Анти-cd 16 связывающие молекулы



Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы

 


Владельцы патента RU 2491294:

АФФИМЕД ТЕРАПЕУТИКС АГ (DE)

Настоящее изобретение относится к области биотехнологии и иммунологии. Предложено антитело, специфично связывающееся с формой A FcγRIII (CD16) (FcγRIIIA, CD16A) и не связывающееся специфично с формой В (FcγRIIIB, CD16B), его антигенсвязывающий фрагмент и мультиспецифичное антитело, включающее антигенсвязывающий фрагмент антитела по изобретению. Рассмотрены композиции, содержащие антитело по изобретению или его антигенсвязывающий фрагмент, и их применение в лечении аутоиммунных, воспалительных, инфекционных заболеваний, аллергии и рака, а также набор для детектирования FcγRIIIA. Описаны полинуклеотиды, векторы и клетки-хозяева и способы получения антитела по изобретению или его антигенсвязывающего фрагмента. Настоящее изобретение обеспечивает новые антитела к FcγRIIIA и, таким образом, может найти дальнейшее применение в терапии FcyRIIIA-опосредованных заболеваний. 14 н. и 27 з.п. ф-лы, 24 пр., 8 ил., 5 табл.

 

Настоящее изобретение относится в целом к связывающим молекулам, которые специфично связываются с рецептором III к Fc гамма человека, экспрессирующимся на поверхности клеток - естественных киллеров (NK-клеток) и макрофагов (т.е. FcγRIIIA), и в частности, к связывающим молекулам, которые специфично связываются с формой A рецептора FcγRIII, но не связываются с формой B рецептора FcγRIII, а также к применению таких связывающих молекул в диагностике и лечении заболевания. Настоящее изобретение, кроме того, распространяется на полинуклеотиды, кодирующие такие связывающие молекулы, клетки-хозяева, включающие такие полинуклеотиды, и способы получения связывающих молекул согласно настоящему изобретения с применением таких клеток-хозяев.

CD16 (также известный как FcγRIII), низкоаффинный рецептор к Fc-фрагменту некоторых IgG, который, как известно, вовлечен в антителозависимую клеточную цитотоксичность (АЗКЦ), представляет собой наиболее изученный мембранный рецептор, ответственный за запуск лизиса клеток-мишеней NK-клетками (Mandelboim et al., 1999). NK-клетки человека составляют приблизительно 15% всех лимфоцитов, и фенотипически их определяют по экспрессии в них CD56 и отсутствию экспрессии CD3 (Robertson & Ritz, 1990). Большинство (около 90%) NK-клеток человека экспрессируют CD56 в низкой плотности (CD56dim), а FcγRIII (CD16) на высоком уровне (Cooper et al., 2001). FcγRIII человека существует в виде двух изоформ, FcγRIIIA и FcγRIIIB, имеющих 96% идентичность по последовательностям внеклеточных иммуноглобулин-связывающих областей (van de Winkel & Capel, 1993).

FcγRIIIA экспрессируется на поверхности макрофагов, тучных клеток и NK-клеток как трансмембранный рецептор. На поверхности NK-клеткок альфа цепь FcγRIIIA ассоциирует с иммунорецепторным богатым тирозином активаторным мотивом (ITAM, immunoreceptor tyrosine-based activation motif), содержащим γ-цепь рецептора FcεRI и/или ζ-цепь T-клеточного рецептора (TCR)/CD3, принимая участие в передачи сигналов (Wirthmueller et al., 1992). В NK-клетках наблюдается взаимодействие FcγRIIIA с различными комбинациями гомо- и гетеродиморов γ и ζ, цепей, что позволяет указывает на возможность существования различных сигнальных путей через различные комплексы FcγRIIIA в NK-клетках (Anderson et al., 1990, PNAS 87(6): 2274-2278; Ackerly et al., 1992, Int. J. Cancer Suppl. 7: 11-14).

FcγRIIIB присутствует на поверхности полиморфноядерных гранулоцитов (ПЯГ) в виде гликозилфосфатидилинозитол (ГФИ)-заякоренного рецептора (изоформа FcγRIIIB), который не может запускать уничтожение опухолевых клеток (van de Winkel & Capel, 1993). Кроме того, FcγRIIIB существует в виде растворимого рецептора в сыворотке, и при связывании с антителом может in vivo вызывать побочные эффекты через образование иммунных комплексов.

Было показано, что клетки-эффекторы, экспрессирующие FcγR, вовлечены в уничтожение опухолевых клеток по механизму АЗКЦ. На основе этого было разработано несколько иммунотерапевтических подходов к терапии рака, которые включают применение активности FcγR, например, специфичные к опухолям моноклональные антитела могут опосредовать уничтожение опухолевых клеток по механизму АЗКЦ, индуцируемой посредством связывания с FcγRs. Также с целью улучшения рекрутирования клеток-эффекторов были получены молекулы с двойной специфичностью: с одной специфичностью по отношению к опухолевым клеткам и с другой специфичностью по отношению либо к FcγRI на поверхности гранулоцитов, либо к FcγRIII на поверхности NK-клеток (van Spriel et al., 2000 Immunol. Today, 21: 391-397).

Как клеточные факторы врожденного иммунитета NK-клетки являются профессиональными клетками-киллерами и, в отличие от T-клеток, как правило, существуют в конститутивно активированном состоянии, не требующем дополнительной (пре-)стимуляции. В противоположность этому, покоящиеся цитотоксические T-клетки требуют активации посредством связывания комплекса антиген-ГКГС и последующей костимуляции через CD28. Таким образом, среди иммунных клеток-эффекторов NK-клетка является одним из наиболее привлекательных кандидатов для применения в иммунотерапии, и были получены антитела с двойной специфичностью: специфичные к CD16 (FcγRIII) и HER-2/neu или CD16 и CD30 (Arndt et al., 1999 Blood 94: 2562-2568; McCall et al., 2001 J. Immunol. 166: 6112-6117).

Большинство антител к CD16, полученные к настоящему времени, не способны различать две изоформы CD16, Fc RIIIA и Fc RIIIB, исключением являются моноклональное антитело (MAT) 1D3, которое связывается только с формой CD16, экспрессирующейся на поверхности нейтрофилов, т.е. FcγRIIIB, и моноклональные антитела, которые узнают различные аллотипические формы FcγRIIIB (Ory et al. 1989, J. Clin. Invest. 83: 1676-81; Huizinga et al. 1990 Blood 75: 213-7; Tamm & Schmidt 1996, J. Immunol. 1996 157: 1576-1581). Однако до настоящего времени отсутствовали примеры молекул, которые бы специфично связывались с Fc RIIIA, формой экспрессирующейся на поверхности NK-клеток, и не связывались с Fc RIIIB.

Тем не менее антитело, специфичное к FcγRIIIA, было бы особенно полезно в качестве компонента связывающих молекул с двойной или множественной специфичностью, направленных на ассоциированные с заболеванием клетки, поскольку оно рекрутировало бы главным образом NK-клетки и не связывалось бы циркулирующим растворимым FcγRIIIB и не уклонялось от связывания с NK-клетками, связываясь с нейтрофилами или активированными эозинофилами. Для эффективного опосредования осуществляемого NK-клетками цитолиза специфичное к FcγRIIIA антитело должно не только связаться с NK-клетками, но также активировать их при связывании.

Мы идентифицировали несколько новых анти-CD16 одноцепочечных антител scFv, демонстрирующих это полезное свойство, т.е. они специфичны к FcγRIIIA, не связываются специфично с FcγRIIIB, и они также способны активировать NK-клетки при связывании.

Также известно, что FcγRIIIA демонстрирует несколько вариантов аллельного полиморфизма, в частности, в положениях 48 и 158 IgG-связывающего домена. Оописанные ранее антитела к CD16 (анти CD-16), как было показано, имеют различную аффиность связывания с различными полиморфными формами FcγRIIIA, и в работе Koene et al. (1997, Blood 90: 1109-1114) было определено различие в связывании некоторых из этих антител с полиморфизмом в положении 158. Поскольку генные частоты аллели FcγRIIIA158F и аллели FcγRIIIA158V составляют приблизительно 0,6 и 0,4, соответственно, то было бы полезно, чтобы любое анти-CD16A антитело узнавало обе аллельные формы, чтобы гарантировать, что анти-CD16 антитело будет способно связывать и активировать популяцию NK-клеток в организме любого пациента.

В данной заявке описано одноцепочечное анти CD-16 антитело scFv, которое узнает как γRIIIA158V, так и FcγRIIIA158F с приблизительно равной аффинностью, но не связывается с FcγRIIIB.

Новые описаннве в настоящей заявке scFv, можно, таким образом, применять для получения новых связывающих молекул, которые можно применять в качестве терапевтических агентов. Термин «связывающая молекула» в данной заявке охватывает антитела и антигенсвязывающие фрагменты антител, причем указанные антитела или антигенсвязывающие фрагменты антител селективно и специфично связываются с FcγRIIIA и не связываются специфично с FcγRIIIB, а также гибридные белки таких антител или антигенсвязывающих фрагментов, и конъюгаты белков, включающие такие антитела или антигенсвязывающие фрагменты.

Таким образом, согласно первому аспекту настоящего изобретения предложена связывающая молекула, обладающая специфичностью по меньшей мере к одному антигену, причем указанный антиген представляет собой FcγRIIIA и связывающая молекула не связывается специфично с FcγRIIIB.

В предпочтительном варианте реализации специфичность по отношению к FcγRIIIA обеспечивается антителом или антигенсвязывающим фрагментом антитела. Соответственно, связывающие молекулы согласно настоящему изобретению могут включать, или в, некоторых вариантах реализации, состоять из по меньшей мере одного антитела (или антигенсвязывающего фрагмента антитела), которое обладает специфичностью к FcγRIIIA, но не к FcγRIIIB.

Антитела, обеспечивающие специфичность к FcγRIIIA, могут представлять собой природные антитела, либо они могут представлять собой рекомбинантные антитела. Антитела согласно настоящему изобретению могут относиться к любому классу иммуноглобулинов, например, они могут представлять собой антитело IgA, IgD, IgE, IgG или IgM. Предпочтительно антитело представляет собой антитело IgG. Антигенсвязывающий фрагмент, подходящий для применения согласно настоящему изобретению, может быть природным или рекомбинантным и включает легкие цепи иммуноглобулина, тяжелые цепи иммуноглобулина, VH домены (вариабельные области тяжелой цепи), VL домены (вариабельные области легкой цепи), антитела Fv, одноцепочечные антитела (включая scFv-антитела), Fab-фрагменты, ди-Fab-фрагменты, Fab'-фрагменты, F(ab')2-фрагменты и гипервариабельные участки (CDR). Специалисту в данной области хорошо известны такие антигенсвязывающие фрагменты и их получение. Во избежание сомнений, термин одноцепочечное антитело в данной заявке относится к полученной методами генной инженерии одноцепочечной молекуле, включающей вариабельную область легкой цепи и вариабельную область тяжелой цепи, связанные подходящим гибким полипептидным линкером. Примеры одноцепочечных антител включают антитела scFv и димеры антител (diabody).

В одном из вариантов реализации антитело или антигенсвязывающий фрагмент, определяющие специфичность к FcγRIIIA, включают по меньшей мере один гипервариабельный участок (CDR) человека, предпочтительно выбранный из гипервариабельных участков (CDR), описанных в Таблице 1 ниже.

Таблица 1
Последовательности аминокислот легкой и тяжелой цепей человека CDR антител scFv, которые селективно и специфично связываются с FcγRIIIA и не связываются специфично с FcγRIIIB
Цепь CDR1 CDR2 CDR3
1. Тяжелая цепь TSYYMH IINPSGGSTSYAQKFQG GSAYYYDFADY
(SEQ ID №17) (SEQ ID №18) (SEQ ID №19)
SGDKLEEKYVS QDNKRPS QVWDNYSVL
2. Легкая цепь (SEQ ID №20) (SEQ ID №21) (SEQ ID №22)
GGNNIESRNVH RDNNRPS QVWDNYTVL
3. Легкая цепь (SEQ ID №23) (SEQ ID №24) (SEQ ID №25)
GGNNIGSKNVH RDSNRPS QVWDNYIVL
4. Легкая цепь (SEQ ID №26) (SEQ ID №27) (SEQ ID №28)
5. Легкая цепь EGNNIGSKNVH DDSDRPS QVWDNYSVL
(SEQ ID №29) (SEQ ID №30) (SEQ ID №22)
GGNNIGSKNVH RDSSRPS QVWDDYIW
6. Легкая цепь (SEQ ID №26) (SEQ ID №31) (SEQ ID №32)
7. Легкая цепь GANDIGKRNVH QDNKRPS QVWDNYSVL
(SEQ ID №33) (SEQ ID №21) (SEQ ID №22)
8. Легкая цепь GGHNIGSKNVH QDNKRPS QVWDNYSVL
(SEQ ID №34) (SEQ ID №35) (SEQ ID №22)

Для специалиста в данной области очевидно, что антитела и их антигенсвязывающие фрагменты, за исключением одиночных CDR, как правило, включают три CDR легкой цепи и/или три CDR тяжелой цепи. Соответственно, в дальнейших вариантах реализации антитело или антигенсвязывающий фрагмент со специфичностью к FcγRIIIA включает три CDR легкой цепи человека и/или три CDR тяжелой цепи человека. Предпочтительно, CDR1 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №20, SEQ ID №23, SEQ ID №26, SEQ ID №29, SEQ ID №33, и SEQ ID №34, CDR2 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №21, SEQ ID №24, SEQ ID №27, SEQ ID №30, SEQ ID №31 и SEQ ID №35, и CDR3 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №22, SEQ ID №25, SEQ ID №28 и SEQ ID №32. Предпочтительно CDR1 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №17, CDR2 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №18, и CDR3 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №19.

В случае если антитело или антигенсвязывающий фрагмент включает вариабельную область легкой цепи или состоит из вариабельной области легкой цепи, оно может иметь одну из следующих последовательностей аминокислот:

SEQ ID №10:

SYELMQPPSVSVSSGQTASIPCSGDKLEEKYVSWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA;

SEQ ID №11:

SYELTQPLSESVAQGQTARITCGGNNIESRNVHWYQQKPGQAPVLVIYRDNNRPSGIP

ERFSGSNSGNMATLTISRAQA;

SEQ ID №12:

SYELTQPPSVAVAPGKTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIP

ERFSGSNSGNTATLTISRAQA;

SEQ ID №13:

QAVLTQPPSVSVAPGQTARIPCEGNNIGSKNVHWYRQKPGQVPVLVMYDDSDRPSGI

PERFSGSNSGNTATLTISGTQA;

SEQ ID №14:

QPVLTQPLSVSVAPGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSSRPSGIP

ERLSGSNSGDTATLTISRAQA;

SEQ ID №15:

SYELTQPPSVSVTPGQTATITCGANDIGKRNVHWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA;

SEQ ID №16:

QPVLTQPSSVSVAPGQTATISCGGHNIGSKNVHWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA.

В случае, если антитело или антигенсвязывающий фрагмент включает вариабельную область тяжелой цепи или состоит из вариабельной области тяжелой цепи, она может иметь следующую последовательность аминокислот (SEQ ID №9):

EVQLVQSGAEVKKPGESLKVSCKASGYTFTSYYMHWVRQAPGQGLE

WMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGSAYY

YDFADYWGQGTLVTVSS.

В предпочтительном варианте реализации антитело или антигенсвязывающий фрагмент, обеспечивающий специфичность к FcγRIIIA, является полностью человеческим и.

В дальнейших предпочтительных вариантах реализации связывающая молекула согласно настоящему изобретению способна активировать клетки человека, экспрессирующие FcγRIIIA, при связывании с FcγRIIIA, экспрессирующимся на поверхности таких клеток, т.е. связывающая молекула способна вызывать биологический ответ, в частности, к сигнальный ответ, при связывании с FcγRIIIA. Предпочтительно, связывающая молекула также способна запускать уничтожение клеток, некоторым образом аналогичное антителозависимой клеточной цитотоксичности (АЗКЦ), посредством связывания с такими клетками.

С тем, чтобы определить, способны ли связывающие молекулы согласно настоящему изобретению активировать клетки человека, экспрессирующие FcγRIIIA, их можно протестировать на способность вызывать мобилизацию кальция в NK-клетках периферической крови, например, как описано в данной заявке в Примерах. Способность связывающих молекул согласно настоящему изобретению запускать цитотоксичность, опосредованную NK-клетками, можно также протестировать, как описано в данной заявке в Примерах, с применением, например, способа анализа с высвобождением кальцеина для обнаружения перенаправленного клеточного лизиса с применением свежевыделенных NK-клеток.

Настоящее изобретение также обеспечивает связывающие молекулы, которые не только обладают специфичностью к FcγRIIIA и в то же время не имеют специфичности к FcγRIIIB, но обладают также специфичностью к одному или более дополнительным антигенам. Таким образом, связывающие молекулы согласно настоящему изобретению могут быть мультиспецифичными. Термин мультиспецифичный (обладающий множественной специфичностью) в данной заявке означает, что связывающая молекула согласно настоящему изобретению, не обладающая специфичностью к FcγRIIIB, обладает по меньшей мере двумя специфичностями, одна из которых к FcγRIIIA. Таким образом, мультиспецифичные связывающие молекулы согласно настоящему изобретению, охватывают молекулы по меньшей мере с двумя специфичностями, тремя специфичностями и четырьмя специфичностями, такие как, например, антитела с двумя специфичностями, включая одноцепочечные димерные антитела (diabodies), (scFv)2, тандемные димерные антитела (TandAb); тримерные антитела (tri-bodies) (антитело с тремя специфичностями); тетрамерные антитела (tetra-bodies) (антитело с четырьмя специфичностями); и комбинацию scFv и димеров антител (flexibodies) (см. Le Gall et al. 1999 FEBS Letts 453: 164-168 и WO 03/025018).

Благодаря своей мультиспецифичности, связывающие молекулы согласно данному аспекту настоящего изобретения могут нацеливать макрофаги или NK-клетки на дополнительные антигены или даже на клетки, несущие такие антигены, что делает возможным уничтожение антигена или клетки, несущей антиген, посредством фагоцитоза или опосредуемого NK-клетками лизиса клеток. Например, связывающая молекула согласно настоящему изобретению может обладать дополнительной специфичностью по отношению к одному или более антигенам, специфичным для опухоли, и может, таким образом, нацеливать NK-клетки на опухолевые клетки. Активация NK-клетки, вызванная связыванием связывающей молекулы с FcγRIIIA, приводит к уничтожению клеток опухоли. Таким образом, связывающие молекулы согласно настоящему изобретению можно применять для лечения и/или устранения больных клеток и инфекционных агентов (таких как, например, бактерии, грибы, микоплазмы, вирусы, паразиты, прионы) в зависимости от дополнительной специфичности или специфичностей связывающей молекулы.

Таким образом, дополнительный аспект настоящего изобретения обеспечивает связывающую молекулу, как описано выше в настоящей заявке, причем связывающая молекула обладает специфичностью по меньшей мере к одному дополнительному антигену. В одном из вариантов реализации пуказанный дополнительный антиген представляет собой антиген клеточной поверхности. Примерами антигенов клеточной поверхности, по отношению к которым демонстрируют специфичность связывающие молекулы согласно данному варианту реализации изобретения, являются CD19, CD20, CD30, белок-предшественник рецептора к ламинину (также известный как онкофетальный антиген незрелого рецептора к ламинину, OFA-iLR), рецептор к эпидермальному фактору роста EGFR1 (также известный как HER-1, ErbB1), EGFR2 (также известный как HER-2, ErbB2, neu), EGFR3 (также известный как HER-3), эпителиальная молекула адгезии клеток (Ep-CAM), PLAP (плацентарная щелочная фосфатаза), антиген Томсена-Фриденрайха (TF), MUC-1 (муцин), рецептор к инсулиноподобному фактору роста IGFR, рецептор к интерлейкину 4 IL4-R альфа, IL13-R, FcεRI и CD5.

В другом варианте указанный дополнительный антиген представляет собой антиген инфекционного агента, например, антиген может секретироваться с или экспрессироваться на наружной поверхности клетки-хозяина, инфицированной клетки, бактерии, гриба, микоплазмы, паразита или вируса, или может высвобождаться при лизисе такого инфекционного агента. Например, связывающая молекула согласно настоящему изобретению может обладать дополнительной специфичностью к вирусному белку, такому как gp34 или gp68 на поверхности инфицированных ЦМВ клеток, или к гемагглютинину в присутствии вируса гриппа, и может таким образом направленно воздействовать либо на зараженную вирусом клетку, либо непосредственно на вирус. Кроме того, в случае если инфекционным агентом является прион, прионовый белок сам по себе может являться антигеном.

В других вариантах реализации указанный дополнительный антиген представляет собой аллерген, или молекулу, вовлеченную в ответ организма на аллерген, такую как, например, циркулирующий IgE, или рецептор FcεRI (в особенности) тучных клеток.

Предпочтительно в связывающих молекулах согласно данному аспекту изобретения специфичность по отношению к по меньшей мере одному дополнительному антигену обеспечивается антителом или антигенсвязывающим фрагментом антитела. Как описано выше, специалист в данной области знаком с типами антител (IgA, IgD, IgE, IgG и IgM) и с антигенсвязывающими фрагментами, полученными из таких антител (например, легкими цепями иммуноглобулина, тяжелыми цепями иммуноглобулина, VH-доменами, VL-доменами, антителами Fv, антителами scFv, фрагментами Fab, фрагментами di-Fab, фрагментами Fab'-, фрагментами F(ab')2 и CDR), которые также можно применять в данном аспекте изобретения. В одном предпочтительном варианте реализации антитело представляет собой IgG.

Мультиспецифичные и, в частности, обладающие двумя специфичностями, связывающие молекулы согласно настоящему изобретению могут быть представлены в одной из следующих форм: обладающие двумя специфичностями IgG, IgG-scFv2, (scFv)4-IgG, (Fab')2, (scFv)2, (dsFv)2, гибридные белки Fab-scFv, (scFv)2-Fab, (scFv-CH2-CH3-scFv)2, димерное антитело (bibody), тримерное антитело (tribody), обладающий двумя специфичностями димер антител, стабилизированное дисульфидной связью (ds) димерное антитело (diabody), димерное антитело типа «knob-into-whole», одноцепочечное димерное антитело (scDb), тандемное димерное антитело (TandAb), комбинация scFv и димеров антител (flexibody), миниантитело DiBi (miniantibody), [(scFv)2-Fc]2, (scDb-CH3)2, (scDb-Fc)2, ди-димерное антитело (Di-diabody), тандемное антитело (Tandemab) (см. обзор (Kipriyanov & Le Gall, 2004; Marvin & Zhu, 2005). В предпочтительных вариантах реализации связывающая молекула представляет собой TandAb или Flexibody. В отличие от многих других форм антител с двумя специфичностями, TandAb представляет собой гомодимер, включающий только вариабельные области антитела, и его образование определяется ассоциацией комплементарных VH- и VL-доменов, расположенных в различных полипептидных цепях. TandAb по размеру в два раза больше diabody и (scFv)2, способно бивалентно связывать как клетки-эффекторы, так и клетки-мишени, и обладает улучшенными фармакокинетическими характеристиками по сравнению с diabody и (scFv)2, например оно имеет большую стабильность и повышенную биологическую активность как in vitro, так и in vivo (Kipriyanov et al., 1999; Cochlovius et al., 2000; Reusch et al., 2004). Образование пары между цепями имеющих сродство (когнатных) доменов VH и VL одинаковой специфичности можно также применять для образования обладающих двумя специфичностями тандемных молекул scFvB-diabodyA-scFvB, так называемых «flexibodies» (A и B могут иметь одинаковую и различную специфичность). В зависимости от того, насколько прочно ассоциированы комплементарные домены, вовлеченные в образование пар различных цепей, и от длины линкера, разделяющего их, могут быть сформированы димеры, тримеры и даже тетрамеры обладающих двумя специфичностями одноцепочечных молекул.

Примеры антител и антигенсвязывающих фрагментов, которые можно применять в данном аспекте изобретения и которые демонстрируют специфичность к CD19, CD20, CD30, белку-предшественнику рецептора к ламинину, EGFR1, EGFR2, EGFR3, Ep-CAM, PLAP, антигена Томсена-Фриденрайха (TF), MUC-1 (муцину), IGFR, CD5, IL4-R альфа, IL13-R, FcεRI и IgE, описаны в данной области как антитела к инфекционным агентам (см., например, EP-A-1314741, Reff et al. 1994 Blood 83: 435-445, EP-A-1005870, WO 01/92340, US 6,033,876, WO 86/03223, Buto et al. 1997 Int. J. Biol. Markers 12: 1-5, US 6,699,473, WO 98/50433, US 5,770195, EP-A-0502812, Carter et al. 1992 PNAS 89: 4285-4289, US 5,968,511, WO 04/106383, Nouri et al. 2000 BJU Int. 86: 894-900, EP-A-0429242, Ravn et al. 2004 J. Mol. Biol. 343: 985-996, Dahlenborg et al. 1997 Int. J. Cancer 70: 63-71, WO 88/05054, WO 02/053596, WO 04/071529, Studnicka et al. 1994 Protein Eng. 7: 805-814, Presta et al. 1993 J. Immunol. 151: 2623-2632). В случаях когда в данных источниках представлены последовательности аминокислот или последовательности нуклеиновых кислот, кодирующие такие антитела или антигенсвязывающие фрагменты, специалист в данной области способен применить такие последовательности непосредственно при получении связывающих молекул согласно настоящему изобретению. В случае, когда в данных источниках описаны гибридомы или клеточные линии, продуцирующие такие антитела или антигенсвязывающие фрагменты, специалист в данной области способен получить последовательности нуклеиновой кислты, кодирующие желаемое антитело или антигенсвязывающий фрагмент, из соответствующей гибридомы или клеточной линии с применением стандартных способов молекулярной биологии, и после того, как последовательности нуклеиновлй кислоты будут получены, их можно применять при создании связывающих молекул согласно настоящему изобретению.

Дополнительный аспект данного изобретения предусматривает связывающую молекулу согласно любому из аспектов или вариантов реализации, описанных выше, которая способна связываться с аллелью FcγRIIIA158F и аллелью FcγRIIIA158F с примерно одинаковой аффинностью, т.е. аффинность связывающей молекулы к двум 158 аллелям FcγRIIIA отличается не более чем в два раза. В предпочтительных вариантах реализации согласно данному аспекту настоящего изобретения специфичность к FcγRIIIA обеспечивается антителом или антигенсвязывающим фрагментом, полученным из scFv 4-LS21, описанным в данной заявке. В особенно предпочтительных вариантах реализации связывающие молекулы согласно данному аспекту изобретения имеют форму TandAb и включают антигенсвязывающие фрагменты, полученные из scFv 4-LS21, описанные в данной заявке, а также антигенсвязывающие фрагменты, обладающие специфичностью к CD19 или CD30.

Как понятно специалисту в данной области, в случае если предполагается применение связывающих молекул согласно настоящему изобретению в лечении и/или терапии людей, потенциальная иммуногенность связывающей молекулы должна быть минимизирована. Соответственно, в случае если специфичность FcγRIIIA и/или дополнительного антигена (антигенов) обеспечивается антителом или антигенсвязывающим фрагментом, предпочтительно, чтобы антитело или антигенсвязывающий фрагмент были химерными, с пересаженными CDR, гуманизированным или полностью человеческим. Более предпочтительные антитело или антигенсвязывающий фрагмент являются гуманизированными или полностью человеческими. Применение стандартных способов молекулярной биологии для осуществления гуманизации антител в настоящее время является обычной практикой в данной области, и, имея последовательность антитела, не относящегося к человеку, специалист в данной области без труда сможет получить гуманизированный вариант такого антитела. Термин «полностью человеческий» в данной заявке применительно к антителу или антигенсвязывающему фрагменту означает, что последовательности аминокислот антитела или антигенсвязывающего фрагмента получены из организма человека (т.е. происходят из него или могут быть обнаружены в нем).

Другой способ, который можно применять в качестве альтернативы или в дополнение к описанным выше способам уменьшения иммуногенности, - деиммунизация. Технология деиммунизации включает идентификацию и удаление эпитопов, распознаваемых T-хелперными (T-x) клетками, из антитела и других белковых биологических терапевтических агентов. Эпитопы T-x клеток включают короткие пептидные последовательности в составе белков, которые обладают способностью связываться с молекулами ГКГС II класса. T-клетки смогут распознавать комплексы пептид-ГКГС II класса, которые могут запускать активацию и дифференцировку T-x клеток, необходимую для инициации и поддержания иммуногенности через взаимодействие с В-клетками, что приводит к секреции антител, специфично связывающихся с введенным биологическим терапевтическим агентом. Для деиммунизации антитела идентифицируют эпитопы для T-x клеток в пределах последовательности антитела, например, автоматизированным методом предсказания связывания пептидов с молекулами ГКГС II класса человека (см. Altuvia et al., 1995; Schueler-Furman et al., 2000). Чтобы избежать узнавания T-клетками, идентифицированные таким образом эпитопы T-клеток устраняют из последовательности белка заменой аминокислот. Это можно осуществить путем применения стандартных методов молекулярной биологии, таких как, например, сайт-направленный мутагенез, для изменения последовательности нуклеиновых кислот, кодирующей эпитопы T-x клеток в терапевтическом белке. Этот способ позволяет модифицировать антитело или антигенсвязывающий фрагмент таким образом, чтобы уменьшить или избежать ответа на человеческие антимышиные антитела (НАМА, Human anti mouse antigenic) и/или антиидиотипического ответа (ответов) (Bander et al., 2003; Nanus et al., 2003). Соответственно, в дальнейших вариантах реализации связывающие молекулы согласно настоящему изобретению модифицируют таким образом, чтобы удалить любые эпитопы для T-x клеток, присутствующие в их последовательности. Такие связывающие молекулы упоминаются в данном изобретении как деиммунизированные связывающие молекулы.

В дополнительном аспекте связывающие молекулы согласно настоящему изобретению включают дополнительный функциональный домен. Этот функциональный домен может сообщать эффекторные свойства связывающей молекуле, например, функциональный домен может представлять собой FcR-связывающий пептид или Fc домен антитела, который, благодаря способности связываться с Fc рецепторами, сообщает эффекторные свойства связывающей молекуле. В качестве альтернативы, функциональный домен может представлять собой фермент, который способен преобразовывать пролекарство в активное лекарственное вредство. Таким образом, связывающие молекулы согласно настоящему изобретению можно применять в антитело-направленной терапии в применением пролекарств и ферментов (ADEPT, antibody-directed enzyme pro-drug therapy). В другом варианте реализации функциональный домен представляет собой белок или пептид, который обеспечивает увеличение периода полужизни связывающей молекулы в сыворотке. Примером такого белка является сывороточный альбумин или Fc-фрагмент IgG, который может увеличивать период полужизни связывающей молекулы в сыворотке, благодаря своей способности связываться с FcγRn (неонатальный рецептор к Fc). В дополнительных вариантах реализации функциональный домен может представлять собой цитокин.

В дополнительном аспекте связывающие молекулы согласно настоящему изобретению могут быть конъюгированы с молекулой-меткой или токсином. В случае если метка или токсин представляют собой белок, конъюгирование со связывающей молекулой можно осуществить посредством образования пептидной связи или химического конъюгирования. Таким образом, связывающая молекула согласно данному аспекту изобретения может находиться в форме гибридного белка, где метка или токсин соединены со связывающей молекулой пептидной связью, предпочтительно линкерным пептидом, или может находиться в форме химического конъюгата. Во избежание сомнений, термин конъюгирование в данной заявке обозначает, что два компонента физически связаны друг с другом химической связью, включающая пептидную связь (таким образом, конъюгаты включают гибридные белки), сложноэфирную связь или дисульфидный мостик.

Конъюгирование связывающей молекулы согласно настоящему изобретению с молекулой-меткой, например радиоактивной меткой, или флюоресцентной, или люминесцентной меткой (в том числе хемилюминесцентной), позволяет применять связывающую молекулу в качестве реагента для иммунологического окрашивания. Такой реагент можно применять для детекции, например, инфильтрирующих ткани NK-клеток, макрофагов или тучных клеток, экспрессирующих FcγRIIIA, или, в случае если связывающая молекула демонстрирует специфичность к дополнительному антигену, в комплексах для детектирования, состоящих из молекулы, связывающаей NK-клетку, и дополнительного антигена. Детекция последних может быть особенно полезна в диагностике заболевания или при наблюдении прогрессирования заболевания или ремиссии.

В случае если связывающая молекула согласно настоящему изобретению конъюгирована с молекулой токсина, например, рибозилтрансферазой, сериновой протеазой, активатором гуанилциклазы, кальмодулин-зависимой аденилциклазой, рибонуклеазой, ДНК-алкилирующим агентом или ингибитором митоза (например, доксорубицином) и т.п., ее можно применять для направленного воздействия на NK-клетки и макрофаги и их уничтожения. Такую связывающую молекулу можно таким образом применять как иммуноподавляющий агент. Специалисту в данной области будет понятно, что в данном аспекте настоящего изобретения предпочтительно, чтобы связывающая молекула демонстрировала специфичность только по отношению к одному антигену, т.е. FcγRIIIA. Подавления иммунной системы можно также достичь с помощью связывающих молекул, включающих моновалентный антигенсвязывающий фрагмент, который связывается селективно и специфично с FcγRIIIA, или состоящих из такого фрагмента. Такие моновалентные связывающие молекулы являются предпочтительными, поскольку они действуют как молекулы, блокируюющие рецептор FcγRIIIA, не образуют поперечные связи и, следовательно, не активируют NK-клетку или макрофаг. Предпочтительные моновалентные антигенсвязывающие фрагменты, направленные к FcγRIIIA, включают scFv, Fab, VH, VL и CDR.

Специалисту в данной области понятно, что в качестве альтернативы соединению с меткой или токсином посредством химического конъюгирования, можно также применять пептидные метки или пептидные токсины. Например, связывающая молекула согласно настоящему изобретению может также экспрессироваться в форме гибридного белка, соединенного с N- или C-концевой меткой, такой как, например, тетра-, пента- или гекса-гистидиновой меткой, c-myc или т.п.

Связывающие молекулы согласно настоящему изобретению можно получить путем экспрессии нуклеиновых кислот, кодирующих их, в любой подходящей системе для экспрессии белков. Таким образом, в дополнительном аспекте настоящего изобретения предложены полинуклеотиды, кодирующие связывающие молекулы согласно настоящему изобретению. Полинуклеотиды, которые особенно подходят для применения в данном аспекте настоящего изобретения, кодируют гипервариабельные участки (CDR), описанные в Таблице 1 выше. В частности, специалист, имея последовательность аминокислот гипервариабельных областей (CDR) легкой и тяжелой цепи из таблицы 1, сможет вывести последовательности полинуклеотидов, кодирующие различные гипервариабельные участки легкой и тяжелой цепей, из следующих последовательностей нуклеиновых кислот:

SEQ ID №1:

gaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctca;

SEQ ID №2:

tcctatgagctgatgcagccaccctcagtgtccgtgtcctcaggacagacagccagcatcccctgctctggagataaattggaggaaaaatatgtttcctggtatcaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №3:

tcctatgagctgacacagccactctcagagtcagtggcccagggacagacggccaggattacctgtgggggaaacaacattgaaagtagaaatgttcactggtaccagcagaagccaggccaggcccctgtgttggtcatctatagggataacaaccggccctctgggatccctgagcgattctctggctccaattcggggaacatggccaccctgaccatcagcagagcccaagccggggatgcagctgactattactgtcaggtgtgggacaactacactgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №4:

tcctatgagctgacacagccaccctcagtggcagtggccccaggaaagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatctatagggatagcaaccggccctctgggatccctgagcgattctctggctccaactcggggaacacggccaccctgaccatcagcagagcccaagccggggatgaggctgacttttattgtcaggtgtgggacaactatattgtgctgttcggcggagggaccaagctgaccgtcctg

SEQ ID №5:

caggctgtgctgactcagccgccctcagtgtcagtggccccaggacagacggccaggattccctgtgagggaaacaacattggaagtaaaaatgtccactggtatcggcagaagccaggccaggtccctgtcctggtcatgtatgatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №6:

cagcctgtgctgactcagccactctcagtgtcagtggccccgggacagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtactggtcatctatagggacagcagccggccctctgggatccctgagcgactctctggctccaactcgggggacacggccaccctgaccatcagcagagcccaggccggggatgaggctgactattactgtcaggtgtgggacgactacattgtggtcttcggcggagggaccaagctgaccgtccta

SEQ ID №7:

tcctatgagctgacacagccaccctcggtgtcagtgaccccaggacagacggccacgattacctgcggggcaaacgacattggaaaaagaaatgtccactggtaccaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №8:

cagcctgtgctgactcagccatcctcggtgtcagtggccccaggacagacggccacgatctcctgtgggggacacaacattgggagtaaaaatgtgcactggtaccagcagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №1 кодирует вариабельную область тяжелой цепи scFv человека, селективно и специфично связывающегося с FcγRIIIA, но не связывающегося специфично с FcγRIIIB. SEQ ID №№2-8 кодируют вариабельные области легких цепей scFv человека, которые селективно и специфично связываются с FcγRIIIA, но которые не связываются специфично с FcγRIIIB. Соответственно, SEQ ID №№1-8 также являются примерами полинуклеотидов согласно настоящему изобретению, и их можно применять при создании дополнительных связывающих молекул согласно настоящему изобретению.

Полинуклеотиды, кодирующие мультиспецифичные связывающие молекулы согласно настоящему изобретению, в частности связывающие молекулы с двумя специфичностями, можно создать, как описано в WO 03/025018, с применением нуклеиновых кислот, кодирующих домены VH и VL антитела, которое связывается селективно и специфично с FcγRIIIA, но не связывается специфично с FcγRIIIB, в комбинации с нуклеиновыми кислотами, кодирующими домены VH и VL антитела, обладающего специфичностью к дополнительному антигену.

Для экспрессии связывающей молекулы в подходящей системе для экспрессии белков полинуклеотид, кодирующий связывающий белок, функционально соединяют с подходящим промотором и, возможно, с подходящим терминатором транскрипции. Это можно осуществить путем введения полинуклеотида согласно настоящему изобретению в геном хозяина и применения промотора, присутствующего в геноме хозяина, для управления экспрессией полинуклеотида. Кроме того, полинуклеотид согласно настоящему изобретению можно вводить в клетки-хозяева в составе вектора, включающего полинуклеотид, функционально связанный с промотором и, возможно, с терминаторной областью. Такие векторы образуют еще один дополнительный аспект изобретения.

Как правило, промотор, с которым в составе вектора фунционально соединен полинуклеотид, кодирующий связывающую молекулу, представляет собой любой промотор, способный направлять экспрессию связывающей молекулы в клетке-хозяине, в которую предстоит ввести полинуклеотид и вектор. Таким образом, если желательно осуществлять экспрессию связывающей молекулы в бактериальной клетке, промотор должен быть функционально активен в этой бактериальной клетке. Аналогично, если необходима экспрессия связывающей молекулы в грибной системе экспрессии, промотор должен быть функционально активным в клетке гриба, и такая же логика действует, если необходимо ввести конструкт в систему экспрессии, на основе клеток млекопитающих, клеток насекомых или растений. В случае если полинуклеотиды согласно настоящему изобретению функционально связаны с подходящим участком терминатора транскрипции, то он опосредует терминацию транскрипции в клетках-хозяевах, в которых должна экспрессироваться связывающая молекула согласно настоящему изобретению. Терминаторы транскрипции, пригодные для этой цели, описаны в данной области техники.

В предпочтительных вариантах реализации полинуклеотиды согласно настоящему изобретению могут также быть функционально с сигнальной последовательностью, которая способна направлять экспрессию связывающей молекулы в определенное место в клетке или вне клетки. Например, в некоторых вариантах реализации может быть желательно, чтобы клетка-хозяин, секретировала связывающую молекулу, которая в ней экспрессируется. В этом случае сигнальная последовательность кодирует сигнал к секреции. В данной области описаны соответствующие сигналы к секреции бактерий, и одним из таких примеров является лидерная последовательность PelB. В других вариантах реализации, например, в тех, которые включают экспрессию в клетках эукариот, может быть желательным сохранить экспрессию связывающей молекулы в эндоплазматическом ретикулуме (ЭР). В этом случае сигнальная последовательность включает последовательность, необходимую для удерживания в ЭР, кодирующую мотив "KDEL" (SEQ ID №54), и в частности, кодирующую последовательность "SEKDEL" (SEQ ID №55).

Полинуклеотиды согласно настоящему изобретению можно также оптимизировать по составу кодонов согласно способам, легкодоступным в данной области, с предпочтением кодонов, подходящих для конкретного выбранного организма-хозяина для экспрессии.

Полинуклеотиды и векторы можно вводить в клетки-хозяева с применением любой подходящей методики. Для клеток эукариот такие методики включают трансфекцию с фосфатом кальция, применение диэтилаиноэтил-декстрана, электропорацию, бомбардировку частицами, опосредуемую липосомами трансфекцию или трансдукцию с применением ретровирусов, аденовирусов или других вирусов, например осповакцины, или, в случае клеток насекомых, бакуловирусов. Для клеток бактерий подходящие способы могут включать трансформацию с хлоридом кальция, электропорацию или трансфекцию с применением бактериофагов. Для клеток растений подходящие способы включают агробактериальную трансформацию, электропорацию, микроинъекцию в растительные клетки и протопласты, бомбардировку микрочастицами, бактериальную бомбардировку, в частности, метод «fibre» или «whisker», в зависимости от конкретного вида растения., которое подвергают трансформации Таким образом, в дополнительном аспекте настоящее изобретение обеспечивает клетки-хозяева, включающие полинуклеотиды или векторы согласно настоящему изобретению. Таким образом, клетки-хозяева из организмов, описанных ниже, и включающие полинуклеотиды или векторы согласно настоящему изобретению также следует рассматривать как конкретные варианты реализации данного аспекта.

Подходящие системы экспрессии для экспрессии связывающих молекул согласно настоящему изобретению включают микробные экспрессии в клетках микробов, например, бактерий (например, экспрессионные системы Е. coli. Bacillus) и системы экспрессии в клетках грибов, например, дрожжи (такие как, например, Saccharomyces cerevisiae, Schizosaccharomyces pombe, виды Pichia, виды Hanensula) и другие системы экспрессии в клетках грибов (например, системы экспрессии в клетках мицеллиальных грибов, полученных из видов Aspergillus, Trichoderma reese и Neurospora crassa)); системы экспрессии в клетках млекопитающих, например, клетках CHO, клетках NS0, клетках HEK 293; системы экспрессии в клетках насекомых и системы экспрессии в клетках растений. Сафлор является особенно предпочтительной растительной экспрессионной системой. Специалисту известны такие экспрессионные системы, полностью описанные в данной области техники.

Настоящее изобретение также обеспечивает способы получения связывающих молекул согласно настоящему изобретению. Таким образом, в дальнейшем аспекте предложен способ получения связывающей молекулы, описанной в данной заявке, который включает введение в клетку-хозяина полинуклеотида или вектора согласно настоящему изобретению и культивирование указанных клеток-хозяев в условиях, при которых экспрессируется связывающая молекула. Условия для выращивания и поддержания клеток-хозяев, а также способствующие экспрессии связывающих молекул согласно настоящему изобретению такими клетками-хозяевами, полностью описаны в данной области техники. В одном варианте реализации способ дополнительно включает выделение и, возможно, дальнейшую очистку связывающей молекулы.

В случае если связывающая молекула согласно настоящему изобретению включает молекулу-метку или молекулу токсина, химически конъюгированную со связывающей молекулой, конъюгированную связывающую молекулу можно получить путем введения полинуклеотида или вектора согласно настоящему изобретению в клетку-хозяина, культивирования клетки-хозяина в условиях, при которых происходит экспрессия связывающей молекулы согласно настоящему изобретению, выделения экспрессированной связывающей молекулы и конъюгирования выделенной связывающей молекулы с подходящей меткой или токсином. Как правило, стадия конъюгирования включает применение гетеробифункциональных агентов, которые вызывают образование дисульфидных или тиоэфирных связей, как описано в данной области (стандартные методики, относящиеся к применению перекрестносшивающих агентов, см., например, в Hermanson, G.T. "Bioconjugate Techniques" Academic Press, London, 1996).

Специалисту ясно, что в некоторых вариантах реализации настоящего изобретения может быть желательным увеличение периода полужизни связывающей молекулы в циркулирующей крови в организме. Этого можно достичь различными способами, например, путем конструирования связывающей молекулы в форме гибридного белка, например, с альбумином, как описано выше в настоящей заявке. Дополнительные способы увеличения периода полужизни молекулы в сыворотке хорошо известны и включают, например, пегилирование, сиалилирование и гликозилирование. Соответственно, настоящее изобретение охватывает связывающие молекулы, как описано выше, которые пегилированы, сиалилированы и гликозилированы

Настоящее изобретение включает также композиции, включающие связывающую молекулу, и по меньшей мере один дополнительный компонент. Например, специалисту в данной области понятно, что при выделении связывающей молекулы из клеток-хозяев после экспрессии, можно получить композиции, включающие в значительной степени очищенную связывающую молекулу, но содержащие также примесь, разбавитель, буфер или т.п. Такие промежуточные композиции могут подходить для непосредственного дальнейшего применения, либо связывающую молекулу можно подвергать дополнительной очистке.

Композиции согласно настоящему изобретению могут также включать связывающую молекулу согласно настоящему изобретению в комбинации с любым подходящим фармацевтически приемлемым носителем, наполнителем, разбавителем и/или стабилизатором. Специалисту известны такие компоненты, описанные в данной области. Предпочтительно такая композиция находится в любой форме, подходящей для введения пациенту, в частности в форме, подходящей для парентерального введения, например путем инъекции или инфузии.

В случае если композиция предназначена для инъекции или инфузиии, она может иметь форму суспензии, раствора или эмульсии в масляной или водной среде и содержать агенты для приготовления препарата, например, суспендирующие, консервирующие, стабилизирующие и/или диспергирующие агенты. Кроме того, связывающая молекула или композиция могут быть в сухой форме, для восстановления перед применением с помощью соответствующей стерильной жидкости.

Связывающие молекулы и композиции согласно настоящему изобретению, в частности мультиспецифичные связывающие молекулы и композиции, содержащие таковые, можно применять для диагностики и/или лечения заболевания, такого как, например, аутоиммунное заболевание, воспалительное заболевание, инфекционное заболевание (включая болезнь трансплантат-против-хозяина), аллергия и рак (например, лимфома не-Ходжкина; хронический лимфолейкоз; лимфома/болезнь Ходжкина; солидные опухоли, например, при раке груди, раке яичников, раке толстой кишки, раке почек или раке желчных протоков; минимальное остаточное заболевание; метастатические опухоли, например метастазы в легких, костях, печени или мозге).

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к антигену CD19 или CD20, могут быть особенно полезны при лечении лимфомы не-Ходжкина.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EGFR1, можно могут быть особенно полезны при лечении типов раков, при которых экспрессия EGFR1 увеличена или изменена, например, рака груди, мочевого пузыря, головы и шеи, предстательной железы, почек, немелкоклеточного рака легких, колоректального рака и глиома.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к антигену ТФ, можно могут быть особенно полезны в лечении рака груди или толстой кишки и/или метастазов в печень.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к CD30, могут быть особенно полезны в лечении болезни Ходжкина.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к альфа-цепи рецептора IL4 (IL4R альфа), могут быть особенно полезна в лечении солидных опухолей, в частности, карциномы груди, яичников, системы почек, головы и шеи, злокачественной меланомы и связанной со СПИДом саркомы Калоши.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EGFR3/HER3 и/или EGFR2/neu, могут быть особенно полезны в лечении рака груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к IGFR, могут быть особенно полезны в лечении рака предстательной железы, колоректального рака, рака яичников или рака груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к CD5, могут быть особенно полезны в лечении хронического лимфолейкоза.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к MUC-1, могут быть особенно полезны в лечении рака желудка и рака яичников.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EpCAM, могут быть особенно полезны в лечении карцином толстой кишки, почек и груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к PLAP, могут быть особенно полезны в лечении рака яичников или яичка.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к OFA-iLR, могут быть особенно полезны в лечении метастатических опухолей.

В дополнительном аспекте настоящее изобретение обеспечивает применение связывающей молекулы, как описано выше, в производстве лекарственного препарата для лечения аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака (например, лимфомы не-Ходжкина; хронического лимфолейкоза; лимфомы Ходжкина; солидных опухолей, например, при раке груди, раке яичников, раке толстой кишки, раке почек или раке желчных протоков; минимальном остаточном заболевании; метастатических опухолях, например, дающих метастазы в легкие, кости, печень или мозг). В случае если определенные мультиспецифичные связывающие молекулы описаны выше как обладающие особенной полезностью в лечении определенного заболевания, эти связывающие молекулы можно также применять в производстве лекарственных препаратов для данного определенного заболевания.

В еще одном аспекте связывающие молекулы согласно настоящему изобретению можно применять в качестве реагентов для окрашивания клеток, экспрессирующих FcγRIIIA. В случае, если связывающая молекула обладает специфичностью к по меньшей мере одному дополнительному антигену, ее можно применять в качестве реагента, с помощью которого можно идентифицировать комплексы молекулы, связывающейся с клетками, экспрессирующими FcγRIIIA, с антигеном. Связывающие молекулы согласно настоящему изобретению также можно применять для анализа и типирования взятых у пециента образцов ex vivo, таких как биомаркеры, а также для выделения NK-клеток для терапии ex-vivo.

Таким образом, в другом аспекте предусмотрен набор, включающий связывающую молекулу, как описано выше, и средства для детекции связывающей молекулы, связанной с FcγRIIIA. В случае если связывающая молекула помечена радиоактивной меткой или хемилюминесцентной меткой, средства детекции могут включать пленку, чувствительную к радиоактивной или хемилюминесцентной метке. В случае если связывающая молекула соединена с гистидиновой меткой последовательностью или меткой c-myc, набор может включать антитело, узнающее эту метку.

Различные аспекты и варианты реализации настоящего изобретения проиллюстрированы более подробно при помощи примеров. Очевидно, что можно осуществить незначительные модификации, не выходящие за пределы объема изобретения, и специалисту понятно, что можно получить дополнительные антитела и антигенсвязывающие фрагменты для применения в настоящем изобретении, как описано в Примере 2 данной заявки, а их свойства в отношении связывания с различными изоформами FcγRIII и даже с различными аллельными формами Fc RIIIA, можно проанализировать, как описано в разделе Примеры данной заявки.

Во избежание сомнений, термины «FcγRIII», «FcγRIIIA» и «FcγRIIIB» используются в данной заявке равнозначно с терминами «CD16», «CD16A» (обозначающим изоформу A CD16) и «CD16B» (обозначающим изоформу B CD16), соответственно.

КРАТКОЕ ОПИСАНИЕ ФИГУР

Фигура 1: Результаты твердофазного ИФА, демонстрирующие связывание scFv 50NI с иммобилизованном на стрептавидине CD16-Fc

Планшеты для ИФА покрывали 500 нг стрептавидина и 300 нг IgG человека (Sigma-Aldrich, Taufkirchen, Germany) на лунку в 100 мМ NaHCO3, pH 8,6. Затем адсорбировали 300 нг биотинилированного CD16A-Fc в течение 30 минут при комнатной температуре в ФБР.

Иммобилизованный на стрептавидине CD16-FC, стрептавидин и IgG человека инкубировали с 1 мкг/мл MAT мыши (мини антитела, Mab) или 50 мкл неочищенного экстракта периплазмы клона 50NI в ФБР/TWEEN 0,1%/2% обезжиренном сухом молоке. Связывание MAT A9 детектировали антителом козы к антителам мыши, конъюгированным с ПХ. Связывание scFv 50NI детектировали с помощью антитела к пента-His, конъюгированного с ПХ (анти-His-ПХ). Оптическую плотность при 450 нм для субстрата ПХ тетраметил бензидина (ТМБ) измеряли после остановки реакции добавлением 50 мкл 0,5 M серной кислоты.

Фигура 2: scFv человека со зрелой аффинностью к CD16 связывается с трансфецированными клетками, экспрессирующими CD16A, но не клетками, экспрессирующими CD16B. Клетки BW мыши и клетки BW, стабильно трансфецированные CD16A (BW/CD16A), клетки HEK-293 и клетки HEK-293, трансфецированные CD16B (293/CD16B), CD16A (293/CD16A) или NKp46 (293/NKp46), окрашивали 10 мкг/мл MAT A9 (анти-CD16) или MAT 195314 (анти-NKp46), а затем 15 мкг/мл конъюгированных с флюорохромом FITC антител козы к IgG мыши. scFv к CD16 (анти-CD16) применяли в концентрации 50 мкг/мл и детектировали 10 мкг/мл MAT 13/45/31-2 (к гекса-His), а затем конъюгированным с FITC антител козы к IgG мыши. Средние интенсивности флуоресценции, полученные при анализе методом проточной цитометрии корректировали путем вычитания значений флуоресценции клеток, окрашенных только вторичными реагентами, и наносили на график.

Фигура 3: Твердофазный ИФА рекомбинантного CD16A-Fc и CD16B.

Рекомбинантные белки CD16A-Fc и CD16B наносили в концентрации 80 нМ в 0,1 M NaHCO3 с pH 8,8. Лунки блокировали ФБР, 2% обезжиренным молоком. Связывание scFv с рекомбинантными белками и с gp34-Fc (отрицательный контроль) детектировали при помощи антител к с-Мус, конъюгированных с ПХ (10 мкг/мл). После инкубации с анти-CD16 MAT A9 (1 мкг/мл) следовала обработка антителом козы к Ig мыши, конъюгированным с ПХ (0,5 мкг/мл). Иммобилизованные рекомбинантные CD16B непосредственно детектировали путем окрашивания конъюгатом анти-His-ПХ (1 мкг/мл), а иммобилизованные гибридные белки, связанные с Fc, анализировали с помощью IgG против антител человека, конъюгированного с ПХ (0,5 мкг/мл). В качестве субстрата для ПХ применяли 50 мкл ТМБ. После остановки реакции добавлением 50 мкл 0,5 M H2SO4, измеряли оптическую плотность при 450 нм.

Фигура 4: Запуск перенаправленной цитотоксичности в свежеизолированных NK-клетках одноцепочечным антителом scFv человека, обладающим зрелой аффинностью к CD16. NK-клетки выделяли из периферической крови здорового донора и обогащали, а затем применяли в качестве эффекторных клеток в анализе цитотоксичности с мечеными кальцеином клетками Р815 в качестве клеток-мишеней. Эффекторные клетки (E) и клетки-мишени (T) инкубировали в течение 3 часов при соотношении Е:Т, равном 10:1, в присутствии 1 мкг/мл указанных антител. Процент специфичного лизиса рассчитывали на основании измеренных значений флюоресценции высвобожденного кальцеина в над осадочной жидкости. Средние значения и стандартные отклонения, полученные по трем повторам, наносили на график.

Фигура 5: Анализ методом проточной цитометрии scFv со зрелой аффинностью к CD16 в ПМЯ и NK-клетках. Полиморфноядерные клетки (ПМЯ) и клетки-естественные киллеры (NK) выделяли из периферической крови здорового донора и применяли для окрашивания и анализа методом поточной цитометрии. Клетки окрашивали 10 мкг/мл анти-CD16 MAT A9 и анти-CD56 MAT B159, а затем 15 мкг/мл конъюгированных с FITC IgG козы к антителам мыши. Все scFv применяли в концентрации 50 мкг/мл и детектировали 10 мкг/мл антитела к (His)6, а затем 15 мкг/мл конъюгированных с FITC IgG козы к антителам мыши. Средние интенсивности флуоресценции, полученные при анализе методом поточной цитометрии корректировали путем вычитания значений флюоресценции клеток, окрашенных только вторичными реагентами, и наносили на график.

Фигура 6: Выравнивание последовательностей аминокислот аллельных вариантов изоформ CD16A и CD16B. Сигнальные пептиды выделены серым. Звездочки и курсив обозначают различия между аллельными вариантами CD16B. Отличия между изоформами CD16A и CD16B показаны жирным подчеркнутым шрифтом. Положение полиморфизма CD16A 158 Val/Phe обозначено прямоугольником.

Фигура 7: Твердофазный ИФА различных изоформ CD16. Лунки планшета MaxisorpTM покрывали 100 мМ NaHCO3, содержащим 200 нг CD16A-Fc48R/158V, CD16A-Fc48R/158F, CD16B-FcSH, CD16B-FcNA1, CD16B-FcNA2 и NKp46-Fc. Все антигены инкубировали с [А] scFv 4-LS21, а затем с конъюгированнм с ПХ антит-His антителом или [Б] с MAT A9, а затем с антителом козы к антителам мыши, конъюгированным с ПХ (минимальная перекрестная реактивность по отношению к IgG человека). scFv к NKp46, применяемое как первичное антитело, служило отрицательным контролем.

Фигура 8: Специфичный цитолиз клеток-мишеней NK-клетками, активированными TandAb. 1×104 указанных меченных кальцеином клеток L540CY (результаты представлены на панели [А]) или клеток-мишеней JOK-1 (результаты представлены на панели [Б]) инкубировали в течение 3 часов с 1×105 NK-клеток в присутствии указанных концентраций антитела TandAb CD30×CD16 (закрашенный ромб) или TandAb CD19×CD16 (незакрашенный ромб). В качестве контроля клетки-мишени инкубировали с NK-клетками без антитела (закрашенный квадрат). Процент специфического лизиса вычисляли на основании измеренных значений флюоресценции высвобожденного кальцеина и методом анализировали нелинейной регрессии с применением программы GraphPadPrism.

ПРИМЕРЫ

Пример 1: Временная экспрессия и очистка гибридного белка CD16A-Fc человека

Секретируемую растворимую форму гибридного белка CD16A-Fc человека плолучали в клетках HEK-293 после временной трансфекции плазмидой pCDM-CD16-Fc, кодирующей CD16A человека, соединенный с Fc-фрагментом IgG1 человека (Mandelboim et al., 1999, см. выше).

Клетки HEK-293 (номер в ATCC CRL-1573) культивировали пол