно предусмотрено, что положение L83 (система нумерации по Кабату) занимает F.

59. Антитело по п. 57, в котором дополнительно предусмотрено, что положение Н97 (система нумерации по Кабату) занимает С.

60. Антитело по п. 52, при условии, что любые различия между каркасным участком вариабельной области зрелой вариабельной области тяжелой цепи и последовательностью SEQ ID NO: 23 представляют собой одно или более из того, что положение H11 (система нумерации по Кабату) занимает V, Н28 (система нумерации по Кабату) занимает Т, положение Н38 (система нумерации по Кабату) занимает R, положение Н48 (система нумерации по Кабату) занимает М, положение Н69 (система нумерации по Кабату) занимает М и положение Н91 (система нумерации по Кабату) занимает Y.

61. Антитело по п. 52, при условии, что любое различие между каркасным участком вариабельной области зрелой вариабельной области легкой цепи и последовательностью SEQ ID NO: 37 заключается в том, что положение L83 (система нумерации по Кабату) занимает F.

62. Антитело по п. 52, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 23, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 37.

63. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 44, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

64. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 19, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

65. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 21, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

66. Антитело по п. 1, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 23, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

67. Антитело по п. 22, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 25, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

68. Антитело по п. 22, в котором зрелая вариабельная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 27, и зрелая вариабельная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностями SEQ ID NO: 45, 33, 35, 37 или 39.

69. Антитело по п. 62, в котором зрелая вариабельная область тяжелой цепи слита с константной областью тяжелой цепи и константная область зрелой легкой цепи слита с константной областью легкой цепи.

70. Антитело по п. 69, в котором константная область тяжелой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 52 при условии, что С-концевой остаток лизина может быть опущен.

71. Антитело по п. 69, в котором константная область легкой цепи имеет аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 49.

72. Антитело по п. 62, в котором зрелая вариабельная область тяжелой цепи слита с константной областью тяжелой цепи, имеющей аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 52 при условии, что С-концевой остаток лизина может быть опущен, и константная область зрелой легкой цепи слита с константной областью легкой цепи, имеющей аминокислотную последовательность, определяемую последовательностью SEQ ID NO: 49.

73. Антитело по п. 72, в котором зрелая легкая цепь содержит последовательность SEQ ID NO: 53 и зрелая тяжелая цепь содержит последовательность SEQ ID NO: 56.

74. Антитело по любому из пп. 1, 22, 46 или 52, в котором константная область тяжелой цепи представляет собой мутантную форму природной человеческой константной области, которая хуже связывается с рецептором Fcγ по сравнению с природной человеческой константной областью.

75. Антитело по любому из пп. 1, 22, 46 или 52, в котором антитело содержит константную область тяжелой цепи из изотипа IgGI человека.

76. Фармацевтическая композиция для обнаружения телец Леви, содержащая антитело, как определено по п. 1, и фармацевтически приемлемый носитель.

77. Фармацевтическая композиция для лечения болезни с тельцами Леви, содержащая антитело, как определено по п. 1, и фармацевтически приемлемый носитель.

78. Способ лечения пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания, содержащий назначение пациенту эффективной схемы введения антитела, как определено по п. 1.

79. Способ обнаружения телец Леви у пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания, включающий введение пациенту эффективного количества антитела, как определено по п. 1, в котором антитело связывается с тельцами Леви; и обнаружения связанного антитела в организме пациента.

80. Антитело по любому из пп. 1, 22, 46 или 52, в котором антитело специфически связывается с эпитопом в аминокислотных остатках 91-99 человеческого альфа-синуклеина.



 

Похожие патенты:

Данная группа объектов изобретения относится к области биотехнологии. Предложено активируемое антитело, содержащее а) антитело или его антигенсвязывающий фрагмент (AB), связывающееся с рецептором эпидермального фактора роста (EGFR); б) маскирующую часть (MM), которая ингибирует специфичное связывание AB в нерасщепленном состоянии с EGFR, но не препятствует его связыванию и не конкурирует с ним за связывание с EGFR в расщепленном состоянии; в) расщепляемую часть (CM), которая действует в качестве субстрата для протеазы; и г) линкеры (L1 и L2).

Настоящее изобретение относится к антителу, мишенью которого является антигенный белок раковой опухоли, специфично экспрессируемый на поверхности раковых клеток.

Изобретения относятся к способам обнаружения рака поджелудочной железы с применением новых маркеров опухоли. Представленные способы обнаружения рака поджелудочной железы включают измерение наличия или количества полипептида, обладающего реактивностью в форме специфического связывания с антителом против белка CAPRIN-1 через взаимодействие антиген-антитело, или наличия или количества нуклеиновой кислоты, кодирующей этот полипептид, в образце, взятом от индивидуума, где полипептид, подлежащий измерению, представляет собой белок CAPRIN-1, состоящий из аминокислотной последовательности, соответствующей любой из SEQ ID NO: 2-30 с четным номером, и где наличие или количество нуклеиновой кислоты, кодирующей полипептид, определяют путем определения нуклеиновой кислоты, кодирующей полипептид, содержащийся в образце.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент.

Группа изобретений относится к биотехнологии, в частности к биспецифическим антителам и их применению. Биспецифические антитела содержат два Fab фрагмента, причем первый Fab фрагмент содержит по меньшей мере один антигенсвязывающий сайт, специфический в отношении первого антигена, и второй Fab фрагмент содержит по меньшей мере один антигенсвязывающий сайт, специфический в отношении второго антигена, где произведен обмен вариабельными участками или константными участками между тяжелой и легкой цепями второго Fab фрагмента, причем биспецифическое антитело лишено Fc домена.

Изобретения касаются способа снижения гетерогенности заряда целевого антитела, способа выработки целевого антитела со сниженной гетерогенностью заряда и способов приготовления лекарственного препарата для лечения злокачественных новообразований, содержащего антитело против глипикана 3 или антитело против IL-31RA.

Изобретение относится к области биохимии, в частности к моноклональному антителу или его антигенсвязывающему фрагменту, которые специфически связывают белок gB цитомегаловируса (CMV).

Изобретение относится к биохимии. Описаны выделенные моноклональные антитела, которые специфически связываются с PD-1 с высокой аффинностью.

Изобретение относится к биохимии. Описан способ получения интересующего белка, включающий введение по меньшей мере одного экспрессионного вектора, который содержит генный фрагмент, содержащий ДНК, кодирующую интересующий белок, и также пару транспозонных последовательностей Tol1 или Tol2 на обоих концах генного фрагмента, в суспензионную клетку млекопитающего СНО и суспензионное культивирование клетки млекопитающего, где суспензионная клетка млекопитающего представляет собой суспензионную клетку СНО, которая способна выживать и пролиферировать в бессывороточной среде.

Группа изобретений относится к области биотехнологии. Предложен полипептид, обладающий цитотоксической активностью, содержащий Fc-область IgG, которая состоит из гетеродимера, содержащего первый полипептид и второй полипептид, в аминокислотных последовательностях которых произведены серии мутаций.

Изобретение относится к области иммунологии. Предложено антитело, которое связывается с рецептором эпидермального фактора роста HER2/CD340.

Настоящее изобретение относится к биотехнологии, в частности к способу получения антител, подходящих для применения у кошки, которые специфично связываются с кошачьим фактором роста нервов (NGF) и нейтрализуют способность кошачьего NGF связываться с рецептором кошачьего NGF р75 или TrkA, и соответствующим антителам.

Изобретение относится к области биохимии, в частности к биспецифическому антителу, специфически связывающемуся с фактором роста сосудистого эндотелия человека - VEGF и ангиопоэтином-2 человека - ANG-2, фармацевтической композиции его содержащей, а также к способу его получения.

Настоящее изобретение относится к биотехнологии, в частности к способу получения антител, подходящих для применения у лошади, которые специфично связываются с лошадиным фактором роста нервов (NGF) и нейтрализуют способность лошадиного NGF связываться с рецептором лошадиного NGF р75 или TrkA, и соответствующим антителам.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к способу создания живой вакцины на основе биологически активного штамма Еnterococcus faecium L3 за счет включения в структуру его пилей антигена клинически актуального патогенного микроорганизма.

Изобретение относится к биохимии и медицине. Предложена фармацевтическая композиция для лечения и/или предотвращения рака печени, экспрессирующего на поверхности белок CAPRIN-1, которая содержит антитело против белка CAPRIN-1.

Настоящее изобретение относится к области биотехнологии, конкретно к бифункциональному пептиду, способному активировать синтез коллагена и ингибировать продуцирование матриксных металлопротеиназ, и может быть использовано в медицине и косметологии.

Изобретение касается способа увеличения пула М1 макрофагов у пациента, страдающего от состояний, ассоциированных с нежелательной М2 активацией. Представленный способ включает этап введения указанному пациенту эффективного количества антитела, способного связываться с CSF-1R, где указанное антитело представляет собой антитело, которое связывается по крайней мере с одним эпитопом, расположенным между положениям аминокислот от 20 до 39 ID NO: 23.

Изобретение относится к области иммунологии. Предложено гуманизированное антитело, специфичное к STEAP-1, и его антигенсвязывающий фрагмент.

Группа изобретений относится к области биотехнологии. Предложен полипептид, обладающий цитотоксической активностью, содержащий Fc-область IgG, которая состоит из гетеродимера, содержащего первый полипептид и второй полипептид, в аминокислотных последовательностях которых произведены серии мутаций.

Изобретение относится к биотехнологии. Описано антитело, содержащее зрелую вариабельную область тяжелой цепи, содержащую три CDR по Кабату, из последовательности SEQ ID NO: 44, и по меньшей мере на 90 идентичную последовательности SEQ ID NO: 44, и легкую цепь, содержащую три CDR по Кабату, из последовательности SEQ ID NO: 45, и по меньшей мере на 90 идентичную последовательности SEQ ID NO: 45, где антитело специфически связывается с человеческим альфа-синуклеином. Также описана фармацевтическая композиция, содержащая описанное антитело. Представлен способ лечения пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания или способ обнаружения телец Леви у пациента, имеющего болезнь с тельцами Леви или имеющего риск развития данного заболевания, содержащий назначение пациенту эффективной схемы введения описанного антитела. Изобретение обеспечивает антитела которые связываются с человеческим альфа-синуклеином и могут применяться для лечения и диагностики болезни с тельцами Леви. 7 н. и 73 з.п. ф-лы, 6 ил., 5 табл., 2 пр.

Наверх