Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака



Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
Связывающиеся с sdf1 нуклеиновые кислоты и их применение при лечении рака
C12N15/115 - Получение мутаций или генная инженерия; ДНК или РНК, связанные с генной инженерией, векторы, например плазмиды или их выделение, получение или очистка; использование их хозяев (мутанты или микроорганизмы, полученные генной инженерией C12N 1/00,C12N 5/00,C12N 7/00; новые виды растений A01H; разведение растений из тканевых культур A01H 4/00; новые виды животных A01K 67/00; использование лекарственных препаратов, содержащих генетический материал, который включен в клетки живого организма, для лечения генетических заболеваний, для генной терапии A61K 48/00 пептиды вообще C07K)

Владельцы патента RU 2679495:

НОКСОН ФАРМА АГ (DE)

Изобретение относится к области биохимии и молекулярной биологии. Предложено применение молекулы нуклеиновой кислоты, способной к связыванию с SDF-1 и блокированию взаимодействия между SDF-1 и рецептором SDF-1 CXCR7. Изобретение может быть использовано для лечения и/или предупреждения заболевания рак. 4 н. и 30 з.п. ф-лы, 18 ил., 1 табл., 11 пр.

 

Настоящее изобретение относится к молекулам нуклеиновых кислот, связывающимся с происходящим из стромальных клеток фактором-1 (SDF-1) хемокином подсемейства СХС, способам лечения рака и их применению для производства лекарственного средства.

Происходящий из стромальных клеток фактор-1 (сокр.: SDF-1; синонимы, CXCL12; PBSF [стимулирующий рост пре-B-клеток фактор]; TPAR-1 [TPA-репрессируемый ген 1]; SCYB12; TLSF [фактор, стимулирующий клетки лимфомы вилочковой железы]; hIRH [интеркрин человека, уменьшенный в гепатомах]) представляет собой ангиогенный хемокин подсемейства CXC, который не содержит мотив ELR, являющийся типичным для подобных IL-8 хемокинов (Salcedo, Wasserman et al., 1999; Salcedo and Oppenheim 2003), который связывается со связанным с G-белком рецептором CXCR4 и активирует его. В результате альтернативного сплайсинга существует две формы SDF-1, SDF-1α (68 аминокислот, SEQ ID NO: 1) и SDF-1β (SEQ ID NO: 2), который по сравнению с SDF-1α содержит пять дополнительных аминокислот на C-конце (Shirozu, Nakano et al., 1995).

Консервативность аминокислотных последовательностей среди SDF-1 различных видов является исключительной: SDF-1α человека (SEQ ID NO: 1) и SDF-1α мыши (SEQ ID NO: 3) являются фактически идентичными. Существует лишь единственная консервативная замена V на I в положении 18 (Shirozu, Nakano et al., 1995).

Поскольку рецептор для SDF-1 CXCR4 широко представлен на лейкоцитах, зрелых дендритных клетках, эндотелиальных клетках, клетках головного мозга и мегакариоцитах, активности SDF-1 являются плейотропными. Этот хемокин, более чем любой другой хемокин, идентифицированный до сих пор, проявляет широчайший диапазон биологических функций. Самыми значительными функциональными эффектами SDF-1 являются:

- Хоуминг и привязанность эпителиальных клеток в (к) области(ям) неоваскуляризации в сосудистой части сетчатки;

- SDF-1 необходим для сохранения стволовых клеток и клеток-предшественников, например, гемопоэтических клеток-предшественников (обычно CD34+) в костном мозге взрослого;

- SDF-1 поддерживает пролиферацию пре-B-клеток и усиливает рост В-клеток-предшественников костного мозга, и он индуцирует специфическую миграцию пре- и про-B-клеток, при этом он не действует как значимый хемоаттрактант для зрелых B-клеток;

- SDF-1 является одним из самых эффективных хемоаттрактантов для T-клеток; и

- SDF-1 и его рецептор CXCR4 важны для эмбрионального развития.

Считают, что измененные уровни экспрессии SDF-1 или его рецептора CXCR4 или измененные ответные реакции на эти молекулы связаны со множеством заболеваний человека, таких как ретинопатия (Brooks, Caballero et al., 2004; Butler, Guthrie et al., 2005; Meleth, Agron et al., 2005); рак молочной железы (Muller, Homey et al., 2001; Cabioglu, Sahin et al., 2005), яичников (Scotton, Wilson et al., 2002), поджелудочной железы (Koshiba, Hosotani et al., 2000), щитовидной железы (Hwang, Chung et al., 2003) и носоглотки (Wang, Wu et al., 2005); глиома (Zhou, Larsen et al., 2002); нейробластома (Geminder, Sagi-Assif et al., 2001); хронический B-клеточный лимфолейкоз (Burger, Tsukada et al., 2000); синдром WHIM (WHIM является сокращением для бородавок, гипогаммаглобулинемии, инфекций и миелокатексиса) (Gulino, Moratto et al., 2004; Balabanian, Lagane et al., 2005b; Kawai, Choi et al., 2005); синдромы иммунологической недостаточности (Arya, Ginsberg et al., 1999; Marechal, Arenzana-Seisdedos et al., 1999; Soriano, Martinez et al., 2002); патологическая неоваскуляризация (Salvucci, Yao et al., 2002; Yamaguchi, Kusano et al., 2003; Grunewald, Avraham et al., 2006); воспаление (Murdoch 2000; Fedyk, Jones et al., 2001; Wang, Guan et al., 2001); рассеянный склероз (Krumbholz, Theil et al., 2006); ревматоидный артрит/остеоартрит (Buckley, Amft et al., 2000; Kanbe, Takagishi et al., 2002; Grassi, Cristino et al., 2004).

Опухоли (в том числе солидные опухоли и опухоли и злокачественные опухоли кроветворной системы) представляют собой не просто массы раковых клеток: инфильтрация опухолей иммуноцитами является характеристикой рака. Многие типы рака человека содержат сложную цепь хемокинов, которая оказывает влияние на степень и фенотип этого инфильтрата, а также рост опухолей, выживание, миграцию и ангиогенез. Большинство солидных опухолей содержат множество незлокачественных стромальных клеток. В самом деле, стромальные клетки иногда численно превосходят раковые клетки. Господствующими стромальными клетками, которые обнаруживаются в раках, являются макрофаги, лимфоциты, эндотелиальные клетки и фибробласты.

Клетки различных типов рака имеют различные профили экспрессии рецепторов хемокинов, но рецептор для SDF-1 CXCR4 чаще всего обнаруживается в опухолевых клетках мыши и человека: опухолевые клетки по крайней мере 23 различных типов раков человека эпителиального, мезенхимного и гемопоэтического происхождения экспрессируют CXCR4 (Balkwill 2004), при этом SDF-1 является единственным известным лигандом для CXCR4. Помимо костного мозга и вторичной лимфоидной ткани, где он экспрессируется конститутивно, SDF-1 обнаруживается в первичных опухолевых очагах в случае лимфомы (Corcione, Ottonello et al., 2000) и опухолей головного мозга и нейрональной, и астроцитарной линии. Кроме того, он присутствует на высоких уровнях в клетках рака яичника (Scotton, Wilson et al., 2002) и рака поджелудочной железы (Koshiba, Hosotani et al., 2000), а также в местах метастазирования в случае рака молочной железы (Muller, Homey et al., 2001) и щитовидной железы (Hwang, Chung et al., 2003), в клетках нейробластомы и злокачественных опухолей кроветворной системы (Geminder, Sagi-Assif et al., 2001).

Помимо CXCR4 был идентифицирован другой рецептор для SDF-1 -RDC1/CXCR7 (Balabanian, Lagane et al., 2005a, Burns, Summers et al., 2006). In vitro и in vivo исследования с использованием линий клеток рака предстательной железы говорят от том, что изменения экспрессии CXCR7/RDC1 связаны с увеличением адгезионной и инвазионной активностей вдобавок к эффекту выживания. In vitro и in vivo исследования показали, что оба рецептора для SDF-1, а именно CXCR4 и CXCR7, активируют рост опухолей, метастатический потенциал и устойчивость к (индуцируемому с помощью химиотерапии) апоптозу в ряде опухолей, например, в случае рака молочной железы, глиобластом, рака яичника, нейробластомы, рака легкого, колоректального рака и рака предстательной железы (Burns et al., 2006; Li et al., 2008; Scotton et al., 2002; Yang et al., 2008; Zagzag et al., 2008).

Таким образом, экспрессия CXCR4 и CXCR7, по-видимому, является общей характеристикой нескольких опухолей.

Основополагающей задачей настоящего изобретения является обеспечение средства, которое специфически взаимодействует с SDF-1, в соответствии с чем эти средства подходят для предупреждения и/или лечения рака.

Другой основополагающей задачей настоящего изобретения является обеспечение средства, которое оказывает поддержку терапии рака, в соответствии с чем при такой терапии обычно применяется химиотерапия и/или облучение.

Дальнейшей основополагающей задачей настоящего изобретения является обеспечение средства, которое подходит для применения в качестве вспомогательной терапии при лечении рака.

Более того, основополагающей задачей настоящего изобретения является обеспечение средства, которое способно к химиосенсибилизации пациента, страдающего раком, и/или химиосенсибилизации клеток, образующих рак или являющихся его частью.

Эти и другие основополагающие задачи настоящего изобретения решены с помощью объектов независимых пунктов приложенной формулы изобретения. Предпочтительные варианты осуществления могут быть заимствованы из зависимых пунктов формулы изобретения.

Конкретнее, основополагающая задача настоящего изобретения решена в первом аспекте, который также является первым вариантом осуществления первого аспекта, с помощью молекулы нуклеиновой кислоты, способной к связыванию с SDF-1, предпочтительно способной к ингибированию SDF-1, в соответствии с чем молекула нуклеиновой кислоты предназначается для применения в способе лечения и/или предупреждения заболевания или нарушения, для применения в способе лечения субъекта, страдающего заболеванием или нарушением или подверженного риску развития заболевания или нарушения, в качестве вспомогательной терапии, или для применения в качестве лекарственного средства для лечения и/или предупреждения заболевания или нарушения, в соответствии с чем заболеванием или нарушением является рак.

Во втором варианте осуществления первого аспекта, который также является вариантом осуществления первого варианта осуществления первого аспекта, раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому.

В третьем варианте осуществления первого аспекта, который также является вариантом осуществления второго варианта осуществления первого аспекта, лейкоз выбирают из группы, включающей хронический лимфоидный лейкоз и острый миелоидный лейкоз.

В четвертом варианте осуществления первого аспекта, который также является вариантом осуществления второго варианта осуществления первого аспекта, миеломой является множественная миелома.

В пятом варианте осуществления первого аспекта, который также является вариантом осуществления первого варианта осуществления первого аспекта, раком является рак, выбираемый из группы солидных опухолей, в соответствии с чем предпочтительно солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

В шестом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого и пятого варианта осуществления первого аспекта вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения.

В седьмом варианте осуществления первого аспекта, который также является вариантом осуществления шестого варианта осуществления первого аспекта, терапия для лечения и/или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

В восьмом варианте осуществления первого аспекта, который также является вариантом осуществления седьмого варианта осуществления первого аспекта, дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В девятом варианте осуществления первого аспекта, который также является вариантом осуществления восьмого варианта осуществления первого аспекта, антитело выбирают из группы, включающей Ритуксимаб, Офатумумаб, Цетуксимаб, Ибритумомаб-Тиуксетан, Тоситумомаб, Трастузумаб, Бевацизумаб и Алемтузумаб.

В десятом варианте осуществления первого аспекта, который также является вариантом осуществления восьмого варианта осуществления первого аспекта, алкилирующий агент выбирают из группы, включающей цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, доксорубицин, липосомальный доксорубицин, бендамустин, темозоломид и Мелфалан.

В одиннадцатом варианте осуществления первого аспекта, который также является вариантом осуществления восьмого варианта осуществления первого аспекта, антиметаболит выбирают из группы, включающей являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин и кладрибин.

В двенадцатом варианте осуществления первого аспекта, который также является вариантом осуществления восьмого варианта осуществления первого аспекта, растительный терпеноид выбирают из группы, включающей таксан, более предпочтительно выбирают из группы, включающей Доцетаксел, Паклитаксел, подофиллотоксин и эпотилон.

В тринадцатом варианте осуществления первого аспекта, который также является вариантом осуществления восьмого варианта осуществления первого аспекта, ингибитор топоизомеразы выбирают из группы, включающей камптотецин, иринотекан и митоксантрон.

В четырнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого и тридцатого вариантов осуществления первого аспекта, молекула нуклеиновой кислоты способна к блокированию взаимодействия между SDF-1 и рецептором SDF-1, в соответствии с чем рецептор SDF-1 выбирают из группы, включающей CXCR4 и CXCR7.

В пятнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тридцатого и четырнадцатого вариантов осуществления первого аспекта, лечение или предупреждение заболевания или нарушения обусловлено молекулой нуклеиновой кислоты, ингибирующей взаимодействие между SDF-1 и рецептором SDF-1.

В шестнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тридцатого, четырнадцатого и пятнадцатого вариантов осуществления первого аспекта, молекулу нуклеиновой кислоты выбирают из группы, включающей связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа B, связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа C, связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа A и связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа D.

В семнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления шестнадцатого варианта осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа B включает центральный участок нуклеотидов, в соответствии с чем центральный участок нуклеотидов включает следующую нуклеотидную последовательность:

5' GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG 3' (SEQ ID NO: 52).

В восемнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления семнадцатого варианта осуществления первого аспекта, центральный участок нуклеотидов включает следующую нуклеотидную последовательность:

5' GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG 3' (SEQ ID NO: 53).

В девятнадцатом варианте осуществления первого аспекта, который также является вариантом осуществления семнадцатого и восемнадцатого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа B включает в направлении 5'→3' первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов.

В двадцатом варианте осуществления первого аспекта, который также является вариантом осуществления семнадцатого и восемнадцатого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа B включает в направлении 5'→3' второй концевой участок нуклеотидов, центральный участок нуклеотидов и первый концевой участок нуклеотидов.

В двадцать первом варианте осуществления первого аспекта, который также является вариантом осуществления девятнадцатого и двадцатого вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X1X2SVNS 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' BVBSX3X4 3', в соответствии с чем

X1 или отсутствует, или представляет собой A, X2 представляет собой G, X3 представляет собой C, и X4 или отсутствует, или представляет собой U; или

X1 отсутствует, X2 или отсутствует, или представляет собой G, X3 или отсутствует, или представляет собой C, и X4 отсутствует.

В двадцать втором варианте осуществления первого аспекта, который также является вариантом осуществления девятнадцатого, двадцатого и двадцать первого, предпочтительно двадцать первого, вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X1X2CRWG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' KRYSX3X4 3',

в соответствии с чем X1 или отсутствует, или представляет собой A, X2 представляет собой G, X3 представляет собой C, и X4 или отсутствует, или представляет U.

В двадцать третьем варианте осуществления первого аспекта, который также является вариантом осуществления девятнадцатого, двадцатого, двадцать первого и двадцать второго, предпочтительно двадцать первого или двадцать второго, вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X1X2CGUG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' UACGX3X4 3',

в соответствии с чем X1 или отсутствует, или представляет собой A, X2 представляет собой G, X3 представляет собой C, и X4 или отсутствует, или представляет собой U, предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' AGCGUG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' UACGCU 3'.

В двадцать четвертом варианте осуществления первого аспекта, который также является вариантом осуществления девятнадцатого, двадцатого и двадцать первого, предпочтительно двадцать первого, вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X1X2SSBS 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' BVSSX3X4 3',

в соответствии с чем X1 отсутствует, X2 или отсутствует, или представляет собой G, X3 или отсутствует, или представляет собой C, и X4 отсутствует,

предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GCGUG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' UACGC 3'.

В двадцать пятом варианте осуществления первого аспекта, который также является вариантом осуществления шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего и двадцать четвертого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа B включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 5 - SEQ ID NO: 20 и SEQ ID NO: 22 - SEQ ID NO: 28,

предпочтительно любой из SEQ ID NO: 5 - SEQ ID NO: 7, SEQ ID NO: 16, SEQ ID NO: 22 и SEQ ID NO: 28,

более предпочтительно любой из SEQ ID NO: 22 и SEQ ID NO: 28.

В двадцать шестом варианте осуществления первого аспекта, который также является вариантом осуществления шестнадцатого варианта осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа C включает центральный участок нуклеотидов, в соответствии с чем центральный участок нуклеотидов включает нуклеотидную последовательность GGUYAGGGCUHRXAAGUCGG (SEQ ID NO: 108),

в соответствии с чем XA или отсутствует, или представляет собой A.

В двадцать седьмом варианте осуществления первого аспекта, который также является вариантом осуществления двадцать шестого варианта осуществления первого аспекта, центральный участок нуклеотидов включает нуклеотидную последовательность 5' GGUYAGGGCUHRAAGUCGG 3' (SEQ ID NO: 109), 5' GGUYAGGGCUHRAGUCGG 3' (SEQ ID NO: 110) или 5' GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO: 111), предпочтительно 5' GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO: 111).

В двадцать восьмом варианте осуществления первого аспекта, который также является вариантом осуществления двадцать шестого и двадцать седьмого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа C включает в направлении 5'→3' первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов.

В двадцать девятом варианте осуществления первого аспекта, который также является вариантом осуществления двадцать шестого и двадцать седьмого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа C включает в направлении 5'→3' второй концевой участок нуклеотидов, центральный участок нуклеотидов и первый концевой участок нуклеотидов.

В тридцатом варианте осуществления первого аспекта, который также является вариантом осуществления двадцать восьмого и двадцать девятого вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' RKSBUSNVGR 3' (SEQ ID NO: 138), а второй участок нуклеотидов включает нуклеотидную последовательность 5' YYNRCASSMY 3' (SEQ ID NO: 139),

предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' RKSBUGSVGR 3 '(SEQ ID NO: 140), и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' YCNRCASSMY 3' (SEQ ID NO: 141).

В тридцать первом варианте осуществления первого аспекта, который также является вариантом осуществления двадцать восьмого и двадцать девятого вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' XSSSSV 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' BSSSXS 3', в соответствии с чем XS или отсутствует, или представляет собой S,

предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' SGGSR 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' YSCCS 3'.

В тридцать втором варианте осуществления первого аспекта, который также является вариантом осуществления двадцать восьмого и двадцать девятого вариантов осуществления первого аспекта,

a) первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GCCGG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CCGGC 3'; или

b) первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' CGUGCGCUUGAGAUAGG 3 '(SEQ ID NO: 220), а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CUGAUUCUCACG 3' (SEQ ID NO: 221); или

c) первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' UGAGAUAGG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CUGAUUCUCA 3' (SEQ ID NO: 222); или

d) первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GAGAUAGG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CUGAUUCUC 3'.

В тридцать третьем варианте осуществления первого аспекта, который также является вариантом осуществления двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого и тридцать второго вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа C включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 95 - SEQ ID NO: 107, SEQ ID NO: 112 - SEQ ID NO: 137, SEQ ID NO: 223 и SEQ ID NO: 224,

предпочтительно любой из SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 129, SEQ ID NO: 134, SEQ ID NO: 135, SEQ ID NO: 223 и SEQ ID NO: 224.

В тридцать четвертом варианте осуществления первого аспекта, который также является вариантом осуществления шестнадцатого варианта осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа А включает центральный участок нуклеотидов, в соответствии с чем центральный участок нуклеотидов включает нуклеотидную последовательность 5' AAAGYRACAHGUMAAXAUGAAAGGUARC 3' (SEQ ID NO: 74),

в соответствии с чем XA или отсутствует, или представляет собой A.

В тридцать пятом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать четвертого варианта осуществления первого аспекта, центральный участок нуклеотидов включает нуклеотидную последовательность

5' AAAGYRACAHGUMAAUGAAAGGUARC 3' (SEQ ID NO: 75), или

5' AAAGYRACAHGUMAAAUGAAAGGUARC 3' (SEQ ID NO: 76), или

5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO: 77), предпочтительно центральный участок нуклеотидов включает нуклеотидную последовательность 5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO: 77).

В тридцать шестом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать четвертого и тридцать пятого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа А включает в направлении 5'→3' первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов.

В тридцать седьмом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать четвертого и тридцать пятого вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа А включает в направлении 5'→3' второй концевой участок нуклеотидов, центральный участок нуклеотидов и первый концевой участок нуклеотидов.

В тридцать восьмом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать шестого и тридцать седьмого вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X1X2NNBV 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' BNBNX3X4 3',

в соответствии с чем X1 или отсутствует, или представляет собой R, X2 представляет собой S, X3 представляет собой S, и X4 или отсутствует, или представляет собой Y;

или

X1 отсутствует, X2 отсутствует, или представляет собой S, X3 отсутствует, или представляет собой S, и X4 отсутствует.

В тридцать девятом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать шестого, тридцать седьмого и тридцать восьмого, предпочтительно тридцать восьмого, вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' RSHRYR 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' YRYDSY 3',

предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GCUGUG 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CGCAGC 3'.

В сороковом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать шестого, тридцать седьмого и тридцать восьмого, предпочтительно тридцать восьмого, вариантов осуществления первого аспекта, первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' X2BBBS 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' SBBVX3 3',

в соответствии с чем X2 отсутствует, или представляет собой S, и X3 отсутствует, или представляет собой S;

предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' CUGUG 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CGCAG 3';

или первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GCGUG 3', и второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' CGCGC 3'.

В сорок первом варианте осуществления первого аспекта, который также является вариантом осуществления тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого и сорокового вариантов осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа А включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 60 - SEQ ID NO: 73, SEQ ID NO: 78 - SEQ ID NO: 82, SEQ ID NO: 84 - SEQ ID NO: 87, SEQ ID NO: 89 - SEQ ID NO: 94 и SEQ ID NO: 145,

предпочтительно любой из SEQ ID NO: 60, SEQ ID NO: 63, SEQ ID NO: 66, SEQ ID NO: 78, SEQ ID NO: 84 и SEQ ID NO: 146,

более предпочтительно любой из SEQ ID NO: 84 и SEQ ID NO: 146.

В сорок втором варианте осуществления первого аспекта, который также является вариантом осуществления шестнадцатого варианта осуществления первого аспекта, связывающаяся с SDF-1 молекула нуклеиновой кислоты типа D включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 142 -SEQ ID NO: 144.

В сорок третьем варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого и сорок второго вариантов осуществления первого аспекта, SDF-1 является SDF-1 человека, в соответствии с чем предпочтительно SDF-1 человека является SDF-1 альфа человека или SDF-1 бета человека, более предпочтительно SDF-1 человека является SDF-1 альфа человека.

В сорок четвертом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго и сорок третьего вариантов осуществления первого аспекта, молекула нуклеиновой кислоты включает модификацию, в соответствии с чем модификацией предпочтительно является высокомолекулярная составляющая, и/или в соответствии с чем модификация предпочтительно делает возможным изменение характеристик молекулы нуклеиновой кислоты в отношении времени жизни в организме животного или человека, предпочтительно в организме человека.

В сорок пятом варианте осуществления первого аспекта, который также является вариантом осуществления сорок четвертого варианта осуществления первого аспекта, модификацию выбирают из группы, включающей ГЭК-составляющую, ПЭГ-составляющую, биодеградируемые модификации и их комбинации.

В сорок шестом варианте осуществления первого аспекта, который также является вариантом осуществления сорок пятого варианта осуществления первого аспекта, модификацией является ПЭГ-составляющая, состоящая из неразветвленного или разветвленного ПЭГ, в соответствии с чем предпочтительно молекулярная масса неразветвленного или разветвленного ПЭГ составляет от приблизительно 20000 до 120000 Да, более предпочтительно от приблизительно 30000 до 80000 Да и наиболее предпочтительно приблизительно 40000 Да.

В сорок седьмом варианте осуществления первого аспекта, который также является вариантом осуществления сорок пятого варианта осуществления первого аспекта, модификацией является ГЭК-составляющая, в соответствии с чем предпочтительно молекулярная масса ГЭК-составляющей составляет от приблизительно 10000 до 200000 Да, более предпочтительно от приблизительно 30000 до 170000 Да и наиболее предпочтительно приблизительно 150000 Да.

В сорок восьмом варианте осуществления первого аспекта, который также является вариантом осуществления сорок четвертого, сорок пятого, сорок шестого и сорок седьмого вариантов осуществления первого аспекта, модификация присоединена к молекуле нуклеиновой кислоты через линкер, причем предпочтительно линкером является биоустойчивый или биодеградируемый линкер.

В сорок девятом варианте осуществления первого аспекта, который также является вариантом осуществления сорок четвертого, сорок пятого, сорок шестого, сорок седьмого и сорок восьмого вариантов осуществления первого аспекта, модификация присоединена к молекуле нуклеиновой кислоты в 5'-концевом нуклеотиде молекулы нуклеиновой кислоты и/или 3'-концевом нуклеотиде молекулы нуклеиновой кислоты и/или к нуклеотиду молекулы нуклеиновой кислоты, находящемуся между 5'-концевым нуклеотидом молекулы нуклеиновой кислоты и 3'-концевым нуклеотидом молекулы нуклеиновой кислоты.

В пятидесятом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого и сорок девятого вариантов осуществления первого аспекта, нуклеотидами молекулы нуклеиновой кислоты или нуклеотидами, образующими молекулу нуклеиновой кислоты, являются L-нуклеотиды.

В пятьдесят первом варианте осуществления первого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого и пятидесятого вариантов осуществления первого аспекта, молекулой нуклеиновой кислоты является молекула L-нуклеиновой кислоты.

Основополагающая задача настоящего изобретения решена во втором аспекте, который также является первым вариантом осуществления второго аспекта, с помощью фармацевтической композиции, включающей в качестве первого фармацевтически активного агента молекулу нуклеиновой кислоты в соответствии с любым из первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого, пятидесятого и пятьдесят первого вариантов осуществления первого аспекта и необязательно дополнительную компоненту, в соответствии с чем дополнительную компоненту выбирают из группы, включающей фармацевтически приемлемый наполнитель, фармацевтически приемлемый носитель и дополнительный фармацевтически активный агент, и в соответствии с чем фармацевтическая композиция предназначается для применения в способе лечения и/или предупреждения заболевания или нарушения, или для применения в способе лечения субъекта, страдающего заболеванием или нарушением или подверженного риску развития заболевания или нарушения, в качестве вспомогательной терапии, или для лечения и/или предупреждения заболевания или нарушения, в соответствии с чем заболеванием или нарушением является рак.

Во втором варианте осуществления второго аспекта, который также является вариантом осуществления первого варианта осуществления второго аспекта, вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения.

В третьем варианте осуществления второго аспекта, который также является вариантом осуществления второго варианта осуществления второго аспекта, терапия для лечения и/или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

В четвертом варианте осуществления второго аспекта, который также является вариантом осуществления первого, второго и третьего вариантов осуществления второго аспекта, дополнительным фармацевтически активным агентом является фармацевтически активный агент, выбираемый из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В пятом варианте осуществления второго аспекта, который также является вариантом осуществления четвертого варианта осуществления второго аспекта, антитело выбирают из группы, включающей Ритуксимаб, Офатумумаб, Цетуксимаб, Ибритумомаб-Тиуксетан, Тоситумомаб, Трастузумаб, Бевацизумаб и Алемтузумаб.

В шестом варианте осуществления второго аспекта, который также является вариантом осуществления четвертого варианта осуществления второго аспекта, алкилирующий агент выбирают из группы, включающей цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, доксорубицин, липосомальный доксорубицин, бендамустин, темозоломид и Мелфалан.

В седьмом варианте осуществления второго аспекта, который также является вариантом осуществления четвертого варианта осуществления второго аспекта, антиметаболит выбирают из группы, включающей являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин и кладрибин.

В восьмом варианте осуществления второго аспекта, который также является вариантом осуществления четвертого варианта осуществления второго аспекта, растительный терпеноид выбирают из группы, включающей таксан, более предпочтительно выбирают из группы, включающей Доцетаксел, Паклитаксел, подофиллотоксин и эпотилон.

В девятом варианте осуществления второго аспекта, который также является вариантом осуществления четвертого варианта осуществления второго аспекта, ингибитор топоизомеразы выбирают из группы, включающей камптотецин, иринотекан и митоксантрон.

В десятом варианте осуществления второго аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого и девятого вариантов осуществления второго аспекта, раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому.

В одиннадцатом варианте осуществления второго аспекта, который также является вариантом осуществления десятого варианта осуществления второго аспекта, лейкоз выбирают из группы, включающей хронический лимфоидный лейкоз и острый миелоидный лейкоз.

В двенадцатом варианте осуществления второго аспекта, который также является вариантом осуществления десятого варианта осуществления второго аспекта, миеломой является множественная миелома.

В тринадцатом варианте осуществления второго аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого и девятого вариантов осуществления второго аспекта, раком является рак, выбираемый из группы солидных опухолей, в соответствии с чем предпочтительно солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

Основополагающая задача настоящего изобретения решена в третьем аспекте, который также является первым вариантом осуществления третьего аспекта, с помощью лекарственного средства, включающего одну или несколько единиц дозирования по крайней мере первого фармацевтически активного агента, причем первым фармацевтически активным агентом является молекула нуклеиновой кислоты, способная к связыванию с SDF-1, определенная в любом из первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого, пятидесятого и пятьдесят первого вариантов осуществления первого аспекта, в соответствии с чем лекарственное средство предназначается для применения в способе лечения и/или предупреждения заболевания или нарушения, или для применения в способе лечения субъекта, страдающего заболеванием или нарушением или подверженного риску развития заболевания или нарушения, в качестве вспомогательной терапии, или для лечения и/или предупреждения заболевания или нарушения, в соответствии с чем заболеванием или нарушением является рак.

Во втором варианте осуществления третьего аспекта, который также является вариантом осуществления первого варианта осуществления третьего аспекта, вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения.

В третьем варианте осуществления третьего аспекта, который также является вариантом осуществления второго варианта осуществления третьего аспекта, терапия для лечения и/или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

В четвертом варианте осуществления третьего аспекта, который также является вариантом осуществления первого, второго и третьего, предпочтительно первого, вариантов осуществления третьего аспекта, лекарственное средство включает дополнительный фармацевтически активный агент, предпочтительно одну или несколько единиц дозирования дополнительного фармацевтически активного агента, в соответствии с чем дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон и Фторурацил.

В пятом варианте осуществления третьего аспекта, который также является вариантом осуществления третьего варианта осуществления третьего аспекта, лекарственное средство включает дополнительный фармацевтически активный агент, предпочтительно одну или несколько единиц дозирования дополнительного фармацевтически активного агента, в соответствии с чем дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В шестом варианте осуществления третьего аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления третьего аспекта, антитело выбирают из группы, включающей Ритуксимаб, Офатумумаб, Цетуксимаб, Ибритумомаб-Тиуксетан, Тоситумомаб, Трастузумаб, Бевацизумаб и Алемтузумаб.

В седьмом варианте осуществления третьего аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления третьего аспекта, алкилирующий агент выбирают из группы, включающей цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, доксорубицин, липосомальный доксорубицин, бендамустин, темозоломид и Мелфалан.

В восьмом варианте осуществления третьего аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления третьего аспекта, антиметаболит выбирают из группы, включающей являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин и кладрибин.

В девятом варианте осуществления третьего аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления третьего аспекта, растительный терпеноид выбирают из группы, включающей таксан, более предпочтительно выбирают из группы, включающей Доцетаксел, Паклитаксел, подофиллотоксин и эпотилон.

В десятом варианте осуществления третьего аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления третьего аспекта, ингибитор топоизомеразы выбирают из группы, включающей камптотецин, иринотекан и митоксантрон.

В одиннадцатом варианте осуществления третьего аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого и десятого вариантов осуществления третьего аспекта, раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому.

В двенадцатом варианте осуществления третьего аспекта, который также является вариантом осуществления одиннадцатого варианта осуществления третьего аспекта, лейкоз выбирают из группы, включающей хронический лимфоидный лейкоз и острый миелоидный лейкоз.

В тринадцатом варианте осуществления третьего аспекта, который также является вариантом осуществления одиннадцатого варианта осуществления третьего аспекта, миеломой является множественная миелома.

В четырнадцатом варианте осуществления третьего аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого и десятого вариантов осуществления третьего аспекта, раком является рак, выбираемый из группы солидных опухолей, в соответствии с чем предпочтительно солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

Основополагающая задача настоящего изобретения решена в четвертом аспекте, который также является первым вариантом осуществления четвертого аспекта, с помощью применения молекулы нуклеиновой кислоты, определенной в любом из первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого, пятидесятого и пятьдесят первого вариантов осуществления первого аспекта, для производства лекарственного средства для лечения и/или предупреждения заболевания или нарушения или для применения в способе лечения субъекта, страдающего заболеванием или нарушением или подверженного риску развития заболевания или нарушения, в качестве вспомогательной терапии, в соответствии с чем заболеванием или нарушением является рак.

Во втором варианте осуществления четвертого аспекта, который также является вариантом осуществления первого варианта осуществления четвертого аспекта, вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения.

В третьем варианте осуществления четвертого аспекта, который также является вариантом осуществления второго варианта осуществления четвертого аспекта, терапия для лечения и/или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

В четвертом варианте осуществления четвертого аспекта, который также является вариантом осуществления первого, второго и третьего, предпочтительно первого, вариантов осуществления четвертого аспекта, лекарственное средство применяется в комбинации с дополнительным фармацевтически активным агентом, в соответствии с чем дополнительным фармацевтически активным агентом является фармацевтически активный агент, выбираемый из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В пятом варианте осуществления четвертого аспекта, который также является вариантом осуществления третьего варианта осуществления четвертого аспекта, дополнительным фармацевтически активным агентом является фармацевтически активный агент, выбираемый из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В шестом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, антитело выбирают из группы, включающей Ритуксимаб, Цетуксимаб, Ибритумомаб-Тиуксетан, Тоситумомаб, Трастузумаб, Бевацизумаб и Алемтузумаб.

В седьмом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, алкилирующий агент выбирают из группы, включающей цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, доксорубицин, липосомальный доксорубицин, бендамустин, темозоломид и Мелфалан.

В восьмом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, антиметаболит выбирают из группы, включающей являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин и кладрибин.

В девятом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, растительный терпеноид выбирают из группы, включающей таксан, более предпочтительно выбирают из группы, включающей Доцетаксел, Паклитаксел, подофиллотоксин и эпотилон.

В десятом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, ингибитор топоизомеразы выбирают из группы, включающей камптотецин, иринотекан и митоксантрон.

В одиннадцатом варианте осуществления четвертого аспекта, который также является вариантом осуществления четвертого и пятого вариантов осуществления четвертого аспекта, раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому.

В двенадцатом варианте осуществления четвертого аспекта, который также является вариантом осуществления одиннадцатого варианта осуществления четвертого аспекта, лейкоз выбирают из группы, включающей хронический лимфоидный лейкоз и острый миелоидный лейкоз.

В тринадцатом варианте осуществления четвертого аспекта, который также является вариантом осуществления одиннадцатого варианта осуществления четвертого аспекта, миеломой является множественная миелома.

В четырнадцатом варианте осуществления четвертого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого и десятого вариантов осуществления четвертого аспекта, раком является рак, выбираемый из группы солидных опухолей, в соответствии с чем предпочтительно солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

Основополагающая задача настоящего изобретения решена в пятом аспекте, который также является первым вариантом осуществления пятого аспекта, с помощью способа лечения субъекта, страдающего раком или подверженного риску развития рака, в соответствии с чем способ включает стадию

- a) введения субъекту фармацевтически эффективного количества молекулы нуклеиновой кислоты, способной к связыванию с SDF-1, определенной в одном из первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого, пятидесятого и пятьдесят первого вариантов осуществления первого аспекта.

Во втором варианте осуществления пятого аспекта, который также является вариантом осуществления первого варианта осуществления пятого аспекта, способ включает стадию

- b) облучения субъекта, и/или хирургического вмешательства, и/или клеточной терапии, и/или введения субъекту фармацевтически эффективного количества дополнительного фармацевтически активного агента, в соответствии с чем дополнительным фармацевтически активным агентом является фармацевтически активный агент, выбираемый из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

В третьем варианте осуществления пятого аспекта, который также является вариантом осуществления второго варианта осуществления пятого аспекта, фармацевтически эффективное количество молекулы нуклеиновой кислоты, способной к связыванию с SDF-1, определенной в любом из первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого, десятого, одиннадцатого, двенадцатого, тринадцатого, четырнадцатого, пятнадцатого, шестнадцатого, семнадцатого, восемнадцатого, девятнадцатого, двадцатого, двадцать первого, двадцать второго, двадцать третьего, двадцать четвертого, двадцать пятого, двадцать шестого, двадцать седьмого, двадцать восьмого, двадцать девятого, тридцатого, тридцать первого, тридцать второго, тридцать третьего, тридцать четвертого, тридцать пятого, тридцать шестого, тридцать седьмого, тридцать восьмого, тридцать девятого, сорокового, сорок первого, сорок второго, сорок третьего, сорок четвертого, сорок пятого, сорок шестого, сорок седьмого, сорок восьмого, сорок девятого, пятидесятого и пятьдесят первого вариантов осуществления первого аспекта, вводят в качестве вспомогательной терапии или части вспомогательной терапии.

В четвертом варианте осуществления пятого аспекта, который также является вариантом осуществления третьего варианта осуществления пятого аспекта, вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения.

В пятом варианте осуществления пятого аспекта, который также является вариантом осуществления четвертого варианта осуществления пятого аспекта, терапия для лечения и/или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию, выполняемое(ую) на стадии b).

В шестом варианте осуществления пятого аспекта, который также является вариантом осуществления второго, третьего, четвертого и пятого вариантов осуществления пятого аспекта, антитело выбирают из группы, включающей Ритуксимаб, Цетуксимаб, Ибритумомаб-Тиуксетан, Тоситумомаб, Трастузумаб, Бевацизумаб и Алемтузумаб.

В седьмом варианте осуществления пятого аспекта, который также является вариантом осуществления второго, третьего, четвертого и пятого вариантов осуществления пятого аспекта, алкилирующий агент выбирают из группы, включающей цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, доксорубицин, липосомальный доксорубицин, бендамустин, темозоломид и Мелфалан.

В восьмом варианте осуществления пятого аспекта, который также является вариантом осуществления второго, третьего, четвертого и пятого вариантов осуществления пятого аспекта, антиметаболит выбирают из группы, включающей являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин и кладрибин.

В девятом варианте осуществления пятого аспекта, который также является вариантом осуществления второго, третьего, четвертого и пятого вариантов осуществления пятого аспекта, растительный терпеноид выбирают из группы, включающей таксан, более предпочтительно выбирают из группы, включающей Доцетаксел, Паклитаксел, подофиллотоксин и эпотилон.

В десятом варианте осуществления пятого аспекта, который также является вариантом осуществления второго, третьего, четвертого и пятого вариантов осуществления пятого аспекта, ингибитор топоизомеразы выбирают из группы, включающей камптотецин, иринотекан и митоксантрон.

В одиннадцатом варианте осуществления пятого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого и десятого вариантов осуществления пятого аспекта, раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому.

В двенадцатом варианте осуществления пятого аспекта, который также является вариантом осуществления одиннадцатого варианта осуществления пятого аспекта, лейкоз выбирают из группы, включающей хронический лимфоидный лейкоз и острый миелоидный лейкоз.

В тринадцатом варианте осуществления пятого аспекта, который также является вариантом осуществления одиннадцатого и двенадцатого вариантов осуществления пятого аспекта, миеломой является множественная миелома.

В четырнадцатом варианте осуществления пятого аспекта, который также является вариантом осуществления первого, второго, третьего, четвертого, пятого, шестого, седьмого, восьмого, девятого и десятого вариантов осуществления пятого аспекта, раком является рак, выбираемый из группы солидных опухолей, в соответствии с чем предпочтительно солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

Без желания ограничиться какой-либо теорией, авторы настоящего изобретения установили, что молекулы нуклеиновых кислот в соответствии с настоящим изобретением ингибируют связывание SDF-1 со своими рецепторами и поэтому, или непосредственно, или опосредованно, используются для лечения рака. Кроме того, авторы настоящего изобретения установили, что молекулы нуклеиновых кислот в соответствии с настоящим изобретением подходят для блокирования взаимодействия SDF-1 со своими рецепторами - CXCR4 и CXCR7, соответственно. В такой мере, связывающиеся с SDF-1 молекулы нуклеиновой кислоты в соответствии с настоящим изобретением могут также рассматриваться как антагонисты CXCR4 и CXCR7, соответственно.

Что касается различных заболеваний, состояний и нарушений, которые можно лечить или предотвращать, используя молекулы нуклеиновых кислот в соответствии с настоящим изобретением или композиции, предпочтительно фармацевтические композиции, включающие их, следует признать, что такими заболеваниями, состояниями и нарушениями являются те, которые здесь описаны, включая и в особенно те, которые описаны и изложены в вводной части настоящей заявки. В такой мере, соответствующие места образуют неотъемлемую составную часть описания настоящего изобретения, в которой сообщается о пригодности молекул нуклеиновых кислот для предупреждения и лечения, соответственно, указанных заболеваний, состояний и нарушений.

Используемый здесь термин «SDF-1» относится любому SDF-1, включая, но без ограничения, SDF-1 млекопитающего. Предпочтительно SDF-1 млекопитающего выбирают из группы, включающей SDF-1 мышей, крысы, кролика, хомяка, обезьяны и человека. Более предпочтительно SDF-1 является SDF-1 человека, также называемый SDF-1α (SEQ ID NO: 1 и/или SDF-1β человека (SEQ ID NO: 2), наиболее предпочтительно SDF-1 человека, также называемый SDF-1α (SEQ ID NO: 1).

Действие SDF-1 осуществляется через два различных рецептора, рецепторы CXCR4 и RDC1/CXCR7 (Balabanian, Lagane et al., 2005a, Burns, Summers et al., 2006) (см. вводную часть настоящей заявки). Увеличенная экспрессия CXCR4 и CXCR7 была установлена в случае нескольких типов рака, описанных здесь.

Поскольку действие SDF-1 осуществляется через два различных рецептора, лечение связанного с SDF-1 заболевания или нарушения соединением, специфическим для одного из двух рецепторов для SDF-1-CXCR4 и CXCR7:

a) будет менее эффективным вследствие представленности двух различных рецепторов для SDF-1 на клетках, предпочтительно раковых клетках;

b) ограничивается отдельной популяцией клеток, предпочтительно отдельной популяцией раковых клеток, вследствие представленности индивидуальных рецепторов для SDF-1 на клетках.

Рак является термином для обозначения злокачественных опухолей, большой и гетерогенной группы заболеваний, в случае которых клетки демонстрируют неконтролируемый рост, инвазию и часто метастазируют, причем раковые клетки распространяются в другие места в теле, в региональные лимфатические узлы или отдаленные места в теле вроде головного мозга, кости, печени и других органов. Эти три опасных свойства рака разграничивают злокачественные опухоли и доброкачественные опухоли, в соответствии с чем используемый здесь термин «рак» должен также включать злокачественные опухоли, которые в свою очередь также называют здесь опухолями. Злокачественные опухоли относятся к двум категориям на основе из происхождения: опухолям кроветворной системы и солидным опухолям. Опухоли кроветворной системы представляют собой типы раков, поражающие кровь, костный мозг и лимфатические узлы. Солидные опухоли образуются в результате анормального роста клеток тканей организма, отличных от клеток крови, костного мозга или лимфатической системы.

Предпочтительными формами рака являются следующие формы:

Карцинома коры надпочечников

Связанные со СПИДом раки, такие как саркома и лимфома Капоши

Рак анального канала

Рак аппендикса

Атипичная тератоидная/рабдоидная опухоль

Базально-клеточный рак

Рак желчного протока, внепеченочный

Рак мочевого пузыря

Рак кости

Остеосаркома

Злокачественная фиброзная гистиоцитома

Глиома ствола головного мозга

Опухоли головного мозга, такие как астроцитомы, опухоли головного и спинного мозга, глиома ствола головного мозга, подросткового периода, атипичная тератоидная/рабдоидная опухоль центральной нервной системы, опухоли центральной нервной системы эмбриональные, краниофарингиома, эпендимобластома, эпендимома, медуллобластома, медуллоэпителиома, паренхимные опухоли шишковидного тела промежуточной дифференциации, супратенториальные примитивные нейроэктодермальные опухоли и пинеобластома

Рак молочной железы

Бронхиальные опухоли

Карциноидная опухоль

Карцинома неизвестного происхождения, первичная

Рак центральной нервной системы, такой как атипичная тератоидная/рабдоидная опухоль и лимфома

Рак шейки матки

Раки подросткового периода

Хордома

Хронические миелопролиферативные заболевания

Рак ободочной кишки

Колоректальный рак

Краниофарингиома

T-клеточная лимфома кожи

Эмбриональные опухоли

Рак эндометрия

Эпендимобластома

Эпендимома

Рак пищевода

Эстезионейробластома

Семейство опухолей типа саркомы Юинга

Внечерепная опухоль из зародышевых клеток

Опухоль из зародышевых клеток вне половой железы

Рак желчного протока вне печени

Рак глаза, такой как внутриглазная меланома и ретинобластома

Фиброзная гистиоцитома кости

Остеосаркома

Рак желчного пузыря

Рак желудка

Карциноидная опухоль желудочно-кишечного тракта

Стромальные опухоли желудочно-кишечного тракта (GIST)

Опухоль из зародышевых клеток (внечерепная, вне половой железы или яичника)

Обусловленная беременностью трофобластическая опухоль

Глиома

Волосато-клеточный лейкоз

Рак головы и шеи

Рак сердца

Печеночно-клеточный рак (печени)

Гистиоцитоз

Гипофарингеальный рак

Внутриглазная меланома

Опухоли из инсулоцитов (эндокринных клеток поджелудочной железы)

Саркома Капоши

Рак почки

Гистиоцитоз из клеток Лангерганса

Рак гортани

Лейкоз, такой как острый лимфобластный лейкоз (сокр. ALL), острый миелоидный лейкоз (сокр. AML), хронический лимфолейкоз (сокр. CLL), хронический миелогенный лейкоз (сокр. CML) и волосато-клеточный лейкоз

Рак губ и ротовой полости

Рак печени (первичный)

Дольковый рак in Situ (LCIS)

Рак легкого

Лимфома, такая как связанная со СПИДом лимфома, Беркитта, грибовидный микоз и синдром Сезари, лимфома Ходжкина, неходжкинская лимфома и первичный лейкоз центральной нервной системы (сокр. ЦНС)

Макроглобулинемия

Злокачественная фиброзная гистиоцитома кости и остеосаркома

Медуллобластома

Медуллоэпителиома

Меланома

Карцинома из клеток Меркеля

Мезотелиома

Метастатический сквамозный рак кожи шеи неизвестного происхождения, первичный

Карцинома, локализованная в дыхательных путях или других местах по срединной линии тела, в которую вовлечен ген NUT

Рак ротовой полости

Синдромы множественных эндокринных неоплазий

Множественная миелома

Грибовидный микоз

Миелодиспластические синдромы

Миелодиспластические/миелопролиферативные опухоли

Миелопролиферативные заболевания

Рак носовой полости и придаточной пазухи носа

Рак носоглотки

Нейробластома

Немелкоклеточный рак легкого

Рак ротовой полости

Ротоглоточный рак

Остеосаркома и злокачественная фиброзная гистиоцитома кости

Рак яичника

Рак поджелудочной железы

Папилломатоз

Параганглиома

Рак придаточной пазухи носа и носовой полости

Рак паращитовидной железы

Рак мужского полового члена

Рак глотки

Феохромоцитома

Паренхимные опухоли шишковидного тела промежуточной дифференциации

Пинеобластома и супратенториальные примитивные нейроэктодермальные опухоли

Опухоль гипофиза

Плазмаклеточная опухоль/Множественная миелома

Плевролегочная бластома, подросткового периода

Первичная лимфома центральной нервной системы (сокр. ЦНС)

Рак предстательной железы

Рак прямой кишки

Почечно-клеточный рак (почки)

Переходно-клеточный рак почечной лоханки и мочеточника

Ретинобластома

Рабдомиосаркома

Рак слюнной железы

Саркома, такая как семейство опухолей типа саркомы Юинга, саркома Капоши, саркома мягких тканей

Саркома матки

Рак кожи, такой как меланома, карцинома из клеток Меркеля и немелоцитарный рак кожи

Мелкоклеточный рак легкого

Рак тонкой кишки

Саркома мягких тканей

Плоскоклеточная карцинома

Сквамозный рак кожи шеи

Рак желудка

Супратенториальные примитивные нейроэктодермальные опухоли

T-клеточная лимфома

Рак яичка

Рак гортани

Тимона и карцинома вилочковой железы

Рак щитовидной железы

Переходно-клеточный рак почечной лоханки и мочеточника

Трофобластическая опухоль, обусловленная беременностью

Переходно-клеточный рак мочеточника и почечной лоханки

Рак мочеиспускательного канала

Рак матки, эндометриальный

Саркома матки

Рак влагалища

Рак женских наружных половых органов

Макроглобулинемия Вальденстрема

Опухоль Вильмса

Установлено, что осевая линия SDF-1-CXCR4 играет роль в мобилизации стволовых клеток, в том числе раковых стволовых клеток, образовании и развитии кровеносных сосудов, росте опухолей и метастазировании. Рецептор для SDF-1 CXCR4 экспрессируется в ряде раков и злокачественных опухолей кроветворной системы in vivo, как и CXCR7 (Maksym, Tarnowski et al., 2009; Wang, Shiosawa et al., 2008; Miao, Lucker et al., 2007). Сигналом для роста и инвазии опухолевых клеток является SDF-1, в особенности если клетки экспрессируют рецепторы для SDF-1 (Batchelor et al., 2007; Zhu et al., 2009; Xu et al., 2009; Kozin et al., 2010).

Гипоксия индуцирует CXCR4, а также SDF-1 (Ceradini et al., 2004). Вместе с VEGF они представляют собой эффективную синергетическую осевую линию, которая запускает и поддерживает пути ангиогенеза/васкулогенеза (Kryczek et al., 2005). Роль в васкулогенезе подтверждает тот факт, что SDF-1 привлекает из циркуляции экспрессирующие CXCR4 эндотелиальные клетки-предшественники (Sengupta et al., 2005). Опосредуемый SDF-1-CXCR4 рекрутмент происходящих из костного мозга клеток, которые поддерживают васкуляризацию, может также быть причиной рецидива глиобластомы после лучевой терапии (Kioi et al., 2010). Как установлено Kioi и др. в модели внечерепной мультиформной глиобластомы (сокр. GBM) с использованием ксенотрансплантатов на мыши, лечение пациентов с GBM высокими дозами облучения является менее эффективным из-за индукции облучением рекрутмента происходящих из костного мозга клеток (сокр. BMDC). Блокирование взаимодействия SDF-1 со своим рецептором - CXCR4 с помощью антагониста CXCR4 - AMD3100 предотвращало поступление BMDC в подвергнутую облучению опухоль (Kioi et al., 2010). В 2010 Tseng и др. представили данные, полученные с использованием модели ENU-индуцируемой глиобластомы на крысе, модели, которая близко воспроизводит GBM у человека, что помимо CXCR4 также CXCR7 вовлечен в индуцируемый облучением рекрутмент BMDC. В этом исследовании антагонист CXCR7-CCX2206 предотвращал поступление BMDC в подвергнутую облучению опухоль (Tseng et al., 2010). В соответствии с этим и поскольку молекулы нуклеиновых кислот в соответствии с настоящим изобретением способны блокировать взаимодействие и SDF-1 и CXCR4, и SDF-1 и CXCR7, эффект на выживание после облучения, как ожидается, будет лучше такового, выявленного в случае применения только одного антагониста CXCR4 или CXCR7.

Кроме того, SDF-1 индуцирует секрецию VEGF, в то время как VEGF увеличивает экспрессию CXCR4 (Salcedo et al., 1999) и сигналы ангиогенеза. Следовательно, ингибирование осевой линии SDF-1-CXCR4 может уменьшить или предотвратить рост опухолей в результате ингибирования ангиогенеза/васкулогенеза с помощью или монотерапии, или особенно в комбинации с другими антиваскулярными средствами, такими как ингибиторы VEGF.

Кроме того, полагают, что хоуминг экспрессирующих CXCR4 раковых клеток в экспрессирующие SDF-1 органы нацеливает метастатические клетки предпочтительно на печень, костный мозг, легкое и лимфатические узлы (Alsayed et al., 2007; Burger & Peled 2009), и, следовательно, осевая линия SDF-1-CXCR4 играет роль в метастазировании.

Следовательно, ингибирование осевой линии SDF-1-CXCR4 и осевой линии SDF-1-CXCR7 с помощью лишь одного соединения, такого как связывающаяся с SDF-1 молекула нуклеиновой кислоты в соответствии с настоящими изобретением, или в виде монотерапии, или в комбинации с другими лечениями, такими как, но без ограничения, лекарственная терапия, клеточная терапия, облучение и хирургическое вмешательство, должно быть эффективным при лечении рака и/или опухолей, в частности, широкого ряда и опухолей кроветворной системы, и солидных опухолей. Кроме того, по сравнению с соединением, которое связывается с одним из двух рецепторов для SDF-1-CXCR4 и CXCR7 и ингибирует его, ингибирование осевой линии SDF-1-CXCR4 и осевой линии SDF-1-CXCR7 с помощью лишь одного соединения, такого как связывающаяся с SDF-1 молекула нуклеиновой кислоты в соответствии с настоящими изобретением, или в виде монотерапии, или в комбинации с другими лечениями, такими как, но без ограничения, лекарственная терапия, клеточная терапия, облучение и хирургическое вмешательство, должно быть более эффективным при лечении рака и/или опухолей, в частности, широкого ряда и опухолей кроветворной системы, и солидных опухолей.

В пределах настоящего изобретения находится то, что лекарственная терапия включает лечение и/или предупреждение заболевания или нарушения с помощью лекарственного средства, предпочтительно фармацевтически активного агента, более предпочтительно фармацевтически активного агента, описываемого здесь.

Как предпочтительно используется здесь, при терапии с использованием клеток, также называемой клеточной терапией, подвергнутую обработке ткань из органов, эмбрионов или плодов животных, таких как овцы или коровы, вводят субъекту, страдающему заболеванием или нарушением или подверженному риску развития заболевания или нарушения, в соответствии с чем предпочтительно заболеванием или нарушением является рак, а клеточная терапия является формой лечения рака.

Теоретически не являющиеся злокачественными опухолями кроветворной системы раки можно излечить в случае их полного удаления посредством хирургического вмешательства. Когда рак метастазировал в другие места в теле до хирургического вмешательства, полное хирургическое иссечение обычно невозможно. Примеры хирургических процедур или хирургического вмешательства в случае рака включают мастэктомию в случае рака молочной железы, простатэктомию в случае рака предстательной железы и иссечение рака легкого в случае немелкоклеточного рака легкого. Целью хирургического вмешательства может быть удаление или лишь опухоли, или всего органа. Хирургическое вмешательство часто сочетается с другими лечениями или терапиями для рака, такими как химиотерапия и облучение. Хирургическое вмешательство в случае рака может использоваться для достижения одной или более целей. Такие цели могут включать, но без ограничения, предупреждение рака, его диагностирование, определение стадии, основное лечение, уменьшение и ослабление симптомов или побочных эффектов.

Радиотерапия (также называемая рентгенотерапией или облучением) представляет собой использование ионизирующего излучения для уничтожения раковых клеток. Радиотерапия используется в области медицины для лечения почти любого типа солидной опухоли. Облучение также используется для лечения лейкоза и лимфомы. Радиотерапия повреждает или разрушает клетки в области, подвергаемой обработке, в результате повреждения их генетического материала, делая невозможным продолжение роста и деления этих клеток. Эффекты радиотерапии локализуются в подвергаемой обработке области и ограничиваются ею. Доза облучения каждого места зависит от ряда факторов, включающих радиочувствительность каждого типа рака и того, есть ли поблизости ткани и органы, которые могут быть повреждены облучением. Целью радиотерапии является разрушение как можно больше раковых клеток при ограничении вреда, наносимого соседней здоровой ткани.

Кроме того, связывающаяся с SDF-1 молекула нуклеиновой кислоты в соответствии с настоящим изобретением является предпочтительной, если физиологический эффект осевой линии SDF-1-CXCR4 и/или осевой линии SDF-1-CXCR7 связан с более высокими уровнями SDF-1 в плазме. Например, конкретные терапевтические средства, такие как пакситаксел и бевацизумаб, вызывают повышение уровней SDF-1 в плазме, которые могут оказывать отрицательный эффект на лечение опухолей в результате освобождения большего количества происходящих из костного мозга эндотелиальных клеток-предшественников или в результате стимуляции роста, инвазионной способности или метастазирования (Shaked, Henke et al., 2008; Xu, Duda et al., 2009). В этом случае совместное применение связывающейся с SDF-1 нуклеиновой кислоты будет уменьшать эффекты повышенных уровней SDF-1 в плазме.

Кроме того, ингибирование осевой линии SDF-1-CXCR4 и/или осевой линии SDF-1-CXCR7 с помощью связывающейся с SDF-1 молекулы нуклеиновой кислоты в соответствии с настоящими изобретением будет усиливать противоопухолевые эффекты других терапевтических средств в результате нарушения адгезионных взаимодействий стромы с лейкозными и другими раковыми клетками, которые обеспечивают выживание и придают устойчивость к этим терапиям (Jin et al., 2008; Nervi et al., 2009). Такое применение связывающейся с SDF-1 молекулы нуклеиновой кислоты известно как процесс, называемый химиосенсибилизацией.

Сенсибилизация опухолевых клеток к химиотерапии или радиотерапии известна как «химиосенсибилизация» или «радиосенсибилизация», соответственно. Такая «химиосенсибилизация» или «радиосенсибилизация», предпочтительно с помощью молекул нуклеиновых кислот в соответствии с настоящим изобретением, сенсибилизирует субъекта, страдающего заболеванием или нарушением, в соответствии с чем сенсибилизированный субъект является более способным к реагированию на терапию для лечения и/или предупреждения заболевания или нарушения, в соответствии с чем предпочтительно заболеванием или нарушением является рак. Такое лечение, используемое вместе с основным лечением, предпочтительно лечением рака, является вспомогательной терапией в соответствии с настоящим изобретением и также называется дополнительной терапией. Целью такой вспомогательной терапии является содействие основному лечению, предпочтительно основному лечению рака. Следовательно, ингибирование осевой линии SDF-1-CXCR4 и/или SDF-1-CXCR7 будет особенно эффективным при лечении широкого ряда и опухолей кроветворной системы, и солидных опухолей, или в виде монотерапии, или в комбинации с другими лечениями, такими как, но без ограничения, лекарственная терапия, клеточная терапия, облучение и хирургическое вмешательство.

Таким образом и ввиду описанной вовлеченности SDF-1 и рецепторов для SDF-1, таких как CXCR4 и CXCR7, связывание SDF-1 и ингибирование взаимодействия между SDF-1 и рецептором для SDF-1 с помощью молекул нуклеиновых кислот в соответствии с настоящим изобретением может помочь в ослаблении таких заболеваний, в соответствии с чем ингибирование SDF-1 с помощью связывающихся с SDF-1 молекул нуклеиновых кислот в соответствии с настоящим изобретением приводит к химиосенсибилизации злокачественных клеток, подвергаемых обработке с помощью химиотерапии, уменьшению или ингибированию роста и инвазионной способности, ингибированию ангиогенеза/васкулогенеза, ингибированию метастазирования и/или ингибированию повышенных уровней SDF-1 в плазме, возникающих в результате ответной реакции хозяина на химиотерапию.

Кроме того, настоящее изобретение основывается на неожиданном открытии, что можно создать молекулы нуклеиновых кислот, связывающиеся специфически и с высоким сродством с SDF-1, ингибирующие и противодействующие тем самым эффекты(ам) SDF-1, в частности, эффекты(ам) SDF-1 на его рецепторы, такие как CXCR4 и CXCR7.

Антагонистом по отношению к SDF-1 является молекула, такая как связывающаяся с SDF-1 молекула нуклеиновых кислот в соответствии с настоящим изобретением, которая связывается с SDF-1 и ингибирует функцию SDF-1, предпочтительно в in vitro анализе или в in vivo модели, которые описываются в разделе «Примеры».

В рамках настоящего изобретения находится то, что нуклеиновая кислота в соответствии с настоящим изобретением является молекулой нуклеиновой кислоты. В такой мере термины «нуклеиновая кислота» и «молекула нуклеиновой кислоты» используются здесь как синонимы, кроме особо оговоренных случаев. Кроме того, такие нуклеиновые кислоты предпочтительно также называют здесь молекулами нуклеиновых кислот в соответствии с настоящим изобретением, нуклеиновыми кислотами в соответствии с настоящим изобретением, нуклеиновыми кислотами настоящего изобретения или молекулами нуклеиновых кислот настоящего изобретения.

Признаки нуклеиновой кислоты в соответствии с настоящим изобретением, описываемые здесь, могут быть реализованы в любом аспекте настоящего изобретения, в котором нуклеиновая кислота используется или отдельно, или в любой комбинации.

Как описано подробнее здесь, авторы настоящего изобретения идентифицировали ряд различных связывающихся с SDF-1 молекул нуклеиновых кислот, в соответствии с чем молекулы нуклеиновых кислот можно охарактеризовать на основе участков нуклеотидов, которые также называют здесь боксами (см. пример 1). Как экспериментально установлено в примерах 5-11, авторы настоящего изобретения смогли, как ни удивительно, продемонстрировать в нескольких системах, что связывающиеся с SDF-1 молекулы нуклеиновых кислот подходят для лечения рака и в действительности способны к лечению рака.

Различные типы связывающихся с SDF-1 молекул нуклеиновых кислот включают три различных участка нуклеотидов: первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов. Как правило, связывающиеся с SDF-1 молекулы нуклеиновых кислот настоящего изобретения содержат на своих 5'-конце и 3'-конце концевые участки нуклеотидов: первый концевой участок нуклеотидов и второй концевой участок нуклеотидов (также называемый 5'-концевым участком нуклеотидов и 3'-концевым участком нуклеотидов). Первый концевой участок нуклеотидов и второй концевой участок нуклеотидов могут, в принципе благодаря комплементарности их оснований, гибридизоваться друг с другом, в соответствии с чем при гибридизации образуется двухцепочечная структура. Однако такая гибридизация необязательно происходит в молекуле в физиологических и/или нефизиологических условиях. Три участка нуклеотидов связывающихся с SDF-1 молекул нуклеиновых кислот - первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов - располагаются друг относительно друга в направлении 5'→3' следующим образом: первый концевой участок нуклеотидов - центральный участок нуклеотидов - второй концевой участок нуклеотидов. Однако, альтернативно, в направлении 5'→3' располагаются друг относительно друга второй концевой участок нуклеотидов, центральный участок нуклеотидов и первый концевой участок нуклеотидов.

Различие последовательностей описанных боксов или участков между различными связывающимися с SDF-1 молекулами нуклеиновых кислот влияет на сродство связывания с SDF-1. Основываясь на анализе связывания различных связывающихся с SDF-1 молекул нуклеиновых кислот настоящего изобретения, центральный участок и образующие его нуклеотиды по отдельности и более предпочтительно в их общей сумме важны для связывания с SDF-1 человека.

Термины «участок» и «участок нуклеотидов» используются здесь как синонимы, кроме особо оговоренных случаев.

В предпочтительном варианте осуществления нуклеиновая кислота в соответствии с настоящим изобретением является одной молекулой нуклеиновой кислоты. В дальнейшем варианте осуществления одна молекула нуклеиновой кислоты присутствует в виде множества из одной молекулы нуклеиновой кислоты или в виде множества из одного вида молекулы нуклеиновой кислоты.

Квалифицированные в данной области техники специалисты признают, что молекула нуклеиновой кислоты в соответствии с настоящим изобретением предпочтительно состоит из нуклеотидов, которые ковалентно связаны друг с другом, предпочтительно благодаря фосфодиэфирным связям.

В рамках настоящего изобретения находится то, что нуклеиновые кислоты в соответствии с настоящим изобретением включают два или более участков или их частей, которые могут, в принципе, гибридизоваться друг с другом. При такой гибридизации образуется двухцепочечная структура. Квалифицированные в данной области техники специалисты признают, что такая гибридизация может происходить или может не происходить, в частности, в условиях in vitro и/или in vivo. Также в случае такой гибридизации необязательно гибридизация происходит по всей длине двух участков, когда, по крайней мере на основе правил для спаривания оснований, такая гибридизация и, следовательно, образование двухцепочечной структуры может, в принципе, происходить. Как предпочтительно здесь используется, двухцепочечная структура является частью молекулы нуклеиновой кислоты или структурой, образованной двумя или более отдельными цепями или двумя пространственно разделенными участками одной цепи молекулы нуклеиновой кислоты, в соответствии с чем существует по крайней мере одна, предпочтительно две или более пар оснований, которые являются спаривающимися предпочтительно в соответствии с правилами спаривания оснований Уотсона-Крика. Также квалифицированный в данной области техники специалист признает, что другие спаривания оснований, такие как спаривание оснований Хугстена, могут существовать в такой двухцепочечной структуре или образовывать ее. Также следует признать, что тот признак, что два участка гибридизуются, предпочтительно указывает на то, что такая гибридизация, как предполагают, происходит благодаря комплементарности оснований двух участков.

В предпочтительном варианте осуществления используемый здесь термин «расположение» означает порядок или порядок следования структурных или функциональных признаков или элементов, описываемых здесь, в связи с нуклеиновыми кислотами, раскрытыми здесь.

Квалифицированный в данной области техники специалист признает, что нуклеиновые кислоты в соответствии с настоящим изобретением способны к связыванию с SDF-1. Без желания ограничиться какой-либо теорией, авторы настоящего изобретения предполагают, что связывание с SDF-1 является следствием комбинации пространственных структурных признаков или элементов заявленной молекулы нуклеиновой кислоты, которые обусловлены ориентацией и характерами укладки первичной последовательности нуклеотидов, образующей такие признаки или элементы, в соответствии с чем предпочтительно такими признаками или элементами являются первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов связывающихся с SDF-1 молекул нуклеиновых кислот. Очевидно, что индивидуальный признак или элемент может быть образован отличными индивидуальными последовательностями, степень отличия которых может меняться в зависимости от трехмерной структуры, которую такой признак или элемент должен образовать. Общая способность к связыванию заявленной нуклеиновой кислоты является следствием взаимодействия различных элементов и признаков, соответственно, которое, в конечном счете, приводит к взаимодействию заявленной нуклеиновой кислоты со своей мишенью, т.е. SDF-1. Снова без желания ограничиться какой-либо теорией, центральный участок нуклеотидов, который является характерным признаком связывающихся с SDF-1 нуклеиновых кислот, по-видимому, важен для опосредования связывания заявленных молекул нуклеиновых кислот с SDF-1. Соответственно, нуклеиновые кислоты в соответствии с настоящим изобретением являются подходящими для взаимодействия с SDF-1. Также квалифицированный в данной области техники специалист признает, что нуклеиновые кислоты в соответствии с настоящим изобретением являются антагонистами SDF-1. Из-за этого нуклеиновые кислоты в соответствии с настоящим изобретением подходят для лечения и предупреждения, соответственно, любого заболевания или состояния, которое связано с SDF-1 или обусловлено им. Такие заболевания и состояния можно заимствовать из известного уровня техники, в котором установлено, что SDF-1 вовлечен в указанные заболевания и состояния или связан с ними, соответственно, и который включен сюда посредством ссылки, обеспечивая научное обоснование терапевтического применения нуклеиновых кислот в соответствии с настоящим изобретением.

Нуклеиновые кислоты в соответствии с настоящим изобретением будут также включать нуклеиновые кислоты, которые в высшей степени гомологичны конкретным последовательностям, раскрытым здесь. Под термином «в высшей степени гомологичны» будет подразумеваться, что, например, гомология составляет по крайней мере 75%, предпочтительно 85%, более предпочтительно 90% и наиболее предпочтительно более чем 95%, 96%, 97%, 98% или 99%.

Фактический процент гомологичных нуклеотидов, присутствующих в нуклеиновой кислоте в соответствии с настоящим изобретением, будет зависеть от общего числа нуклеотидов, присутствующих в нуклеиновой кислоте. Процент модификации может основываться на общем числе нуклеотидов, присутствующих в нуклеиновой кислоте.

Гомологию между двумя молекулами нуклеиновых кислот можно определить, как известно квалифицированному в данной области техники специалисту. Конкретнее, алгоритм для сравнения последовательностей может использоваться для расчета процента гомологии между исследуемой последовательности(ями) и контрольной последовательностью, на основе намеченных параметров программы. Исследуемой последовательностью предпочтительно является последовательность или молекула нуклеиновой кислоты, которая, как полагают, является гомологичной отличной молекуле нуклеиновой кислоты или исследуется в отношении того, является ли она гомологичной ей, и если да, то в какой степени, в соответствии с чем такую отличную молекулу нуклеиновой кислоты также называют контрольной последовательностью. В варианте осуществления контрольной последовательностью является молекула нуклеиновой кислоты, описываемая здесь, предпочтительно молекула нуклеиновой кислоты, имеющая последовательность в соответствии с любой из SEQ ID NO: 5 - SEQ ID NO: 225, более предпочтительно молекула нуклеиновой кислоты, имеющая последовательность в соответствии с любой из SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 129, SEQ ID NO: 134, SEQ ID NO: 135, SEQ ID NO: 223, SEQ ID NO: 224, SEQ ID NO: 84, SEQ ID NO: 146, SEQ ID NO: 142, SEQ ID NO: 143 и SEQ ID NO: 144. Оптимальное совмещение последовательность для сравнения можно выполнить, например, с использованием алгоритма для локальной гомологии Smith & Waterman (Smith & Waterman, 1981), с использованием алгоритма для совмещения для определения гомологии Needleman & Wunsch (Needleman & Wunsch, 1970), с использованием способа поиска схожести Pearson & Lipman (Pearson & Lipman, 1988), посредством выполнений компьютером этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете компьютерных программ Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.) или с помощью визуальной проверки.

Одним примером алгоритма, который является подходящим для определения процента идентичности последовательностей, является алгоритм, используемый в средстве поиска основного локального совмещения (в дальнейшем «BLAST»), см., например, Altschul et al., (Altschul et al., 1990 and Altschul et al., 1997). Программное обеспечение для выполнения анализов BLAST общедоступно через Национальный центр биотехнологической информации (в дальнейшем «NCBI»). Параметры по умолчанию, используемые при определении идентичности последовательностей, используя программное обеспечение, доступное через NCBI, например, BLASTN (для нуклеотидных последовательностей) и BLASTP (для аминокислотных последовательностей), описаны McGinnis и др. (McGinnis et al., 2004).

Нуклеиновые кислоты в соответствии с настоящим изобретением будут также включать нуклеиновые кислоты, идентичные в определенной степени нуклеиновым кислотам, раскрытым здесь, что определяется по их нуклеотидной последовательности. Конкретнее, настоящее изобретение также включает те молекулы нуклеиновых кислот, которые идентичны на по крайней мере 75%, предпочтительно 85%, более предпочтительно 90% и наиболее предпочтительно более чем 95%, 96%, 97%, 98% или 99% нуклеиновым кислотам, раскрытым здесь, что определяется по их нуклеотидной последовательности или ее части.

Термин «нуклеиновая кислота настоящего изобретения» или «нуклеиновая кислота в соответствии с настоящим изобретением» будет также включать те нуклеиновые кислоты, которые включают раскрытые здесь последовательности нуклеиновых кислот или их часть, такую как, например, метаболит или производное нуклеиновой кислоты в соответствии с настоящим изобретением, предпочтительно в той мере, в которой нуклеиновые кислоты или указанные части вовлечены в связывание с SDF-1 или способны к такому связыванию. Такая нуклеиновая кислота может быть получена из тех, которые здесь раскрыты, например, с помощью усечения. Усечение может относиться к одному из двух или обоим концам нуклеиновых кислот, раскрытых здесь. Также усечение может относиться к внутренней последовательности нуклеотидов, т.е. оно может относиться к нуклеотиду(ам) между 5'- и 3'-концевыми нуклеотидами, соответственно. Кроме того, усечение будет включать делецию всего одного нуклеотида из последовательности нуклеиновых кислот, раскрытых здесь. Усечение может также относиться к более чем одному участку нуклеиновой кислоты (кислот) настоящего изобретения, в соответствии с чем длина участка может составлять всего один нуклеотид. Связывание нуклеиновой кислоты в соответствии с настоящим изобретением может быть определено квалифицированными в данной области техники специалистами, используя обычные эксперименты или используя или адоптируя способ, описанный здесь, предпочтительно описанный здесь в разделе «Примеры».

Нуклеиновые кислоты в соответствии с настоящим изобретением могут быть или D-нуклеиновыми кислотами, или L-нуклеиновыми кислотами. Предпочтительно нуклеиновые кислоты настоящего изобретения являются L-нуклеиновыми кислотами. Кроме того, возможно, что одна или несколько частей нуклеиновых кислот присутствуют в виде D-нуклеиновых кислот, или по крайней мере одна или несколько частей нуклеиновых кислот являются L-нуклеиновыми кислотами. Термин «часть» нуклеиновых кислот будет означать всего один нуклеотид. Такие нуклеиновые кислоты обычно называют здесь D- и L-нуклеиновыми кислотами, соответственно. Следовательно, в особо предпочтительном варианте осуществления нуклеиновые кислоты в соответствии с настоящим изобретением состоят из L-нуклеотидов и включают по крайней мере один D-нуклеотид. Такой D-нуклеотид предпочтительно присоединен к части, отличной от участков, определяющих нуклеиновые кислоты в соответствии с настоящим изобретением, предпочтительно тех их частей, которые вовлечены во взаимодействие с другими частями нуклеиновой кислоты. Предпочтительно такой D-нуклеотид присоединен к концу любого из участков и любой нуклеиновой кислоты в соответствии с настоящим изобретением, соответственно. В дальнейшем предпочтительном варианте осуществления такие D-нуклеотиды могут выполнять роль спейсера или линкера, предпочтительно присоединяющего модификации, такие как ПЭГ и ГЭК, к нуклеиновым кислотам в соответствии с настоящим изобретением.

В рамках настоящего изобретения также находится то, что каждая и любая из молекул нуклеиновых кислот, описываемых здесь, в своей целостности, исходя из последовательности(ей) нуклеиновой кислоты, ограничивается конкретной нуклеотидной последовательностью(ями). Другими словами, термины «включающий» или «включают (включает)» следует интерпретировать в таком варианте осуществления в значении «содержащий» или «состоящий из».

В рамках настоящего изобретения также находится то, что нуклеиновые кислоты в соответствии с настоящим изобретением являются частью более длинной нуклеиновой кислоты, в соответствии с чем эта более длинная нуклеиновая кислота включает несколько частей, в соответствии с чем по крайней мере одна такая часть является нуклеиновой кислотой, или ее частью, в соответствии с настоящим изобретением. Другая часть(и) этих более длинных нуклеиновых кислот может быть или одной, или несколькими D-нуклеиновыми кислотами или L-нуклеиновыми кислотами. Любая комбинация может использоваться в связи с настоящим изобретением. Эти другие части (часть) более длинной нуклеиновой кислоты могут проявлять функцию, отличную от связывания, предпочтительно от связывания с SDF-1. Одной возможной функцией является допуск взаимодействия с другими молекулами, в соответствии с чем такие другие молекулы предпочтительно отличны от SDF-1, например, для иммобилизации, сшивания, выявления или амплификации. В дальнейшем варианте осуществления настоящего изобретения нуклеиновые кислоты в соответствии с настоящим изобретением включают, в качестве индивидуальных или объединенных составляющих, некоторое число нуклеиновых кислот настоящего изобретения. Такая нуклеиновая кислота, включающая некоторое количество нуклеиновых кислот настоящего изобретения, также охватывается термин «более длинная нуклеиновая кислота».

L-нуклеиновые кислоты, как здесь используются, являются нуклеиновыми кислотами, состоящими из L-нуклеотидов, предпочтительно состоящими полностью из L-нуклеотидов.

D-нуклеиновые кислоты, как здесь используются, являются нуклеиновыми кислотами, состоящими из D-нуклеотидов, предпочтительно состоящими полностью из D-нуклеотидов.

Термины «нуклеиновая кислота» и «молекула нуклеиновой кислоты» используются здесь взаимозаменяемо, кроме особо оговоренных случаев.

Также, кроме особо оговоренных случаев, любая нуклеотидная последовательность представлена здесь в направлении 5'→3'.

Как предпочтительно здесь используется, любое положение нуклеотида определено, или на его ссылаются, относительно 5'-конца последовательности, участка или подучастка. Соответственно, вторым нуклеотидом является второй нуклеотид, отсчитанный с 5'-конца последовательности, участка или подучастка, соответственно. Также в соответствии с этим, предпоследним нуклеотидом является второй нуклеотид, отсчитанный с 3'-конца последовательности, участка или подучастка, соответственно.

Независимо от того, состоит ли нуклеиновая кислота настоящего изобретения из D-нуклеотидов, L-нуклеотидов или их комбинации, при этом комбинация является, например, случайной комбинацией или определенным рядом участков, состоящим из по крайней мере одного L-нуклеотида и по крайней мере одной D-нуклеиновой кислоты, нуклеиновая кислота может состоять из дезоксирибонуклеотида(ов), рибонуклеотида(ов) или их комбинации.

Конструирование нуклеиновых кислот настоящего изобретения в виде L-нуклеиновой кислоты является выгодным по нескольким причинам. L-нуклеиновые кислоты являются энантиомерами встречающихся в природе нуклеиновых кислот. Однако D-нуклеиновые кислоты не очень стабильны в водных растворах и особенно в биологических системах или биологических образцах из-за повсеместного присутствия нуклеаз. Встречающиеся в природе нуклеазы, в частности, нуклеазы из клеток животных, неспособны к деградации L-нуклеиновых кислот. Вследствие этого полупериод биологической жизни L-нуклеиновой кислоты является значительно увеличенным в такой системе, в том числе организме животного и человека. Из-за отсутствия деградируемости L-нуклеиновой кислоты продукты деградации под действием нуклеаз не образуются, и поэтому не наблюдаются побочные эффекты, обусловленные ими. Этот аспект отделяет L-нуклеиновую кислоту от фактически всех других соединений, которые используются при лечении заболеваний и/или нарушений, в патогенез которых вовлечено присутствие SDF-1. L-нуклеиновые кислоты, которые специфически связываются с молекулой-мишенью посредством механизма, отличного от спаривания оснований Уотсона-Крика, или аптамеры, которые состоят частично или полностью из L-нуклеотидов, особенно с теми частями аптамера, которые вовлечены в связывание аптамера с молекулой-мишенью, также называют шпигельмерами. Аптамеры и шпигельмеры как таковые известны квалифицированному в данной области техники специалисту и описаны, среди прочего, в «The Aptamer Handbook» (под редакцией Klussmann, 2006).

В рамках настоящего изобретения также находится то, что нуклеиновые кислоты настоящего изобретения, независимо от того, присутствуют ли они в виде D-нуклеиновых кислот, L-нуклеиновых кислот или D,L-нуклеиновых кислот, или того, являются ли они ДНК или РНК, могут быть представлены в виде одноцепочечных или двухцепочечных нуклеиновых кислот. Типично нуклеиновые кислоты настоящего изобретения являются одноцепочечными нуклеиновыми кислотами, которые демонстрируют определенные вторичные структуры, обусловленные первичной последовательностью, и могут, таким образом, также образовывать третичные структуры. Однако нуклеиновые кислоты настоящего изобретения могут также быть двухцепочечными в том смысле, что две цепи, которые являются комплементарными или частично комплементарными друг другу, гибридизуются друг с другом.

Нуклеиновые кислоты настоящего изобретения могут быть модифицированными. Такие модификации могут относиться к одному нуклеотиду нуклеиновой кислоты и хорошо известны в данной области техники. Примеры таких модификаций описаны, среди прочего, Venkatesan и др. (Venkatesan, Kim et al., 2003) и Kusser (Kusser 2000). Такой модификацией может быть атом H, атом F или O-CH3-группа или NH2-группа в 2'-положении индивидуального нуклеотида, из которого состоит нуклеиновая кислота. Также нуклеиновая кислота в соответствии с настоящим изобретением может включать по крайней мере один LNA-нуклеотид (закрытую нуклеиновую кислоту). В варианте осуществления нуклеиновая кислота в соответствии с настоящим изобретением состоит из LNA-нуклеотидов.

В варианте осуществления нуклеиновая кислота в соответствии с настоящим изобретением может быть состоящей из нескольких частей нуклеиновой кислотой. Состоящей из нескольких частей нуклеиновой кислотой, как здесь используется, является нуклеиновая кислота, которая состоит из по крайней мере двух отдельных цепей нуклеиновой кислоты. Эти по крайней мере две цепи нуклеиновой кислоты образуют функциональную единицу, в соответствии с чем функциональной единицей является лиганд для молекулы-мишени. По крайней мере две цепи нуклеиновой кислоты могут быть получены из любой из нуклеиновых кислот настоящего изобретения или с помощью расщепления молекулы нуклеиновой кислоты для образования двух цепей, или с помощью синтеза одной нуклеиновой кислоты, соответствующей первой части нуклеиновой кислоты настоящего изобретения, т.е. полноразмерной нуклеиновой кислоты, и другой нуклеиновой кислоты, соответствующей второй части полноразмерной нуклеиновой кислоты. Следует признать, что и расщепление, и синтез могут использоваться для создания состоящей из нескольких частей нуклеиновой кислоты, в которой существуют более чем две цепи, проиллюстрированные выше. Другими словами, по крайней мере две отдельные цепи нуклеиновой кислоты обычно отличны от двух цепей, которые являются комплементарными и гибридизуются друг с другом, хотя некоторая степень комплементарности между указанными по крайней мере двумя цепями нуклеиновой кислоты может существовать, и в соответствии с чем такая комплементарность может приводить к гибридизации указанных отдельных цепей.

Наконец, в рамках настоящего изобретения также находится то, что формируется полностью закрытая, т.е. кольцевая, структура для нуклеиновых кислот в соответствии с настоящим изобретением, т.е. то, что нуклеиновые кислоты в соответствии с настоящим изобретением являются закрытыми в варианте осуществления, предпочтительно благодаря ковалентной связи, в соответствии с чем более предпочтительно, когда такая ковалентная связь создается между 5'-концом и 3'-концом последовательностей нуклеиновых кислот, раскрытых здесь, или любого их производного.

Возможностью определения констант связывания молекул нуклеиновых кислот в соответствии с настоящим изобретением является использование способов, описанных в примерах 3 и 4, которые служат подтверждением того открытия, что нуклеиновые кислоты в соответствии с настоящим изобретением демонстрируют подходящий диапазон значений KD. Соответствующим показателем для выражения силы связывания между индивидуальной молекулой нуклеиновой кислоты и мишенью, которой в данном случае является SDF-1, является так называемое значение KD, которое как таковое, а также способ его определения известны квалифицированному в данной области техники специалисту.

Предпочтительно, когда значение KD, которое демонстрируют нуклеиновые кислоты в соответствии с настоящим изобретением, ниже 1 мкМ. Значение KD, превышающее 1 мкМ, как полагают, является характеристикой неспецифического связывания нуклеиновой кислоты с мишенью. Как будет признано квалифицированными в данной области техники специалистами, значение KD группы соединений, таких как нуклеиновые кислоты в соответствии с настоящим изобретением, находится в определенном диапазоне. Вышеупомянутое значение KD, составляющее приблизительно 1 мкМ, является предпочтительной верхней границей для значения KD. Нижняя граница для значения KD связывающихся с мишенью нуклеиновых кислот может составлять лишь 10 пМ или может быть меньше. В рамках настоящего изобретения находится то, что значения KD индивидуальных нуклеиновых кислот, связывающихся с SDF-1, предпочтительно находятся в этом диапазоне. Предпочтительные диапазоны можно определить посредством выбора любого первого числа в этом диапазоне и любого второго числа в этом диапазоне. Предпочтительные верхние значения KD составляют 250 нМ и 100 нМ, предпочтительные нижние значения KD составляют 50 нМ, 10 нМ, 1 нМ, 100 пМ и 10 пМ. Более предпочтительное верхнее значение KD равно 2,5 нМ, более предпочтительное нижнее значение KD равно 100 пМ.

Помимо способности молекул нуклеиновых кислот в соответствии с настоящим изобретением к связыванию, молекулы нуклеиновых кислот в соответствии с настоящим изобретением ингибируют функцию соответствующей молекулы-мишени, которой в данном случае является SDF-1. Ингибирование функции SDF-1 - например, стимуляции соответствующих рецепторов, описанных выше - достигается в результате связывания молекул нуклеиновых кислот в соответствии с настоящим изобретением с SDF-1 и образования комплекса молекулы нуклеиновой кислоты в соответствии с настоящим изобретением и MCP-1 и SDF-1. Такой комплекс молекулы нуклеиновой кислоты и SDF-1 не может стимулировать рецепторы, которые обычно стимулируются SDF-1. Соответственно, ингибирование функции рецептора с помощью молекул нуклеиновых кислот в соответствии с настоящим изобретением не зависит от соответствующего рецептора, который может стимулировать SDF-1, а является следствием предотвращения стимуляции рецептора с помощью MCP-1 и SDF-1 молекулами нуклеиновых кислот в соответствии с настоящим изобретением.

Возможностью определения констант ингибирования молекул нуклеиновых кислот в соответствии с настоящим изобретением является использование способов, описанных в примерах 5 и 6 (например, для CXCR4 и CXCR7, соответственно), которые служат подтверждением вышеотмеченного открытия, что нуклеиновые кислоты в соответствии с настоящим изобретением демонстрируют подходящую константу ингибирования, которая позволяет использовать указанные нуклеиновые кислоты в схеме терапевтического лечения. Соответствующим показатель для выражения силы ингибиторного эффекта индивидуальной молекулы нуклеиновой кислоты на взаимодействие мишени, которой в данном случае является SDF-1, и соответствующего рецептора, является так называемая концентрация полумаксимального ингибирования (сокр. IC50), которая как таковая, а также способ ее определения известны квалифицированному в данной области техники специалисту.

Предпочтительно, значение IC50, которое демонстрируют молекулы нуклеиновых кислот в соответствии с настоящим изобретением, ниже 1 мкМ. Значение IC50, превышающее 1 мкМ, как полагают, является характеристикой неспецифического ингибирования функций мишени с помощью молекулы нуклеиновой кислоты. Как будет признано квалифицированными в данной области техники специалистами, значение IC50 группы соединений, таких как нуклеиновые кислоты в соответствии с настоящим изобретением, находится в определенном диапазоне. Вышеупомянутое значение IC50, составляющее приблизительно 1 мкМ, является предпочтительной верхней границей для значения IC50. Нижняя граница для значения IC50 связывающихся с мишенью нуклеиновых кислот может составлять лишь 10 пМ или может быть меньше. В рамках настоящего изобретения находится то, что значения IC50 индивидуальных нуклеиновых кислот, связывающихся с SDF-1, предпочтительно находятся в этом диапазоне. Предпочтительные диапазоны можно определить посредством выбора любого первого числа в этом диапазоне и любого второго числа в этом диапазоне. Предпочтительные верхние значения IC50 составляют 250 нМ и 100 нМ, предпочтительные нижние значения IC50 составляют 50 нМ, 10 нМ, 1 нМ, 100 пМ и 10 пМ. Более предпочтительное верхнее значение IC50 равно 2,5 нМ, более предпочтительное нижнее значение IC50 равно 100 пМ.

Молекулы нуклеиновых кислот в соответствии с настоящим изобретением могут иметь любую длину при условии, что они все еще способны к связыванию с молекулой мишени. В данной области техники будет признано, что существуют предпочтительные длины нуклеиновых кислот в соответствии с настоящим изобретением. Типично длина составляет от 15 до 120 нуклеотидов. Квалифицированные в данной области техники специалисты признают, что любе целое число между 15 и 120 является возможной длиной для нуклеиновых кислот в соответствии с настоящим изобретением. Более предпочтительными диапазонами для длины нуклеиновых кислот в соответствии с настоящим изобретением являются длины от приблизительно 20 до 100 нуклеотидов, от приблизительно 20 до 80 нуклеотидов, от приблизительно 20 до 60 нуклеотидов, от приблизительно 20 до 50 нуклеотидов и от приблизительно 29 до 450 нуклеотидов.

В рамках настоящего изобретения находится то, что нуклеиновые кислоты, раскрытые здесь, включают составляющую, которая предпочтительно является высокомолекулярной составляющей, и/или которая предпочтительно позволяет изменить характеристики нуклеиновой кислоты в отношении, среди прочего, времени жизни в организме животного, предпочтительно организме человека. Особенно предпочтительным вариантом осуществления такой модификации является ПЭГилирование и ГЭКилирование нуклеиновых кислот в соответствии с настоящим изобретением. Как здесь используется, ПЭГ означает полиэтиленгликоль, а ГЭК - гидроксиэтилкрахмал. ПЭГилирование, как предпочтительно используется здесь, является модификацией нуклеиновой кислоты в соответствии с настоящим изобретением, в соответствии с чем такая модификация состоит из ПЭГ-составляющей, которая присоединена к нуклеиновой кислоте в соответствии с настоящим изобретением. ГЭКилирование, как предпочтительно используется здесь, является модификацией нуклеиновой кислоты в соответствии с настоящим изобретением, в соответствии с чем такая модификация состоит из ГЭК-составляющей, которая присоединена к нуклеиновой кислоте в соответствии с настоящим изобретением. Эти модификации, а также процесс модифицирования нуклеиновой кислоты, используя такие модификации, описан в заявке на Европейский патент EP 1306382, описание которой включено в ее полном объеме посредством ссылки.

В том случае, когда ПЭГ является такой высокомолекулярной составляющей, молекулярная масса предпочтительно составляет от приблизительно 20000 до приблизительно 120000 Да, более предпочтительно от приблизительно 30000 до приблизительно 80000 Да и наиболее предпочтительно приблизительно 40000 Да. В том случае, когда ГЭК является такой высокомолекулярной составляющей, молекулярная масса предпочтительно составляет от приблизительно 50 до приблизительно 1000 кДа, более предпочтительно от приблизительно 100 до приблизительно 700 кДа и наиболее предпочтительно от 200 до 500 кДа. ГЭК демонстрирует молярное замещение, составляющее 0,1-1,5, более предпочтительно 1-1,5, и демонстрирует образец замещения, представляемый в виде отношения C2/C6, составляющего приблизительно 0,1-15, предпочтительно приблизительно 3-10. Процесс ГЭК-модифицирования описывается, например, в заявке на патент Германии DE 1 2004 006249.8, описание которой включено в ее полном объеме посредством ссылки.

В принципе, модификацию молекул нуклеиновых кислот настоящего изобретения можно осуществить в любом их положении. Предпочтительно такую модификацию осуществляют или в 5'-концевой нуклеотиде, 3'-концевом нуклеотиде и/или любом нуклеотиде между 5' нуклеотидом и 3' нуклеотидом молекулы нуклеиновой кислоты.

Модификация и предпочтительно ПЭГ- и/или ГЭК-составляющая может быть присоединена к молекуле нуклеиновой кислоты настоящего изобретения или непосредственно, или опосредованно, предпочтительно через линкер. В рамках настоящего изобретения также находится то, что молекула нуклеиновой кислоты в соответствии с настоящим изобретением включает одну или более модификаций, предпочтительно одну или более ПЭГ- и/или ГЭК-составляющих. В варианте осуществления отдельная линкерная молекула присоединяет более чем одну ПЭГ-составляющую или ГЭК-составляющую к молекуле нуклеиновой кислоты в соответствии с настоящим изобретением. Сам линкер, используемый в связи с настоящим изобретением, может быть неразветвленным или разветвленным. Эти виды линкеров известны квалифицированным в данной области техники специалистам и, кроме того, описываются в заявках на патенты WO2005/074993 и WO2003/035665.

В предпочтительном варианте осуществления линкером является биодеградируемый линкер. Биодеградируемый линкер делает возможным изменение характеристик нуклеиновой кислоты в отношении, среди прочего, времени жизни в организме животного, предпочтительно организме человека, благодаря освобождению модификации от нуклеиновой кислоты в соответствии с настоящим изобретением. Использование биодеградируемого линкера может сделать возможным лучшее контролирование времени жизни нуклеиновой кислоты в соответствии с настоящим изобретением. Предпочтительным вариантом осуществления такого биодеградируемого линкера является биодеградируемый линкер, описанный в, но без исключения, международных заявках на патенты WO2006/052790, WO2008/034122, WO2004/092191 и WO2005/099768.

В рамках настоящего изобретения находится то, что модификацией или группой модификаций является биодеградируемая модификация, в соответствии с чем биодеградируемая модификация может быть присоединена к молекуле нуклеиновой кислоты настоящего изобретения или непосредственно, или опосредованно, предпочтительно через линкер. Биодеградируемая модификация делает возможным изменение характеристик нуклеиновой кислоты в отношении, среди прочего, времени жизни в организме животного, предпочтительно организме человека, благодаря освобождению модификации от нуклеиновой кислоты в соответствии с настоящим изобретением. Использование биодеградируемой модификации может сделать возможным лучшее контролирование времени жизни нуклеиновой кислоты в соответствии с настоящим изобретением. Предпочтительным вариантом осуществления такой биодеградируемой модификации является биодеградируемая модификация, описанная в, но без ограничения, международных заявках на патенты WO2002/065963, WO2003/070823, WO2004/113394 и WO2000/41647, предпочтительно в WO2000/41647, стр. 18, строки 4-24.

Помимо описанных выше модификаций, другие модификации могут использоваться для изменения характеристик нуклеиновых кислот в соответствии с настоящим изобретением, в соответствии с чем такие другие модификации могут выбираться из группы белков, липидов, таких как холестерин, и сахарных цепей, таких как амилаза, декстран и т.д.

Без желания ограничиться какой-либо теорией, по-видимому, в результате модифицирования нуклеиновых кислот в соответствии с настоящим изобретением с помощью высокомолекулярной составляющей, такой как полимер, а конкретнее один или некоторое количество полимеров, описываемых здесь, которые предпочтительно являются физиологически приемлемыми, изменяется кинетика выведения. Конкретнее, по-видимому, из-за увеличения молекулярной массы таких модифицированных нуклеиновых кислот настоящего изобретения и из-за того, что нуклеиновые кислоты настоящего изобретения не подвергаются метаболизму, особенно в случае их нахождения в L-форме, уменьшается выведение из организма животного, предпочтительно организма млекопитающего и более предпочтительно из организма человека. Поскольку выведение обычно происходит через почки, авторы настоящего изобретения полагают, что скорость клубочковой фильтрации модифицированных таким образом нуклеиновых кислот является значительно уменьшенной по сравнению с нуклеиновыми кислотами, не имеющими такого вида высокомолекулярной модификации, которая приводит к увеличению времени жизни в организме животного. В связи с этим особо следует отметить, что, несмотря на такую высокомолекулярную модификацию, нет вредного влияния на специфичность нуклеиновых кислот в соответствии с настоящим изобретением. В такой мере, нуклеиновые кислоты в соответствии с настоящим изобретением обладают, среди прочего, такой неожиданной характеристикой - которую обычно нельзя ожидать от фармацевтически активных соединений - что обеспечение фармацевтического препарата для замедленного высвобождения не требуется обязательно для обеспечения замедленного высвобождения нуклеиновых кислот в соответствии с настоящим изобретением. Наоборот, нуклеиновые кислоты в соответствии с настоящим изобретением в их модифицированной форме, включающей высокомолекулярную составляющую, могут как таковые уже использоваться в качестве препарата с замедленным высвобождением, поскольку они уже действуют, благодаря своей модификации, как будто они высвободились из препарата с замедленным высвобождением. В такой мере, модификация(и) молекул нуклеиновых кислот в соответствии с настоящим изобретением, раскрытых здесь, и модифицированные таким образом молекулы нуклеиновых кислот в соответствии с настоящим изобретением и любая композиция, включающая их, может обеспечить отличную, предпочтительно контролируемую фармакокинетику и их биораспределение. Это также включает время жизни в кровяном русле и распределение в тканях. Такие модификации, кроме того, описываются в заявке на патент WO2003/035665.

Однако в рамках настоящего изобретения также находится то, что нуклеиновые кислоты в соответствии с настоящим изобретением не содержат никакую модификацию и, в частности, не содержат высокомолекулярную модификацию, такую как ПЭГилирование или ГЭКилирование. Такой вариант осуществления является особенно предпочтительным, когда нуклеиновая кислота в соответствии с настоящим изобретением демонстрирует предпочтительное распределение в каком-либо органе- или ткани-мишени организма, или когда быстрый клиренс нуклеиновой кислоты в соответствии с настоящим изобретением из организма после введения является желательным. Раскрытые здесь нуклеиновые кислоты в соответствии с настоящим изобретением с профилем преимущественного распределения в каком-либо органе- или ткани-мишени в организме, вероятно, сделают возможным установление эффективных локальных концентраций в ткани-мишени при сохранении низкой системной концентрации нуклеиновых кислот. Это сделало бы возможным использованием низких доз, которое не только выгодно с экономической точки зрения, но также уменьшает ненужное подвергание других тканей воздействию агента в виде нуклеиновой кислоты, уменьшая тем самым возможных риск побочных эффектов. Быстрый клиренс после введения нуклеиновых кислот в соответствии с настоящим изобретением из организма, вероятно, будет желательным, среди прочего, в случае получения in vivo изображения или специфических терапевтических требований к введению доз, используя нуклеиновые кислоты в соответствии с настоящим изобретением или включающие их лекарственные средства.

Нуклеиновые кислоты в соответствии с настоящим изобретением и/или антагонисты в соответствии с настоящим изобретением могут использоваться для создания или производства лекарственного средства. Такое лекарственное средство или фармацевтическая композиция в соответствии с настоящим изобретением содержит по крайней мере одну из нуклеиновых кислот настоящего изобретения, выбираемую из группы связывающихся с SDF-1 нуклеиновых кислот, необязательно вместе с дополнительными фармацевтически активными соединениями, в соответствии с чем нуклеиновая кислота настоящего изобретения предпочтительно сама действует как фармацевтически активное соединение. Такие лекарственные средства включают в предпочтительных вариантах осуществления по крайней мере фармацевтически приемлемый носитель. Таким носителем может быть, например, вода, буфер, PBS, раствор глюкозы, предпочтительно сбалансированный солевой раствор с 5% глюкозы, крахмал, сахар, желатин или любое другое приемлемое вещество-носитель. Такие носители, как правило, известны квалифицированному в данной области техники специалисту. Квалифицированный в данной области техники специалист признает, что любые варианты осуществления, применения и аспекты лекарственного средства настоящего изобретения или те, которые имеют отношение к нему, также применимы к фармацевтической композиции настоящего изобретения и наоборот.

Показание, заболевание и нарушения, для лечения и/или предупреждения которых применимы нуклеиновые кислоты, фармацевтические композиции и лекарственные средства в соответствии настоящим изобретением или те, которые приготовлены в соответствии с настоящим изобретением, вытекает из вовлеченности, или непосредственной, или опосредованной, SDF-1 в соответствующий механизм патогенеза.

Конечно, поскольку связывающиеся с SDF-1 нуклеиновые кислоты в соответствии с настоящим изобретением взаимодействуют и связываются с SDF-1 человека или мыши, квалифицированному специалисту будет в целом понятно, что связывающиеся с SDF-1 нуклеиновые кислоты в соответствии с настоящим изобретением могут смело использоваться для лечения, предупреждения и/или диагностирования любого описываемого здесь заболевания людей и животных. В связи с этим следует признать, что молекулы нуклеиновых кислот в соответствии с настоящим изобретением могут использоваться для лечения и предупреждения любого из заболеваний, нарушений или состояний, описываемых здесь, независимо от механизма, лежащего в основе такого заболевания, нарушения и состояния.

Ниже представлено логическое обоснование применения молекул нуклеиновых кислот в соответствии с настоящим изобретением в связи с различными заболеваниями, нарушениями и состояниями, что делает таким образом правдоподобной терапевтическую, профилактическую и диагностическую применимость молекул нуклеиновых кислот в соответствии с настоящим изобретением. Во избежание любого ненужного повторения следует признать, что вследствие вовлеченности осевой линии SDF-1 - рецептор для SDF-1, как описано в связи с ней, на указанную ось могут быть направлены молекулы нуклеиновых кислот в соответствии с настоящим изобретением из условия, чтобы достигался заявленный терапевтический, профилактический и диагностический эффект. Кроме того, следует признать, что особенности заболеваний, нарушений и состояний пациентов и любая детализация схемы лечения, представленная в связи с ними, могут быть указаны в предпочтительных вариантах осуществления настоящей заявки.

В случае злокачественных опухолей кроветворной системы, в частности, существуют заслуживающие внимания данные, что лейкозные клетки могут быть защищены от традиционных терапий (химиотерапии в сочетании с различными направленными агентами, такими как специфические антитела и ингибиторы киназ) в особых тканевых микроокружениях, называемых нишами. Такие ниши, в которых укрываются злокачественные клетки, которые затем способны распространяться и вызывать рецидив после первоначальной терапии, обнаружены, в частности, в костном мозге (Burger and Kipps, 2002; Burger and Burkle, 2007; Meads et al., 2008; Burger, Ghia et al., 2009). Эта охрана злокачественных клеток во время химиотерапии, как полагают, в значительной степени обусловлена непосредственным контактом между злокачественными клетками и стромальными клетками (Lagneaux, Delforge et al., 1998; Kurtova, Balakrishnan et al., 2009; Damiano, Cress et al., 1999), однако во множестве составляющих этого микроокружения существует множество клеточных и молекулярных сигналов, которые могут приводить к устойчивости злокачественных клеток к химиотерапии. Несмотря на это множество составляющих очевидно, что стромальные клетки продуцируют хемокин SDF-1, и как нормальные, так и злокачественные клетки, которые экспрессируют CXCR4, мигрируют в такие ниши и хранятся там. На то, что этот молекулярный путь является ключом для этого взаимодействия, указывает тот факт, что специфическое ингибирование этого взаимодействия является достаточным для освобождения и нормальных, и злокачественных клеток из ниш (Broxmeyer, Orschell et al., 2005; Devine, Flomenberg et al., 2004; Azab, Runnels et al., 2009). Помимо ослабления взаимодействия с нишами, в случае многочисленных злокачественных опухолей кроветворной системы было установлено, что разрушение осевой линии SDF-1-CXCR4 приводит к увеличению чувствительности клеток к другим терапиям - так называемой «химиосенсибилизации». Эта химиосенсибилизация была описана в случае множественной миеломы (Azab, Runnels et al., 2009) и различных острых и хронических лейкозов (Dillmann, Veldwijk et al., 2009; Lagneaux, Delforge et al., 1998).

Следовательно, использование связывающихся с SDF-1 нуклеиновых кислот в соответствии с настоящим изобретением для нарушения «переходного разговора» между злокачественными клетками и их окружение для сенсибилизации их к другим терапиям является привлекательной стратегией лечения злокачественных опухолей кроветворной системы. Примеры терапий, которые могут быть усилены в результате комбинирования со связывающимися с SDF-1 нуклеиновыми кислотами в соответствии с настоящим изобретением, включают следующие, но без ограничения, Флударабин, Циклофосфамид, Ритуксан, Хлорамбуцил, Леналидомид, Бортезомиб, Дексаметазон, Мелфалан, Иматиниб или Нилотиниб.

Предшествующее описание подчеркивает роль стромальных клеток костного мозга и ниш в костном мозге в защите злокачественных клеток от эффектов химиотерапии или других направленных терапий в случае злокачественных опухолей кроветворной системы. Однако существуют данные о схожих взаимодействиях, возникающих локально в солидных опухолях, поскольку большая часть клеток в солидных опухолях не является раковыми клетками, а точнее является стромальными клетками, иммуноцитами или клетками сосудов, происходящими от хозяина, которые тесно взаимодействуют с опухолевыми клетками. Множество различных типов солидных опухолей экспрессирует рецепторы CXCR4 (Engl, Relja et al., 2006; Müller, Homey et al., 2001; Koshiba, Hosotani et al., 2000, Ehtesham, Stevenson, et al., 2008; Zeelenberg, Ruuls-Van Stalle et al., 2003; Sauer, Seidler et al., 2005; Su, Zhang et al., 2005) и/или CXCR7 (Burns, Summers et al., 2006; Miao et al., 2007; Wang et al., 2008; Zheng, Li et al., 2010) или конститутивно, или в ответ на гипоксию или различные лечения. Злокачественные клетки могут использовать этот путь передачи сигналов для выживания и миграции в результате активации Akt и Erk. SDF-1 может продуцироваться самими злокачественными клетками или стромальными клетками внутри опухоли. И снова в этом сложном окружении точный механизм, с помощью которого опухолевые клетки растут и ускользают от химиотерапии или других терапевтических подходов, не четко определен. Однако очевидно, что осевая линия SDF-1-CXCR4 и осевая линия SDF-1-CXCR7 играют важную роль. Например, ингибирование CXCR4 сенсибилизирует линии глиомных клеток к in vitro химиотерапии (Redjal et al., 2006), а высокая экспрессия CXCR4 предсказывает плохой исход в случае рака молочной железы (Holm, Abreo et al., 2008; Mizell, Smith et al., 2009) и раков желудочно-кишечного тракта (Schimanski et al., 2008). Следовательно, применение связывающихся с SDF-1 нуклеиновых кислот в соответствии с настоящим изобретением для ингибирования действия SDF-1 на рецепторы или CXCR4, или CXCR7 в широком ряде солидных опухолей будет усиливать современную терапию, делая клетки более чувствительными к терапии или в результате прямого действия, или в результате блокирования взаимодействий с другими клетками в опухоли.

Помимо вышеуказанных аспектов, CXCR4 также передает сигналы, которые, как полагают, важны для рекрутмента и удержания проангиогенных и иммунодепрессивных клеток, происходящих из костного мозга (BMDC). Следовательно, это путь может также использоваться для VEGF-независимого ангиогенеза. В результате, в качестве привлекательной стратегии лечения солидных опухолей возникло блокирование осевой линии SDF1-CXCR4 для сенсибилизации опухолей к терапии с использованием антител против VEGF или облучению.

Однако есть опасение, что блокирование CXCR4 может быть недостаточным для блокирования эффектов SDF-1, который может также связываться с CXCR7 на раковых или стромальных клетках. Например, CXCR7, как недавно сообщалось, экспрессируется в клетках головного мозга и опосредует антиапоптозные эффекты, и, как было также установлено, регулирует инвазию, ангиогенез и рост печеночно-клеточных карцином человека. В таких случаях действие связывающихся с SDF-1 нуклеиновых кислот c блокированием действия SDF-1 на рецепторы и CXCR7, и CXCR4 с использованием одного агента, возможно, обеспечит особую эффективность по сравнению с блокаторами специфических рецепторов.

Лекарственное средство в соответствии с настоящим изобретением может использоваться в комбинации с дополнительным лекарственным средством или дополнительным фармацевтически активным агентом, в соответствии с чем дополнительное лекарственное средство или дополнительный фармацевтически активный агент повреждает, разрушает и/или метит раковые клетки. В случае использования молекулы нуклеиновой кислоты в соответствии с настоящим изобретением вместе с дополнительным лекарственным средством или дополнительным фармацевтически активным агентом терапия, основанная на молекуле нуклеиновой кислоты, является предпочтительно терапией, вспомогательной по отношению к терапии, в которой используется дополнительное лекарственное средство или дополнительный фармацевтически активный агент или которая основана на нем. Такое дополнительное лекарственное средство или дополнительный фармацевтически активный агент предпочтительно выбирают, но без ограничения, из группы, включающей

а) антитела, такие как Ритуксимаб (мишень: CD20), Цетуксимаб (мишень: рецептор эпидермального фактора роста), Ибритумомаб-Тиуксетан (мишень: CD20), Тоситумомаб (мишень: CD20), Трастузумаб (мишень: HER2/neu), Бевацизумаб (мишень: VEGF), Алемтузумаб (мишень: CD52);

b) алкилирующие агенты, такие как цисплатин, карбоплатин, оксалиплатин, мехлоретамин, циклофосфамид, хлорамбуцил, Доксорубицин, липосомальный Доксорубицин, бендамустин, Мелфалан, темозоломид;

c) антиметаболиты, такие как являющийся аналогом пурина азатиоприн, меркаптопурин, флударабин, пентостатин, кладрибин;

d) растительные алкалоиды, такие как алкалоиды барвинка, растительные терпеноиды, такие как таксаны, предпочтительно Доцетаксел, Паклитаксел, подофиллотоксин, эпотилон;

e) ингибиторы топоизомеразы, такие как камптотецины, иринотекан, митоксантрон;

f) и другие, такие как Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

Другие агенты, которые могут использоваться в качестве дополнительного фармацевтически активного агента при лечении рака, хорошо известны в данной области техники и включают, но без ограничения, иммунодепрессанты, цитокины и цитостатические агенты (для ссылки: "Allgemeine und Spezielle Pharmakologie und Toxikologie 2011", editor: Thomas Karow; Pulheim, Germany). Такие агенты, хорошо известные в данной области техники, используются при лечении рака в соответствии с современным стандартом лечения конкретной популяции раковых больных.

Будет признано, что вышеуказанные дополнительные фармацевтически активные агенты могут использоваться в связи с каждым любым аспектом настоящего изобретения, в котором используется такой дополнительный фармацевтически активный агент.

Дополнительное лекарственное средство или фармацевтически активный агент обладает действием химиотерапии или может обеспечить такое действие. Альтернативно химиотерапии или дополнительно к ней может использоваться радиотерапия.

Лекарственное средство в соответствии с настоящим изобретением, в комбинации с дополнительным лекарственным средством или дополнительным фармацевтически активным агентом или без него и с радиотерапией или без нее, может использоваться для лечения и/или предупреждения рака, предпочтительно

a) злокачественной опухоли кроветворной системы, в соответствии с чем более предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому;

b) солидных опухолей, соответствии с чем более предпочтительно солидные опухоли выбирают из группы глиобластомы, колоректального рака, рака молочной железы, лимфомы, рака предстательной железы, рака поджелудочной железы, рака легкого, рака почки и рака яичника.

Предпочтительно рак молочной железы выбирают из группы HER2-отрицательного рака молочной железы на поздней стадии.

Предпочтительно лейкоз выбирают из группы хронического лимфоидного лейкоза и острого миелоидного лейкоза.

Предпочтительно миелому выбирают из группы множественной миеломы.

Предпочтительным дополнительным лекарственным средством или дополнительным фармацевтически активным агентом для лечения глиобластомы является облучение или химиотерапия с использованием темозоломида или терапия с использованием бевацизумаба. Предпочтительное дополнительное лекарственное средство или дополнительный фармацевтически активный агент для лечения колоректального рака выбирают из группы, включающей фторурацил, Лейковорин, Оксалиплатин, Иринотекан и бевацизумаб.

Предпочтительное дополнительное лекарственное средство или дополнительный фармацевтически активный агент для лечения HER2-отрицательного рака молочной железы на поздней стадии выбирают из группы Доксорубицина, Паклитаксела, Доцетаксела, Метотрексата, Фторурацила, Бевацизумаба, Тамоксифена и ингибиторов ароматазы.

Предпочтительное дополнительное лекарственное средство или дополнительный фармацевтически активный агент для лечения хронического лимфоидного лейкоза выбирают из группы, включающей флударабин, циклофосфамид, ритуксимаб, Хлорамбуцил, алемтузумаб, винкристин, пентостатин, митоксантрон, доксорубицин, кладрибин и бендамустин.

Предпочтительное дополнительное лекарственное средство или дополнительный фармацевтически активный агент для лечения множественной миеломы выбирают из группы, включающей Леналидомид, Бортезомиб, Дексаметазон, Мелфалан, Циклофосфамид, липосомальный доксорубицин и преднизон.

В одном варианте осуществления лекарственного средства настоящего изобретения такое лекарственное средство предназначается для применения в комбинации с другими лечениями для любого из заболеваний, раскрытых здесь, особенно тех, для которых лекарственное средство настоящего изобретения должно использоваться.

«Комбинированная терапия» (или «котерапия») включает введение лекарственного средства настоящего изобретения и по крайней мере второго или дополнительного агента в качестве части конкретной схемы лечения, предназначенной для обеспечения положительного эффекта от совместного действия этих терапевтических средств, т.е. лекарственного средства настоящего изобретения и указанного второго или дополнительного агента. Положительный эффект комбинации включает, но без ограничения, фармакокинетическое или фармакодинамическое совместное действие, являющееся следствием объединения терапевтических средств. Введение этих терапевтических средств в комбинации типично осуществляют в течение заданного периода времени (обычно минут, часов, дней или недель в зависимости от выбранной комбинации).

«Комбинированная терапия», как может предполагаться, но, как правило, не предполагается, включает введение двух или более этих терапевтических средств в качестве отдельных схем монотерапии. «Комбинированная терапия», как предполагается, включает введение этих терапевтических средств последовательно, т.е., когда каждое терапевтическое средство вводят в различное время, а также введение этих терапевтических средств, или по крайней мере двух из терапевтических средств, по существу одновременно. По существу одновременное введение можно осуществить, например, посредством введения субъекту одной капсулы, содержащей фиксированное соотношение каждого терапевтического средства, или множества отдельных капсул для каждого из терапевтических средств.

Последовательное или по существу одновременное введение каждого терапевтического средства можно осуществить любым подходящим путем, включая, но без ограничения, местно, перорально, внутривенно, внутримышечно и непосредственное всасывание через ткани слизистых оболочек. Терапевтические средства могут вводиться одним и тем же путем или различными путями. Например, первое терапевтическое средство выбранной комбинации можно ввести с помощью инъекции, в то время как другое терапевтические средства комбинации можно ввести местно.

Альтернативно, например, все терапевтические средства могут вводиться местно, или все терапевтические средства могут вводиться с помощью инъекции. Последовательность, в которой вводят терапевтические средства, не является исключительно важной, кроме особо оговоренных случаев. «Комбинированная терапия» также может включать введение терапевтических средств, описанных выше, в дополнительной комбинации с другими биологически активными ингредиентами. Если комбинированная терапия, кроме того, включает нелекарственное лечение, это нелекарственное лечение может проводиться в любое подходящее время при условии, что достигается положительный эффект от совместного действия комбинации терапевтических средств и нелекарственного лечения. Например, в соответствующих случаях, положительный эффект все еще достигается, когда нелекарственное лечение временно отодвигают от введения терапевтических средств, может быть на дни или даже недели.

Как изложено в общих чертах выше, лекарственное средство в соответствии с настоящим изобретением можно вводить, в принципе, в любой форме, известной квалифицированным в данной области техники специалистам. Предпочтительным путем введения является системное введение, более предпочтительно с использованием парентерального введения, предпочтительно с помощью инъекции. Альтернативно, лекарственное средство можно вводить местно. Другие пути введения включают внутримышечный, внутрибрюшинный и подкожный, пероральный, интраназальный, интратрахиальный или внутрилегочный путь, при этом предпочтение отдается пути введения, который является в наименьшей степени инвазивным, при обеспечении эффективности.

Парентеральное введение, как правило, используют в случае подкожных, внутримышечных или внутривенных инъекций и инфузий. Кроме того, в одном способе парентерального введения используется имплантация медленного высвобождения или систем для замедленного высвобождения, которые хорошо известны специалистам со средним уровнем компетентности в данной области техники, которая обеспечивает сохранение постоянного уровня дозы.

Кроме того, предпочтительные лекарственные средства настоящего изобретения можно вводить в интраназальной форме посредством местного применения подходящих интраназальных носителей, лекарственных форм для ингаляции или через чрескожные пути, используя те формы кожных пластырей для чрескожной доставки, которые хорошо известны специалистам со средним уровнем компетентности в данной области техники. Для введения в форме системы для чрескожной доставки введение доз будет, конечно, непрерывным, а не прерывистым на протяжении всей схемы введения доз. Другие предпочтительные препараты для местного применения включают кремы, мази, лосьоны, аэрозольные разбрызгиваемые растворы и гели.

Субъекты, которые будут реагировать положительно на способ настоящего изобретения, включают, как правило, субъектов медицины и ветеринарии, включая людей и являющихся людьми пациентов. Среди других субъектов, для которых применимы способы и средства настоящего изобретения, находятся кошки, собаки, большие животные, птицы, такие как цыплята, и т.п.

Лекарственное средство настоящего изобретения будет, как правило, включать эффективное количество активного компонента(ов) терапии, включая, но без ограничения, молекулу нуклеиновой кислоты настоящего изобретения, который растворен или диспергирован в фармацевтически приемлемой среде. Фармацевтически приемлемые среды или носители включают любые и все растворители, дисперсионные среды, покрытия, антибактериальные и противогрибковые агенты, агенты для придания изотоничности и замедляющие всасывание агенты и т.п. Применение таких сред и агентов для фармацевтически активных веществ хорошо известно в данной области техники. В лекарственное средство настоящего изобретения могут быть также включены дополнительные активные ингредиенты.

В дальнейшем аспекте настоящее изобретение относится к фармацевтической композиции. Такая фармацевтическая композиция включает по крайней мере одну из нуклеиновых кислот в соответствии с настоящим изобретением и предпочтительно фармацевтически приемлемое связующее вещество. Таким связующим веществом может быть любое связующее вещество, используемое и/или известное в данной области техники. Конкретнее, таким связующим веществом является любое связующее вещество, обсуждаемое в связи с производством лекарственного средства, раскрытого здесь. В дальнейшем варианте осуществления фармацевтическая композиция включает дополнительный фармацевтически активный агент.

Изготовление лекарственного средства и фармацевтической композиции будут известно квалифицированным в данной области техники специалистам ввиду описания настоящего изобретения. Типично такие композиции можно приготовить в виде инъецируемых препаратов, в виде или жидких растворов, или суспензий; твердых форм, подходящих для растворения или суспендирования в жидкости перед инъецированием; в виде таблеток или других твердых препаратов для орального введения; в виде капсул с высвобождением в течение времени или в любой другой форме, используемой в настоящее время, включая глазные капли, кремы, лосьоны, целебные мази, лекарственные формы для ингаляции и т.п. Применение стерильных препаратов, таких как примочки на основе солевых растворов, хирургами, врачами или работниками здравоохранения для обработки конкретной области в оперируемой зоне может также, в частности, осуществляться. Композиции могут также доставляться посредством микроустройства, микрочастицы или тампона.

После приготовления лекарственное средство будет вводиться способом, совместимым с лекарственной формой, и в таком количестве, которое является фармакологически эффективным. Препараты легко вводятся в случае ряда лекарственных форм, таких как тип инъецируемых растворов, описанный выше, но также могут использоваться капсулы для высвобождения лекарственного средства и т.п.

Лекарственное средство настоящего изобретения можно также вводить в пероральных лекарственных формах в виде таблеток или капсул с высвобождением в течение времени или с замедленным высвобождением, пилюль, порошков, гранул, эликсиров, настоек, суспензий, сиропов и эмульсий. Суппозитории преимущественно готовят из эмульсий или суспензий жиров.

Фармацевтическая композиция или лекарственное средство может быть стерилизована и/или содержать вспомогательные вещества, такие как консерванты, стабилизаторы, смачивающие вещества или эмульгаторы, активаторы растворения, соли для регулирования осмотического давления и/или буферы. Кроме того, они могут также содержать другие терапевтически ценные вещества. Композиции готовят в соответствии с традиционными способами смешивания, гранулирования или покрытия и типично содержат приблизительно 0,1%-75%, предпочтительно приблизительно 1%-50%, активного ингредиента.

Жидкие, в частности инъецируемые, композиции можно, например, приготовить с помощью растворения, диспергирования и т.д. Активное соединение растворяют в фармацевтически чистом растворителе, таком как, например, вода, солевой раствор, декстроза в воде, глицерин, этанол и т.п., или смешивают с ним для образования тем самым инъецируемого раствора или суспензии. Кроме того, можно приготовить твердые формы, подходящие для растворения в жидкости перед инъецированием.

Лекарственные средства и молекулы нуклеиновых кислот по настоящему изобретению можно также вводить в форме систем доставки на основе липосом, таких как небольшие однослойные везикулы, большие однослойные везикулы и многослойные везикулы. Липосомы могут быть образованы из ряда фосфолипидов, содержащих холестерин, стеариламин или фосфатидилхолины. В некоторых вариантах осуществления тонкий слой липидных компонентов подвергают гидратации с использованием водного раствора лекарственного средства для образования жидкого слоя, инкапсулирующего лекарственное средство, что хорошо известно специалистам со средним уровнем компетентности в данной области техники. Например, молекулы нуклеиновых кислот, описываемые здесь, могут быть предоставлены в виде комплекса с липофильным соединением или неиммуногенным, высокомолекулярным соединением, созданным с использованием известных в данной области техники способов. Кроме того, липосомы могут нести такие молекулы нуклеиновых кислот на своей поверхности для направленной доставки и переноса цитотоксических агентов внутрь для опосредования уничтожения клеток. Пример связанных с нуклеиновыми кислотами комплексов представлен в патенте США 6011020.

Лекарственные средства и молекулы нуклеиновых кислот по настоящему изобретению могут быть также соединены с растворимыми полимерами в качестве носителей для нацеливаемых лекарственных средств. Такие полимеры могут включать поливинилпирролидон, сополимеры пирана, полигидроксипропилметакриламидфенол, полигидроксиэтиласпанамидфенол или полиэтиленоксидполилизин, замещенный пальмитоильными остатками. Кроме того, лекарственные средства и молекулы нуклеиновых кислот, соответственно, настоящего изобретения можно соединить с классом биодеградируемых полимеров, применимых для достижения контролируемого высвобождения лекарственного средства, например, полимолочной кислотой, полиэпсилонкапролактоном, полигидроксимасляной кислотой, полиортоэфирами, полиацеталями, полидигидропиранами, полицианоакрилатами и сшитыми или амфипатическими блоксополимерами гидрогелей.

Если желательно, вводимая фармацевтическая композиция и лекарственное средство, соответственно, может также содержать незначительные количества нетоксичных вспомогательных веществ, таких как смачивающие вещества или эмульгаторы, pH буферные вещества, и другие вещества, такие как, например, ацетат натрия и триэтаноламина олеат.

Схему введения, используя молекулы нуклеиновых кислот и лекарственные средства по настоящему изобретению, выбирают в соответствии с рядом факторов, включающих тип, вид, возраст, вес, пол и состояние здоровья пациента; тяжесть заболевания, подвергаемого лечению; путь введение; функционирование почек и печени пациента и конкретный используемый аптамер или его соль. Врач или ветеринар со средним уровнем компетентности может без труда определить и прописать эффективное количество лекарственного средства, необходимое для предотвращения, противодействия или остановки прогрессирования заболевания.

Эффективные уровни нуклеиновой кислоты в соответствии с настоящим изобретением в плазме предпочтительно находятся в диапазоне от 500 фМ до 200 мкМ, предпочтительно от 1 нМ до 20 мкМ, более предпочтительно от 5 нМ до 20 мкМ, наиболее предпочтительно от 50 нМ до 20 мкМ при лечении любого из заболеваний, описываемых здесь.

Молекулы нуклеиновых кислот и лекарственные средства по настоящему изобретению могут вводиться в однократной суточной дозе, каждый второй или третий день, еженедельно, каждую вторую неделю, в однократной месячной дозе или каждый третий месяц.

В рамках настоящего изобретения находится то, что описываемое здесь лекарственное средство является описываемой здесь фармацевтической композицией.

В дальнейшем аспекте настоящее изобретение относится к способу лечения субъекта, который нуждается в таком лечении, в соответствии с чем способ включает введение фармацевтически активного количества по крайней мере одной из нуклеиновых кислот в соответствии с настоящим изобретением. В варианте осуществления субъект страдает заболеванием или подвержен риску развития такого заболевания, в соответствии с чем заболеванием является любое из заболеваний, описываемых здесь, в частности, любое из тех заболеваний, которые описаны в связи с применением любой из нуклеиновых кислот в соответствии с настоящим изобретением для производства лекарственного средства.

Как предпочтительно здесь используется, термин «лечение» включает в предпочтительном варианте осуществления дополнительно или альтернативно предупреждение и/или последующее наблюдение врача.

Как предпочтительно здесь используется, термин «заболевание» и «нарушение» должен использоваться взаимозаменяемо, кроме особо оговоренных случаев.

Как здесь используется, термин «включает(ют)», как предпочтительно подразумевается, не ограничивает объект, за которым следует такой термин или который описывается с использованием такого термина. Однако в альтернативном варианте осуществления термин «включает» должен пониматься в смысле «содержащий» и, следовательно, в качестве ограничения объекта, за которым следует такой термин или который описывается с использованием такого термина.

Различные SEQ ID NO:, химическая природа молекул нуклеиновых кислот в соответствии с настоящим изобретением и являющиеся мишенями молекулы SDF-1, используемые здесь, их фактическая последовательность и внутренний ссылочной номер суммированы в следующей таблице. Следует отметить, что нуклеиновые кислоты были охарактеризованы согласно аптамеру, т.е. уровню D-нуклеиновой кислоты (D-РНК), с использованием биотинилированного D-SDF-1 человека (SEQ ID NO: 4) или согласно уровню шпигельмера, т.е. L-нуклеиновой кислоты (L-РНК), с использованием природной конфигурации SDF-1, L-SDF-1 (SDF-1α человека, SEQ ID NO: 1). Различные нуклеиновые кислоты имеют одно внутреннее название для ссылок, но какие-то SEQ ID No: для молекулы D-РНК (аптамера), а какие-то SEQ ID No: для молекулы L-РНК (шпигельмера), соответственно.

Таблица 1
SEQ ID NO: РНК/пептид Последовательность Внутренняя ссылка
1 L-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK SDF-1α человека/обезьяны/кошки
SDF-1 человека/обезьяны/кошки
2 L-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM SDF-1β человека/обезьяны/кошки
3 L-пептид KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK SDF-1α мыши
SDF-1 мыши
4 D-пептид KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNKRFK-Биотин биотинилированный D-SDF-1 человека
5 L-РНК AGCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGCU 193-C2-001
6 L-РНК AGCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGCU 193-G2-001
7 L-РНК AGCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGUGCGCU 193-F2-001
8 L-РНК GCGAGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-G1-002
9 L-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-D2-002
10 L-РНК GCAUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCCC 193-A1-002
11 L-РНК GCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGGACGC 193-D3-002
12 L-РНК GCGUGGUGUGAUCUAGAUGUAGAGGCUGAUCCUAGUCAGGUACGC 193-B3-002
13 L-РНК GCGUGGUGUGAUCUAGAUGUAAAGGCUGAUCCUAGUCAGGUACGC 193-H3-002

14 L-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGUUCCUAGUCAGGUAUGC 193-E3-002
15 L-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUUAGGUACGC 193-D1-002
16 L-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGC 193-C2-002
17 L-РНК CGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACG 193-C2-003
18 L-РНК GUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUAC 193-C2-004
19 L-РНК UGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUA 193-C2-005
20 L-РНК GGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGU 193-C2-006
21 L-РНК GUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGG 193-C2-007
22 L-РНК GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC 193-G2-012
23 L-РНК GCGCGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGCGCGC 193-G2-013
24 L-РНК GCGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCGC 193-G2-014
25 L-РНК GGGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCCC 193-G2-015
26 L-РНК GGCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGCC 193-G2-016
27 L-РНК GCCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGGC 193-G2-017
28 L-РНК 5’-40 кДа-ПЭГ-GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC 193-G2-012-5’-ПЭГ, NOX-A12
29 D-РНК AGCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGCU 193-C2-001
30 D-РНК AGCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGCU 193-G2-001
31 D-РНК AGCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGUGCGCU 193-F2-001
32 D-РНК GCGAGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-G1-002
33 D-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCGC 193-D2-002
34 D-РНК GCAUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUGCCC 193-A1-002

35 D-РНК GCGUGGUGUGAUCUAGAUGUAAUGGCUGAUCCUAGUCAGGGACGC 193-D3-002
36 D-РНК GCGUGGUGUGAUCUAGAUGUAGAGGCUGAUCCUAGUCAGGUACGC 193-B3-002
37 D-РНК GCGUGGUGUGAUCUAGAUGUAAAGGCUGAUCCUAGUCAGGUACGC 193-H3-002
38 D-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGUUCCUAGUCAGGUAUGC 193-E3-002
39 D-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUUAGGUACGC 193-D1-002
40 D-РНК GCGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACGC 193-C2-002
41 D-РНК CGUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUACG 193-C2-003
42 D-РНК GUGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUAC 193-C2-004
43 D-РНК UGGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGUA 193-C2-005
44 D-РНК GGUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGGU 193-C2-006
45 D-РНК GUGUGAUCUAGAUGUAGUGGCUGAUCCUAGUCAGG 193-C2-007
46 D-РНК GCGUGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGUACGC 193-G2-012
47 D-РНК GCGCGGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGCGCGC 193-G2-013
48 D-РНК GCGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCGC 193-G2-014
49 D-РНК GGGCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGCCC 193-G2-015
50 D-РНК GGCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGCC 193-G2-016
51 D-РНК GCCCGUGUGAUCUAGAUGUAUUGGCUGAUCCUAGUCAGGGGGC 193-G2-017
52 L-РНК GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG Формула-1 типа B
53 L-РНК GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG Формула-2 типа B
54 L-РНК AAAGUAACACGUAAAAUGAAAGGUAAC
55 L-РНК AAAGCAACAUGUCAAUGAAAGGUAGC
56 L-РНК GGUUAGGGCUAAAGUCGG

57 L-РНК GGUUAGGGCUAGAAGUCGG
58 L-РНК GGUUAGGGCUCGAAGUCGG
59 L-РНК GGUUAGGGCUUGAAGUCGG
60 L-РНК GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC 192-A10-001
61 L-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-G10
62 L-РНК GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCGCAGC 192-F10
63 L-РНК GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCACAGC 192-B11
64 L-РНК GCUGUAAAAGUAACAUGUCAAUGAAAGGUAACUACAGC 192-C9
65 L-РНК GCUGUAAAAGUAACAAGUCAAUGAAAGGUAACUACAGC 192-E10
66 L-РНК GCUGUGAAAGUAACAAGUCAAUGAAAGGUAACCACAGC 192-C10
67 L-РНК GCAGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-D11
68 L-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACUGC 192-G11
69 L-РНК GCUAUGAAAGUAACAUGUCAAUGAAAGGUAACCAUAGC 192-H11
70 L-РНК GCUGCGAAAGCGACAUGUCAAUGAAAGGUAGCCGCAGC 192-D10
71 L-РНК GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCACAGC 192-E9
72 L-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAGCCGCAGC 192-H9
73 L-РНК AGCGUGAAAGUAACACGUAAAAUGAAAGGUAACCACGCU 191-A6
74 L-РНК AAAGYRACAHGUMAAXAUGAAAGGUARC; XA=A или отсутствует Формула-1 типа A
75 L-РНК AAAGYRACAHGUMAAUGAAAGGUARC Формула-2 типа A
76 L-РНК AAAGYRACAHGUMAAAUGAAAGGUARC Формула-3 типа A
77 L-РНК AAAGYAACAHGUCAAUGAAAGGUARC Формула-4 типа A

78 L-РНК CUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAG 192-A10-002
79 L-РНК UGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCA 192-A10-003
80 L-РНК GUGAAAGCAACAUGUCAAUGAAAGGUAGCCGC 192-A10-004
81 L-РНК UGAAAGCAACAUGUCAAUGAAAGGUAGCCG 192-A10-005
82 L-РНК GAAAGCAACAUGUCAAUGAAAGGUAGCC 192-A10-006
83 L-РНК AAAGCAACAUGUCAAUGAAAGGUAGC 192-A10-007
84 L-РНК GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-008
85 L-РНК GCGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-015
86 L-РНК GCGGAAAGCAACAUGUCAAUGAAAGGUAGCCCGC 192-A10-014
87 L-РНК CGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCG 192-A10-016
88 L-РНК GCGCAAAGCAACAUGUCAAUGAAAGGUAGCGUGC 192-A10-017
89 L-РНК GUGCAAAGCAACAUGUCAAUGAAAGGUAGCGCGC 192-A10-018
90 L-РНК CGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGUG 192-A10-019
91 L-РНК GGGCAAAGCAACAUGUCAAUGAAAGGUAGCGCCC 192-A10-020
92 L-РНК GGCCAAAGCAACAUGUCAAUGAAAGGUAGCGGCC 192-A10-021
93 L-РНК GCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGC 192-A10-022
94 L-РНК CCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGG 192-A10-023
95 L-РНК GUGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCAC 197-B2
96 L-РНК AGCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGCU 191-D5-001
97 L-РНК GUGUUGCGGAGGUUAGGGCUAGAAGUCGGUCAGCAGCAC 197-H1
98 L-РНК CGUGCGGCCUAAGAGGUUAGGGCUUAAAGUCGGUCUUUGGCCAACACG 190-D3
99 L-РНК CGUGCGCUUGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCACG 190-A3-001

100 L-РНК CGUGAUUGGUGAGGGGUUAGGGCUUGAAGUCGGCCUUGUCCAGUCACG 190-A2
101 L-РНК AGCGUGAAGGGGUUAGGGCUCGAAGUCGGCUGACACGCU 191-A5
102 L-РНК GUGCUGCGGGGGUUAGGGCUCGAAGUCGGCCCGCAGCAC 197-H3
103 L-РНК GUGUUCCCGGGGUUAGGGCUUGAAGUCGGCCGGCAGCAC 197-B1
104 L-РНК GUGUUGCAGGGGUUAGGGCUUGAAGUCGGCCUGCAGCAC 197-E3
105 L-РНК GUGCUGCGGGGGUUAGGGCUCAAAGUCGGCCUGCAGCAC 197-H2
106 L-РНК GUGCUGCCGGGGUUAGGGCUAA-AGUCGGCCGACAGCAC 197-D1
107 L-РНК GUGCUGUGGGGGUCAGGGCUAGAAGUCGGCCUGCAGCAC 197-D2
108 L-РНК GGUYAGGGCUHRXAAGUCGG; XA=A или отсутствует Формула-1 типа С
109 L-РНК GGUYAGGGCUHRAAGUCGG Формула-2 типа С
110 L-РНК GGUYAGGGCUHRAGUCGG Формула-3 типа С
111 L-РНК GGUUAGGGCUHGAAGUCGG Формула-4 типа С
112 L-РНК UGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCA 190-A3-003
113 L-РНК GAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUC 190-A3-004
114 L-РНК GGGGUUAGGGCUUAAAGUCGGCUGAUUCU 190-A3-007
115 L-РНК GCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGC 191-D5-002
116 L-РНК CGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACG 191-D5-003
117 L-РНК CGGGCGAGGUUAGGGCUAGAAGUCGGUCGACCG 191-D5-004
118 L-РНК CGGGCGAGGUUAGGGCUAGAAGUCGGUCGCCCG 191-D5-005
119 L-РНК CGGCGAGGUUAGGGCUAGAAGUCGGUCGCCG 191-D5-006
120 L-РНК CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007
121 L-РНК GGGAGGUUAGGGCUAGAAGUCGGUCCC 191-D5-010

122 L-РНК CCGCGGUUAGGGCUAGAAGUCGGGCGG 191-D5-017
123 L-РНК CCCGGGUUAGGGCUAGAAGUCGGCGGG 191-D5-029
124 L-РНК GGCGGGUUAGGGCUAGAAGUCGGCGCC 191-D5-024
125 L-РНК CCCGCGGUUAGGGCUAGAAGUCGGGCGGG 191-D5-017-29a
126 L-РНК GCCGCGGUUAGGGCUAGAAGUCGGGCGGC 191-D5-017-29b
127 L-РНК CCCCGGGUUAGGGCUAGAAGUCGGCGGGG 191-D5-019-29a
128 L-РНК CGGCGGGUUAGGGCUAGAAGUCGGCGCCG 191-D5-024-29a
129 L-РНК GGGCGGGUUAGGGCUAGAAGUCGGCGCCC 191-D5-024-29b
130 L-РНК UGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCA 197-B2-001
131 L-РНК GCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGC 197-B2-002
132 L-РНК CUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAG 197-B2-003
133 L-РНК UGCGGGGGUUAGGGCUAGAAGUCGGCCUGCA 197-B2-004
134 L-РНК GCGGGGGUUAGGGCUAGAAGUCGGCCUGC 197-B2-005
135 L-РНК GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006
136 L-РНК GGCCGGGGUUAGGGCUAGAAGUCGGCCGGCC 197-B2-006-31a
137 L-РНК CGCCGGGGUUAGGGCUAGAAGUCGGCCGGCG 197-B2-006-31b
138 L-РНК RKSBUSNVGR Формула-5-5’ типа С
139 L-РНК YYNRCASSMY Формула-5-3’ типа С
140 L-РНК RKSBUGSVGR Формула-6-5’ типа С
141 L-РНК YCNRCASSMY Формула-6-3’ типа С
142 L-РНК CGUGGUCCGUUGUGUCAGGUCUAUUCGCCCCGGUGCAGGGCAUCCGCG 194-A2-001
143 L-РНК GCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAGGUGAG 196-B12-003

144 L-РНК CAACAGCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAG 196-B12-004
145 L-РНК 5’-40 кДа-ПЭГ-GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-008-5’-ПЭГ
146 D-РНК GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAGC 192-A10-001
147 D-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-G10
148 D-РНК GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCGCAGC 192-F10
149 D-РНК GCUGUGAAAGUAACACGUCAAUGAAAGGUAACCACAGC 192-B11
150 D-РНК GCUGUAAAAGUAACAUGUCAAUGAAAGGUAACUACAGC 192-C9
151 D-РНК GCUGUAAAAGUAACAAGUCAAUGAAAGGUAACUACAGC 192-E10
152 D-РНК GCUGUGAAAGUAACAAGUCAAUGAAAGGUAACCACAGC 192-C10
153 D-РНК GCAGUGAAAGUAACAUGUCAAUGAAAGGUAACCACAGC 192-D11
154 D-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAACCACUGC 192-G11
155 D-РНК GCUAUGAAAGUAACAUGUCAAUGAAAGGUAACCAUAGC 192-H11
156 D-РНК GCUGCGAAAGCGACAUGUCAAUGAAAGGUAGCCGCAGC 192-D10
157 D-РНК GCUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCACAGC 192-E9
158 D-РНК GCUGUGAAAGUAACAUGUCAAUGAAAGGUAGCCGCAGC 192-H9
159 D-РНК AGCGUGAAAGUAACACGUAAAAUGAAAGGUAACCACGCU 191-A6
160 D-РНК CUGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCAG 192-A10-002
161 D-РНК UGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCA 192-A10-003
162 D-РНК GUGAAAGCAACAUGUCAAUGAAAGGUAGCCGC 192-A10-004
163 D-РНК UGAAAGCAACAUGUCAAUGAAAGGUAGCCG 192-A10-005
164 D-РНК GAAAGCAACAUGUCAAUGAAAGGUAGCC 192-A10-006

165 D-РНК AAAGCAACAUGUCAAUGAAAGGUAGC 192-A10-007
166 D-РНК GCGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-008
167 D-РНК GCGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGCGC 192-A10-015
168 D-РНК GCGGAAAGCAACAUGUCAAUGAAAGGUAGCCCGC 192-A10-014
169 D-РНК CGUGAAAGCAACAUGUCAAUGAAAGGUAGCCGCG 192-A10-016
170 D-РНК GCGCAAAGCAACAUGUCAAUGAAAGGUAGCGUGC 192-A10-017
171 D-РНК GUGCAAAGCAACAUGUCAAUGAAAGGUAGCGCGC 192-A10-018
172 D-РНК CGCGAAAGCAACAUGUCAAUGAAAGGUAGCCGUG 192-A10-019
173 D-РНК GGGCAAAGCAACAUGUCAAUGAAAGGUAGCGCCC 192-A10-020
174 D-РНК GGCCAAAGCAACAUGUCAAUGAAAGGUAGCGGCC 192-A10-021
175 D-РНК GCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGC 192-A10-022
176 D-РНК CCCCAAAGCAACAUGUCAAUGAAAGGUAGCGGGG 192-A10-023
177 D-РНК GUGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCAC 197-B2
178 D-РНК AGCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGCU 191-D5-001
179 D-РНК GUGUUGCGGAGGUUAGGGCUAGAAGUCGGUCAGCAGCAC 197-H1
180 D-РНК CGUGCGGCCUAAGAGGUUAGGGCUUAAAGUCGGUCUUUGGCCAACACG 190-D3
181 D-РНК CGUGCGCUUGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCACG 190-A3-001
182 D-РНК CGUGAUUGGUGAGGGGUUAGGGCUUGAAGUCGGCCUUGUCCAGUCACG 190-A2
183 D-РНК AGCGUGAAGGGGUUAGGGCUCGAAGUCGGCUGACACGCU 191-A5
184 D-РНК GUGCUGCGGGGGUUAGGGCUCGAAGUCGGCCCGCAGCAC 197-H3
185 D-РНК GUGUUCCCGGGGUUAGGGCUUGAAGUCGGCCGGCAGCAC 197-B1
186 D-РНК GUGUUGCAGGGGUUAGGGCUUGAAGUCGGCCUGCAGCAC 197-E3

187 D-РНК GUGCUGCGGGGGUUAGGGCUCAAAGUCGGCCUGCAGCAC 197-H2
188 D-РНК GUGCUGCCGGGGUUAGGGCUAA-AGUCGGCCGACAGCAC 197-D1
189 D-РНК GUGCUGUGGGGGUCAGGGCUAGAAGUCGGCCUGCAGCAC 197-D2
190 D-РНК UGAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUCA 190-A3-003
191 D-РНК GAGAUAGGGGUUAGGGCUUAAAGUCGGCUGAUUCUC 190-A3-004
192 D-РНК GGGGUUAGGGCUUAAAGUCGGCUGAUUCU 190-A3-007
193 D-РНК GCGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACGC 191-D5-002
194 D-РНК CGUGGCGAGGUUAGGGCUAGAAGUCGGUCGACACG 191-D5-003
195 D-РНК CGGGCGAGGUUAGGGCUAGAAGUCGGUCGACCG 191-D5-004
196 D-РНК CGGGCGAGGUUAGGGCUAGAAGUCGGUCGCCCG 191-D5-005
197 D-РНК CGGCGAGGUUAGGGCUAGAAGUCGGUCGCCG 191-D5-006
198 D-РНК CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007
199 D-РНК GGGAGGUUAGGGCUAGAAGUCGGUCCC 191-D5-010
200 D-РНК CCGCGGUUAGGGCUAGAAGUCGGGCGG 191-D5-017
201 D-РНК CCCGGGUUAGGGCUAGAAGUCGGCGGG 191-D5-029
202 D-РНК GGCGGGUUAGGGCUAGAAGUCGGCGCC 191-D5-024
203 D-РНК CCCGCGGUUAGGGCUAGAAGUCGGGCGGG 191-D5-017-29a
204 D-РНК GCCGCGGUUAGGGCUAGAAGUCGGGCGGC 191-D5-017-29b
205 D-РНК CCCCGGGUUAGGGCUAGAAGUCGGCGGGG 191-D5-019-29a
206 D-РНК CGGCGGGUUAGGGCUAGAAGUCGGCGCCG 191-D5-024-29a
207 D-РНК GGGCGGGUUAGGGCUAGAAGUCGGCGCCC 191-D5-024-29b
208 D-РНК UGCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGCA 197-B2-001

209 D-РНК GCUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAGC 197-B2-002
210 D-РНК CUGCGGGGGUUAGGGCUAGAAGUCGGCCUGCAG 197-B2-003
211 D-РНК UGCGGGGGUUAGGGCUAGAAGUCGGCCUGCA 197-B2-004
212 D-РНК GCGGGGGUUAGGGCUAGAAGUCGGCCUGC 197-B2-005
213 D-РНК GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006
214 D-РНК GGCCGGGGUUAGGGCUAGAAGUCGGCCGGCC 197-B2-006-31a
215 D-РНК CGCCGGGGUUAGGGCUAGAAGUCGGCCGGCG 197-B2-006-31b
216 D-РНК CGUGGUCCGUUGUGUCAGGUCUAUUCGCCCCGGUGCAGGGCAUCCGCG 194-A2-001
217 D-РНК GCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAGGUGAG 196-B12-003
218 D-РНК CAACAGCAGUGUGACGCGGACGUGAUAGGACAGAGCUGAUCCCGCUCAG 196-B12-004
219 L-РНК 5’-40 кДа-ПЭГ-UAAGGAAACUCGGUCUGAUGCGGUAGCGCUGUGCAGAGCU Контрольный шпигельмер
220 L-РНК CGUGCGCUUGAGAUAGG
221 L-РНК CUGAUUCUCACG
222 L-РНК CUGAUUCUCA
223 L-РНК 5’-40 кДа-ПЭГ-GCCGGGGUUAGGGCUAGAAGUCGGCCGGC 197-B2-006-5’-ПЭГ
224 L-РНК 5’-40 кДа-ПЭГ-CGGGAGGUUAGGGCUAGAAGUCGGUCCCG 191-D5-007-5‘ПЭГ
225 L-РНК 5’-40 кДа-ПЭГ-CGCAUGGACUGAUCCUAGUCGGUUAUGUAGAUCUAGUGUGGUGCG revNOX-A12

Настоящее изобретение далее поясняется с помощью фигур, примеров и списка последовательностей, из которых могут быть заимствованы дополнительные признаки, варианты осуществления и преимущества, где

На фиг. 1 представлено совмещение последовательностей связывающихся с SDF-1 молекул нуклеиновых кислот «типа A»;

На фиг. 2A+B продемонстрированы производные связывающейся с SDF-1 молекулы нуклеиновой кислоты 192-A10-001 (связывающейся с SDF-1 молекулы нуклеиновой кислоты «типа A»);

На фиг. 3 представлено совмещение последовательностей связывающихся с SDF-1 молекул нуклеиновых кислот «типа B»;

На фиг. 4A+B продемонстрированы производные связывающихся с SDF-1 молекул нуклеиновой кислоты 193-C2-001 и 193-G2-001 (связывающихся с SDF-1 молекул нуклеиновых кислот «типа B»);

На фиг. 5 представлено совмещение последовательностей связывающихся с SDF-1 молекул нуклеиновых кислот «типа C»;

На фиг. 6 продемонстрированы производные связывающейся с SDF-1 молекулы нуклеиновой кислоты 190-A3-001 (связывающейся с SDF-1 молекулы нуклеиновой кислоты «типа C»);

На фиг. 7A+B продемонстрированы производные связывающейся с SDF-1 молекулы нуклеиновой кислоты 190-D5-001 (связывающейся с SDF-1 молекулы нуклеиновой кислоты «типа C»);

На фиг. 8 продемонстрированы производные связывающейся с SDF-1 молекулы нуклеиновой кислоты 197-B2 (связывающейся с SDF-1 молекулы нуклеиновых кислот «типа C»);

На фиг. 9 продемонстрированы дополнительные связывающиеся с SDF-1 молекулы нуклеиновых кислот, которые, помимо других связывающихся с SDF-1 молекул нуклеиновых кислот, также называют здесь связывающимися с SDF-1 молекулами нуклеиновых кислот «типа D»;

На фиг. 10 продемонстрирована эффективность связывающихся с SDF-1 шпигельмеров 193-G2-012-5'-ПЭГ (также называемого NOX-A12), 197-B2-006-5'-ПЭГ, 191-D5-007-5'-ПЭГ и 191-A 10-008-5'-ПЭГ в анализе хемотаксиса с использованием линии клеток T-клеточного лейкоза человека Jurkat, в соответствии с чем клеткам предоставляли возможность мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно подвергнутого инкубации при 37°C с различными количествами шпигельмеров 193-G2-012-5'-ПЭГ, 197-B2-006-5'-ПЭГ, 191-D5-007-5'-ПЭГ и 191-A10-008-5'-ПЭГ, представленная как процент от контроля относительно концентрации шпигельмеров 193-G2-012-5'-ПЭГ, 197-B2-006-5'-ПЭГ, 191-D5-007-5'-ПЭГ и 191-A10-008-5'-ПЭГ;

На фиг. 11А продемонстрирована эффективность связывающегося с SDF-1 шпигельмера NOX-A12 в анализе хемотаксиса с использованием линии клеток пре-B-клеточного ALL человека Nalm-6, в соответствии с чем клеткам предоставляли возможность мигрировать в направлении 0,3 нМ SDF-1 человека, предварительно подвергнутого инкубации при 37°C с различными количествами шпигельмера NOX-A12, представленная как процент от контроля относительно концентрации NOX-A12;

На фиг. 11В продемонстрирована эффективность связывающегося с SDF-1 шпигельмера NOX-A12 в анализе хемотаксиса с использованием линии клеток моноцитарной лимфомы человека U937, в соответствии с чем клеткам предоставляли возможность мигрировать в направлении 3 нМ SDF-1 человека, предварительно подвергнутого инкубации при 37°C с различными количествами шпигельмера NOX-A12, представленная как процент от контроля относительно концентрации шпигельмера NOX-A12;

На фиг. 12 продемонстрирована эффективность связывающегося с SDF-1 шпигельмера NOX-A12 в анализе хемотаксиса с использованием линии клеток пре-B-клеточного лейкоза человека BV-173, в соответствии с чем клеткам предоставляли возможность мигрировать в направлении 3 нМ SDF-1 человека, предварительно подвергнутого инкубации при 37°C с различными количествами шпигельмера NOX-A12, представленная как процент от контроля относительно концентрации шпигельмера NOX-A12;

На фиг. 13 продемонстрирована эффективность связывающегося с SDF-1 шпигельмера NOX-A12 в анализе комлементации с использованием клеток CHO, стабильно экспрессирующих CXCR7 и β-аррестин, оба из которых слиты с фрагментом β-галактозидазы, в соответствии с чем CXCR7 клеток активировали к 10 нМ SDF-1 человека, предварительно подвергнутого инкубации при 37°C с различными количествами шпигельмера NOX-A12, представленная как процент от контроля относительно концентрации шпигельмера NOX-A12;

На фиг. 14 продемонстрировано ингибирование индуцируемого SDF-1 спраутинга с помощью связывающегося с SDF-1 человека шпигельмера 193-G2-012-5'-ПЭГ (также называемого NOX-A12) и подвергнутого ПЭГилированию контрольного шпигельмера в анализе спраутинга с использованием аортальных колец, в соответствии с чем кольца из аорты крысы внедряли в коллагеновую матрицу и инкубировали в течение 6 дней с SDF-1 со шпигельмерами или без них (a: контроль; b: 10 нМ SDF-1; c: 10 нМ SDF-1 + 1 мкМ связывающийся с SDF-1 человека шпигельмер 193-G2-012-5'-ПЭГ; d: 10 нМ SDF-1+1 мкМ подвергнутый ПЭГилированию контрольный шпигельмер);

На фиг. 15 продемонстрировано ингибирование индуцируемого SDF-1 спраутинга с помощью связывающегося с SDF-1 человека шпигельмера 193-G2-012-5'-ПЭГ (также называемого NOX-A12) и подвергнутого ПЭГилированию контрольного шпигельмера в анализе спраутинга с использованием аортальных колец, в соответствии с чем индексы спраутинга представлены как среднее значение +/- среднеквадратическое отклонение для 5 колец для каждого условия (*: значение для SDF-1 значимо отличается от контроля (критерий Манна-Уитни; p=0,009); **: значение для SDF-1 + связывающийся с SDF-1 человека шпигельмер 193-G2-012-5'-ПЭГ значимо отличается от значения для SDF-1 (критерий Манна-Уитни; p=0,028)

На фиг. 16 демонстрируется эффективность связывающегося с SDF-1 человека шпигельмера NOX-A12 в сенсибилизации клеток множественной миеломы (ММ) RPMI-8226 к F-ara-A (Флударабину), в соответствии с чем конфлюэнтные мышиные стромальные клетки костного мозга MS-5, секретирующие SDF-1, инкубировали со связывающимся с SDF-1 человека шпигельмером NOX-A12 или нефункциональным revNOX-A12 и впоследствии сокультивировали с клетками ММ RPMI-8226; клетки обрабатывали 1 мкМ F-ara-A в течение 40 часов, и определяли жизнеспособность клеток с помощью проточной цитометрии, используя реагент ViaCoun; «усы» означают среднеквадратическое отклонение, N=5, *p=0,0134, ***p=0,0003 (двусторонний критерий Стьюдента для одной выборки);

На фиг. 17 демонстрируется эффективность связывающегося с SDF-1 человека шпигельмера NOX-A12 в ингибировании пролиферации клеток Jurkat в сокультуре со стромальными клетками MS-5, в соответствии с чем мышиные стромальные клетки MS-5, секретирующие SDF-1, инкубировали с увеличивающимися концентрациями связывающегося с SDF-1 человека шпигельмера NOX-A12; клетки Jurkat добавляли к конфлюэнтному слою клеток MS-5, и количества клеток определяли через 40 часов с помощью проточной цитометрии, используя реагент ViaCoun, «усы» означают среднеквадратическое отклонение, N=4, ***p=0,0008 (двусторонний критерий Стьюдента для одной выборки);

На фиг. 18A+B демонстрируется эффективность связывающегося с SDF-1 человека шпигельмера NOX-A12 в аннулировании зависимой от дозы SDF-1 адгезии клеток Jurkat к фибронектину, в соответствии с чем клетки Jurkat инкубировали с только SDF-1 (A), с SDF-1 и увеличивающимися концентрациями связывающегося с SDF-1 человека шпигельмера NOX-A12 или с SDF-1 и увеличивающимися концентрациями контрольного шпигельмера revNOX-A12 (B) в течение 30 минут и высевали в покрытые фибронектином планшеты на 15 минут; впоследствии клетки отмывали средой, и количество прикрепленных клеток определяли, используя реагент Cell Titer Glo; «усы» означают среднеквадратическое отклонение.

Пример 1: Нуклеиновые кислоты, которые связываются с SDF-1 человека

Ниже термины «нуклеиновая кислота» и «молекула нуклеиновой кислоты» используются здесь как синонимы, кроме особо оговоренных случаев. Кроме того, термины «участок» и «участок нуклеотидов» используются здесь как синонимы, кроме особо оговоренных случаев.

Молекулы L-нуклеиновых кислот, которые связываются с SDF-1 человека, и соответствующие нуклеотидные последовательности представлены на фиг. 1-9. Нуклеиновые кислоты были охарактеризованы согласно аптамеру, т.е. уровню D-нуклеиновой кислоты, используя анализы конкурентного связывания или прямые анализы связывания с использованием аффинной очистки с биотинилированным D-SDF-1 человека (протокол, см. пример 3). Шпигельмеры исследовали с использованием природной конфигурации SDF-1 (L-SDF-1) посредством измерения с помощью поверхностного плазмонного резонанса, используя инструментальное средство Biacore 2000 (протокол, см. пример 5), и помощью анализа хемотаксиса in vitro в культуре клеток (протокол, см. пример 4).

Связывающиеся с SDF-1 молекулы нуклеиновых кислот демонстрируют различные мотивы в последовательности, три основных типа определены на фиг. 1, 2A и 2B (тип A), фиг. 3, 4A и 4B (тип B), фиг. 5, 4, 7A, 7B и 8 (тип C). Молекулы нуклеиновых кислот демонстрируют различные мотивы в последовательности. Для определения мотивов в нуклеотидной последовательности используются сокращения IUPAC (Международного союза теоретической и прикладной химии) для неоднозначных нуклеотидов:

S Сильный G или C;
W Слабый A или U;

R пурин G или A;
Y пиримидин C или U;
K кето G или U;
M имино A или C;
B не А C или U или G;
D не C A или G или U;
H не G A или C или U;
V не U A или C или G;
N все A или G или C или U

Кроме особо оговоренных случаев, всякая последовательность нуклеиновой кислоты или последовательность участков и боксов, соответственно, представлена в направлении 5'→3'.

Связывающиеся с SDF-1 молекулы нуклеиновых кислот типа A

Как представлено на фиг. 1, все последовательности связывающихся с SDF-1 молекул нуклеиновых кислот типа A включают один центральный участок нуклеотидов, который фланкирован первым (5'-) концевым и вторым (3'-) концевым участками нуклеотидов (также называемыми первым концевым участком нуклеотидов и вторым участком нуклеотидов), в соответствии с чем оба участка могут гибридизоваться друг с другом. Однако такая гибридизация необязательно задана в молекуле.

Ниже термины «связывающиеся с SDF-1 молекулы нуклеиновых кислот типа A» и «связывающиеся с SDF-1 нуклеиновые кислоты типа А» используются здесь как синонимы, кроме особо оговоренных случаев.

Последовательности определенных боксов или участков нуклеотидов могут отличаться между связывающимися с SDF-1 нуклеиновыми кислотами типа A, что влияет на сродство связывания с SDF-1. Основываясь на анализе связывания различных связывающихся с SDF-1 нуклеиновых кислот, обобщенных как связывающиеся с SDF-1 нуклеиновые кислоты типа А, центральный участок нуклеотидов и его нуклеотидные последовательности, приведенные ниже, по отдельности и более предпочтительно в их целостности необходимы для связывания с SDF-1.

Центральный участок нуклеотидов всех определенных последовательностей связывающихся с SDF-1 нуклеиновых кислот типа А имеет общую последовательность AAAGYRACAHGUMAAXAUGAAAGGUARC (формулы-1 типа А, SEQ ID NO: 74), в соответствии с чем XA или отсутствует, или представляет собой «A». Если «A» отсутствует, последовательность центрального участка нуклеотидов можно привести как последовательность формулы-2 типа A (AAAGYRACAHGUMAA-UGAAAGGUARC, SEQ ID NO: 75. Связывающаяся с SDF-1 нуклеиновая кислота типа А - 191-A6 (центральная нуклеотидная последовательность: AAAGUAACACGUAAAAUGAAAGGUAAC, SEQ ID NO: 54), содержащая дополнительный нуклеотид «A» в центральной нуклеотидной последовательности и все еще связывающаяся с SDF-1, позволяет вывести альтернативную центральную нуклеотидную последовательность (AAAGYRACAHGUMAAAUGAAAGGUARC, формулы-3 типа А, SEQ ID NO: 76). В качестве примера для всех других связывающихся с SDF-1 нуклеиновых кислот типа А было определено сродство связывания связывающейся с SDF-1 нуклеиновой кислоты типа А - 192-A10-001 к SDF-1 человека. Равновесная константа связывания KD была определена, используя анализ связывания с использованием аффинной очистки (KD=1,5 нМ), и с помощью измерения с использованием поверхностного плазмонного резонанса (KD=1,0 нМ). IC50 (концентрация 50% ингибирования), составляющая 0,12 нМ для 192-A10-001, была определена, используя анализ in vitro хемотаксиса в культуре клеток. В результате, все связывающиеся с SDF-1 нуклеиновые кислоты типа А, представленные на фиг. 1, были проанализированы в анализе конкурентного связывания с использованием аффинной очистки в сравнение с 192-A10-001. Связывающиеся с SDF-1 нуклеиновые кислоты типа А 192-B11 и 192-C10 продемонстрировали сродство связывания, равное таковому 192-A10-001, в этих экспериментах по конкуренции. Меньшее сродство связывания было определено для связывающихся с SDF-1 нуклеиновых кислот типа А: 192-G10, 192-F10, 192-C9, 192-E10, 192-D11, 192-G11, 192-H11 и 191-A6. Связывающиеся с SDF-1 нуклеиновые кислоты типа А: 192-D10, 192-E9 и 192-H9 - обладали намного меньшим сродством связывания, чем 192-A10-001.

Как отмечено выше, связывающиеся с SDF-1 нуклеиновые кислоты типа А: 192-B11 и 192-C10 - демонстрируют сродство связывания к SDF-1, равное таковому 192-A10-001. Однако они демонстрируют небольшие различия в нуклеотидной последовательности центрального участка нуклеотидов. Поэтому консенсусную последовательность трех молекул, связывающихся с SDF-1 с почти одинаковым высоким сродством, можно привести согласно нуклеотидной последовательности AAAGYAACAHGUCAAUGAAAGGUARC (формулы-4 типа А, SEQ ID NO: 77), в соответствии с чем нуклеотидная последовательность центрального участка нуклеотидов 192-A10-001 (нуклеотидная последовательность: AAAGCAACAUGUCAAUGAAAGGUAGC, SEQ ID NO: 84) представляет собой нуклеотидную последовательность с наибольшим сродством связывания связывающихся с SDF-1 нуклеиновых кислот типа А.

Пять или шесть из шести нуклеотидов 5'-концевого участка (также называемого первым концевым участком) связывающихся с SDF-1 нуклеиновых кислот типа А могут гибридизоваться с соответствующими пятью или шестью нуклеотидами из шести нуклеотидов 3'-концевого участка (также называемого вторым концевым участком) с образованием спирали на конце. Хотя эти нуклеотиды являются вариабельными в нескольких положениях, различные нуклеотиды допускают гибридизацию пяти или шести из шести нуклеотидов каждого из 5'- и 3'-концевых участков. 5'-концевой и 3'-концевой участки связывающихся с SDF-1 нуклеиновых кислот типа А, представленных на фиг. 1, можно свести к общей формуле для 5'-концевого участка («RSHRYR», формуле 5-5' типа А) и для 3'-концевого участка («YRYDSY», формуле 5-3' типа А). Усеченные производные связывающейся с SDF-1 нуклеиновой кислоты типа А 192-A10-001 были проанализированы в анализе конкурентного связывания с использованием аффинной очистки в сравнение с исходной молекулой 192-A10-001 и 192-A10-008 (фиг. 2A и 2B). Эти эксперименты показали, что сокращение шести концевых нуклеотидов (5'-конца: GCUGUG; 3'-конца: CGCAGC) 192-A10-001 до пяти нуклеотидов (5'-конца: CUGUG; 3'-конца: CGCAG) производного 192-A10-002 можно было осуществить без уменьшения сродства связывания. Однако усечение до четырех концевых нуклеотидов (5'-конца: UGUG; 3'-конца: CGCA; 192-A10-003) или менее (192-A10-004/ -005/ -006/ -007) приводило к уменьшению сродства связывания с SDF-1 (фиг. 2A). Определенные 5'-концевые и 3'-концевые участки длиной пять и четыре нуклеотида производных связывающейся с SDF-1 нуклеиновой кислоты типа А 192-A10-001, представленных на фиг. 2A и 2B, можно описать общей формулой для 5'-концевого участка («X2BBBS», формулой 6-5' типа А) и для 3'-концевого участка («SBBVX3»; формулой-6-3' типа А), в соответствии с чем X2 или отсутствует, или представляет собой S, и X3 или отсутствует, или представляет собой S.

Нуклеотидная последовательность 5'- и 3'-концевых участков оказывает влияние на сродство связывания связывающихся с SDF-1 нуклеиновых кислот типа A. Это не только продемонстрировано с помощью нуклеиновых кислот 192-F10 и 192-E10, но также с помощью производных 192-A10-001 (фиг. 2B). Центральный участок 192-F10 и 192-E10 идентичен таковому 192-B11 и 192-C10, но они имеют небольшие различия на 3'-конце 5'-концевого участка и на 5'-конце 3'-концевого участка, приводящие к уменьшению сродства связывания.

Замена 5'- и 3'-концевых нуклеотидов «CUGUG» и «CGCAG» связывающейся с SDF-1 нуклеиновой кислоты типа A 192-A10-002 на «GCGCG» и «CGCGC» (192-A10-015) приводила к уменьшению сродства связывания, тогда как замены на «GCGUG» и «CGCGC» (192-A10-008) приводили к сродству связывания, одинаковому с таковым, продемонстрированным в случае 192-A10-002 (фиг. 2B). Кроме того, девять производных связывающейся с SDF-1 нуклеиновой кислоты типа A 192-A10-001 (192-A10-014/ -015/ -016/ -017/ -018/ -019/ -020/ -021/ -022/ -023), содержащих четыре 5'- и 3'-концевых нуклеотида, соответственно, были исследованы в качестве аптамеров в отношении их сродства связывания в сравнение с 192-A10-001 и ее производной 192-A10-008 (обе обладают равным сродством связывания с SDF-1). Все молекулы продемонстрировали меньшее, намного меньшее или гораздо меньшее сродство связывания с SDF-1, чем 192-A10-001 (с шестью нуклеотидами, образующими спираль на конце) или 192-A10-008 с пятью концевыми нуклеотидами, соответственно (фиг. 2B). Следовательно, последовательность и число нуклеотидов 5'- и 3'-концевых участков важны для эффективного связывания с SDF-1. Как установлено для связывающихся с SDF-1 нуклеиновых кислот типа А 192-A10-002 и 192-A10-08, предпочтительными комбинациями 5'- и 3'-концевых участков являются «CUGUG» и «CGCAG» (5'- и 3'-концевые участки связывающейся с SDF-1 нуклеиновой кислоты типа А 192-A10-002) и «GCGUG» и «CGCGC» (5'- и 3'- концевые участки связывающейся с SDF-1 нуклеиновой кислоты типа А 192-A10-008).

Однако при совмещении 5'- и 3'-концевых участков всех исследованных связывающихся с SDF-1 нуклеиновых кислот типа А общей формулой для 5'-концевого участка связывающихся с SDF-1 нуклеиновых кислот типа А является «X1X2NNBV» (формула-7-5' типа А), а общей формулой для 3'-концевого участка связывающихся с SDF-1 нуклеиновых кислот типа А является «BNBNX3X4» (формула-7-3' типа А), где

X1 представляет собой R или отсутствует, X2 представляет собой S, X3 представляет собой S, и X4 представляет собой Y или отсутствует; или

X1 отсутствует, X2 представляет собой S или отсутствует, X3 представляет собой S или отсутствует, и X4 отсутствует.

Для увеличения времени жизни шпигельмеров в плазме in vivo, к шпигельмерам 192-A10-008 была ковалентно присоединена составляющая - полиэтиленгликоль (ПЭГ) с М.м. 40 кДа на 5'-конце, как описано в главе 2. ПЭГ-составляющая не оказывала влияние на эффективность ингибирования шпигельмерами SDF-1-индуцируемого хемотаксиса.

Связывающиеся с SDF-1 молекулы нуклеиновых кислот типа B

Как представлено на фиг. 3, все последовательности связывающихся с SDF-1 нуклеиновых кислот типа В включают один центральный участок нуклеотидов, который фланкирован 5'- и 3'-концевыми участками (также называемыми первым и вторым концевыми участками нуклеотидов), которые могут гибридизоваться друг с другом. Однако такая гибридизация необязательно задана в молекуле.

Ниже термины «связывающиеся с SDF-1 молекулы нуклеиновых кислот типа В» и «связывающиеся с SDF-1 нуклеиновые кислоты типа В» используются здесь как синонимы, кроме особо оговоренных случаев.

Последовательности определенных боксов или участков нуклеотидов могут отличаться между связывающимися с SDF-1 нуклеиновыми кислотами, что влияет на сродство связывания с SDF-1. Основываясь на анализе связывания различных связывающихся с SDF-1 нуклеиновых кислот, центральный участок нуклеотидов и его нуклеотидные последовательности, приведенные ниже, по отдельности и более предпочтительно в их целостности необходимы для связывания с SDF-1.

Центральный участок нуклеотидов всех определенных последовательностей связывающихся с SDF-1 нуклеиновых кислот 193-C2-001, 193-G2-001, 193-F2-001, 193-G1-002, 193-D2-002, 193-A1-002, 193-D3-002, 193-B3-002, 193-H3-002, 193-E3-002 и 193-D1-002 имеет общую последовательность GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG (формулы-1 типа В, SEQ ID NO: 52). Связывающиеся с SDF-1 нуклеиновые кислоты 193-G2-001, 193-C2-001 и 193-F2-001, которые отличаются по одному положению центрального участка нуклеотидов, (с консенсусной последовательностью центрального участка нуклеотидов: GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG (формулы-2 типа В, SEQ ID NO: 53), были проанализированы в анализе конкурентного связывания с использованием аффинной очистки в сравнение со связывающейся с SDF-1 нуклеиновой кислотой 192-A10-001 (KD=1,5 нМ, как определено в анализе связывания с использованием аффинной очистки, IC50=0,12 нМ). Каждая из связывающихся с SDF-1 нуклеиновых кислот 193-G2-001, 193-C2-001 и 193-F2 продемонстрировала лучшее связывание с SDF-1 человека, чем связывающаяся с SDF-1 нуклеиновая кислота 192-A10-001, в соответствии с чем сродство связывания 193-G2-001 в сущности не хуже такового 193-C2-001 и 193-F2-001 (фиг. 3). Эти данные говорят о том, что различие в нуклеотидной последовательности центрального участка нуклеотидов связывающихся с SDF-1 нуклеиновых кислот 193-G2-001, 193-C2-001 и 193-F2-001 не оказывает влияние на сродство связывания с SDF-1. Связывающиеся с SDF-1 нуклеиновые кислоты 193-G1-002, 193-D2-002, 193-A1-002, 193-D3-002, 193-B3-002, 193-H3-002, 193-E3-002 и 193-D1-002 продемонстрировали уменьшенное связывание с SDF-1 человека по сравнению со связывающейся с SDF-1 нуклеиновой кислотой 193-G2-001. Было определено сродство связывания связывающейся с SDF-1 нуклеиновой кислоты 193-G2-001 к SDF-1 человека. Равновесная константа связывания KD была определена, используя анализ связывания с использованием аффинной очистки (KD=0,3 нМ). IC50 (концентрация 50% ингибирования), составляющая 0,08 нМ для 193-G2-001, была определена, используя анализ in vitro хемотаксиса в культуре клеток.

Четыре, пять или шесть из шести нуклеотидов 5'-концевого участка связывающихся с SDF-1 нуклеиновых кислот могут гибридизоваться с соответствующими четырьмя, пятью или шестью нуклеотидами из шести нуклеотидов 3'-концевого участка связывающихся с SDF-1 нуклеиновых кислот с образованием спирали на конце. Хотя эти нуклеотиды являются вариабельными в нескольких положениях, различные нуклеотиды допускают гибридизацию четырех, пяти или шести нуклеотидов из шести нуклеотидов каждого из 5'- и 3'-концевых участков. 5'-концевой и 3'-концевой участки связывающихся с SDF-1 нуклеиновых кислот, представленных на фиг. 3, можно свести к общей формуле для 5'-концевого участка («X1X2GCRWG», где X1 представляет собой A или отсутствует, X2 представляет собой G) и для 3'-концевого участка («KRYSCX3X4», где X3 представляет собой G, X4 представляет собой U или отсутствует). Связывающиеся с SDF-1 нуклеиновые кислоты 193-Gl-002, 193-D2-002, 193-A1-002 и 193-D3-002 обладали меньшим сродством связывания с SDF-1, хотя они имеют центральный участок нуклеотидов, идентичный таковому в 193-C2-001, 193-G2-001 и 193-F2-001 (фиг. 3). Невыгодные свойства, относящиеся к связыванию, связывающихся с SDF-1 нуклеиновых кислот 193-G1-002, 193-D2-002, 193-A1-002 и 193-D3-002 могут быть обусловлены числом нуклеотидов и последовательностью 5'- и 3'-концевых участков.

Усеченные производные связывающихся с SDF-1 нуклеиновых кислот 193-G2-001 и 193-C2-001 были проанализированы в анализе конкурентного связывания с использованием аффинной очистки в сравнение с 193-G2-001 и 193-G2-012, соответственно (фиг. 4А и 4В). Эти эксперименты показали, что сокращение шести концевых нуклеотидов (5'-конца: AGCGUG; 3'-конца: UACGCU) связывающихся с SDF-1 нуклеиновых кислот 193-G2-001 и 193-C2-001 до пяти нуклеотидов (5'-конца: GCGUG; 3'-конца: UACGC) приводит к молекулам со схожим сродством связывания (193-C2-002 и 193-G2-012). Используя анализ связывания с использованием аффинной очистки, была определена равновесная константа диссоциации KD (KD=0,3 нМ). Усечение до четырех (5'-конца: CGUG; 3'-конца: UACG; 193-C2-003) или менее нуклеотидов (193-C2-004, 193- C2-005, 193-C2-006, 193-C2-007) приводило к уменьшению сродства связывания с SDF-1, которое определяли, используя анализ конкурентного связывания с использованием аффинной очистки (фиг. 4A). Нуклеотидная последовательность пяти концевых нуклеотидов на 5'- и 3'-концах, соответственно, оказывает влияние на сродство связывания связывающихся с SDF-1 нуклеиновых кислот. Замена 5'- и 3'-концевых нуклеотидов «GCGUG» и «UACGC» (193-C2-002, 193-G2-12) на «GCGCG» и «CGCGC» (193-G2-013) приводила к уменьшению сродства связывания. Кроме того, были исследованы четыре различные производные связывающихся с SDF-1 нуклеиновых кислот 193-G2-001 со спиралью на конце длиной четыре спаривающихся нуклеотида (193-G2-014/ -015/ -016/ -017). Все из них продемонстрировали уменьшенное сродства связывания с SDF-1 (фиг. 4B). Следовательно, последовательность и длина 5'- и 3'-концевых нуклеотидов важны для эффективного связывания с SDF-1. 5'-концевые и 3'-концевые участки длиной пять и четыре нуклеотида производных связывающихся с SDF-1 нуклеиновых кислот 193-C2-003 и 193-G2-012, представленных на фиг. 4A и 4B, можно описать общей формулой для 5'-концевого участка («X1X2SSBS»), в соответствии с чем X1 отсутствует, X2 или отсутствует, или представляет собой G, и для 3'-концевого участка («BVSSX3X4»), в соответствии с чем X3 или отсутствует, или представляет собой C, и X4 отсутствует. Как установлено для связывающихся с SDF-1 нуклеиновых кислот 193-G2-001 и 193-C2-01 и их производных 193-G2-012 и 193-C2-002, предпочтительной комбинацией 5'- и 3'-концевых участков является X1X2GCGUG (5'-концевой участок) и UACGCX3X4 (3'-концевой участок), в соответствии с чем X1 представляет собой А, или отсутствует, X2 представляет собой G, X3 представляет собой C, и X4 представляет собой U, или отсутствует.

Однако при совмещении 5'- и 3'-концевых участков всех исследованных связывающихся с SDF-1 нуклеиновых кислот общей формулой для 5'-концевого участка связывающихся с SDF-1 нуклеиновых кислот является «X1X2SVNS», а общей формулой для 3'-концевого участка связывающихся с SDF-1 нуклеиновых кислот является «BVBSX3X4», где

X1 представляет собой A или отсутствует, X2 представляет собой G, X3 представляет собой C, и X4 представляет собой U или отсутствует; или

X1 отсутствует, X2 представляет собой G или отсутствует, X3 представляет собой C или отсутствует, и X4 отсутствует.

Для увеличения времени жизни шпигельмеров в плазме in vivo, к шпигельмеру 192-G2-012 была ковалентно присоединена составляющая - полиэтиленгликоль (ПЭГ) с М.м. 40 кДа на 5'-конце, как описано в главе 2 (ПЭГилированная нуклеиновая кислота: 193-G2-012-5'-ПЭГ, также называемая NOX-A12). ПЭГилированный шпигельмер NOX-A12 анализировали в культуре клеток в in vitro анализе хемотаксиса, и было определено ингибирование SDF-1-индуцируемого хемотаксиса (IC50=0,2 нМ). ПЭГилированный шпигельмер NOX-A12 анализировали с помощью измерения с использованием Biacore, и была определена константа связывания (KD), равная 0,2 нМ.

Связывающиеся с SDF-1 молекулы нуклеиновых кислот типа C

Как представлено на фиг. 12, все последовательности связывающихся с SDF-1 нуклеиновых кислот типа C включают один центральный участок нуклеотидов, который фланкирован 5'- и 3'-концевыми участками (также называемыми первым и вторым концевыми участками нуклеотидов), которые могут гибридизоваться друг с другом. Однако такая гибридизация необязательно задана в молекуле.

Ниже термины «связывающиеся с SDF-1 молекулы нуклеиновых кислот типа С» и «связывающиеся с SDF-1 нуклеиновые кислоты типа С» используются здесь как синонимы, кроме особо оговоренных случаев.

Последовательности определенных боксов или участков нуклеотидов могут отличаться между связывающимися с SDF-1 нуклеиновыми кислотами типа С, что влияет на сродство связывания с SDF-1. Основываясь на анализе связывания различных связывающихся с SDF-1 нуклеиновых кислот, обобщенных как связывающиеся с SDF-1 нуклеиновые кислоты типа С, центральный участок нуклеотидов и его нуклеотидные последовательности, приведенные ниже, по отдельности и более предпочтительно в их целостности необходимы для связывания с SDF-1.

Центральный участок нуклеотидов всех определенных последовательностей связывающихся с SDF-1 нуклеиновых кислот типа С имеет общую последовательность GGUYAGGGCUHRXAAGUCGG (формулы-1 типа С, SEQ ID NO: 108), в соответствии с чем XA или отсутствует, или представляет собой «A». За исключением связывающейся с SDF-1 нуклеиновой кислоты типа С 197-D1, центральный участок нуклеотидов всех определенных последовательностей связывающихся с SDF-1 нуклеиновых кислот типа С имеет общую нуклеотидную последовательность GGUYAGGGCUHRAAGUCGG (формулы-2 типа С, SEQ ID NO: 109). Связывающаяся с SDF-1 нуклеиновая кислота типа С 197-D1 (с центральным участком нуклеотидов: GGUUAGGGCUAA-AGUCGG (SEQ ID NO: 56), в которой отсутствует один нуклеотид «A» в центральном участке нуклеотидов и которая все еще связывается с SDF-1, позволяет вывести альтернативную последовательность центрального участка нуклеотидов (GGUYAGGGCUHR-AGUCGG, формулы-3 типа С, SEQ ID NO: 110). В начале, все связывающиеся с SDF-1 нуклеиновые кислоты типа С, представленные на фиг. 5, были проанализированы в анализе конкурентного связывание с использованием аффинной очистки в сравнение со связывающейся с SDF-1 нуклеиновой кислотой типа А 192-A10-001 (KD=1,5 нМ, как определено в анализе с использованием аффинной очистки и с помощью измерения с использованием поверхностного плазмонного резонанса; IC50=0,12 нМ). Связывающиеся с SDF-1 нуклеиновые кислоты типа С 191-D5-001, 197-B2, 190-A3-001, 197-H1, 197-H3 и 197-E3 продемонстрировали меньшее сродство связывания, чем 192- A10-001 в экспериментах по конкуренции. Намного меньшее сродство связывания было определено для 191-A5, 197-B1, 197-D1, 197-H2 и 197-D2 (фиг. 5). Молекулы или их производные были далее охарактеризованы с использованием дополнительных анализов конкурентного связывания с использованием аффинной очистки, измерений с использованием поверхностного плазмонного резонанса и in vitro анализа хемотаксиса. Было определено сродство связывания связывающейся с SDF-1 нуклеиновой кислоты типа С 191-D5-001 к SDF-1 человека, а равновесная константа связывания KD была определена с помощью измерения с использованием поверхностного плазмонного резонанса (KD=0,8 нМ). IC50 (концентрация 50% ингибирования), составляющая 0,2 нМ для 191-D5-001, была определена, используя анализ in vitro хемотаксиса в культуре клеток. Сродство связывания связывающейся с SDF-1 нуклеиновой кислоты типа С 197-B2 к SDF-1 человека было определено с помощью измерения с использованием поверхностного плазмонного резонанса (KD=0,9 нМ), его IC50 (концентрация 50% ингибирования), составляющая 0,2 нМ, была определена в анализе in vitro хемотаксиса в культуре клеток. Эти данные указывают на то, что связывающиеся с SDF-1 нуклеиновые кислоты типа С 191-D5-001 и 197-B2 обладают схожим сродством связывания с SDF-1 (фиг. 5 и 8).

Связывающаяся с SDF-1 нуклеиновая кислота типа С 190-A3-001 включает 5'-концевой участок из 17 нуклеотидов (CGUGCGCUUGAGAUAGG, SEQ ID NO: 220) и 3'-концевой участок из 12 нуклеотидов (CUGAUUCUCACG, SEQ ID NO: 221), в соответствии с чем, с одной стороны, четыре нуклеотида на 5'-конце 5'-концевого участка и четыре нуклеотида на 3'-конце 3'-концевого участка могут гибридизоваться друг с другом с образованием спирали на конце. Альтернативно, нуклеотиды UGAGA в 5'-концевом участке могут гибридизоваться с нуклеотидами UCUCA в 3'-концевом участке с образованием спирали на конце. Укорочение до девяти нуклеотидов 5'-концевого участка (UGAGAUAGG) и до десяти нуклеотидов (CUGAUUCUCA, SEQ ID NO: 222) 3'-концевого участка (CUGAUUCUC) молекулы 190-A3-001 не оказывает влияние на сродство связывания с SDF-1 (190-A3-003; фиг. 13). Укорочение до восьми нуклеотидов 5'-концевого участка (GAGAUAGG) и до девяти нуклеотидов 3'-концевого участка (CUGAUUCUC) молекулы 190-A3-001 не оказывает влияние на сродство связывания с SDF-1 (190-A3-004; фиг. 6). Равновесная константа связывания KD 190-A3-004 была определена, используя анализ связывания с использованием аффинной очистки (KD=4,6 нМ), и с помощью измерения с использованием поверхностного плазмонного резонанса (KD=4,7 нМ). IC50 (концентрация 50% ингибирования), равная 0,1 нМ для 190-A3-004, была определена, используя in vitro анализ хемотаксиса в культуре клеток. Однако усечение до двух нуклеотидов в 5'-концевом участке приводит к очень сильному уменьшению сродства связывания (190-A3-007; фиг. 6).

Связывающиеся с SDF-1 нуклеиновые кислоты типа С 191-D5-001, 197-B2 и 197-Hl (с центральным участком нуклеотидов: GGUUAGGGCUAGAAGUCGG, SEQ ID 57), 197-H3/191-A5 (с центральным участком нуклеотидов: GGUUAGGGCUCGAAGUCGG, SEQ ID NO: 58) и 197-E3/197-B1 (с центральным участком нуклеотидов: GGUUAGGGCUUGAAGUCGG, SEQ ID NO: 59) имеют почти идентичный центральный участок нуклеотидов (формулы-4 типа С; нуклеотидную последовательность: GGUUAGGGCUHGAAGUCG SEQ ID NO: 111). 191-D5-001, 197-B2 и 197-H1 не имеют схожих 5'- и 3'-концевых участков (197-H3 и 197-E3 имеют 5'- и 3'-концевые участки, идентичные таковым в 197-B2). Однако соответствующие десять (197-B2, 197-E3, 197-H3) или девять из десяти нуклеотидов (191-D5-001, 197-H1) 5'-концевого участка могут гибридизоваться с соответствующими десятью (197-B2, 197-E3, 197-H3) или девятью из десяти нуклеотидов (191-D5-001, 197-H1) 3'-концевого участка (фиг. 5). Таким образом, 5'-концевой участок связывающихся с SDF-1 нуклеиновых кислот типа С 197-B2, 191-D5-001, 197-H1, 197-E3 и 197-H3, упомянутых выше, плюс 191-A5, 197-B1, 197-H2, 197-D1 и 197-D2 включает общую нуклеотидную последовательность «RKSBUSNVGR» (формулы-5-5' типа С, SEQ ID NO: 138). 3'-Концевой участок связывающихся с SDF-1 нуклеиновых кислот типа С 197-B2, 191-D5-001, 197-H1, 197-E3 и 197-H3, упомянутых выше, плюс 191-A5, 197-B1, 197-H2, 197-D1 и 197-D2 включает общую нуклеотидную последовательность «YYNRCASSMY» (формулы-5-3' типа С, SEQ ID NO: 139), в соответствии с чем 5'- и 3'-концевые участки связывающихся с SDF-1 нуклеиновых кислот типа С 197-B2, 191-D5-001, 197-H1, 197-E3 и 197-H3 являются предпочтительными. Эти предпочтительные 5'- и 3'-концевые участки связывающихся с SDF-1 нуклеиновых кислот типа С 197-B2, 191-D5-001, 197-Hl, 197-E3 и 197-H3 можно свести к общей формуле «RKSBUGSVGR» (формуле-6-5' типа С; для 5'-концевого участка, SEQ ID NO: 140) и «YCNRCASSMY» (формуле-6-3' типа С; для 3'-концевого участка, SEQ ID NO: 141).

Усеченные производные связывающейся с SDF-1 нуклеиновой кислоты типа С 191-D5-001 были сконструированы и исследованы в анализе конкурентного связывания с использованием аффинной очистки в сравнение с исходной молекулой 191-D5-001 (фиг. 7A, фиг. 7B). Сначала длину каждого из 5'- и 3'-концевых участков укорачивали с десяти нуклеотидов (191-D5-001) до семи нуклеотидов (191-D5-004), как представлено на фиг. 14A, в соответствии с чем девять из десяти (191-D5-001) или шесть из семи нуклеотидов (191-D5-004) 5'-концевого участка и 3'- концевого участка, соответственно, могли гибридизоваться друг с другом. Укорочение до семи нуклеотидов 5'- и 3'-концевого участка, соответственно (в соответствии с чем шесть из семи нуклеотидов могут гибридизоваться друг с другом) приводило к уменьшению сродства связывания с SDF-1 (191-D5-004). Концевые участки связывающейся с SDF-1 нуклеиновой кислоты типа С 191-D5-004 были модифицированы, в соответствии с чем не спаривающийся нуклеотид «A» в 3'-концевом участке 191-D5-004 был заменен на «C» (191-D5-005). Эта модификация привела к увеличению связывания. Это производное, связывающаяся с SDF-1 нуклеиновая кислота 191-D5-005, продемонстрировало связывание с SDF-1, схожее с таковым 191-D5-001. Дальнейшее усечение 5'- и 3'-концевого участка до пяти нуклеотидов, соответственно, приводило к молекуле длиной всего 29 нуклеотидов (191-D5-007). Из-за сходств между 191-D5-001 и связывающимися с SDF-1 нуклеиновыми кислотами типа С 197-B2, 191-D5-001, 197-H1, 191-A5, 197-H3, 197-B1, 197-E3, 197-D1, 197-H2 и 197-D2 и на основании данных для 191-D5-007 можно предположить, что 5'- и 3'-концевой участок можно, в принципе, укоротить до пяти нуклеотидов, в соответствии с чем была с успехом проверена нуклеотидная последовательность «CGGGA» для 5'-концевого участка и «UCCCG» для 3'-концевого участка (связывающейся с SDF-1 нуклеиновой кислоты типа С 191-D5-007). Связывающаяся с SDF-1 нуклеиновая кислота типа С 191-D5-007, как ни удивительно, связывается с SDF-1 отчасти лучше, чем 191-D5-001 (как определено согласно уровню аптамера, используя анализ конкурентного связывания). Равновесная константа связывания KD 191-D5-007 была определена, используя анализ связывания с использованием аффинной очистки (KD=2,2 нМ), и с помощью измерения с использованием поверхностного плазмонного резонанса (KD=0,8 нМ). IC50 (концентрация 50% ингибирования), равная 0,1 нМ для 191-D5-007, была определена, используя in vitro анализ хемотаксиса в культуре клеток. Дальнейшее усечение обоих концевых участков до четырех нуклеотидов (191-D5-010, фиг. 7A).

Дополнительные производные связывающейся с SDF-1 нуклеиновой кислоты типа С 191-D5-001 (191-D5-017/ -024/ - 029), имеющие 5'- и 3'-концевые участки из соответственно четырех нуклеотидов, также продемонстрировали уменьшенное сродство связывания с SDF-1 в анализе конкурентного связывания с использованием аффинной очистки в сравнение с 191-D5-007 (фиг. 7B). Кроме того, были исследованы альтернативные 5'- и 3'-концевые участки длиной соответственно пять нуклеотидов (191-D5-017-29a, 191-D5-017-29b, 191-D5-019-29a, 191-D5-024-29a, 191-D5-024-29b). Общей формулой для 5'-кончевого участка этих производных является «XSSSSV» (формула-7-5' типа С) и для 3'-участка - «BSSSXS» (формула-7-3' типа С), в соответствии с чем XS или отсутствует, или представляет собой S. Два из пяти исследованных вариантов продемонстрировали сродство связывания с SDF-1, идентичное с таковым 191-D5-007 (191-D5-024-29a, 191 -D5-024-29b; фиг. 7B). Последовательности 5'-концевых и 3'-концевых участков производных 191-D5-001, которые демонстрируют наибольшее сродство связывания с SDF-1 и включают 5'-концевой и 3'-концевой участок из пяти нуклеотидов, соответственно, (191-D5-007, 191-D5-024-29a, 191-D5-024-29b) могут быть сведены к общей формуле (для 5'-концевого участка: «SGGSR», формуле-8-5' типа С; для 3'-концевого участка: «YSCCS», формуле-8-3' типа С).

Усеченные производные связывающейся с SDF-1 нуклеиновой кислоты типа С 197-B2 были проанализированы в анализе конкурентного связывания с использованием аффинной очистки в сравнение с исходной молекулой 197-B2 и 191-D5-007 (фиг. 7). В результате использования анализа конкурентного связывания с использованием аффинной очистки в сравнение с 191-D5-007 было установлено, что 197-B2 обладает сродством связывания с SDF-1, одинаковым с таковым 191-D5-007. Каждый из 5'- и 3'-концевых участков был укорочен без уменьшения сродства связывания с десяти нуклеотидов (197-B2) до пяти нуклеотидов (197-B2-005), в соответствии с чем нуклеотиды 5'-концевого участка и 3'-концевого участка могут полностью гибридизоваться друг с другом. В случае замены 5'-концевого («GCGGG») и 3'-концевого («CCUGC») участка 197-B2-005 на «GCCGG» (5'-концевой участок) и на «CCGGC» (3'-концевой участок) 197-B2-006 сродство связывания с SDF-1 полностью сохранялось. Поскольку 197-B2 и 191-D5-001 (и их производные) имеют идентичную центральную нуклеотидную последовательность, и было исследовано несколько производных 191-D5 с 5'- и 3'-концевыми участками длиной, соответственно, четыре нуклеотида, дальнейшее усечение 5'- и 3'-концевого участка не совершалось. Были разработаны дополнительные производные, включающие шесть нуклеотидов на 5'- и 3'-конце (5'- и 3'-концевые участки), соответственно. Сродство связывания с SDF-1 обеих молекул (197-B2-006-31a и 197-B2-006-31b) является одинаковым с таковым 191-D5-007 и 197-B2-006 (фиг. 15). Последовательности 5'-концевых и 3'-концевые участки производных 197-B2, которые демонстрируют наилучшее сродство связывания с SDF-1 и включают 5'-концевой и 3'-концевой участок из пяти нуклеотидов, соответственно, можно свести к общей формуле (для 5'-концевого участка: «GCSGG», формуле-9-5' типа С; для 3'-концевого участка: «CCKGC», формуле-9-3' типа С).

При совмещении предпочтительных 5'- и 3'-концевых участков усеченных производных связывающихся с SDF-1 нуклеиновых кислот типа С 191-D5-001 (с 5'-концевым участком: «SGGSR», формулы-8-5' типа С; с 3'-концевым участком: «YSCCS», формулы-8-3' типа С) и 197-B2 (с 5'-концевым участком: «GCSGG», формулы-9-5' типа С; с 3'-концевым участком: «CCKGC», формулы-9-3' типа С) общей предпочтительной формулой для 5'-концевого участка и 3'-концевого участка является «SSSSR» (5'-концевой участок, формула-10-5' типа С) и «YSBSS» (3'-концевой участок: формула-10-3' типа С).

Для увеличения времени жизни шпигельмеров в плазме in vivo, к шпигельмерам 197-B2-006 и 191-D5-007 была ковалентно присоединена составляющая - полиэтиленгликоль (ПЭГ) с М.м. 40 кДа на 5'-конце, как описано в главе 2. ПЭГилированные шпигельмеры 197-B2-006 и 191-D5-007 анализировали в культуре клеток в отношении in vitro хемотаксиса. ПЭГ-составляющая не оказывает влияние на эффективность ингибирования шпигельмерами SDF-1-индуцируемого хемотаксиса.

Связывающиеся с SDF-1 молекулы нуклеиновых кислот типа D

Кроме того, три дополнительные, связывающиеся с SDF-1 нуклеиновые кислоты, которые не имеют общих мотивов связывания с SDF-1 «типа A», «типа B» и «типа C», были идентифицированы, и их называют здесь «типом D». Они были проанализированы как аптамеры, используя анализ связывания с использованием аффинной очистки (фиг. 9).

Следует понимать, что любые из последовательностей, представленных на фиг. 1-9, включая их усеченные формы, а также их удлиненные формы, являются молекулами нуклеиновых кислот в соответствии с настоящим изобретением, при условии, однако, что такие усеченные и удлиненные, соответственно, молекулы нуклеиновых кислот все еще способны к связыванию с мишенью.

Пример 2: Синтез и получение производных аптамеров и шпигельмеров

СИНТЕЗ В НЕБОЛЬШОМ МАСШТАБЕ

Аптамеры и шпигельмеры были получены с помощью твердофазного синтеза, используя синтезатор ABI 394 (Applied Biosystems, Foster City, CA, США), используя химию 2'TBDMS-РНК-фосфорамидитов (Damha and Ogilvie, 1993). rA(N-Bz)-, rC(Ac)-, rG(N-ibu)- и rU-фосфорамидиты в D- и L-конфигурации были приобретены у ChemGenes, Wilmington, MA. Аптамеры и шпигельмеры были очищены с помощью гель-электрофореза.

СИНТЕЗ В БОЛЬШОМ МАСШТАБЕ ПЛЮС МОДИФИКАЦИЯ

Шпигельмеры были получены с помощью твердофазного синтеза с использованием синтезатора AktaPilot100 (Amersham Biosciences; General Electric Healthcare, Freiburg), используя химию 2'TBDMS-РНК-фосфорамидитов (Damha and Ogilvie, 1993). L-rA(N-Bz)-, L-rC(Ac)-, L-rG(N-ibu)- и L-rU-фосфорамидиты были приобретены у ChemGenes (Wilmington, MA, США). 5'-Амино-модификатор был приобретен у American International Chemicals Inc. (Framingham, MA, США). Синтез шпигельмеров начинали на соответственно модифицированных L-рибоG; L-рибоC, L-рибоA, L-рибоU CPG с размером пор 1000 Å (Link Technology, Glasgow, Соединенное Королевство). Для соединения (15 мин на цикл) использовали 0,3 M бензилтиотетразол (American International Chemicals Inc., Framingham, MA, США) в ацетонитриле и 3,5 эквивалентов 0,2 M раствора соответствующего фосфорамидита в ацетонитриле. Использовали цикл кэппирования от окисления. Дополнительные стандартные растворы и реагенты для синтеза олигонуклеотидов были приобретены у Biosolve (Valkenswaard, NL). Шпигельмеры были синтезированы с DMT-ON; после снятия защиты их очищали посредством препаративной HPLC с обращенной фазой (Wincott F. et al., 1995), используя среду Source 15RPC (Amersham). 5'DMT-группу удаляли с помощью 80% уксусной кислоты (90 мин при комнатной температуре). Впоследствии добавляли 2 M раствор NaOAc в воде, и шпигельмер обессоливали с помощью проточной фильтрации вдоль потока, используя 5 K регенерированную целлюлозную мембрану (Millipore, Bedford, MA).

ПЭГИЛИРОВАНИЕ

Для увеличения времени жизни шпигельмеров в плазме in vivo, к 5'-концу шпигельмеров ковалентно присоединяли составляющую - полиэтиленгликоль (ПЭГ) с М.м. 40 кДа.

Для ПЭГилирования (в отношении технических подробностей способа ПЭГилирования см. заявку на Европейский патент EP 1306382) очищенные 5'-амино-модифицированные шпигельмеры растворяли в смеси H2O (2,5 мл), DMF (5 мл) и буфера A (5 мл; приготовленного смешиванием лимонной кислоты.H2O [7 г], борной кислоты [3,54 г], фосфорной кислоты [2,26 мл] и 1 M NaOH [343 мл] и добавлением воды до конечного объема = 1 л; pH=8,4 доводили с помощью 1 M HCl).

pH раствора шпигельмера доводили до 8,4 с помощью 1 M NaOH. Затем ПЭГ с М.м. 40 кДа-NHS эфир (JenKem Technology USA Inc., Allen, TX) добавляли при 37°C каждые 30 мин шестью порциями, равными 0,25 эквивалентам, до достижения максимального выхода, составляющего 75-85%. pH реакционной смеси поддерживали на уровне 8-8,5 с помощью 1 M NaOH во время добавления ПЭГ-NHS эфира.

Реакционную смесь смешивали с 4 мл раствора мочевины (8 M) и 4 мл буфера B (0,1 M триэтиламмония ацетата в H2O) и нагревали до 95°C в течение 15 мин. Подвергнутый ПЭГилированию шпигельмер затем очищали с помощью HPLC с обращенной фазой с использованием среды Source 15RPC (Amersham), используя градиент ацетонитрила (буфер B; буфер C: 0,1 M триэтиламмония ацетат в ацетонитриле). Избыток ПЭГ подвергался элюированию при 5% буфера C, подвергнутый ПЭГилированию шпигельмер - при 10-15% буфера C. Фракции продукта со степенью чистоты, составляющей >95% (как определено с помощью HPLC), объединяли и смешивали с 40 мл 3 M NaOAC. Подвергнутый ПЭГилированию шпигельмер обессоливали с помощью проточной фильтрации вдоль потока (используя 5 K регенерированную целлюлозную мембрану, (Millipore, Bedford, MA).

Пример 3: Определение констант связывания (анализ связывания с использованием аффинной очистки)

Прямой анализ связывания с использованием аффинной очистки

Сродство аптамеров к биотинилированному D-SDF-1 человека определяли в формате анализа связывания с использованием аффинной очистки при 37°C. Аптамеры были помечены по 5'-фосфатной группе с помощью полинуклеотидкиназы T4 (Invitrogen, Karlsruhe, Германия), используя [γ-32P]-меченный АТФ (Hartmann Analytic, Braunschweig, Германия). Удельная радиоактивность меченых аптамеров составляла 200000 - 800000 имп/мин/пмоль. Аптамеры инкубировали после де- и ренатурации в концентрации, составляющей 10, 20, 30 или 40 пМ, при 37°C в буфере для селекции (20 мМ Трис-HCl pH 7,4; 137 мМ NaCl; 5 мМ KCl; 1 мМ MgCl2; 1 мМ CaCl2; 0,1% [в отношении веса к объему] Tween-20) вместе с переменными количествами биотинилированного D-SDF-1 человека в течение 4-12 часов для достижения равновесия при низких концентрациях. Буфер для селекции был дополнен 10 мкг/мл сывороточного альбумина человека (Sigma-Aldrich, Steinheim, Германия) и 10 мкг/мл дрожжевой РНК (Ambion, Austin, США) для предотвращения адсорбции партнеров по связыванию к поверхностям используемого изделия из пластмассы или матрицы для иммобилизации. Диапазон концентраций биотинилированного D-SDF-1 человека был установлен с 8 пМ до 100 нМ; общий объем реакции составлял 1 мл. Пептид и комплексы пептид-аптамер иммобилизовали на 1,5 мкл частиц Streptavidin Ultralink Plus (Pierce Biotechnology, Rockford, США), которые были предварительно уравновешены буфером для селекции и ресуспендированы в общем объеме, составляющем 6 мкл. Частицы сохраняли в суспензии в течение 30 мин при соответствующей температуре в термомиксере. Иммобилизованную радиоактивность количественно определяли в сцинтилляционном счетчике после отделения супернатанта и соответствующей промывки. Строили графики зависимости процента связывания от концентрации биотинилированного D-SDF-1 человека, и получали константы диссоциации, используя алгоритмы программного обеспечения (GRAFIT; Erithacus Software; Surrey Соединенное Королевство), исходя из 1:1 стехиометрии.

Анализ конкурентного связывания с использованием аффинной очистки

Для сравнения различных связывающихся с D-SDF-1 аптамеров был выполнен анализ оценки конкуренции. С этой целью имеющийся в наличии аптамер с наибольшим сродством был радиоактивно помечен (см. выше) и служил в качестве контроля. После де- и ренатурации его инкубировали при 37°C с биотинилированным D-SDF-1 человека в 1 мл буфера для селекции в условиях, которые приводили к приблизительно 5-10% связывания пептида после иммобилизации на агарозе NeutrAvidin или частицах Streptavidin Ultralink Plus (оба реагента от Pierce) и промывки, без конкуренции. Избыточное количество подвергнутых де- и ренатурации немеченых вариантов аптамеров - D-РНК добавляли к различным концентрациям пептида (например, 2, 10 и 50 нМ) с меченым контрольным аптамером в параллельных реакциях связывания. Исследуемые аптамеры конкурировали с контрольным аптамером за связывание с мишенью, уменьшая тем самым сигнал, обусловленный связыванием, в зависимости от их способностей к связыванию. Аптамер, который, как было установлено, является самым активным в этом анализе, мог затем служить в качестве нового контроля для сравнительного анализа дополнительных вариантов аптамеров.

Пример 4: Анализ связывания с помощью измерения с использованием поверхностного плазмонного резонанса

Для анализа связывания шпигельмеров с SDF-1α человека использовали инструментальное средство Biacore 2000 (Biacore AB, Uppsala, Швеция). В случае, когда связывание SDF-1α человека должно было достигаться через аминогруппы, SDF-1α человека подвергали диализу против воды в течение 1-2 ч (с использованием смешанных эфиров целлюлозы Millipore VSWP; размер пор, 0,025 мкМ) для удаления интерферирующих аминов. Перед связыванием белка сенсорные чипы CM4 (Biacore AB, Uppsala, Швеция) активировали с помощью инъекции 35 мкл 1:1 разведения 0,4 M NHS и 0,1 M EDC со скоростью, составляющей 5 мкл/мин. MCP-1 человека или SDF-1α человека затем инъецировали в концентрациях, составляющих 0,1-1,5 мкг/мл, со скоростью 2 мкл/мин до достижения показания инструментального средства в диапазоне 1000-2000 RU (относительных единиц). Не прореагировавшие эфиры NHS дезактивировали посредством инъекции 35 мкл раствора этаноламина гидрохлорида (pH 8,5) со скоростью, составляющей 5 мкл/мин. В сенсорный чип инъецировали дважды буфер для связывания, и его уравновешивали при скорости 10 мкл/мин в течение 1-2 часов до установки стабильной базовой линии. В случае всех белков кинетические параметры и константы диссоциации определяли с помощью ряда инъекций шпигельмеров в концентрациях, составляющих 1000, 500, 250, 125, 62,5, 31,25, и 0 нМ, в буфере для селекции (20 мМ Трис-HCl; 137 мМ NaCl; 5 мМ KCl; 1 мМ CaCl2; 1 мМ MgCl2, 0,1% [в отношении веса к объему] Tween20, pH 7,4). Во всех экспериментах анализ проводили при 37°C, используя команду Kinject, определяющую время ассоциации = 180 и время диссоциации = 360 секундам при скорости = 10 мкл/мин. Анализ данных и расчет констант диссоциации (KD) был сделан с использованием программного обеспечения BIAevaluation 3.0 (BIACORE AB, Uppsala, Швеция), используя алгоритм подгонки к стехиометрическому соотношению 1:1 Лэнгмюра.

Пример 5: Анализ ингибирования SDF-1-индуцируемого хемотаксиса с помощью связывающихся с SDF-1 шпигельмеров

Линия клеток T-клеточного лейкоза человека Jurkat, линия клеток моноцитарной лимфомы человека U937, линия клеток пре-В-клеточного лейкоза человека BV-173 и линия клеток пре-B-клеточного ALL человека Nalm-6 экспрессируют CXCR4. В то время как клетки Jurkat не экспрессируют CXCR7, линии лейкозных клеток BV-173 и U-937 были, как установлено, положительными по экспрессии CXCR7. Все используемые клетки были получены от DSMZ (Braunschweig). Все линии клеток культивировали при 37°C и 5% CO2 в среде RPMI 1640 с Glutamax (Invitrogen, Karlsruhe, Германия), который содержит 10% фетальной телячьей сыворотки, 100 единиц/мл пенициллина и 100 мкг/мл стрептомицина (Invitrogen, Karlsruhe, Германия). За день до эксперимента клетки засевали в новый матрас T175 с плотностью = 0,3×106/мл (Jurkat, U937, BV-173) или 0,75×106/мл (Nalm-6), соответственно.

В случае этого эксперимента клетки центрифугировали (5 мин при 300×g), ресуспендировали, подсчитывали и промывали один раз 15 мл HBH (сбалансированного солевого раствора Хэнкса, содержащего 1 мг/мл бычьего сывороточного альбумина и 20 мМ HEPES; Invitrogen, Karlsruhe, Германия). Затем клетки ресуспендировали в концентрации 1,33×106/мл (Jurkat, U937, BV-173) или 2,67×106/мл (Nalm-6), соответственно. Затем клеткам предоставляли возможность мигрировать через пористые мембраны планшетов с фильтрами в течение трех часов в направлении раствора, содержащего SDF-1 и различные количества шпигельмера. Растворы для стимуляции (SDF-1 + различные концентрации шпигельмера) были составлены в виде 10X растворов в 0,2-мл низкопрофильном 96-камерном планшете. 212 мкл HBH пипетировали в нижние отсеки планшета для перемещения, и добавляли 23,5 мкл растворов для стимуляции. Все условия составляли в трех повторах. Через 20-30 мин планшет с фильтрами вставляли в планшет, содержащий растворы для стимуляции, и 75 мкл суспензии клеток с концентрацией = 1,33×106/мл или 2,67×106/мл, соответственно, добавляли в лунки планшета с фильтрами (1×105 или 2×105 клеток/лунку). Затем клеткам предоставляли возможность мигрировать в течение 3 ч при 37°C. Для калибровки 0, 10 и 30 мкл суспензии клеток добавляли к 235, 225 и 205 мкл HBH, соответственно, в лунки отдельного 96-луночного планшета. После инкубации в течение 3 часов планшет для вставки удаляли, и добавляли 30 мкл рабочего раствора резазурина (440 мкМ в PBS) в нижние лунки и в лунки планшета для калибровки. Планшеты затем инкубировали при 37°C в течение 2,5 ч. После инкубации 100 мкл из каждой лунки переносили в черный 96-луночный планшет.

Для оценки в значения флуоресценции вносили поправку на фоновую флуоресценцию (без клеток в лунке). Затем рассчитывали разницу между экспериментальными условиями с использованием SDF-1 или без него. Значение для образца без шпигельмера (только SDF-1) принимали за 100%, а значения для образцов с шпигельмером рассчитывали как процент от него. Для получения кривых доза-ответ строили графики зависимости значений в процентах от концентрации шпигельмера, и исходя из результирующего графика определяли графически значение IC50 (концентрацию шпигельмера, при которой присутствует 50% активности от таковой без шпигельмера).

Результаты

Установлено, что SDF-1 человека стимулирует миграцию клеток Jurkat дозозависимым образом, с полумаксимальной стимуляцией при приблизительно 0,3 нМ.

Установлено, что SDF-1 человека стимулирует миграцию клеток линии клеток моноцитарной лимфомы человека U937 дозозависимым образом, с полумаксимальной стимуляцией при приблизительно 3 нМ.

Установлено, что SDF-1 человека стимулирует миграцию клеток линии клеток пре-B-клеточного лейкоза человека BV-173 дозозависимым образом, с полумаксимальной стимуляцией при приблизительно 3 нМ.

Установлено, что SDF-1 человека стимулирует миграцию клеток линии клеток пре-B-клеточного ALL человека Nalm-6 дозозависимым образом, с полумаксимальной стимуляцией при 0,3 нМ.

Когда клеткам предоставляли возможность мигрировать в направлении раствора, содержащего SDF-1 человека плюс увеличивающиеся концентрации связывающихся с SDF-1 шпигельмеров, наблюдалось ингибирование в зависимости от дозы. Соответствующие IC50 исследуемых шпигельмеров, определенных в примере 1, определяли в клетках Jurkat линии клеток Т-клеточного лейкоза человека. Например, в случае связывающегося с SDF-1 шпигельмера NOX-A12 (также называемого 193-G2-012-5'-ПЭГ) была определена IC50, составляющая 0,2 нМ (фиг. 10). В случае использования неспецифического контрольного шпигельмера вместо связывающегося с SDF-1 шпигельмеры ингибиторный эффект не отмечался вплоть до 1 мкМ.

Ингибирование SDF-1-индуцируемого хемотаксиса с помощью связывающегося с SDF-1 шпигельмера NOX-A12 также отмечали в трех других различных типах лейкозных клеток: линии клеток моноцитарной лимфомы человека U937 (фиг. 11B), линии клеток пре-B-клеточного лейкоза человека BV-173 (фиг. 12) и линии клеток пре-B-клеточного ALL человека Nalm-6 (фиг. 11A). Кроме того, авторы настоящего изобретения имеют данные, что эмбриональные клетки хронического лимфолейкоза мигрируют в направлении SDF-1, и что SDF-1-зависимый хемотаксис эффективно блокируется с помощью NOX-A12.

Линии лейкозных клеток BV-173 и U-937 были, как установлено, положительными также по экспрессии CXCR7. Была определена эффективность связывающегося с SDF шпигельмера NOX-A12 в блокировании взаимодействия SDF-1 и CXCR7, как продемонстрировано в примере 6.

Пример 6: Ингибирование активации CXCR7 с помощью связывающего с SDF-1 шпигельмера NOX-A12

Помимо CXCR4, SDF-1 также связывается с рецептором для хемокина CXCR7. Ингибиторный потенциал связывающегося с SDF-1 шпигельмера NOX-A12 по отношению к CXCR7 исследовали в анализе комплементации с использованием клеток CHO, стабильно экспрессирующих CXCR7 и β-аррестин, оба слитые с фрагментом β-галактозидазы (анализ β-аррестина PathHunterTM, DiscoveRX, CA, США). После связывания с SDF-1 β-аррестин образовывал комплекс с CXCR7 и, таким образом, приводил к комплементации и активации β-галактозидазы, которую определяли с использованием хемилюминесцентного субстрата.

Способ

Экспрессирующие CXCR7 и β-аррестин клетки человека PathHunter eXpress CHO-K1 засевали на 48 часов в среду OCC2 и стимулировали с помощью 10 нМ SDF-1 и различных концентраций связывающего с SDF-1 шпигельмера NOX-A12 в течение 90 минут. После стимуляции выявляли сигнал, используя набор для выявления PathHUnter и рекомендуемый производителем протокол (DiscoveRX, CA, США).

Результаты

Связывающийся с SDF-1 шпигельмер NOX-A12 эффективно блокировал стимуляцию β-галактозидазы и, следовательно, активацию CXCR7 с помощью 10 нМ SDF-1 человека с IC50, составляющей 5,4 нМ (фиг. 13).

Пример 7: Функциональный анализ связывающегося с SDF-1 человека шпигельмер 193-G2-012-5'-ПЭГ в анализе спраутинга с использованием аортальных колец

Для проверки того, является ли связывающийся с SDF-1 шпигельмер 193-G2-012-5'-ПЭГ также функциональным в стандартом анализе ангиогенеза с использованием органной культуры, были выполнены анализы спраутинга с использованием аортальных колец. Этот анализ, в котором определяется длина и численность сосудоподобных частей, выступающих из эксплантов, стал наиболее широко используемой моделью ангиогенеза с использованием органной культуры (Auerbach et al., 2003). Уже было установлено, что SDF-1 индуцирует спраутинг в этом типе анализа (Salcedo et al., 1999).

Аорты крыс разрезали на кольца, внедряли в коллагеновую матрицу и инкубировали с SDF-1 и SDF-1 плюс связывающийся с SDF-1 человека шпигельмер 193-G2-012-5'-ПЭГ или SDF плюс нефункциональный, подвергнутый ПЭГилированию, контрольный шпигельмер, который не связывается с SDF-1. Через 6-7 дней спраутинг (т.е. выпячивание эндотелиальных клеток) исследовали посредством фотографирования и определения индекса спраутинга.

Способ

Аорты самцов крыс получали от Bagheri Life Sciences (Berlin, Германия). Аорты были свежеполученными, и их транспортировали на льду в среде MCDB 131 (Invitrogen, Karlsruhe, Германия), содержащей 50 единиц/мл пенициллина, 50 мкг/мл стрептомицина (оба от Invitrogen, Karlsruhe, Германия) и 2,5 мкг/мл фунгизона (Cambrex, США).

В случае этого эксперимента одну аорту переносили в чашку для культивирования клеток вместе со средой, и удаляли остаточную соединительную ткань. Затем аорты разрезали скальпелем на кольца толщиной 1-2 мм. Кольца тщательно промывали (по крайней мере пять раз) в Medium 199 (Invitrogen, Karlsruhe, Германия), а затем помещали в лунки 24-луночного планшета, содержащие 450 мкл раствора коллагена в каждой лунке. Этот раствор коллагена готовили смешиванием 9 мл коллагена хвоста крысы (3 мг/мл в 0,1% уксусной кислоте; Sigma, Deisenhofen, Германия) с 1,12 мл 10X Medium 199 (Invitrogen, Karlsruhe, Германия), 1,12 мл 10X буфера для коллагена (0,05 н NaOH, 200 мМ HEPES, 260 мМ NaHCO3) и 0,6 мл 200 мМ глютамина. Кольца ориентировали так, чтобы обрезные кромки были перпендикулярны дну лунки. Коллаген делал возможным твердение при инкубации планшетов в течение по крайней мере одного часа при 37°C. Впоследствии в лунку добавляли 1 мл среды MCDB 131 вместе с добавками (SDF-1 и шпигельмерами). Затем кольца инкубировали при 37°C в течение шести-семи дней. В качестве контроля для спраутинга были выполнены, кроме того, эксперименты с использованием VEGF (фактора роста сосудистого эндотелия).

Спраутинг документировали фотографированием с использованием цифрового фотоаппарата. В некоторых случаях кольца фиксировали посредством добавления 1 мл 10% параформальдегида и хранили при 2-8°C для дальнейшей документации. Фотографии анализировали с использованием программного обеспечения для обработки изображений Scion Image. После калибровки с помощью фотографии многоступенчатого микрометра проводили линию на расстояние 0,33 мм от одной кромки кольца. Графическую гистограмму вдоль этой линии создавали с помощью программного обеспечения, гистограммы распечатывали, и подсчитывали пики (представляющие отростки, пересекающие линию). Это число принимали за индекс спраутинга. Оценивали 4-5 колец в случае каждого условия. Статистический анализ выполняли с использованием WinSTAT для Excel.

Результаты

Смогли установить, что SDF-1 индуцирует спраутинг, и что этот эффект можно блокировать с помощью связывающегося с SDF-1 человека шпигельмера 193-G2-012-5'-ПЭГ. Блокировка SDF-1 индуцируемого спраутинга с помощью нефункционального, подвергнутого ПЭГилированию, контрольного шпигельмера не отмечалась (фиг. 14 и 15).

Пример 8: Эффект связывающегося с SDF-1 шпигельмера NOX-A12 на химиосенсибилизацию лейкозных клеток

Существуют заслуживающие внимания данные, что лейкозные клетки могут быть защищены от традиционных терапий в результате взаимодействия их рецепторов CXCR4 с SDF-1, секретируемым стромальными клетками, в особых тканевых микроокружениях, таких как ниши в костном мозге (сокр. КМ). Поэтому воздействие на осевую линию CXCR4-SDF-1 посредством использования связывающегося с SDF-1 шпигельмера NOX-A12 является привлекательным подходом для разрушения протективных эффектов секретирующих SDF-1 стромальных клеток и для сенсибилизации лейкозных клеток к последующей химиотерапии.

Для имитирования in vivo взаимодействия микроокружения КМ с лейкозными клетками была создана in vitro система сокультивирования стромальных клеток КМ мыши MS-5 и линии клеток множественной миеломы (сокр. MM) RPMI 8226. Целью эксперимента была установка того, сенсибилизирует ли связывающийся с SDF-1 шпигельмер NOX-A12 клетки MM в сокультуре со стромальными клетками к действиям химиотерапевтических средств. Стромальные клетки MS-5, секретирующие SDF-1, инкубировали со связывающимся с SDF-1 шпигельмером NOX-A12 или нефункциональным revNOX-A12. Линию клеток MM RPMI-8226 добавляли к конфлюэнтному слою стромальных клеток. Затем клетки инкубировали с химиотерапевтическим средством F-ara-A (Флударабином) в течение 40 часов. Определяли жизнеспособность клеток.

Способ

Линию стромальных клеток мыши MS-5 (ACC 441) приобретали у DSMZ, линию клеток множественной миеломы RPMI8226 (CCL-155) приобретали у ATCC. Линию клеток множественной миеломы RPMI8226 поддерживали в среде RPMI 1640 GlutaMAX (Invitrogen), дополненной 10% FBS (Biochrom) и пенициллином-стрептомицином, клетки MS-5 культивировали в MEM alpha GlutaMAX (Invitrogen) с 10% FBS и пенициллином-стрептомицином. Для экспериментов по химиосенсибилизации с использованием сокультуры стромальные клетки MS-5 высевали за день до экспериментов в 24-луночные планшеты (с восемью внутренними лунками) в концентрации, составляющей 8×104/мл/лунку, в среде MEM alpha GlutaMAX (+10% FBS) и инкубировали при 37°C в 5% CO2. Конфлюэнтный слой стромальных клеток промывали, и в лунки добавляли 0,5 мл среды RPMI 1640 (+1% FBS). Впоследствии в лунки добавляли связывающийся с SDF-1 шпигельмер NOX-A12 или revNOX-A12 до конечной концентрации, составляющей 100 нМ, и инкубировали в течение четырех часов. 3,5×105 клеток RPMI8226 в среде RPMI 1640 (+1% FBS) добавляли к слою стромальных клеток. Спустя четыре часа добавляли 1 мкМ F-ara-A (Sigma Aldrich) к клеткам во время инкубации. После инкубации в течение 40 часов клетки собирали в 15-мл пробирки, сначала собирали супернатант, а затем прикрепленные клетки, включая клетки MS-5, подвергали трипсинизации. Собранные клетки дважды промывали PBS (+1% BSA) и ресуспендировали в 2 мл PBS (+1% BSA). 150 мкл суспензии клеток переносили в планшет с 96-лунками с дном в u-форме, а затем инкубировали с 50 мкл реагента ViaCount (Millipore) в течение 15 минут при комнатной температуре. Жизнеспособность клеток и количество клеток определяли с помощью проточной цитометрии, используя Guava EasyCyte 6HT/2L (Millipore).

Результаты

На жизнеспособность клеток RPMI-8226, сокультивируемых со стромальными клетками MS-5, оказывал лишь незначительное влияние связывающийся с SDF-1 шпигельмер NOX A12. 1 мкМ F-ara-A не оказывал значительный эффект на жизнеспособность клеток RPMI-8226. Однако, когда NOX-A12 и F-ara-A объединяли, отмечалось синергетическое уменьшение жизнеспособности клеток (фиг. 16). Таким образом, было установлено, что связывающийся с SDF-1 шпигельмер NOX-A12 сенсибилизирует линию клеток MM RPMI-8226 к лечению химиотерапевтическим средством F-ara-A при сокультивировании с линией клеток КМ MS-5. На жизнеспособность стромальных клеток MS-5 не оказывает влияние ни F-ara-A, ни NOX-A12 (нет представленных данных). Эти результаты служат доказательством принципа, состоящего в способности NOX A12 к разрушению протективных эффектов SDF-1, секретируемого стромальными клетками КМ.

Пример 9: Эффект связывающегося с SDF-1 шпигельмера NOX-A12 на пролиферацию лейкозных клеток

Целью эксперимента была установка того, оказывает ли связывающийся с SDF-1 шпигельмер NOX-A12 влияние на пролиферацию лейкозных клеток в сокультуре со стромальными клетками костного мозга (сокр. КМ). Мышиные стромальные клетки MS-5, секретирующие SDF-1, инкубировали со связывающимся с SDF-1 шпигельмером NOX-A12 или нефункциональным шпигельмером revNOX-A12. Линию клеток T-клеточного лейкоза Jurkat добавляли к конфлюэнтному слою стромальных клеток и инкубировали в течение 40 часов при 37°C и 5% CO2. Количество клеток определяли с помощью проточной цитометрии, используя Guava EasyCyte и реагент ViaCount.

Способ

Линию стромальных клеток мыши MS-5 (ACC 441) приобретали у DSMZ и культивировали в MEM alpha GlutaMAX (Invitrogen) с 10% FBS и пенициллином-стрептомицином. Для экспериментов по пролиферации с использованием сокультивирования стромальные клетки MS-5 высевали за день до экспериментов в 24-луночные планшеты (с восьмью внутренними лунками) в концентрации, составляющей 8×104/мл/лунку, в среде MEM alpha GlutaMAX (+10% FBS) и инкубировали при 37°C в 5% CO2. Конфлюэнтный слой стромальных клеток промывали, и в лунки добавляли 0,5 мл среды RPMI 1640 (+1% FBS). Впоследствии в лунки добавляли связывающийся с SDF-1 шпигельмер NOX-A12 или шпигельмер revNOX-A12 до конечной концентрации, составляющей 100 нМ, и инкубировали в течение четырех часов. 2×105 клеток Jurkat (из ~ логарифмической фазы роста; промытых один раз) в среде RPMI 1640 (+1% FBS) добавляли к конфлюэнтному слою стромальных клеток и инкубировали в течение 48 часов при 37°C в 5% CO2. Затем клетки собирали в 15-мл пробирки, прикрепленные клетки, включая клетки MS-5, подвергали трипсинизации. Собранные клетки дважды промывали PBS (+1% BSA). 150 мкл этой суспензии клеток переносили в планшет с 96-лунками с дном в u-форме, а затем инкубировали с 50 мкл реагента ViaCount (Millipore) в течение 15 минут при комнатной температуре. Жизнеспособность клеток и количество клеток определяли с помощью проточной цитометрии, используя Guava EasyCyte 6HT/2L.

Результаты

В то время как 1 нМ связывающегося с SDF-1 шпигельмера NOX-A12 не оказывал эффект на количество клеток Jurkat после культивирования в течение 40 часов, количество клеток уменьшалось вплоть до 20%, когда стромальные клетки MS-5 предварительно инкубировали с 10 или 100 нМ связывающегося с SDF-1 шпигельмера NOX-A12 (фиг. 17). Таким образом, SDF-1, секретируемый стромальными клетками, очевидно, стимулирует пролиферацию клеток Jurkat. Зависимую от SDF-1 индукцию пролиферации можно блокировать с помощью связывающегося с SDF-1 шпигельмера NOX-A12, что приводит к выявлению меньшего количества лейкозных клеток.

Пример 10: Эффект связывающегося с SDF-1 шпигельмера NOX-A12 на адгезионные свойства лейкозных клеток

Взаимодействие лейкозных клеток с белками экстраклеточного матрикса (сокр. ECM) играет важную роль в патогенезе лейкоза. Поэтому авторы настоящего изобретения проверили эффект связывающегося с SDF-1 шпигельмера NOX-A12 на адгезию лейкозных клеток к фибронектину - белку ECM. Стимуляция линии клеток Т-клеточного лейкоза Jurkat с помощью SDF-1 приводила к модуляции в зависимости от дозы адгезии к фибронектину.

Способы

Клетки T-клеточного лейкоза Jurkat (ACC 282) приобретали у DSMZ и поддерживали в среде RPMI 1640 GlutaMAX (Invitrogen), дополненной 10% FBS (Biochrom) и пенициллином-стрептомицином. Для экспериментов по адгезии 96-луночные планшеты для культивирования инкубировали со 10 мкг/мл фибронектина человека (R&D systems) в PBS в течение 2 часов при 37°C. Планшеты дважды промывали 100 мкл PBS и впоследствии блокировали с использованием PBS-BSA (0,1%) в течение двух часов при 37°C. Затем клетки промывали средой RPMI. Клетки Jurkat из логарифмической фазы роста промывали средой RPMI (+0,1% BSA) и инкубировали с различными концентрациями SDF-1 человека (R&D systems) и NOX-A12 в течение 15 минут при 37°C. NOX-A12 и SDF-1 предварительно инкубировали в течение 30 минут. 1×105 подвергнутых стимуляции клеток Jurkat засевали в покрытые фибронектином 96-луночные планшеты и инкубировали в течение 30 минут. Затем планшеты промывали пять раз средой RPMI. Количество прикрепленных клеток определяли, используя реагент Cell Titer Glo (Promega). Для этого 50 мкл среды RPMI добавляли в каждую лунку, а затем 50 мкл реагента Cell Titer Glo. Планшеты перемешивали в течение двух минут с последующей инкубацией при комнатной температуре в течение 10 минут. Количество клеток определяли по относительному люминесцентному сигналу.

Результаты

Низкие-средние концентрации SDF-1 (1-10 нМ) уменьшали адгезию клеток Jurkat к фибронектину, в то время как более высокие концентрации (30-300 нМ) увеличивали адгезионные свойства клеток Jurkat (фиг. 18A). Было установлено, что связывающийся с SDF-1 шпигельмер NOX-A12 аннулирует этот эффект, а контрольный шпигельмер revNOX-A12 нет (фиг. 18B). Следовательно, связывающийся с SDF-1 шпигельмер NOX-A12, возможно, оказывает влияние на нарушение взаимодействий лейкозных клеток с протективным для них ECM окружением. Кроме того, этот эксперимент, возможно, объясняет зависимое от связывающегося с SDF-1 шпигельмера NOX-A12 отсоединение гемопоэтических клеток от ниши в костном мозге и их мобилизацию.

Пример 11: Нарушение взаимодействия клеток множественной миеломы со средой костного мозга in vivo, увеличивающее тем самым чувствительность клеток множественной миеломы к терапии.

Осевая линия SDF-1/CXCR4 играет основную роль в хоуминге и перемещении клеток множественной миеломы (сокр. MM) в костном мозге (в костный мозг). Поэтому дезадгезия клеток MM от окружающей ниши в КМ благодаря ингибированию SDF-1 увеличивает чувствительность MM к химиотерапевтическим средствам. Azab и др. Опубликовали протокол для проверки эффективности ингибитора CXCR4 AMD3100 в нарушении взаимодействия клеток MM с окружением в КМ in vivo, которое оказывает влияние на локализацию клеток MM, которая в свою очередь увеличивает чувствительность клеток MM к химиотерапии. Исследователи сообщили, что блокирование рецептора для SDF-1 CXCR4 с помощью специфического для CXCR4 антагониста приводит к нарушению взаимодействия клеток MM с окружением в КМ in vivo, к увеличению чувствительности клеток MM к терапии и в результате к увеличению уменьшения опухоли, индуцированного бортезомибом (Azab et al., 2009). Основываясь на этом протоколе (Azab et al., 2009), исследуется эффективность связывающегося с SDF-1 шпигельмера NOX-A12 в нарушении взаимодействия клеток MM с окружением в КМ in vivo, увеличивающим тем самым чувствительность клеток MM к терапии.

Для создания модели MM на животном используются мыши с тяжелым комбинированным иммунодефицитом (SCID), в соответствии с чем Luc+/GFP+ MM.1S клетки (2×106/мышь) вводят в хвостовую вену мышей с SCID. Через 3-4 недели достаточное прогрессирование опухоли выявляется с помощью получения биолюминесцентного изображения (протокол, см. Azab et al., 2009). Мышей случайным образом делили на 4 группы: группу 1, контрольные мыши (которым вводили носитель: 5% глюкозу); группу 2, мыши, подвергаемые лечению через день с помощью подкожной инъекции 20 мг/кг NOX-A12; группу 3, мыши, подвергаемые лечению с помощью внутрибрюшинной инъекции бортезомиба в дозе 0,5 мг/кг два раза в неделю; группу 4, мыши, подвергаемые лечению с помощью внутрибрюшинной инъекции бортезомиба в дозе 0,5 мг/кг два раза в неделю и с помощью подкожной инъекции через день 20 мг/кг NOX-A12.

Локализацию опухолевых клеток MM в костном мозге определяли с помощью in vivo конфокальной микроскопии, используя флуоресцентно меченное антитело против SDF (протокол, см. Azab et al., 2009), в соответствии с чем введение NOX-A12 приводит к мобилизации клеток MM из костного мозга в кровь (что определяется с помощью ex vivo проточной цитометрии; протокол, см. Azab et al., 2009) и к уменьшению роста опухоли при введении вместе с бортезомибом (что определяется с помощью in vivo выявления биолюминесценции; протокол, см. Mitsiades et al., 2003; Mitsiades et al.2004). Более сильные эффекты на рост опухоли бортезомиба плюс NOX-A12 по сравнению с лечением только бортезомибом подкрепляют данные примера 8, в котором демонстрируются положительные эффекты NOX-12 на химиосенсибилизацию клеток MM.

Использованная литература

Полные библиографические данные приведенных здесь документов являются следующими, кроме особо оговоренных случаев, в соответствии с чем раскрытие каждого из указанных ссылочных документов включено сюда посредством ссылки.

Alsayed Y., Ngo H., et al., (2007) Mechanisms of regulation of CXCR4/SDF-1 (CXCL12)-dependent migration and homing in multiple myeloma. Blood 109(7): 2708-17.

Altschul S.F., Gish W., et al., (1990) Basic local alignment search tool. J Mol Biol. 215(3):403-10.

Altschul S.F., Madden T.L., et al., (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25(17):3389-402.

Arya S.K., Ginsberg C.C., et al., (1999) In vitro phenotype of SDF1 gene mutant that delays the onset of human immunodeficiency virus disease in vivo. J Hum Virol 2(3): 133-8.

Auerbach R., Lewis R., et al., (2003) Angiogenesis assays: a critical overview. Clin Chem. 49(1):32-40. Review.

Azab A.K., Runnels J.M., et al., (2009) CXCR4 inhibitor AMD3100 disrupts the interaction of multiple myeloma cells with the bone marrow microenvironment and enhances their sensitivity to therapy. Blood. 113(18):4341-51.

Batchelor T.T., Sorensen A.G., et al., (2007) AZD2171, a pan-VEGF receptor tyrosine kinase inhibitor, normalizes tumor vasculature and alleviates edema in glioblastoma patients. Cancer Cell. 11(1):83-95.

Balabanian K., Lagane B., et al., (2005) The chemokine SDF-1/CXCL12 binds to and signals through the orphan receptor RDC1 in T lymphocytes. J Biol Chem 280(42): 35760-35766.

Balabanian, K., Lagane B., et al., (2005) WHIM syndromes with different genetic anomalies are accounted for by impaired CXCR4 desensitization to CXCL12. Blood 105(6): 2449-57.

Balkwill F. (2004) Cancer and the chemokine network. Nat Rev Cancer 4(7): 540-50.

Brooks H.L. Jr., Caballero S. Jr., et al., (2004) Vitreous levels of vascular endothelial growth factor and stromal-derived factor 1 in patients with diabetic retinopathy and cystoid macular edema before and after intraocular injection of triamcinolone. Arch Ophthalmol 122(12): 1801-7.

Broxmeyer H.E., Orschell C.M., (2005) Rapid mobilization of murine and human hematopoietic stem and progenitor cells with AMD3100, a CXCR4 antagonist. J Exp Med. 201(8):1307-18.

Buckley C.D., Amft N., et al., (2000) Persistent induction of the chemokine receptor CXCR4 by TGF-beta 1 on synovial T cells contributes to their accumulation within the rheumatoid synovium. J Immunol 165(6): 3423-9.

Burger J.A., Bürkle A, et al., (2007) The CXCR4 chemokine receptor in acute and chronic leukaemia: a marrow homing receptor and potential therapeutic target. Br J Haematol. 137(4):288-96.

Burger J.A., Ghia P., et al., (2009) The microenvironment in mature B-cell malignancies: a target for new treatment strategies. Blood. 114(16):3367-75. Review

Burger J.A., Kipps T.J. et al., (2002) Chemokine receptors and stromal cells in the homing and homeostasis of chronic lymphocytic leukemia B cells. Leuk Lymphoma. 43(3):461-6.

Burger J.A. and Peled A. (2009) CXCR4 antagonists: targeting the microenvironment in leukemia and other cancers. Leukemia 23(1): 43-52.

Burger J.A., Tsukada N., et al., (2000) Blood-derived nurse-like cells protect chronic lymphocytic leukemia B cells from spontaneous apoptosis through stromal cell-derived factor-1. Blood. 96(8):2655-63.

Burns J.M., Summers B.C., et al., (2006) A novel chemokine receptor for SDF-1 and I-TAC involved in cell survival, cell adhesion, and tumor development. J Exp Med 203(9): 2201-2213.

Butler J.M., Guthrie S.M., et al., (2005) SDF-1 is both necessary and sufficient to promote proliferative retinopathy. J Clin Invest 115(1): 86-93.

Cabioglu, N., Sahin A., et al., (2005) Chemokine receptor CXCR4 expression in breast cancer as a potential predictive marker of isolated tumor cells in bone marrow. Clin Exp Metastasis 22(1): 39-46.

Ceradini D.J., Kulkarni A.R., et al., (2004) Progenitor cell trafficking is regulated by hypoxic gradients through HIF-1 induction of SDF-1. Nat Med.10(8):858-64.

Corcione A., Ottonello L., et al., (2000) Stromal cell-derived factor-1 as a chemoattractant for follicular center lymphoma B cells. J Natl Cancer Inst 92(8): 628-35.

Damha M.J., Ogilvie K.K., et al., (1993) Oligoribonucleotide synthesis. The silyl-phosphoramidite method. Methods Mol Biol. 20:81-114.

Damiano J.S., Cress A.E., et al., (1999) Cell adhesion mediated drug resistance (CAM-DR): role of integrins and resistance to apoptosis in human myeloma cell lines. Blood. 93(5):1658-67.

Devine S.M., Flomenberg N., et al., (2004) Rapid mobilization of CD34+ cells following administration of the CXCR4 antagonist AMD3100 to patients with multiple myeloma and non-Hodgkin's lymphoma. J Clin Oncol. 22(6):1095-102.

Dillmann F., Veldwijk M.R., et al., (2009) Plerixafor inhibits chemotaxis toward SDF-1 and CXCR4-mediated stroma contact in a dose-dependent manner resulting in increased susceptibility of BCR-ABL+ cell to Imatinib and Nilotinib. Leuk Lymphoma. 50(10):16.

Ehtesham M., Stevenson C.B., et al., (2008) Preferential expression of chemokine receptor CXCR4 by highly malignant human gliomas and its association with poor patient survival. Neurosurgery. 63(4):E820.

Engl T., Relja B., et al., (2006) CXCR4 chemokine receptor mediates prostate tumor cell adhesion through alpha5 and beta3 integrins. Neoplasia. 8(4):290-301.

Fedyk E.R., Jones D., et al., (2001) Expression of stromal-derived factor-1 is decreased by IL-1 and TNF and in dermal wound healing. J Immunol. 166(9):5749-54.

Geminder H., Sagi-Assif O., et al., (2001) A possible role for CXCR4 and its ligand, the CXC chemokine stromal cell-derived factor-1, in the development of bone marrow metastases in neuroblastoma. J Immunol 167(8): 4747-57.

Grassi F., Cristino S., et al., (2004) CXCL12 chemokine up-regulates bone resorption and MMP-9 release by human osteoclasts: CXCL12 levels are increased in synovial and bone tissue of rheumatoid arthritis patients. J Cell Physiol 199(2): 244-51.

Grunewald M., Avraham I., et al., (2006) VEGF-induced adult neovascularization: recruitment, retention, and role of accessory cells. Cell 124(1): 175-89.

Gulino, A.V., Moratto D., et al., (2004) Altered leukocyte response to CXCL12 in patients with warts hypogammaglobulinemia, infections, myelokathexis (WHIM) syndrome. Blood 104(2): 444-52.

Holm N.T., Abreo F., et al., (2009) Elevated chemokine receptor CXCR4 expression in primary tumors following neoadjuvant chemotherapy predicts poor outcomes for patients with locally advanced breast cancer (LABC). Breast Cancer Res Treat. 113(2):293-9. Epub 2008 Feb 13.

Hwang J.H., Chung H.K., et al., (2003) CXC chemokine receptor 4 expression and function in human anaplastic thyroid cancer cells. J Clin Endocrinol Metab 88(1): 408-16.

Jin L., Tabe Y., et al., (2008) CXCR4 up-regulation by imatinib induces chronic myelogenous leukemia (CML) cell migration to bone marrow stroma and promotes survival of quiescent CML cells. Mol Cancer Ther 7(1): 48-58.

Kanbe K., Takagishi K., et al., (2002) Stimulation of matrix metalloprotease 3 release from human chondrocytes by the interaction of stromal cell-derived factor 1 and CXC chemokine receptor 4. Arthritis Rheum 46(1): 130-7.

Kawai T., Choi U., et al., (2005) Enhanced function with decreased inteРНКlization of carboxy-terminus truncated CXCR4 responsible for WHIM syndrome. Exp Hematol 33(4): 460-8.

Kioi M., Vogel H., et al., (2010) Inhibition of vasculogenesis, but not angiogenesis, prevents the recurrence of glioblastoma after irradiation in mice. J Clin Invest 120(3): 694-705.

Klussmann S. (2006). The Aptamer Handbook - Functional Oligonucleotides and their Applications. Edited by S. Klussmann. WILEY-VCH, Weinheim, Germany, ISBN 3-527-31059-2.

Koshiba T., Hosotani R., et al., (2000) Expression of stromal cell-derived factor 1 and CXCR4 ligand receptor system in pancreatic cancer: a possible role for tumor progression. Clin Cancer Res 6(9): 3530-5.

Kozin S.V., Kamoun W.S., et al., (2010) Recruitment of myeloid but not endothelial precursor cells facilitates tumor regrowth after local irradiation. Cancer Res 70(14): 5679-85.

Krumbholz M., Theil D., et al., (2006) Chemokines in multiple sclerosis: CXCL12 and CXCL13 up-regulation is differentially linked to CNS immune cell recruitment. Brain 129: 200-211.

Kryczek I., Lange A., et al., (2005) CXCL12 and vascular endothelial growth factor synergistically induce neoangiogenesis in human ovarian cancers. Cancer Res 65(2): 465-72.

Kurtova A.V., Balakrishnan K., et al., (2009) Diverse marrow stromal cells protect CLL cells from spontaneous and drug-induced apoptosis: development of a reliable and reproducible system to assess stromal cell adhesion-mediated drug resistance. Blood. 114(20):4441-50.

Kusser W. (2000) Chemically modified nucleic acid aptamers for in vitro selections: evolving evolution. J Biotechnol 74(1): 27-38.

Lagneaux L., Delforge A., et al., (1998) Chronic lymphocytic leukemic B cells but not normal B cells are rescued from apoptosis by contact with normal bone marrow stromal cells. Blood. 91(7):2387-96.

Li J.K., Yu L., et al., (2008) Inhibition of CXCR4 activity with AMD3100 decreases invasion of human colorectal cancer cells in vitro. World J Gastroenterol 14(15): 2308-2313.

Maksym R.B., Tarnowski M., et al., (2009) The role of stromal-derived factor-1--CXCR7 axis in development and cancer. Eur J Pharmacol. 625(1-3):31-40. Review.

Marechal V., Arenzana-Seisdedos F., et al., (1999) Opposite effects of SDF-1 on human immunodeficiency virus type 1 replication. J Virol 73(5): 3608-15.

McGinnis S., Madden T.L. et al., (2004) BLAST: at the core of a powerful and diverse set of Последовательность analysis tools. Nucleic Acids Res. 32(Web Server issue):W20-5.

Meads M.B., Hazlehurst L.A., et al., (2008) The bone marrow microenvironment as a tumor sanctuary and contributor to drug resistance. Clin Cancer Res. 14(9):2519-26. Review.

Meleth A.D., Agron E., et al., (2005) Serum inflammatory markers in diabetic retinopathy. Invest Ophthalmol Vis Sci 46(11): 4295-301.

Miao, Z., Luker K.E., et al., (2007) CXCR7 (RDC1) promotes breast and lung tumor growth in vivo and is expressed on tumor-associated vasculature. Proc Natl Acad Sci U S A 104(40): 15735-40.

Mitsiades C.S., Mitsiades N.S., et al., (2003) Fluorescence imaging of multiple myeloma cells in a clinically relevant SCID/NOD in vivo model: biologic and clinical implications. Cancer Res. 63(20):6689-96.

Mitsiades C.S., Mitsiades N., et al., (2004) Focus on multiple myeloma. Cancer Cell. 6(5):439-44. Review.

Mizell J., Smith M., et al., (2009) Overexpression of CXCR4 in primary tumor of patients with HER-2 negative breast cancer was predictive of a poor disease-free survival: a validation study. Ann Surg Oncol. 16(10):2711-6.

Muller, A., Homey B., et al., (2001) Involvement of chemokine receptors in breast cancer metastasis. Nature 410(6824): 50-6.

Murdoch, C. (2000) CXCR4: chemokine receptor extraordinaire. Immunol Rev 177: 175-84.

Needleman and Wunsch (1970) A general method applicable to the search for similarities in the amino acid Последовательность of two proteins. J Mol Biol. 48(3):443-53.

Nervi B., Ramirez P., et al., (2009) Chemosensitization of acute myeloid leukemia (AML) following mobilization by the CXCR4 antagonist AMD3100. Blood. 113(24):6206-14. Epub 2008 Dec 2.

Pearson and Lipman (1988) Improved tools for biological Последовательность comparison. Proc. Nat'l. Acad. Sci. USA 85: 2444.

Redjal N., Chan J.A., et al., (2006) CXCR4 inhibition synergizes with cytotoxic chemotherapy in gliomas. Clin Cancer Res. 12(22):6765-71.

Salcedo R., Wasserman K., et al., (1999) Vascular endothelial growth factor and basic fibroblast growth factor induce expression of CXCR4 on human endothelial cells: In vivo neovascularization induced by stromal-derived factor-1alpha. Am J Pathol 154(4): 1125-1135.

Salcedo, R. and Oppenheim J.J. (2003) Role of chemokines in angiogenesis: CXCL12/SDF-1 and CXCR4 interaction, a key regulator of endothelial cell responses. Microcirculation 10(3-4): 359-70.

Salvucci O., Yao L., et al., (2002) Regulation of endothelial cell branching morphogenesis by endogenous chemokine stromal-derived factor-1. Blood 99(8): 2703-11.

Saur D., Seidler B., et al., (2005) CXCR4 expression increases liver and lung metastasis in a mouse model of pancreatic cancer. Gastroenterology. 129(4):1237-50.

Schimanski C.C., Galle P.R., et al., (2008) Chemokine receptor CXCR4-prognostic factor for gastrointestinal tumors. World J Gastroenterol. 14(30):4721-4.

Scotton C.J., Wilson J.L., et al., (2002) Multiple actions of the chemokine CXCL12 on epithelial tumor cells in human ovarian cancer. Cancer Res. 62(20):5930-8.

Sengupta N., Caballero S., et al., (2005) Preventing stem cell incorporation into choroidal neovascularization by targeting homing and attachment factors. Invest Ophthalmol Vis Sci. 46(1):343-8.

Shaked Y., Henke E., et al., (2008) Rapid chemotherapy-induced acute endothelial progenitor cell mobilization: implications for antiangiogenic drugs as chemosensitizing agents. Cancer Cell. 14(3):263-73.

Shirozu M., Nakano T., et al., (1995) Structure and chromosomal localization of the human stromal cell-derived factor 1 (SDF1) gene. Genomics 28(3): 495-500.

Smith and Waterman (1981), Adv. Appl. Math. 2: 482.

Soriano A., Martinez C., et al., (2002) Plasma stromal cell-derived factor (SDF)-1 levels, SDF1-3'A genotype, and expression of CXCR4 on T lymphocytes: their impact on resistance to human immunodeficiency virus type 1 infection and its progression. J Infect Dis 186(7): 922-31.

Su L., Zhang J, et al., (2005) Differential expression of CXCR4 is associated with the metastatic potential of human non-small cell lung cancer cells. Clin Cancer Res. 11(23):8273-80.

Tseng D., Lartey F. et al., (2010) J.K., Yu L., et al., (2008) (MS108) Inhibition of SDF-1/CXCR7 radiosensitizes ENU induced glioblastomas in the rat. 56th Annual Meeting Radiation Research Society, September 25-29, 2010, Grand Wailea Resort Hotel and Spa, Maui, Hawaii, USA.

Venkatesan N., Kim S.J., et al., (2003) Novel phosphoramidite building blocks in synthesis and applications toward modified oligonucleotides. Curr Med Chem 10(19): 1973-91.

Wang J., Shiozawa Y., et al., (2008) The role of CXCR7/RDC1 as a chemokine receptor for CXCL12/SDF-1 in prostate cancer. J Biol Chem 283(7): 4283-4294. Epub 2007 Dec 5.

Wang J., Guan E., et al., (2001) Role of tyrosine phosphorylation in ligand-independent sequestration of CXCR4 in human primary monocytes-macrophages. J Biol Chem 276(52): 49236-43.

Wang N., Wu Q.L., et al., (2005) Expression of chemokine receptor CXCR4 in nasopharyngeal carcinoma: pattern of expression and correlation with clinical outcome. J Transl Med 3: 26.

Xu L., Duda D.G., et al., (2009) Direct evidence that bevacizumab, an anti-VEGF antibody, up-regulates SDF1alpha, CXCR4, CXCL6, and neuropilin 1 in tumors from patients with rectal cancer. Cancer Res. 69(20):7905-10.

Yamaguchi J., Kusano K.F., et al., (2003) Stromal cell-derived factor-1 effects on ex vivo expanded endothelial progenitor cell recruitment for ischemic neovascularization. Circulation 107(9): 1322-8.

Yang J., Zhang B. et al., (2008) Breast cancer metastasis suppressor 1 inhibits SDF-1alpha-induced migration of non-small cell lung cancer by decreasing CXCR4 expression. Cancer Lett 269(1):46-56.

Zagzag D., Esencay M., et al., (2008) Hypoxia- and vascular endothelial growth factor-induced stromal cell-derived factor-1alpha/CXCR4 expression in glioblastomas: one plausible explanation of Scherer's structures. Am J Pathol 173(2): 545-560.

Zeelenberg I.S., Ruuls-Van Stalle L., et al., (2003) The chemokine receptor CXCR4 is required for outgrowth of colon carcinoma micrometastases. Cancer Res. 63(13):3833-9.

Zheng K., Li H.Y., et al., (2010) Chemokine receptor CXCR7 regulates the invasion, angiogenesis and tumor growth of human hepatocellular carcinoma cells. J Exp Clin Cancer Res. 29:31.

Zhou Y., Larsen P.H., et al., (2002) CXCR4 is a major chemokine receptor on glioma cells and mediates their survival. J Biol Chem 277(51): 49481-7.

Zhu A.X., Sahani D.V., et al., (2009) Efficacy, safety, and potential biomarkers of sunitinib monotherapy in advanced hepatocellular carcinoma: a phase II study. J Clin Oncol 27(18): 3027-35.

Признаки настоящего изобретения, раскрытые в описании настоящего изобретения, формуле изобретения и/или чертежах, могут быть как по отдельности, так и в их комбинации материалом для осуществления настоящего изобретения в различных его формах.

1. Применение молекулы нуклеиновой кислоты, способной к связыванию с SDF-1 и блокированию взаимодействия между SDF-1 и рецептором SDF-1 CXCR7, для лечения или предупреждения заболевания или нарушения, для применения в способе лечения субъекта, страдающего заболеванием или нарушением или подверженного риску развития заболевания или нарушения, в качестве вспомогательной терапии или для применения в качестве лекарственного средства для лечения или предупреждения заболевания или нарушения, где заболеванием или нарушением является рак, экспрессирующий рецептор SDF-1 CXCR7,

где молекула нуклеиновой кислоты содержит в направлении 5'→3' первый концевой участок нуклеотидов, центральный участок нуклеотидов и второй концевой участок нуклеотидов, или второй концевой участок нуклеотидов, центральный участок нуклеотидов и первый концевой участок нуклеотидов,

где молекулу нуклеиновой кислоты выбирают из группы, включающей связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа B, связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа C, связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа A и связывающуюся с SDF-1 молекулу нуклеиновой кислоты типа D;

где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает следующую нуклеотидную последовательность:

5' GUGUGAUCUAGAUGUADWGGCUGWUCCUAGUYAGG 3' (SEQ ID NO: 52), и

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает нуклеотидную последовательность 5' X1X2SVNS 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает нуклеотидную последовательность 5' BVBSX3X4 3', в соответствии с чем

X1 отсутствует или представляет собой A, X2 представляет собой G, X3 представляет собой C, и X4 отсутствует или представляет собой U; или

X1 отсутствует, X2 отсутствует или представляет собой G, X3 отсутствует или представляет собой C, и X4 отсутствует;

где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает следующую нуклеотидную последовательность: GGUYAGGGCUHRXAAGUCGG (SEQ ID NO: 108),

где XA отсутствует или представляет собой A; и

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' RKSBUSNVGR 3' (SEQ ID NO: 138), а второй участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' YYNRCASSMY 3' (SEQ ID NO: 139), или

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' XSSSSV 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' BSSSXS 3', в соответствии с чем XS или отсутствует, или представляет собой S, или

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' CGUGCGCUUGAGAUAGG 3' (SEQ ID NO: 220), а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' CUGAUUCUCACG 3' (SEQ ID NO: 221); или

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' UGAGAUAGG 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' CUGAUUCUCA 3' (SEQ ID NO: 222); или

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' GAGAUAGG 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' CUGAUUCUC 3';

где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' AAAGYRACAHGUMAAXAUGAAAGGUARC 3' (SEQ ID NO: 74),

где XA отсутствует или представляет собой A, и

где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' X1X2NNBV 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' BNBNX3X4 3',

в соответствии с чем X1 отсутствует или представляет собой R, X2 представляет собой S, X3 представляет собой S, и X4 отсутствует или представляет собой Y; или

X1 отсутствует, X2 отсутствует или представляет собой S, X3 отсутствует или представляет собой S, и X4 отсутствует; и

где связывающаяся с SDF-1 молекула нуклеиновой кислоты типа D включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 142 - SEQ ID NO: 144.

2. Применение по п. 1, где раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы и солидных опухолей, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому, а солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

3. Применение по п. 1, где вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения или предупреждения заболевания или нарушения.

4. Применение по п. 3, где терапия для лечения или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

5. Применение по п. 4, где дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

6. Применение по любому из пп. 1-5, где лечение или предупреждение заболевания или нарушения обусловлено молекулой нуклеиновой кислоты, ингибирующей взаимодействие между SDF-1 и рецептором SDF-1.

7. Применение по п. 1, где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает следующую нуклеотидную последовательность:

5' GUGUGAUCUAGAUGUADUGGCUGAUCCUAGUCAGG 3' (SEQ ID NO: 53).

8. Применение по п. 7, где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает нуклеотидную последовательность 5' X1X2SSBS 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа B включает нуклеотидную последовательность 5' BVSSX3X4 3',

в соответствии с чем X1 отсутствует, X2 или отсутствует, или представляет собой G, X3 или отсутствует, или представляет собой C, и X4 отсутствует, предпочтительно первый концевой участок нуклеотидов включает нуклеотидную последовательность 5' GCGUG 3', а второй концевой участок нуклеотидов включает нуклеотидную последовательность 5' UACGC 3'.

9. Применение по п. 1, где связывающаяся с SDF-1 молекула нуклеиновой кислоты типа B включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 5 - SEQ ID NO: 20 и SEQ ID NO: 22 - SEQ ID NO: 28,

предпочтительно любой из SEQ ID NO: 5 - SEQ ID NO: 7, SEQ ID NO: 16, SEQ ID NO: 22 и SEQ ID NO: 28,

более предпочтительно любой из SEQ ID NO: 22 и SEQ ID NO: 28.

10. Применение по п. 1, где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' GGUYAGGGCUHRAAGUCGG 3' (SEQ ID NO: 109), 5' GGUYAGGGCUHRAGUCGG 3' (SEQ ID NO: 110) или 5' GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO: 111), предпочтительно 5' GGUUAGGGCUHGAAGUCGG 3' (SEQ ID NO: 111).

11. Применение по п. 10, где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' RKSBUGSVGR 3' (SEQ ID NO: 140), а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' YCNRCASSMY 3' (SEQ ID NO: 141).

12. Применение по п. 10, где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' SGGSR 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа С включает нуклеотидную последовательность 5' YSCCS 3'.

13. Применение по п. 1, где связывающаяся с SDF-1 молекула нуклеиновой кислоты типа C включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 95 - SEQ ID NO: 107, SEQ ID NO: 112 - SEQ ID NO: 137, SEQ ID NO: 223 и SEQ ID NO: 224,

предпочтительно любой из SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 129, SEQ ID NO: 134, SEQ ID NO: 135, SEQ ID NO: 223 и SEQ ID NO: 224.

14. Применение по п. 1, где центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность

5' AAAGYRACAHGUMAAUGAAAGGUARC 3' (SEQ ID NO: 75), или

5' AAAGYRACAHGUMAAAUGAAAGGUARC 3' (SEQ ID NO: 76), или

5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO: 77), предпочтительно центральный участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' AAAGYAACAHGUCAAUGAAAGGUARC 3' (SEQ ID NO: 77).

15. Применение по п. 1, где первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' X2BBBS 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' SBBVX3 3',

в соответствии с чем X2 отсутствует или представляет собой S, и X3 отсутствует или представляет собой S;

предпочтительно первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' CUGUG 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' CGCAG 3';

или первый концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' GCGUG 3', а второй концевой участок нуклеотидов связывающейся с SDF-1 молекулы нуклеиновой кислоты типа А включает нуклеотидную последовательность 5' CGCGC 3'.

16. Применение по п. 1, где связывающаяся с SDF-1 молекула нуклеиновой кислоты типа А включает нуклеотидную последовательность в соответствии с любой из SEQ ID NO: 60 - SEQ ID NO: 73, SEQ ID NO: 78 - SEQ ID NO: 82, SEQ ID NO: 84 - SEQ ID NO: 87, SEQ ID NO: 89 - SEQ ID NO: 94 и SEQ ID NO: 145,

предпочтительно любой из SEQ ID NO: 60, SEQ ID NO: 63, SEQ ID NO: 66, SEQ ID NO: 78, SEQ ID NO: 84 и SEQ ID NO: 146, более предпочтительно любой из SEQ ID NO: 84 и SEQ ID NO: 146.

17. Применение по любому из пп. 1-5 или 7-16, где молекула нуклеиновой кислоты включает модификацию, в соответствии с чем модификацией предпочтительно является высокомолекулярная составляющая, и/или в соответствии с чем модификация предпочтительно делает возможным изменение характеристик молекулы нуклеиновой кислоты в отношении времени жизни в организме животного или человека, предпочтительно организме человека.

18. Применение по пп. 1-5 или 7-16, где молекулой нуклеиновой кислоты является молекула L-нуклеиновой кислоты.

19. Применение фармацевтической композиции для лечения и/или предупреждения рака, экспрессирующего рецептор SDF-1 CXCR7, где указанная композиция включает в эффективном количестве первый фармацевтически активный агент, где первый фармацевтически активный агент представляет собой молекулу нуклеиновой кислоты, охарактеризованную в любом из пп. 1-18, и необязательно дополнительную компоненту, где дополнительную компоненту выбирают из группы, включающей фармацевтически приемлемый наполнитель, фармацевтически приемлемый носитель, и дополнительный фармацевтически активный агент.

20. Применение по п. 19, где дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

21. Применение по п. 19, где вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения или предупреждения заболевания или нарушения.

22. Применение по п. 21, где терапия для лечения или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

23. Применение по любому из пп. 19-22, где раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы и солидных опухолей, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому, а солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

24. Применение лекарственного средства для лечения и/или предупреждения рака, экспрессирующего рецептор SDF-1 CXCR7, где указанное лекарственное средство включает одну или несколько единиц дозирования по крайней мере первого фармацевтически активного агента и при необходимости одну или несколько единиц дозирования по крайней мере еще одного фармацевтически активного агента, причем первым фармацевтически активным агентом является молекула нуклеиновой кислоты, охарактеризованная в любом из пп. 1-18.

25. Применение по п. 24, где вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения или предупреждения заболевания или нарушения.

26. Применение по п. 25, где терапия для лечения или предупреждения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

27. Применение по любому из пп. 24-26, которое включает одну или несколько единиц дозирования дополнительного фармацевтически активного агента, в соответствии с чем дополнительный фармацевтически активный агент выбирают из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

28. Применение по любому из пп. 24-26, где раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы и солидных опухолей, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому, а солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.

29. Способ лечения субъекта, страдающего раком, экспрессирующим рецептор SDF-1 CXCR7, или подверженного риску развития рака, экспрессирующего рецептор SDF-1 CXCR7, в соответствии с чем способ включает введение субъекту фармацевтически эффективного количества молекулы нуклеиновой кислоты, охарактеризованной в любом из пп. 1-18.

30. Способ по п. 29, дополнительно включающий облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию, и/или введение субъекту фармацевтически эффективного количества дополнительного фармацевтически активного агента, в соответствии с чем дополнительным фармацевтически активным агентом является фармацевтически активный агент, выбираемый из группы, включающей антитело, алкилирующий агент, антиметаболит, растительный алкалоид, предпочтительно винкристин, растительный терпеноид, ингибитор топоизомеразы, Лейковорин, Метотрексат, Тамоксифен, Сорафениб, Леналидомид, Бортезомиб, Дексаметазон, Фторурацил и Преднизон.

31. Способ по п. 30, в соответствии с чем фармацевтически эффективное количество молекулы нуклеиновой кислоты, способной к связыванию с SDF-1, по любому из пп. 1-18 вводят в качестве вспомогательной терапии или части вспомогательной терапии.

32. Способ по п. 31, в соответствии с чем вспомогательная терапия сенсибилизирует субъекта, причем сенсибилизированный субъект является более способным к реагированию на терапию для лечения заболевания или нарушения.

33. Способ по п. 32, в соответствии с чем терапия для лечения заболевания или нарушения включает введение дополнительного фармацевтически активного агента, и/или облучение субъекта, и/или хирургическое вмешательство, и/или клеточную терапию.

34. Способ по любому из пп. 29-32, в соответствии с чем раком является рак, выбираемый из группы злокачественной опухоли кроветворной системы и солидных опухолей, в соответствии с чем предпочтительно злокачественную опухоль кроветворной системы выбирают из группы, включающей лейкоз и миелому, а солидные опухоли выбирают из группы, включающей глиобластому, колоректальный рак, рак молочной железы, лимфому, рак предстательной железы, рак поджелудочной железы, рак почки, рак яичника и рак легкого.



 

Похожие патенты:

Группа изобретений относится к области биотехнологии. Предложены способ извлечения нуклеиновых кислот из являющегося пластичным в живом организме полимера, способ обнаружения микроорганизма, прикрепленного или закрепленного в пластичном в живом организме полимере, способ идентификации резистентных к адгезии микроорганизма пластичных полимеров в живом организме, способ создания микробного профиля полости рта субъекта–млекопитающего и in vitro способ диагностики инфекции в полости рта млекопитающего или определения восприимчивости млекопитающего к развитию инфекции в полости рта.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, в клетках яичника китайского хомячка (СНО).

Изобретение относится к биохимии. Описано двухцепочечное средство для РНКи для ингибирования экспрессии транстиретина (TTR), содержащее смысловую цепь, комплементарную антисмысловой цепи, где указанная антисмысловая цепь содержит последовательность, комплементарный нуклеотидам 504-526 гена транстиретина (TTR) (SEQ ID NO:1), где смысловая цепь имеет длину 21 нуклеотид, а антисмысловая цепь имеет длину 23 нуклеотида.

Изобретение относится к генной инженерии и биотехнологии, в частности к генотерапевтическому ДНК-вектору VTvaf17 размером 3165 п.н. и способу его получения.

Изобретение относится к области биотехнологии, конкретно к способам для идентификации связывающих полипептидов (например, антител или их антигенсвязывающих фрагментов), которые специфически связываются с антигеном клеточной поверхности, что может быть использовано в медицине.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoM депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-797.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoB депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-796.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoQ, депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-798.

Изобретение относится к области биохимии, в частности к способу определения присутствия экзогенного донорского полинуклеотида ДНК, вставленного в целевой геномный локус DAS-59132 растения кукурузы.

Изобретение относится к области биотехнологии и биохимии, в частности к выделенному ферменту P450. Указанный фермент отличается тем, что он состоит из аминокислотной последовательности, которая по меньшей мере на 80% идентична SEQ ID NO: 1, которая содержит треонин в положении 225 и аспарагиновую кислоту в положении 289.

Изобретение относится к биохимии. Описано двухцепочечное средство для РНКи для ингибирования экспрессии транстиретина (TTR), содержащее смысловую цепь, комплементарную антисмысловой цепи, где указанная антисмысловая цепь содержит последовательность, комплементарный нуклеотидам 504-526 гена транстиретина (TTR) (SEQ ID NO:1), где смысловая цепь имеет длину 21 нуклеотид, а антисмысловая цепь имеет длину 23 нуклеотида.

Изобретение относится к применимому в медицине соединению, содержащему модифицированный олигонуклеотид и конъюгирующую группу, при этом модифицированный олигонуклеотид состоит из 12-30 связанных нуклеозидов и содержит последовательность азотистых оснований, включающую часть из по меньшей мере 8 смежных азотистых оснований, комплементарную равной по длине части SEQ ID NO: 1, при этом последовательность азотистых оснований модифицированного олигонуклеотида по меньшей мере на 90% комплементарна SEQ ID NO: 1, где конъюгирующая группа содержит где конъюгирующая группа связана с модифицированным олигонуклеотидом на 5'-конце или 3'-конце модифицированного олигонуклеотида.

Изобретение относится к области биотехнологии, конкретно к самособирающейся в наночастицу олигонуклеотидной конструкции, и может быть использовано в медицине. Олигонуклеотидная конструкция согласно настоящему изобретению может быть полезной в качестве системы доставки на основе олигонуклеотида нового типа, а также инструмента для лечения злокачественных заболеваний, инфекционных заболеваний и т.п.

Изобретение относится к области биотехнологии, конкретно к способам обнаружения молекулы-мишени в тест-образце, что может быть использовано в медицине. Описанные способы облегчают детекцию мишени, отличающейся от нуклеиновой кислоты (например, белка-мишени), в исследуемом образце путем детекции нуклеиновой кислоты (т.е., аптамера).

Изобретение относится к биотехнологии. Описаны трансляторы на основе нуклеиновых кислот, способные осуществлять логические операции с улучшенной эффективностью, максимизированным выходом и сниженным побочным действием, в частности в биологической системе.

Изобретение относится к пригодному для применения в медицине соединению, содержащему модифицированный олигонуклеотид и конъюгирующую группу при этом модифицированный олигонуклеотид состоит из 20 связанных азотистых оснований, комплементарных равной по длине части азотистых оснований 3533-3552 в SEQ ID NO: 3, при этом модифицированный олигонуклеотид содержит сегмент гэп, состоящий из связанных дезоксинуклеозидов; сегмент крыла 5', состоящий из связанных нуклеозидов; сегмент крыла 3', состоящий из связанных нуклеозидов; при этом сегмент гэп расположен между сегментом крыла 5' и сегментом крыла 3', и при этом каждый нуклеозид каждого сегмента крыла содержит модифицированный сахар, и где по меньшей мере один нуклеозид содержит модифицированное азотистое основание; и модифицированный олигонуклеотид содержит по меньшей мере одну модифицированную межнуклеозидную связь.

Изобретение относится к области биохимии, в частности к выделенной молекуле нуклеиновой кислоты, кодирующей рекомбинантное антитело или его фрагмент, где рекомбинантное антитело или его фрагмент нейтрализует VEGF человека, а также к экспрессирующему вектору и клетке-хозяину, ее содержащей.

Изобретение относится к области биохимии, в частности к трансгенному растению сои, обладающему устойчивостью к глифосату и изоксафлютолу. Также раскрыты трансгенное семя указанного растения, молекула нуклеиновой кислоты, геномная ДНК сои, продукт из сои, набор, пара праймеров и пара специфичных зондов для идентификации одновременного присутствия генов устойчивости к указанным гербицидам.

Изобретение относится к биохимии. Описана двухцепочечная рибонуклеиновая кислота (дцРНК) для ингибирования экспрессии гена АРОС3, где указанная дцРНК содержит (а) смысловую цепь, состоящую из нуклеотидной последовательности GcuuAAAAGGGAcAGuAuudTsdT, и антисмысловую цепь, состоящую из нуклеотидной последовательности AAuACUGUCCCUUUuAAGCdTsdT; (b) смысловую цепь, состоящую из нуклеотидной последовательности GCUUAAAAGGGACAGUAUUdTsdT, и антисмысловую цепь, состоящую из нуклеотидной последовательности AAUACUGUCCCUUUUAAGCdTsdT, (c) смысловую цепь, состоящую из нуклеотидной последовательности GfcUfuAfaAfaGfgGfaCfaGfuAfuUfdTsdT, и антисмысловую цепь, состоящую из нуклеотидной последовательности aAfuAfcUfgUfcCfcUfuUfuAfaGfcdTsdT, или (d) смысловую цепь, состоящую из нуклеотидной последовательности GcuuAAAAGGGAcAGuAuudTsdT, и антисмысловую цепь, состоящую из нуклеотидной последовательности AAuACuGUCCCuuuuAagcdTsdT, где нуклеотиды, обозначенные строчными буквами, представляют собой 2'-О-метилнуклеотиды; Gf, Af, Uf и Cf представляют собой 2'-фторнуклеотиды; и s представляет собой фосфоротиоатную связь.

Группа изобретений относится к области биотехнологии. В группу изобретений входят нуклеиновая кислота, которая кодирует флуоресцентный биосенсор для регистрации изменения рН, аминокислотная последовательность которого показана в SEQ ID No: 4, а также кассета экспрессии и эукариотическая клетка, продуцирующая биосенсор.

Изобретение относится к соединению, имеющему структуру формулы (I), в которой X представляет собой О, R1 представляет собой атом водорода; R2 представляет собой атом водорода; R3 представляет собой атом водорода; R4 представляет собой атом водорода; R5 представляет собой N-имидазолильную группу; R6 представляет собой гидроксильную группу; R7 представляет собой радикал формулы CnFmHo, где n равен 2, 3, 4, 5 или 6, причем m≥1 и m+o=2n+1.

Изобретение относится к области биохимии и молекулярной биологии. Предложено применение молекулы нуклеиновой кислоты, способной к связыванию с SDF-1 и блокированию взаимодействия между SDF-1 и рецептором SDF-1 CXCR7. Изобретение может быть использовано для лечения иили предупреждения заболевания рак. 4 н. и 30 з.п. ф-лы, 18 ил., 1 табл., 11 пр.

Наверх