Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза



Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
Рекомбинантная плазмидная днк poptivec-mbp84-106-fc, кодирующая константный фрагмент иммуноглобулина человека, слитного с фрагментом основного белка миелина, линии эукариотических клеток - продуцентов указанного белка и способ получения белка mbp84-106-fc для терапии рассеянного склероза
C12N2015/8518 - Микроорганизмы или ферменты; их композиции (биоциды, репелленты или аттрактанты или регуляторы роста растений, содержащие микроорганизмы, вирусы, микробные грибки, ферменты, агенты брожения или вещества, получаемые или экстрагируемые из микроорганизмов или из материала животного происхождения A01N 63/00; пищевые составы A21,A23; лекарственные препараты A61K; химические аспекты или использование материалов для бандажей, перевязочных средств, впитывающих подкладок или хирургических приспособлений A61L; удобрения C05); размножение, консервирование или сохранение микроорганизмов (консервирование живых тканей или органов людей или животных A01N 1/02); мутации или генная инженерия; питательные среды (среды для микробиологических испытаний C12Q)
C12N15/625 - Получение мутаций или генная инженерия; ДНК или РНК, связанные с генной инженерией, векторы, например плазмиды или их выделение, получение или очистка; использование их хозяев (мутанты или микроорганизмы, полученные генной инженерией C12N 1/00,C12N 5/00,C12N 7/00; новые виды растений A01H; разведение растений из тканевых культур A01H 4/00; новые виды животных A01K 67/00; использование лекарственных препаратов, содержащих генетический материал, который включен в клетки живого организма, для лечения генетических заболеваний, для генной терапии A61K 48/00 пептиды вообще C07K)
C07K2319/30 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2679055:

Федеральное государственное бюджетное учреждение науки Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук (ИБХ РАН) (RU)

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, в клетках яичника китайского хомячка (СНО). Конструируют рекомбинантный бипромоторный вектор экспрессии pOptiVEC-MBP84-106-Fc, обеспечивающий биосинтез бифункциональной молекулы MBP84-106-Fc в культивируемых клетках СНО. Линию клеток CHO-S18 - продуцента MBP84-106-Fc - получают путем трансфекции клеток линии СНО DG44 вектором pOptiVEC-MBP84-106-Fc. Предложенное изобретение позволяет получить линию клеток СНО, стабильно продуцирующую в культуральную жидкость белок MBP84-106-Fc с выходом 20 мкг в мл кондиционированной среды. 4 н. и 3 з.п. ф-лы, 5 ил., 1 табл., 4 пр.

 

Введение

Изобретение относится к биотехнологии, а именно: к способу получения бифункциональной молекулы для терапии рассеянного склероза (PC). Объектом исследования является химерный белок, состоящий из модуля доставки - пептида основного белка миелина МВР84-106, слитного с цитотоксическим модулем - константным доменом иммуноглобулина человека. Аутоантиген - пептид основного белка миелина МВР84-106 является одним из основных биомаркеров патологических лимфоцитов, при этом имеет высокую стабильность к протеолитической деградации. Константный домен иммуноглобулина человека является естественным сигналом иммунной системы для деградации клетки-мишени по механизму комплимент-зависимой цитотоксичности. Объединение перечисленных модулей в единую молекулу позволяет получать бифункцональный цитотоксический белок, направленно элиминирующий специфические патологические лимфоциты при PC.

Известны способы получения прототипов бифункциональных цитотоксических молекул в составе слитного белка на основе специфического пептида и токсических агентов на основе барназы, псевдомонадного токсина и константного Fc-домена антитела человека (Stepanov, А.V., Belogurov, A.A., Ponomarenko, N.A., Stremovskiy, О.A., Kozlov, L.V., Bichucher, А.М., et al. (2011). Design of Targeted В Cell Killing Agents. PloS One, 6(6), e20991. http://doi.org/10.1371/journal.pone.0020991.t001). Прототипы препаратов иммунотоксинов высокоспецифично (с избирательностью до 5000 раз в сравнении с иммунотоксином не содержащим таргетного участка) взаимодействовали с клетками мишенями и вызывали значительный цитотоксический эффект. Вариантов использования слитного белка МВР84-106 и константного домена иммуноглобулина человека на сегодняшний день не известно.

Область техники

Изобретение относится к области биотехнологии, в частности, предложена рекомбинантная плазмидная ДНК, кодирующая слитный белок МВР84-106 и константный домен иммуноглобулина человека. И способ получения белка MBP84-106-Fc для терапии рассеянного склероза.

Уровень техники

Изобретение относится к биотехнологии, а именно: к способу получения бифункционального агента для терапии социально-значимого заболевания - рассеянного склероза (PC).

Объектом разработки является пептид основного белка миелина МВР84-106, слитный с константным доменом иммуноглобулина человека. Аутоантиген - пептид основного белка миелина МВР84-106 является одним из основных биомаркеров патологических лимфоцитов при этом имеет высокую стабильность к протеолитической деградации. Константный домен иммуноглобулина человека является естественным сигналом иммунной системы для деградации клетки-мишени по механизму комплимент-зависимой цитотоксичности. Объединение перечисленных модулей в единую молекулу позволяет получать бифункцональный цитотоксический препарат, направленно элиминирующий специфические патологические лимфоциты при PC.

Известны способы получения прототипов бифункциональных цитотоксических молекул в составе слитного белка на основе специфического пептида и токсических агентов на основе барназы, псевдомонадного токсина и константного Fc-домена антитела человека (Stepanov, А.V., Belogurov, A.A., Ponomarenko, N.A., Stremovskiy, О.A., Kozlov, L.V., Bichucher, А.М., et al. (2011). Design of Targeted В Cell Killing Agents. PloS One, 6(6), e20991. Прототипы препаратов иммунотоксинов высокоспецифично (с избирательностью до 5000 раз в сравнении с иммунотоксином не содержащим таргетный участок) взаимодействовали с клетками мишенями и вызывали значительный цитотоксический эффект. Все представленные методики заключаются в генно-инженерном способе получения бифункциональных молекул, однако, способы получения слитного белка пептида основного белка миелина МВР84-106 с константным доменом иммуноглобулина человека, на настоящий момент не описаны.

Известна плазмида pYR-GCEVH, содержащая тяжелую цепь антитела HCAb к раку кишечника человека, и плазмида pYR-GCEVL, содержащая легкую цепь антитела к раку кишечника человека [Xiong Н., Ran Y., Xing J., Yang X., Li Y. and Chen Z. Expression vectors for human-mouse chimeric antibodies // Journal of Biochemistry and Molecular Biology. - 2005. - V. 38 (4). - P. 414-419]. Плазмида pYR-GCEVL включает в себя ген устойчивости к неомицину/генетицину под управлением раннего промотора вируса SV40 с удаленным энхансером. Транскрипция гена легкой цепи находится под контролем CMV на 5' конце и терминатора бычьего гормона роста (BGHT), на 3' конце находится сайт полиаденилирования. Плазмида pYR-GCEVH включает в себя ген dhfr под управлением раннего промотора вируса SV40. Транскрипция гена легкой цепи находится под контролем CMV на 5' конце и терминатора бычьего гормона роста (BGHT), на 3' конце находится сайт полиаденилирования.

Культура клеток dhfr (-) СНО (АТСС, США), дефицитных по дигидрофолатредуктазе (ДГФР), была ко-трансфецирована с использованием равных количеств плазмид pYR-GCEVH, pYR-GCEVL. После проведения нескольких раундов селекции была получена культура, клоны которой продуцировали химерные антитела с выходом от 30 до 100 мкг/мл кондиционированной среды [Xiong и др., 2005].

Известны плазмиды phCMV-VHRhD-g1C-neo и phCMV-VLRhD-KR-neo, кодирующие антитела против RhD антигена. Плазмида phCMV-VHRhD-g1C-neo содержит вариабельную и константную области тяжелой цепи под контролем главного раннего энхансера цитомегаловируса и промотор начала инициации транскрипции рекомбинантных тяжелых химерных цепей антитела, а также бактериальный ген устойчивости к неомицину под контролем раннего промотора SV40. Плазмида phCMV-VLRhDKR-neo содержит вариабельную и константную области легкой цепи под контролем раннего энхансера цитомегаловируса и промотор начала инициации транскрипции рекомбинантных легких химерных цепей антитела. В данной плазмиде ген устойчивости к неомицину под контролем раннего промотора SV40 был заменен геном dhfr из плазмиды pSV2-dhfr (Subramani S., Mulligan R., Berg P. Expression of the mouse dihydrofolatereductase complementary deoxyribonucleic acid in simian virus 40 vectors // Mol Cell Biol - 1981. - V. 1 (9). - P. 854-864). В обе плазмиды были внесены секреторные последовательности перед вариабельными доменами цепей антител, отделяющими их от интронных последовательностей. После проведения трансфекции клеточной линии СНО, дефицитной по гену ДГФР, и нескольких раундов селекции клонов, полученных из трансформированной культуры CHO-mAb с использованием МТХ (до 1000 нМ) и селективного антибиотика G418 (600 мкг/мл) были получены относительно устойчивые клоны с продукцией до 110 мкг/мл химерных антител [Chusainow J., Yang Y.S, Yeo J.H.M., Toh P.C., Asvadi P., Wong N.S.C., Miranda G.S. Yap. A Study of Monoclonal Antibody-Producing CHO Cell Lines: What Makes a Stable High Producer // Biotechnology and Bioengineering. - 2009. - V. 102 (4). - P. 1182-1196].

Раскрытие изобретения

Изобретение решает задачу создания технологии для ускорения и повышения экономичности процесса получения препарата основного белка миелина МВР84-106, слитого с константной областью человеческого антитела F10 (MBP84-106-Fc).

Технический результат достигается за счет увеличения уровня биологического синтеза MBP84-106-Fc клетками-продуцентами при использовании селективного цитостатического препарата (метотрексата).

Поставленная задача решается путем конструирования рекомбинантной плазмидной ДНК, обозначенной pOptiVEC-MBP84-106-Fc, и содержащей

- фрагмент плазмиды pOptiVEC™-TOPO®, включающий промотор/энхансер ранних генов цитомегаловируса человека (CMV), внутренний сайт связывания (IRIS), ген ДГФР, сигнал полиаденилирования тимидинкиназы вируса герпеса, сайт начала репликации в Е. coli из плазмиды pUC, ген β-лактамазы, а также следующие модификации - единичный сайт узнавания рестриктазы MluI вместо сайта узнавания рестриктазы SalI в положении 23, единичные сайты узнавания рестриктаз NheI и XhoI после промотора CMV для клонирования ДНК МВР84-106-Fc;

- фрагмент ДНК, включающий фланкированную сайтами рестрикции NheI и XhoI кДНК MBP84-106-Fc под контролем промотора/энхансера ранних генов цитомегаловируса человека (CMV);

Также настоящее изобретение представляет способ получения культуры клеток яичника китайского хомячка СНО - продуцента MBP84-106-Fc путем трансфекции клеток упомянутой выше рекомбинантной плазмидной ДНК.

Также настоящее изобретение представляет линию клеток яичника китайского хомячка СНО - продуцента MBP84-106-Fc, называемую далее CHO-S18 и полученную путем трансфекции линии клеток СНО DG44 упомянутой выше рекомбинантной плазмидной

ДНК.

Также настоящее изобретение представляет способ получения MBP84-106-Fc, включающий:

- культивирование в питательной среде упомянутой линии клеток культуры СНО-S18,

- выделение полученного целевого белка из культуральной жидкости.

В частном варианте воплощения настоящего изобретения указанная плазмида может представлять собой плазмиду, состоящую из:

фрагмента плазмиды pOptiVEC™-TOPO®, включающего промотор/энхансер ранних генов цитомегаловируса человека (CMV), обеспечивающий высокий уровень экспрессии целевых белков в клетках млекопитающих, внутренний сайт связывания рибосом (IRES), ген ДГФР для ауксотрофной селекции трансфецированных клеток СНО DG44 и геномной амплификации стабильных клеточных линий с использованием метатрексата, сигнал полиаденилирования тимидинкиназы вируса герпеса для правильной терминации и процессинга рекомбинантных транскриптов, сайт начала репликации в Е. coli из плазмиды pUC, ген β-лактамазы, а также следующие модификации - единичный сайт узнавания рестриктазы MluI вместо сайта узнавания рестриктазы SalI в положении 23, единичные сайты узнавания рестриктаз NheI и XhoI после промотора CMV для клонирования кДНК МВР84-106;

NheI/XhoI - фрагмента ДНК, включающего фланкированную сайтами рестрикции NheI и XhoI кДНК лидерного пептида тяжелой цепи моноклонального антитела F10, необходимого для секреции рекомбинантного константного фрагмента иммуноглобулина человека, слитного с фрагментом основного белка миелина 84-106 из клеток-продуцентов СНО в культуральную среду, кДНК фрагмента основного белка миелина МВР84-106, кодирующую фрагмент основного белка миелина, включающий в себя аминокислотные остатки данного белка с 84 по 106 включительно, и кДНК константного фрагмента иммуноглобулина человека, а именно константных доменов СН2, СН3 тяжелой цепи иммуноглобулина изотипа IgG1 человека.

Наличие в плазмиде pOptiVEC-MBP84-106-Fc активного гена ДГФР, находящегося под контролем IRES, позволяет проводить селекцию и амплификацию чужеродных последовательностей, интегрированных в геном клетки СНО DG44 (dhfr-/- вариант линии клеток СНО-K1), в среде, содержащей метотрексат.

Технический эффект изобретения заключается в том, что культура, трансфецированная плазмидой pOptiVEC-MBP884-106-Fc продуцирует бифункциональную молекулу MBP84-106-Fc для терапии рассеянного склероза в среду культивирования.

Экспрессия бифункциональной молекулы MBP84-106-Fc может быть осуществлена в эукариотических клетках. Примером эукариотической клетки, пригодной для продукции слитного белка МВР84-106 с константным доменом иммуноглобулина человека, согласно настоящему изобретению являются, но не ограничиваются ими, клетки яичников Cricetulus griseus (СНО). Примерами клеток яичников Cricetulus griseus (СНО), применимых в рамках настоящего изобретения, являются, но не ограничиваются ими, клетки яичников Cricetulus griseus (СНО) клетки СНО DG44 (Invitrogen).

Способом согласно настоящему изобретению является способ получения МВР84-106-Fc, включающий выращивание трансформированных клеток эукариот в питательной среде и выделение полученных антител из культуральной жидкости.

Выращивание клеток эукариот осуществляют в атмосфере 5% СО2 в режиме культивирования с перемешиванием в синтетических средах, таких как среда OptiCHO, в течение 3-6 суток.

После выращивания твердые компоненты, такие как клетки, могут быть удалены из культуральной жидкости методом центрифугирования или фильтрации с использованием мембраны, а затем белок может быть выделен и очищен методом осаждения с солями, с использованием сульфата натрия или сульфата аммония, аффинной хроматографии, ионообменной хроматографии и т.п.

Предложенные рекомбинантная плазмида pOptiVEC-MBP84-106-Fc и способ получения линии культивируемых клеток СНО, основанный на использовании рекомбинантной плазмиды pOptiVEC-MBP84-106-Fc, впервые получены авторами данного изобретения, в научной и патентной литературе не описаны.

Осуществление изобретения

Пример 1. Конструирование рекомбинантной плазмидной ДНК pOptiVEC-MBP84-106-Fc.

Конструирование плазмиды pOptiVEC-MBP84-106-Fc проводят по схеме, изложенной на фигуре 1, с использованием праймеров, приведенных в таблице 1.

Последовательности:

SEQ ID NO: 1

аминокислотная последовательность лидерного пептида тяжелой цепи моноклонального антитела F10

SEQ ID NO: 2

нуклеотидная последовательность, кодирующая лидерный пептид тяжелой цепи моноклонального антитела F10

SEQ ID NO: 3

нуклеотидная последовательность, кодирующая фрагмент основного белка миелина 84-106 (МВР84-106)

SEQ ID NO: 4

аминокислотная последовательность фрагмента основного белка миелина 84-106 (МВР84-106)

SEQ ID NO: 5

нуклеотидная последовательность, кодирующая Fc-фрагмент антитела IgG1 (домены СН2-СН3) человека

SEQ ID NO: 6

аминокислотная последовательность Fc-фрагмента антитела IgG1 (доменов СН2-СН3) человека

Итоговая последовательность:

NheI

XhoI

Жирным шрифтом отмечен сигнальный пептид, подчеркиванием выделена область Fc, между сигнальным пептидом и областью Fc находится последовательность МВР84-106, после области Fc находится нетранслируемая область. На 5'- и 3'-концах курсивом выделены сайты узнавания рестриктаз NheI и XhoI, соответственно. Результирующая генетическая конструкция изображена на фигуре 2.

Пример 2. Получение линии CHO-S18, продуцента MBP84-106-Fc с применением плазмиды pOptiVEC-MBP84-106-Fc.

Для получения линии СНО-18, стабильного продуцента рекомбинантного слитного белка МВР84-106 с константным доменом иммуноглобулина человека проводят трансфекцию клеток яичника китайского хомячка СНО DG44 dhfr - плазмидой pOptiVEC-MBP84-106-Fc. Клетки культивируют в среде CD DG44 (Invitrogen) с добавлением 200 мМ раствора L-Глутамина до конечной концентрации 8 мМ и содержащей 0,18% (v/v) Pluronic F-68 (Invitrogen). Во флаконы Эрленмейера объемом 125 мл засевают 30 мл клеточной суспензии (4,5 млн клеток) при постоянном пемешивании на орбитальном шейкере с частотой 130 об/мин и через 20-24 ч проводят трансфекцию с использованием реагента Freestyle МАХ (Invitrogen) [Freestyle MAX Reagent Protocol, http://tools.invitrogen.com/content/sfs/manuals/freestyle_max_reagent_man.pdf]. Плазмидную ДНК добавляют к клеткам в виде ДНК-липосомного преципитата. Преципитат готовят следующим образом: при комнатной температуре во флакон А вносят 18 мкг ДНК плазмиды в 1200 мкл среды OptiPRO SFM (Invitrogen), перемешивают, добавляют 15 мкл реагента Freestyle MAX (Invitrogen), инкубируют от 10 до 20 минут при комнатной температуре. После инкубации перемешивают пипетированием и по каплям вносят в культуральный флакон. Культуральный флакон инкубируют при температуре 37°С, 98% влажности, в атмосфере 8% СО2 и непрерывном перемешивании 130 об/мин.

Через 48 ч после трансфекции клетки отмывают и помещают в ростовую среду CD OptiCHO (Invitrogen) (без тимидина и гипоксантина) с добавлением 200 мМ раствора L-Глутамина до конечной концентрации 8 мМ и содержащей 0,18% (v/v) Pluronic F-68 на 48 ч. Клетки инкубируют в селективной среде в течение двух недель, смену среды и поддержание концентрации клеток в среде проводят каждые трое суток.

Через 14 дней после помещения в селективные условия в культуре остаются клетки, способные существовать без добавления в среду тимидина и гипоксантина. При достижении культурой времени удвоения популяции 24 часа производят полную замену среды на среду CD DG44, содержащей 8 мМ L-Глутамина, 0,18% Pluronic F-68, 50 нМ метотрексата.

Через 14 дней после помещения в среду, содержащую метотрексат, остаются только клетки, способные существовать в присутствии 50 нМ метотрексата. При достижении культурой времени удвоения популяции 24 часа производят полную замену среды на среду CD DG44, содержащую 8 мМ L-Глутамина, 0,18% (v/v) Pluronic F-68, 100 нМ метотрексата.

Данную процедуру увеличения концентрации метотрексата проводят до тех пор, пока не будет достигнута устойчивость клеток к концентрации метотрексата равной 500 нМ.

Таким образом, получают культуру CHO-S18, клетки которой стабильно продуцируют MBP84-106-Fc в культуральную жидкость с выходом до 20 мкг/мл среды при культивировании в условиях перемешивания со скоростью 130 об/мин.

Пример 3. Получение, выделение и очистка белкового продукта с помощью линии клеток CHO-S18, продуцирующей MBP84-106-Fc.

Получение белкового продукта с применением линии CHO-S18 производят в колбах Эрленмейера различного объема без рассекателей в ростовой среде CD OptiCHO (без тимидина и гипоксантина) с добавлением 200 мМ раствора L-Глутамина до конечной концентрации 8 мМ и 0,18% (v/v) Pluronic F-68 без добавления дополнительных количеств питательных веществ при постоянном перемешивании с частотой 135 об/мин при температуре 37°С, 98% влажности в атмосфере 8% СО2. Культивирование для получения белкового продукта производят не менее 14 дней.

После окончания культивирования для получения продукта MBP84-106-Fc от культуры CHO-S18 полученную кондиционированную среду от культуры CHO-S18 центрифугируют при 4000 об/мин в течение 30 мин. Супернатант смешивают в соотношении 4:1 с Буфером для нанесения (50 мМ Трис-HCl, рН=7.0) и наносят на подготовленную Белок А-агарозную колонку (Gibco BRL, США). При элюции используют Буфер для элюции (100 мМ глицина, рН 3,0) и Нейтрализующий буфер (1 М Трис-HCl, рН 8,0). Колонку с 2 мл Белок А-агарозы промывают 3 раза по 4 мл Буфером для нанесения. Далее наносят смесь супернатанта кондиционированной среды и Буфера для нанесения. Образец наносят при комнатной температуре с помощью перистальтического насоса. После нанесения образца колонку промывают 3 раза по 20 мл Буфером для нанесения. Смывание белка MBP84-106-Fc с колонки производят с помощью 6 фракций по 2 мл Буфера для элюции. К образцу добавляют Нейтрализующий буфер в соотношении 1 часть буфера на 9 частей прошедшего через колонку Буфера для элюции.

Полученные образцы выделенного белка MBP84-106-Fc диализуют против ФСБ (фосфатно-солевой буфер, 137 мМ NaCl, 2,7 мМ KCl, 10 мМ Na2HPO4, 1,76 мМ KH2PO4, рН 7,4) и хранят при температуре +4°С.

Оценку гомогенности и степени очистки препарата проводят как с использованием электрофоретического метода, так и аналитической гель-проникающей ВЭЖХ.

Препараты рекомбинантных белка MBP84-106-Fc, полученные в ходе выделения с помощью аффинной хроматографии на Белок А-агарозе, анализируют на хроматографической ВЭЖХ системе Knauer (Германия), оснащенной колонкой Супердекс-200-10/300GL. Исследование проводят в протекающем буфере А (100 мМ Трис-HCl, 150 мМ NaCl, рН 7,5). Детекцию осуществляют при длине волны 230 нм УФ-детектором 2600 (UV detector 2600).

Элюция MBP84-106-Fc с колонки происходит в интервале 31-34 мин от момента старта проведения хроматографического анализа. Данные хроматографического анализа свидетельствуют о более чем 98%-ной чистоте полученного препарата рекомбинантных антител.

Электрофорез проводят в 10%-ном полиакриламидном геле. В качестве контроля используют неокрашенный белковый маркер молекулярных весов (Fermentas, Великобритания). Перед внесением к 15 мкл образца антител добавляют 5 мкл Буфера для нанесения с 2-меркаптоэтанолом (2-МЭ) (200 мМ Трис-HCl, рН 6,8, 400 мМ 2-МЭ, 4% натрия додецилсульфат, 0,01% бромофеноловый синий, 40%-ный глицерин). Образцы для внесения на гель инкубируют при температуре 95°С в течение 5 мин.

Полученные образцы продукта MBP84-106-Fc (Фиг. 3) характеризуются следующими показателями:

- гомогенность препарата не менее 98% (по данным гель-электрофореза в 10%-ном полиакриламидном геле с денситометрией);

- молекулярная масса - 28119 Да (по данным гель-электрофореза с белковыми маркерами молекулярных весов);

Пример 4. Получение, выделение и очистка MBP84-106-Fc с применением гель-проникающей хроматографии

После окончания культивирования для получения препарата рекомбинантного MBP84-106-Fc полученную кондиционированную среду от культуры CHO-S18 центрифугируют при 4000 об/мин в течение 30 мин. Супернатант смешивают в соотношении 4:1 с Буфером для нанесения (50 мМ Трис-HCl, рН 7,0) и наносят на подготовленную Белок А-агарозную колонку (Gibco BRL, США). При элюции используют Буфер для элюции (100 мМ глицина, рН 3,0) и Нейтрализующий буфер (1 М Трис-HCl, рН 8,0). Колонку с 2 мл Белок А-агарозы промывают 3 раза по 4 мл Буфером для нанесения. Далее наносят смесь супернатанта кондиционированной среды и Буфера для нанесения. Образец наносят при комнатной температуре с помощью перистальтического насоса. После нанесения образца колонку промывают 3 раза по 20 мл Буфером для нанесения. Смывание препарата рекомбинантного Fc-MBP с колонки производят с помощью 6 фракций по 2 мл Буфера для элюции. К образцу добавляют Нейтрализующий буфер в соотношении 1 часть буфера Полученные образцы выделенных антител диализуют против ФСБ (фосфатно-солевой буфер, 137 мМ NaCl, 2,7 мМ KCl, 10 мМ Na2HPO4, 1,76 мМ KH2PO4, рН 7,4), концентрируют с помощью Amicon Ultracel (10000NMWL) до 4 мл (15 мин 4°С, 5000g) и хранят при температуре +4°С. Проводят гель-фильтрационную хроматографию с использованием хроматографической колонки Superdex 75 16/600 GL (GE Healthcare Life Sciences). Буфер нанесения: ФСБ (фосфатно-солевой буфер, 137 мМ NaCl, 2,7 мМ KCl, 10 мМ Na2HPO4, 1,76 мМ KH2PO4, рН 7,4). Скорость потока: 2,5 мл/мин. Очищенная фракция препарата рекомбинантного Fc-MBP выходит с 0,4 по 0,47 объем колонки. Типичная хроматограмма процесса очистки представлена на фигуре 4.

Оценку гомогенности и степени очистки препарата проводят как с использованием электрофоретического метода, так и иммуноферментного анализа. Элюция препарата рекомбинантного MBP84-106-Fc с колонки происходит в интервале 0,4-0,47 объема колонки от момента старта проведения хроматографической очистки.

Электрофорез проводят в 12%-ном полиакриламидном геле. В качестве контроля используют неокрашенный белковый маркер молекулярных весов (Fermentas, Великобритания). Перед внесением к 15 мкл образца антител добавляют 5 мкл Буфера для нанесения с 2-меркаптоэтанолом (2-МЭ) (200 мМ Трис-HCl, рН 6,8, 400 мМ 2-МЭ, 4% натрия додецилсульфат, 0,01% бромофеноловый синий, 40%-ный глицерин). Образцы для внесения на гель инкубируют при температуре 95°С в течение 5 мин.

Иммуноферментный анализ препарата рекомбинатного MBP84-106-Fc, приведенный на фигуре 5, проводили с использованием антивидовых антител анти-Fc (anti-human anti-Fc hrp Sigma Aldrich). Препарат рекомбинатного MBP84-106-Fc анализировали в двукратных разведениях от 6 до 50 нг/мл (в соответсвии с оптической плотностью белка). В качестве калибровки и положительного контроля использовалась титровка препарата поликлональных очищенных антител человека из сыворотки крови (hAb) при концентрации от 6 до 50 нг/мл.

Полученные образцы препарата рекомбинантного MBP84-106-Fc характеризуются следующими показателями:

- гомогенность препарата не менее 98% (по данным гель-электрофореза в 12%-ном полиакриламидном геле с денситометрией);

- молекулярная масса - 28000 Да (по данным гель-электрофореза с белковыми маркерами молекулярных весов);

Изобретение иллюстрируют следующие графические материалы:

Фиг. 1. Схема конструирования экспрессионной плазмиды pOptiVEC-MBP84-106-Fc. PCMV - CMV промотор; EMCV IRES - независимый сайт инициирования рибосомы; NheI, XhoI - эндонуклеазы рестрикции

Фиг. 2. Физическая карта рекомбинантной плазмиды pOptiVEC-MBP84-106-Fc со следующими обозначениями: bla promoter - промотор гена β-лактамазы, CMV promoter -промотор/энхансер ранних генов цитомегаловируса человека, CMV Forward priming site -сайт отжига праймера CMV Forward, МВР84-106 - пептид основного белка миелина, Fc -константный домен тяжелой цепи антитела F10 человека, EMCV IRES reverse primer binding site - сайт отжига праймера EMCV IRES reverse primer, EMCV IRES - внутренний сайт связывания рибосом (IRES) вируса энцефаломиокардита, DHFR - ген дигидрофолатредуктазы, TK polyA - сигнал полиаденилирования тимидинкиназы вируса герпеса, pUC origin - последовательность, отвечающая за репликацию плазмиды pUC, Ampicillin (bla) resistance gene - ген устойчивости к антибиотику ампициллину. MluI, SphI, XhoI, SacII, NheI, NdeI, XbaI, SalI, BglII, PvuI - сайты эндонуклеаз рестрикции.

Фиг. 3. Электрофореграмма с денситометрией рекомбинантного препарата MBP84-106-Fc со следующими обозначениями: кДа - белковые стандарты молекулярного веса; Е1 - объединенная фракция препарата MBP84-106-Fc; kDa - единица молекулярного веса, килодальтон.

Фиг. 4. Профиль гель-фильтрационной хроматографии с использованием колонки Superdex75 для финальной очистки препарата рекомбинатного MBP84-106-Fc

Фиг. 5. Иммуноферментный анализ по специфическому узнаванию антител анти-Fc (anti-human) с препаратом рекомбинатного Fc-MBP. В качестве калибровки и положительного контроля использовалась титровка препарата поликлональных очищенных антител человека из сыворотки крови (hAb) при концентрации от 6 до 50 нг/мл.

Таблица 1. Структура использованных олигонуклеотидов.

Заявка № 2016152258/10(083704) (дата подачи 29.12.2016, заявитель Федеральное государственное бюджетное учреждение науки Институт биоорганической зимии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук(ИБХ РАН), RU)

РЕКОМБИНАНТНАЯ ПЛАЗМИДНАЯ ДНК pOptiVEC-MBP84-106-Fc, КОДИРУЮЩАЯ КОНСТАНТНЫЙ ФРАГМЕНТ ИММУНОГЛОБУЛИНА ЧЕЛОВЕКА, СЛИТНОГО С ФРАГМЕНТОМ ОСНОВНОГО БЕЛКА МИЕЛИНА, ЛИНИИ ЭУКАРИОТИЧЕСКИХ КЛЕТОК – ПРОДУЦЕНТОВ УКАЗАННОГО БЕЛКА И СПОСОБ ПОЛУЧЕНИЯ БЕЛКА MBP84-106-Fc ДЛЯ ТЕРАПИИ РАССЕЯННОГО СКЛЕРОЗА

Последовательности:

SEQ ID NO:1

аминокислотная последовательность лидерного пептида тяжелой цепи моноклонального антитела F10

MAWVWTLLFLMAAAQSAQA

SEQ ID NO:2

нуклеотидная последовательность, кодирующая лидерный пептид тяжелой цепи моноклонального антитела F10

ATGGCTTGGGTGTGGACCTTGCTATTCCTGATGGCAGCTGCCCAAAGTGCCCAAGCA

SEQ ID NO:3

нуклеотидная последовательность, кодирующая фрагмент основного белка миелина 84-106 (MBP84-106)

GAAAACCCGGTAGTCCACTTCTTCAAGAATATTGTGACGCCGCGTACTCCGCCGCCATCTCAGGGCAAA

SEQ ID NO:4

аминокислотная последовательность фрагмента основного белка миелина 84-106 (MBP84-106)

ENPVVHFFKNIVTPRTPPPSQGK

SEQ ID NO:5

нуклеотидная последовательность, кодирующая Fc-фрагмент антитела IgG1 (домены CH2-CH3) человека

GACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGGGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA

SEQ ID NO:6

аминокислотная последовательность Fc-фрагмента антитела IgG1 (доменов CH2-CH3) человека

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

1. Рекомбинантная плазмидная ДНК pOptiVEC-MBP84-106-Fc, способная к экспрессии в клетках СНО слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, соотносимая с физической картой, приведенной на фиг. 2, содержащая:

- фрагмент плазмиды pOptiVEC™-TOPO®, включающий промотор/энхансер ранних генов цитомегаловируса человека (CMV), ген ДГФР, сигнал полиаденилирования тимидинкиназы вируса герпеса, сайт начала репликации в Е. coli из плазмиды pUC, ген β-лактамазы, а также следующие модификации - единичный сайт узнавания рестриктазы MluI вместо сайта узнавания рестриктазы SalI в положении 23, единичные сайты узнавания рестриктаз NheI и XhoI после промотора CMV для клонирования ДНК MBP84-106-Fc;

- фрагмент ДНК, включающий фланкированную сайтами рестрикции NheI и XhoI ДНК - MBP84-106-Fc с нуклеотидными последовательностями SEQ ID NO: 2, SEQ ID NO: 3 и SEQ ID NO: 5, под контролем промотора/энхансера ранних генов цитомегаловируса человека (CMV).

2. Рекомбинантная плазмидная ДНК по п. 1, характеризующаяся тем, что в ней содержится фрагмент ДНК, кодирующий аминокислотную последовательность лидерного пептида тяжелой цепи моноклонального антитела F10 с аминокислотной последовательностью SEQ ID NO: 1.

3. Рекомбинантная плазмидная ДНК по п. 1, характеризующаяся тем, что в ней содержится фрагмент ДНК, кодирующий аминокислотную последовательность фрагмента основного белка миелина 84-106 (МВР84-106) SEQ ID NO: 4.

4. Рекомбинантная плазмидная ДНК по п. 1, характеризующаяся тем, что в ней содержится фрагмент ДНК, кодирующий аминокислотную последовательность Fc-фрагмента антитела IgG1 (доменов СН2-СН3) человека SEQ ID NO: 6.

5. Способ получения эукариотической линии клеток CHO-S18 - продуцента MBP84-106-Fc, которая получена путем трансфекции клеток линии СНО DG44 (не являющейся эмбриональными клетками человека) рекомбинантной плазмидной ДНК по п. 1.

6. Линия эукариотических клеток CHO-S18 - продуцент MBP84-106-Fc, полученная путем трансфекции клеток линии СНО DG44 рекомбинантной плазмидной ДНК по п. 1.

7. Способ получения слитного белка МВР84-106 с константным доменом иммуноглобулина человека (MBP84-106-Fc), включающий:

- культивирование в питательной среде клеток линии CHO-S18 - продуцент МВР84-106-Fc по п. 5,

- выделение полученного целевого белка MBP84-106-Fc из культуральной жидкости.



 

Похожие патенты:

Изобретение относится к биотехнологии. Описан способ лечения расстройства, связанного или ассоциированного с действием желчных кислот, включающий введение пептида.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению человеческих белков в клетках СНО, и может быть использовано для получения человеческого антитела к гемагглютинину вируса гриппа А (ВГА) изотипа IgA2m1.

Изобретение относится к области биохимии, в частности к молекуле нуклеиновой кислоты, кодирующей первый полипептид, второй полипептид, сигнальную последовательность mBIP и либо белок оболочки, либо адаптерный белок.

Настоящее изобретение относится к области биотехнологии, конкретно к проникающим в клетку пептидам, и может быть использовано в медицине путем доставки терапевтической карго-молекулы в клетку млекопитающего.

Изобретение относится к области биотехнологии, конкретно к вариантам исходного альбумина, что может быть использовано в медицине. Получают полипептид, который является вариантом альбумина или его фрагментом, где этот полипептид содержит изменения в двух или более положениях, выбранных из положений: (а) 492 и 580; (b) 492 и 574; (с) 492 и 550; (d) 550 и 573; (e) 550 и 574; (f) 550 и 580 в SEQ ID NO: 2, и не содержит мутаций E492G+K573P, E492G+K573A или E492G+N503K, а также получают слитые с ним полипептиды, полинуклеотиды, кодирующие эти варианты, конъюгаты, ассоциаты и наночастицы с ним, композиции, векторы, клетки-хозяева, содержащие эти полинуклеотиды, и способы использования этих вариантов.

Изобретение относится к области биохимии, генной инженерии и биотехнологии, в частности к рекомбинантной плазмидной ДНК pET31b-pHLIP. Указанная плазмидная ДНК кодирует аминокислотную последовательность рекомбинантного рН-зависимого встраивающегося пептида и обеспечивает его синтез в составе белка-слияния с кетостероидизомеразой.

Изобретение относится к области генной инженерии, конкретно к рекомбинантному получению антиангиогенных белков, и может быть использовано в медицине. Сконструирована рекомбинантная плазмидная ДНК pERIG-PGS, обеспечивающая синтез в клетках Escherichia coli гибридного белка GyrA-PGS, содержащего модифицированный мини-интеин Мхе GyrA и антиангиогенный пептид Пигастин - производное фрагмента [44-77] фактора роста пигментного эпителия человека с присоединенной к С-концу последовательностью Pro-Gly-Pro.

Предложены композиция среды и способ для получения ботулинического токсина. Данная группа изобретений относится к биотехнологии.

Настоящее изобретение относится к области биотехнологии, конкретно к пептидомиметикам эпитопа аполипопротеина А-I, и может быть использовано в медицине. Пептидомиметик эпитопа аполипопротеина А-I, способный специфично связываться с антителами против аполипопротеина А-I, используется в диагностическом иммунологическом методе анализа и позволяет выявить ряд сердечно-сосудистых заболеваний по образцу биологической жидкости.

Изобретение относится к биотехнологии, конкретно к получению рекомбинантных белков человека, и может быть использовано для получения и очистки рекомбинантного белка GAGE1 человека.

Настоящее изобретение относится к области иммунологии. Предложено антитело, обладающее иммунологической реактивностью в отношении белка CAPRIN-1.

Настоящее изобретение относится к иммунологии. Предложен связывающий агент, представляющий собой биспецифическое антитело, содержащее домен, связывающийся с клаудином (CLDN), а именно CLDN18.2, и домен, связывающийся с CD3.

Настоящее изобретение относится к области биотехнологии, конкретно к полипептидному биомаркеру эффективности применения ингибитора FGFR при лечении рака мочевого пузыря и рака легких, что может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению человеческих белков в клетках СНО, и может быть использовано для получения человеческого антитела к гемагглютинину вируса гриппа А (ВГА) изотипа IgA2m1.

Данное изобретение относится к иммунологии. Предложен выделенный пептид-эпитоп, полученный из ассоциированной с кинетохором молекулы 2 (KNTC2) и обладающий способностью к индукции цитотоксических T-лимфоцитов (CTL) в присутствии антигенпрезентирующей клетки (APC), несущей HLA-A*0201.

Настоящее изобретение относится к иммунологии. Предложен полипептид, способный связываться с поверхностным антигеном вируса гепатита B (HBV) и поверхностным антигеном, презентируемым иммунными эффекторными клетками.

Изобретение относится к биотехнологии. Описан вектор экспрессии CAR, содержащий нуклеиновую кислоту, кодирующую химерный антигенный рецептор (CAR), и нуклеиновую кислоту, кодирующую иммуномодулирующий фактор Т-клетки, при этом нуклеиновая кислота, кодирующая иммуномодулирующий фактор Т-клетки, представляет собой нуклеиновую кислоту, кодирующую интерлейкин-7, и нуклеиновую кислоту, кодирующую CCL19.

Изобретение относится к области биотехнологии, конкретно к вариантам исходного альбумина, что может быть использовано в медицине. Получают полипептид, который является вариантом альбумина или его фрагментом, где этот полипептид содержит изменения в двух или более положениях, выбранных из положений: (а) 492 и 580; (b) 492 и 574; (с) 492 и 550; (d) 550 и 573; (e) 550 и 574; (f) 550 и 580 в SEQ ID NO: 2, и не содержит мутаций E492G+K573P, E492G+K573A или E492G+N503K, а также получают слитые с ним полипептиды, полинуклеотиды, кодирующие эти варианты, конъюгаты, ассоциаты и наночастицы с ним, композиции, векторы, клетки-хозяева, содержащие эти полинуклеотиды, и способы использования этих вариантов.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, способные к специфическому связыванию с фолатным рецептором человека 1 (FOLR1).

Изобретение относится к области биотехнологии, конкретно к антителам, которые специфично связываются с гепсидином, что может быть использовано в медицине. Получают моноклональные антитела к пептиду N-концевой части гепсидина, которые используют в составе композиции и применяют для лечения заболеваний, ассоциированных с повышенным уровнем гепсидина, или нарушений гомеостаза железа.

Изобретение относится к области биотехнологии, конкретно к способу выделения клеток внелуковичной дермальной оболочки волосяного фолликула (NBDS), и может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 и затем с Fc-фрагментом антитела IgG 1 человека, в клетках яичника китайского хомячка. Конструируют рекомбинантный бипромоторный вектор экспрессии pOptiVEC-MBP84-106-Fc, обеспечивающий биосинтез бифункциональной молекулы MBP84-106-Fc в культивируемых клетках СНО. Линию клеток CHO-S18 - продуцента MBP84-106-Fc - получают путем трансфекции клеток линии СНО DG44 вектором pOptiVEC-MBP84-106-Fc. Предложенное изобретение позволяет получить линию клеток СНО, стабильно продуцирующую в культуральную жидкость белок MBP84-106-Fc с выходом 20 мкг в мл кондиционированной среды. 4 н. и 3 з.п. ф-лы, 5 ил., 1 табл., 4 пр.

Наверх