Анти-cd 16 связывающие молекулы



Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы
Анти-cd 16 связывающие молекулы

 


Владельцы патента RU 2491294:

АФФИМЕД ТЕРАПЕУТИКС АГ (DE)

Настоящее изобретение относится к области биотехнологии и иммунологии. Предложено антитело, специфично связывающееся с формой A FcγRIII (CD16) (FcγRIIIA, CD16A) и не связывающееся специфично с формой В (FcγRIIIB, CD16B), его антигенсвязывающий фрагмент и мультиспецифичное антитело, включающее антигенсвязывающий фрагмент антитела по изобретению. Рассмотрены композиции, содержащие антитело по изобретению или его антигенсвязывающий фрагмент, и их применение в лечении аутоиммунных, воспалительных, инфекционных заболеваний, аллергии и рака, а также набор для детектирования FcγRIIIA. Описаны полинуклеотиды, векторы и клетки-хозяева и способы получения антитела по изобретению или его антигенсвязывающего фрагмента. Настоящее изобретение обеспечивает новые антитела к FcγRIIIA и, таким образом, может найти дальнейшее применение в терапии FcyRIIIA-опосредованных заболеваний. 14 н. и 27 з.п. ф-лы, 24 пр., 8 ил., 5 табл.

 

Настоящее изобретение относится в целом к связывающим молекулам, которые специфично связываются с рецептором III к Fc гамма человека, экспрессирующимся на поверхности клеток - естественных киллеров (NK-клеток) и макрофагов (т.е. FcγRIIIA), и в частности, к связывающим молекулам, которые специфично связываются с формой A рецептора FcγRIII, но не связываются с формой B рецептора FcγRIII, а также к применению таких связывающих молекул в диагностике и лечении заболевания. Настоящее изобретение, кроме того, распространяется на полинуклеотиды, кодирующие такие связывающие молекулы, клетки-хозяева, включающие такие полинуклеотиды, и способы получения связывающих молекул согласно настоящему изобретения с применением таких клеток-хозяев.

CD16 (также известный как FcγRIII), низкоаффинный рецептор к Fc-фрагменту некоторых IgG, который, как известно, вовлечен в антителозависимую клеточную цитотоксичность (АЗКЦ), представляет собой наиболее изученный мембранный рецептор, ответственный за запуск лизиса клеток-мишеней NK-клетками (Mandelboim et al., 1999). NK-клетки человека составляют приблизительно 15% всех лимфоцитов, и фенотипически их определяют по экспрессии в них CD56 и отсутствию экспрессии CD3 (Robertson & Ritz, 1990). Большинство (около 90%) NK-клеток человека экспрессируют CD56 в низкой плотности (CD56dim), а FcγRIII (CD16) на высоком уровне (Cooper et al., 2001). FcγRIII человека существует в виде двух изоформ, FcγRIIIA и FcγRIIIB, имеющих 96% идентичность по последовательностям внеклеточных иммуноглобулин-связывающих областей (van de Winkel & Capel, 1993).

FcγRIIIA экспрессируется на поверхности макрофагов, тучных клеток и NK-клеток как трансмембранный рецептор. На поверхности NK-клеткок альфа цепь FcγRIIIA ассоциирует с иммунорецепторным богатым тирозином активаторным мотивом (ITAM, immunoreceptor tyrosine-based activation motif), содержащим γ-цепь рецептора FcεRI и/или ζ-цепь T-клеточного рецептора (TCR)/CD3, принимая участие в передачи сигналов (Wirthmueller et al., 1992). В NK-клетках наблюдается взаимодействие FcγRIIIA с различными комбинациями гомо- и гетеродиморов γ и ζ, цепей, что позволяет указывает на возможность существования различных сигнальных путей через различные комплексы FcγRIIIA в NK-клетках (Anderson et al., 1990, PNAS 87(6): 2274-2278; Ackerly et al., 1992, Int. J. Cancer Suppl. 7: 11-14).

FcγRIIIB присутствует на поверхности полиморфноядерных гранулоцитов (ПЯГ) в виде гликозилфосфатидилинозитол (ГФИ)-заякоренного рецептора (изоформа FcγRIIIB), который не может запускать уничтожение опухолевых клеток (van de Winkel & Capel, 1993). Кроме того, FcγRIIIB существует в виде растворимого рецептора в сыворотке, и при связывании с антителом может in vivo вызывать побочные эффекты через образование иммунных комплексов.

Было показано, что клетки-эффекторы, экспрессирующие FcγR, вовлечены в уничтожение опухолевых клеток по механизму АЗКЦ. На основе этого было разработано несколько иммунотерапевтических подходов к терапии рака, которые включают применение активности FcγR, например, специфичные к опухолям моноклональные антитела могут опосредовать уничтожение опухолевых клеток по механизму АЗКЦ, индуцируемой посредством связывания с FcγRs. Также с целью улучшения рекрутирования клеток-эффекторов были получены молекулы с двойной специфичностью: с одной специфичностью по отношению к опухолевым клеткам и с другой специфичностью по отношению либо к FcγRI на поверхности гранулоцитов, либо к FcγRIII на поверхности NK-клеток (van Spriel et al., 2000 Immunol. Today, 21: 391-397).

Как клеточные факторы врожденного иммунитета NK-клетки являются профессиональными клетками-киллерами и, в отличие от T-клеток, как правило, существуют в конститутивно активированном состоянии, не требующем дополнительной (пре-)стимуляции. В противоположность этому, покоящиеся цитотоксические T-клетки требуют активации посредством связывания комплекса антиген-ГКГС и последующей костимуляции через CD28. Таким образом, среди иммунных клеток-эффекторов NK-клетка является одним из наиболее привлекательных кандидатов для применения в иммунотерапии, и были получены антитела с двойной специфичностью: специфичные к CD16 (FcγRIII) и HER-2/neu или CD16 и CD30 (Arndt et al., 1999 Blood 94: 2562-2568; McCall et al., 2001 J. Immunol. 166: 6112-6117).

Большинство антител к CD16, полученные к настоящему времени, не способны различать две изоформы CD16, Fc RIIIA и Fc RIIIB, исключением являются моноклональное антитело (MAT) 1D3, которое связывается только с формой CD16, экспрессирующейся на поверхности нейтрофилов, т.е. FcγRIIIB, и моноклональные антитела, которые узнают различные аллотипические формы FcγRIIIB (Ory et al. 1989, J. Clin. Invest. 83: 1676-81; Huizinga et al. 1990 Blood 75: 213-7; Tamm & Schmidt 1996, J. Immunol. 1996 157: 1576-1581). Однако до настоящего времени отсутствовали примеры молекул, которые бы специфично связывались с Fc RIIIA, формой экспрессирующейся на поверхности NK-клеток, и не связывались с Fc RIIIB.

Тем не менее антитело, специфичное к FcγRIIIA, было бы особенно полезно в качестве компонента связывающих молекул с двойной или множественной специфичностью, направленных на ассоциированные с заболеванием клетки, поскольку оно рекрутировало бы главным образом NK-клетки и не связывалось бы циркулирующим растворимым FcγRIIIB и не уклонялось от связывания с NK-клетками, связываясь с нейтрофилами или активированными эозинофилами. Для эффективного опосредования осуществляемого NK-клетками цитолиза специфичное к FcγRIIIA антитело должно не только связаться с NK-клетками, но также активировать их при связывании.

Мы идентифицировали несколько новых анти-CD16 одноцепочечных антител scFv, демонстрирующих это полезное свойство, т.е. они специфичны к FcγRIIIA, не связываются специфично с FcγRIIIB, и они также способны активировать NK-клетки при связывании.

Также известно, что FcγRIIIA демонстрирует несколько вариантов аллельного полиморфизма, в частности, в положениях 48 и 158 IgG-связывающего домена. Оописанные ранее антитела к CD16 (анти CD-16), как было показано, имеют различную аффиность связывания с различными полиморфными формами FcγRIIIA, и в работе Koene et al. (1997, Blood 90: 1109-1114) было определено различие в связывании некоторых из этих антител с полиморфизмом в положении 158. Поскольку генные частоты аллели FcγRIIIA158F и аллели FcγRIIIA158V составляют приблизительно 0,6 и 0,4, соответственно, то было бы полезно, чтобы любое анти-CD16A антитело узнавало обе аллельные формы, чтобы гарантировать, что анти-CD16 антитело будет способно связывать и активировать популяцию NK-клеток в организме любого пациента.

В данной заявке описано одноцепочечное анти CD-16 антитело scFv, которое узнает как γRIIIA158V, так и FcγRIIIA158F с приблизительно равной аффинностью, но не связывается с FcγRIIIB.

Новые описаннве в настоящей заявке scFv, можно, таким образом, применять для получения новых связывающих молекул, которые можно применять в качестве терапевтических агентов. Термин «связывающая молекула» в данной заявке охватывает антитела и антигенсвязывающие фрагменты антител, причем указанные антитела или антигенсвязывающие фрагменты антител селективно и специфично связываются с FcγRIIIA и не связываются специфично с FcγRIIIB, а также гибридные белки таких антител или антигенсвязывающих фрагментов, и конъюгаты белков, включающие такие антитела или антигенсвязывающие фрагменты.

Таким образом, согласно первому аспекту настоящего изобретения предложена связывающая молекула, обладающая специфичностью по меньшей мере к одному антигену, причем указанный антиген представляет собой FcγRIIIA и связывающая молекула не связывается специфично с FcγRIIIB.

В предпочтительном варианте реализации специфичность по отношению к FcγRIIIA обеспечивается антителом или антигенсвязывающим фрагментом антитела. Соответственно, связывающие молекулы согласно настоящему изобретению могут включать, или в, некоторых вариантах реализации, состоять из по меньшей мере одного антитела (или антигенсвязывающего фрагмента антитела), которое обладает специфичностью к FcγRIIIA, но не к FcγRIIIB.

Антитела, обеспечивающие специфичность к FcγRIIIA, могут представлять собой природные антитела, либо они могут представлять собой рекомбинантные антитела. Антитела согласно настоящему изобретению могут относиться к любому классу иммуноглобулинов, например, они могут представлять собой антитело IgA, IgD, IgE, IgG или IgM. Предпочтительно антитело представляет собой антитело IgG. Антигенсвязывающий фрагмент, подходящий для применения согласно настоящему изобретению, может быть природным или рекомбинантным и включает легкие цепи иммуноглобулина, тяжелые цепи иммуноглобулина, VH домены (вариабельные области тяжелой цепи), VL домены (вариабельные области легкой цепи), антитела Fv, одноцепочечные антитела (включая scFv-антитела), Fab-фрагменты, ди-Fab-фрагменты, Fab'-фрагменты, F(ab')2-фрагменты и гипервариабельные участки (CDR). Специалисту в данной области хорошо известны такие антигенсвязывающие фрагменты и их получение. Во избежание сомнений, термин одноцепочечное антитело в данной заявке относится к полученной методами генной инженерии одноцепочечной молекуле, включающей вариабельную область легкой цепи и вариабельную область тяжелой цепи, связанные подходящим гибким полипептидным линкером. Примеры одноцепочечных антител включают антитела scFv и димеры антител (diabody).

В одном из вариантов реализации антитело или антигенсвязывающий фрагмент, определяющие специфичность к FcγRIIIA, включают по меньшей мере один гипервариабельный участок (CDR) человека, предпочтительно выбранный из гипервариабельных участков (CDR), описанных в Таблице 1 ниже.

Таблица 1
Последовательности аминокислот легкой и тяжелой цепей человека CDR антител scFv, которые селективно и специфично связываются с FcγRIIIA и не связываются специфично с FcγRIIIB
Цепь CDR1 CDR2 CDR3
1. Тяжелая цепь TSYYMH IINPSGGSTSYAQKFQG GSAYYYDFADY
(SEQ ID №17) (SEQ ID №18) (SEQ ID №19)
SGDKLEEKYVS QDNKRPS QVWDNYSVL
2. Легкая цепь (SEQ ID №20) (SEQ ID №21) (SEQ ID №22)
GGNNIESRNVH RDNNRPS QVWDNYTVL
3. Легкая цепь (SEQ ID №23) (SEQ ID №24) (SEQ ID №25)
GGNNIGSKNVH RDSNRPS QVWDNYIVL
4. Легкая цепь (SEQ ID №26) (SEQ ID №27) (SEQ ID №28)
5. Легкая цепь EGNNIGSKNVH DDSDRPS QVWDNYSVL
(SEQ ID №29) (SEQ ID №30) (SEQ ID №22)
GGNNIGSKNVH RDSSRPS QVWDDYIW
6. Легкая цепь (SEQ ID №26) (SEQ ID №31) (SEQ ID №32)
7. Легкая цепь GANDIGKRNVH QDNKRPS QVWDNYSVL
(SEQ ID №33) (SEQ ID №21) (SEQ ID №22)
8. Легкая цепь GGHNIGSKNVH QDNKRPS QVWDNYSVL
(SEQ ID №34) (SEQ ID №35) (SEQ ID №22)

Для специалиста в данной области очевидно, что антитела и их антигенсвязывающие фрагменты, за исключением одиночных CDR, как правило, включают три CDR легкой цепи и/или три CDR тяжелой цепи. Соответственно, в дальнейших вариантах реализации антитело или антигенсвязывающий фрагмент со специфичностью к FcγRIIIA включает три CDR легкой цепи человека и/или три CDR тяжелой цепи человека. Предпочтительно, CDR1 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №20, SEQ ID №23, SEQ ID №26, SEQ ID №29, SEQ ID №33, и SEQ ID №34, CDR2 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №21, SEQ ID №24, SEQ ID №27, SEQ ID №30, SEQ ID №31 и SEQ ID №35, и CDR3 легкой цепи человека имеет последовательность аминокислот, выбранную из SEQ ID №22, SEQ ID №25, SEQ ID №28 и SEQ ID №32. Предпочтительно CDR1 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №17, CDR2 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №18, и CDR3 тяжелой цепи человека имеет последовательность аминокислот SEQ ID №19.

В случае если антитело или антигенсвязывающий фрагмент включает вариабельную область легкой цепи или состоит из вариабельной области легкой цепи, оно может иметь одну из следующих последовательностей аминокислот:

SEQ ID №10:

SYELMQPPSVSVSSGQTASIPCSGDKLEEKYVSWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA;

SEQ ID №11:

SYELTQPLSESVAQGQTARITCGGNNIESRNVHWYQQKPGQAPVLVIYRDNNRPSGIP

ERFSGSNSGNMATLTISRAQA;

SEQ ID №12:

SYELTQPPSVAVAPGKTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIP

ERFSGSNSGNTATLTISRAQA;

SEQ ID №13:

QAVLTQPPSVSVAPGQTARIPCEGNNIGSKNVHWYRQKPGQVPVLVMYDDSDRPSGI

PERFSGSNSGNTATLTISGTQA;

SEQ ID №14:

QPVLTQPLSVSVAPGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSSRPSGIP

ERLSGSNSGDTATLTISRAQA;

SEQ ID №15:

SYELTQPPSVSVTPGQTATITCGANDIGKRNVHWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA;

SEQ ID №16:

QPVLTQPSSVSVAPGQTATISCGGHNIGSKNVHWYQQRPGQSPVLVIYQDNKRPSGIP

ERFSGSNSGNTATLTISGTQA.

В случае, если антитело или антигенсвязывающий фрагмент включает вариабельную область тяжелой цепи или состоит из вариабельной области тяжелой цепи, она может иметь следующую последовательность аминокислот (SEQ ID №9):

EVQLVQSGAEVKKPGESLKVSCKASGYTFTSYYMHWVRQAPGQGLE

WMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGSAYY

YDFADYWGQGTLVTVSS.

В предпочтительном варианте реализации антитело или антигенсвязывающий фрагмент, обеспечивающий специфичность к FcγRIIIA, является полностью человеческим и.

В дальнейших предпочтительных вариантах реализации связывающая молекула согласно настоящему изобретению способна активировать клетки человека, экспрессирующие FcγRIIIA, при связывании с FcγRIIIA, экспрессирующимся на поверхности таких клеток, т.е. связывающая молекула способна вызывать биологический ответ, в частности, к сигнальный ответ, при связывании с FcγRIIIA. Предпочтительно, связывающая молекула также способна запускать уничтожение клеток, некоторым образом аналогичное антителозависимой клеточной цитотоксичности (АЗКЦ), посредством связывания с такими клетками.

С тем, чтобы определить, способны ли связывающие молекулы согласно настоящему изобретению активировать клетки человека, экспрессирующие FcγRIIIA, их можно протестировать на способность вызывать мобилизацию кальция в NK-клетках периферической крови, например, как описано в данной заявке в Примерах. Способность связывающих молекул согласно настоящему изобретению запускать цитотоксичность, опосредованную NK-клетками, можно также протестировать, как описано в данной заявке в Примерах, с применением, например, способа анализа с высвобождением кальцеина для обнаружения перенаправленного клеточного лизиса с применением свежевыделенных NK-клеток.

Настоящее изобретение также обеспечивает связывающие молекулы, которые не только обладают специфичностью к FcγRIIIA и в то же время не имеют специфичности к FcγRIIIB, но обладают также специфичностью к одному или более дополнительным антигенам. Таким образом, связывающие молекулы согласно настоящему изобретению могут быть мультиспецифичными. Термин мультиспецифичный (обладающий множественной специфичностью) в данной заявке означает, что связывающая молекула согласно настоящему изобретению, не обладающая специфичностью к FcγRIIIB, обладает по меньшей мере двумя специфичностями, одна из которых к FcγRIIIA. Таким образом, мультиспецифичные связывающие молекулы согласно настоящему изобретению, охватывают молекулы по меньшей мере с двумя специфичностями, тремя специфичностями и четырьмя специфичностями, такие как, например, антитела с двумя специфичностями, включая одноцепочечные димерные антитела (diabodies), (scFv)2, тандемные димерные антитела (TandAb); тримерные антитела (tri-bodies) (антитело с тремя специфичностями); тетрамерные антитела (tetra-bodies) (антитело с четырьмя специфичностями); и комбинацию scFv и димеров антител (flexibodies) (см. Le Gall et al. 1999 FEBS Letts 453: 164-168 и WO 03/025018).

Благодаря своей мультиспецифичности, связывающие молекулы согласно данному аспекту настоящего изобретения могут нацеливать макрофаги или NK-клетки на дополнительные антигены или даже на клетки, несущие такие антигены, что делает возможным уничтожение антигена или клетки, несущей антиген, посредством фагоцитоза или опосредуемого NK-клетками лизиса клеток. Например, связывающая молекула согласно настоящему изобретению может обладать дополнительной специфичностью по отношению к одному или более антигенам, специфичным для опухоли, и может, таким образом, нацеливать NK-клетки на опухолевые клетки. Активация NK-клетки, вызванная связыванием связывающей молекулы с FcγRIIIA, приводит к уничтожению клеток опухоли. Таким образом, связывающие молекулы согласно настоящему изобретению можно применять для лечения и/или устранения больных клеток и инфекционных агентов (таких как, например, бактерии, грибы, микоплазмы, вирусы, паразиты, прионы) в зависимости от дополнительной специфичности или специфичностей связывающей молекулы.

Таким образом, дополнительный аспект настоящего изобретения обеспечивает связывающую молекулу, как описано выше в настоящей заявке, причем связывающая молекула обладает специфичностью по меньшей мере к одному дополнительному антигену. В одном из вариантов реализации пуказанный дополнительный антиген представляет собой антиген клеточной поверхности. Примерами антигенов клеточной поверхности, по отношению к которым демонстрируют специфичность связывающие молекулы согласно данному варианту реализации изобретения, являются CD19, CD20, CD30, белок-предшественник рецептора к ламинину (также известный как онкофетальный антиген незрелого рецептора к ламинину, OFA-iLR), рецептор к эпидермальному фактору роста EGFR1 (также известный как HER-1, ErbB1), EGFR2 (также известный как HER-2, ErbB2, neu), EGFR3 (также известный как HER-3), эпителиальная молекула адгезии клеток (Ep-CAM), PLAP (плацентарная щелочная фосфатаза), антиген Томсена-Фриденрайха (TF), MUC-1 (муцин), рецептор к инсулиноподобному фактору роста IGFR, рецептор к интерлейкину 4 IL4-R альфа, IL13-R, FcεRI и CD5.

В другом варианте указанный дополнительный антиген представляет собой антиген инфекционного агента, например, антиген может секретироваться с или экспрессироваться на наружной поверхности клетки-хозяина, инфицированной клетки, бактерии, гриба, микоплазмы, паразита или вируса, или может высвобождаться при лизисе такого инфекционного агента. Например, связывающая молекула согласно настоящему изобретению может обладать дополнительной специфичностью к вирусному белку, такому как gp34 или gp68 на поверхности инфицированных ЦМВ клеток, или к гемагглютинину в присутствии вируса гриппа, и может таким образом направленно воздействовать либо на зараженную вирусом клетку, либо непосредственно на вирус. Кроме того, в случае если инфекционным агентом является прион, прионовый белок сам по себе может являться антигеном.

В других вариантах реализации указанный дополнительный антиген представляет собой аллерген, или молекулу, вовлеченную в ответ организма на аллерген, такую как, например, циркулирующий IgE, или рецептор FcεRI (в особенности) тучных клеток.

Предпочтительно в связывающих молекулах согласно данному аспекту изобретения специфичность по отношению к по меньшей мере одному дополнительному антигену обеспечивается антителом или антигенсвязывающим фрагментом антитела. Как описано выше, специалист в данной области знаком с типами антител (IgA, IgD, IgE, IgG и IgM) и с антигенсвязывающими фрагментами, полученными из таких антител (например, легкими цепями иммуноглобулина, тяжелыми цепями иммуноглобулина, VH-доменами, VL-доменами, антителами Fv, антителами scFv, фрагментами Fab, фрагментами di-Fab, фрагментами Fab'-, фрагментами F(ab')2 и CDR), которые также можно применять в данном аспекте изобретения. В одном предпочтительном варианте реализации антитело представляет собой IgG.

Мультиспецифичные и, в частности, обладающие двумя специфичностями, связывающие молекулы согласно настоящему изобретению могут быть представлены в одной из следующих форм: обладающие двумя специфичностями IgG, IgG-scFv2, (scFv)4-IgG, (Fab')2, (scFv)2, (dsFv)2, гибридные белки Fab-scFv, (scFv)2-Fab, (scFv-CH2-CH3-scFv)2, димерное антитело (bibody), тримерное антитело (tribody), обладающий двумя специфичностями димер антител, стабилизированное дисульфидной связью (ds) димерное антитело (diabody), димерное антитело типа «knob-into-whole», одноцепочечное димерное антитело (scDb), тандемное димерное антитело (TandAb), комбинация scFv и димеров антител (flexibody), миниантитело DiBi (miniantibody), [(scFv)2-Fc]2, (scDb-CH3)2, (scDb-Fc)2, ди-димерное антитело (Di-diabody), тандемное антитело (Tandemab) (см. обзор (Kipriyanov & Le Gall, 2004; Marvin & Zhu, 2005). В предпочтительных вариантах реализации связывающая молекула представляет собой TandAb или Flexibody. В отличие от многих других форм антител с двумя специфичностями, TandAb представляет собой гомодимер, включающий только вариабельные области антитела, и его образование определяется ассоциацией комплементарных VH- и VL-доменов, расположенных в различных полипептидных цепях. TandAb по размеру в два раза больше diabody и (scFv)2, способно бивалентно связывать как клетки-эффекторы, так и клетки-мишени, и обладает улучшенными фармакокинетическими характеристиками по сравнению с diabody и (scFv)2, например оно имеет большую стабильность и повышенную биологическую активность как in vitro, так и in vivo (Kipriyanov et al., 1999; Cochlovius et al., 2000; Reusch et al., 2004). Образование пары между цепями имеющих сродство (когнатных) доменов VH и VL одинаковой специфичности можно также применять для образования обладающих двумя специфичностями тандемных молекул scFvB-diabodyA-scFvB, так называемых «flexibodies» (A и B могут иметь одинаковую и различную специфичность). В зависимости от того, насколько прочно ассоциированы комплементарные домены, вовлеченные в образование пар различных цепей, и от длины линкера, разделяющего их, могут быть сформированы димеры, тримеры и даже тетрамеры обладающих двумя специфичностями одноцепочечных молекул.

Примеры антител и антигенсвязывающих фрагментов, которые можно применять в данном аспекте изобретения и которые демонстрируют специфичность к CD19, CD20, CD30, белку-предшественнику рецептора к ламинину, EGFR1, EGFR2, EGFR3, Ep-CAM, PLAP, антигена Томсена-Фриденрайха (TF), MUC-1 (муцину), IGFR, CD5, IL4-R альфа, IL13-R, FcεRI и IgE, описаны в данной области как антитела к инфекционным агентам (см., например, EP-A-1314741, Reff et al. 1994 Blood 83: 435-445, EP-A-1005870, WO 01/92340, US 6,033,876, WO 86/03223, Buto et al. 1997 Int. J. Biol. Markers 12: 1-5, US 6,699,473, WO 98/50433, US 5,770195, EP-A-0502812, Carter et al. 1992 PNAS 89: 4285-4289, US 5,968,511, WO 04/106383, Nouri et al. 2000 BJU Int. 86: 894-900, EP-A-0429242, Ravn et al. 2004 J. Mol. Biol. 343: 985-996, Dahlenborg et al. 1997 Int. J. Cancer 70: 63-71, WO 88/05054, WO 02/053596, WO 04/071529, Studnicka et al. 1994 Protein Eng. 7: 805-814, Presta et al. 1993 J. Immunol. 151: 2623-2632). В случаях когда в данных источниках представлены последовательности аминокислот или последовательности нуклеиновых кислот, кодирующие такие антитела или антигенсвязывающие фрагменты, специалист в данной области способен применить такие последовательности непосредственно при получении связывающих молекул согласно настоящему изобретению. В случае, когда в данных источниках описаны гибридомы или клеточные линии, продуцирующие такие антитела или антигенсвязывающие фрагменты, специалист в данной области способен получить последовательности нуклеиновой кислты, кодирующие желаемое антитело или антигенсвязывающий фрагмент, из соответствующей гибридомы или клеточной линии с применением стандартных способов молекулярной биологии, и после того, как последовательности нуклеиновлй кислоты будут получены, их можно применять при создании связывающих молекул согласно настоящему изобретению.

Дополнительный аспект данного изобретения предусматривает связывающую молекулу согласно любому из аспектов или вариантов реализации, описанных выше, которая способна связываться с аллелью FcγRIIIA158F и аллелью FcγRIIIA158F с примерно одинаковой аффинностью, т.е. аффинность связывающей молекулы к двум 158 аллелям FcγRIIIA отличается не более чем в два раза. В предпочтительных вариантах реализации согласно данному аспекту настоящего изобретения специфичность к FcγRIIIA обеспечивается антителом или антигенсвязывающим фрагментом, полученным из scFv 4-LS21, описанным в данной заявке. В особенно предпочтительных вариантах реализации связывающие молекулы согласно данному аспекту изобретения имеют форму TandAb и включают антигенсвязывающие фрагменты, полученные из scFv 4-LS21, описанные в данной заявке, а также антигенсвязывающие фрагменты, обладающие специфичностью к CD19 или CD30.

Как понятно специалисту в данной области, в случае если предполагается применение связывающих молекул согласно настоящему изобретению в лечении и/или терапии людей, потенциальная иммуногенность связывающей молекулы должна быть минимизирована. Соответственно, в случае если специфичность FcγRIIIA и/или дополнительного антигена (антигенов) обеспечивается антителом или антигенсвязывающим фрагментом, предпочтительно, чтобы антитело или антигенсвязывающий фрагмент были химерными, с пересаженными CDR, гуманизированным или полностью человеческим. Более предпочтительные антитело или антигенсвязывающий фрагмент являются гуманизированными или полностью человеческими. Применение стандартных способов молекулярной биологии для осуществления гуманизации антител в настоящее время является обычной практикой в данной области, и, имея последовательность антитела, не относящегося к человеку, специалист в данной области без труда сможет получить гуманизированный вариант такого антитела. Термин «полностью человеческий» в данной заявке применительно к антителу или антигенсвязывающему фрагменту означает, что последовательности аминокислот антитела или антигенсвязывающего фрагмента получены из организма человека (т.е. происходят из него или могут быть обнаружены в нем).

Другой способ, который можно применять в качестве альтернативы или в дополнение к описанным выше способам уменьшения иммуногенности, - деиммунизация. Технология деиммунизации включает идентификацию и удаление эпитопов, распознаваемых T-хелперными (T-x) клетками, из антитела и других белковых биологических терапевтических агентов. Эпитопы T-x клеток включают короткие пептидные последовательности в составе белков, которые обладают способностью связываться с молекулами ГКГС II класса. T-клетки смогут распознавать комплексы пептид-ГКГС II класса, которые могут запускать активацию и дифференцировку T-x клеток, необходимую для инициации и поддержания иммуногенности через взаимодействие с В-клетками, что приводит к секреции антител, специфично связывающихся с введенным биологическим терапевтическим агентом. Для деиммунизации антитела идентифицируют эпитопы для T-x клеток в пределах последовательности антитела, например, автоматизированным методом предсказания связывания пептидов с молекулами ГКГС II класса человека (см. Altuvia et al., 1995; Schueler-Furman et al., 2000). Чтобы избежать узнавания T-клетками, идентифицированные таким образом эпитопы T-клеток устраняют из последовательности белка заменой аминокислот. Это можно осуществить путем применения стандартных методов молекулярной биологии, таких как, например, сайт-направленный мутагенез, для изменения последовательности нуклеиновых кислот, кодирующей эпитопы T-x клеток в терапевтическом белке. Этот способ позволяет модифицировать антитело или антигенсвязывающий фрагмент таким образом, чтобы уменьшить или избежать ответа на человеческие антимышиные антитела (НАМА, Human anti mouse antigenic) и/или антиидиотипического ответа (ответов) (Bander et al., 2003; Nanus et al., 2003). Соответственно, в дальнейших вариантах реализации связывающие молекулы согласно настоящему изобретению модифицируют таким образом, чтобы удалить любые эпитопы для T-x клеток, присутствующие в их последовательности. Такие связывающие молекулы упоминаются в данном изобретении как деиммунизированные связывающие молекулы.

В дополнительном аспекте связывающие молекулы согласно настоящему изобретению включают дополнительный функциональный домен. Этот функциональный домен может сообщать эффекторные свойства связывающей молекуле, например, функциональный домен может представлять собой FcR-связывающий пептид или Fc домен антитела, который, благодаря способности связываться с Fc рецепторами, сообщает эффекторные свойства связывающей молекуле. В качестве альтернативы, функциональный домен может представлять собой фермент, который способен преобразовывать пролекарство в активное лекарственное вредство. Таким образом, связывающие молекулы согласно настоящему изобретению можно применять в антитело-направленной терапии в применением пролекарств и ферментов (ADEPT, antibody-directed enzyme pro-drug therapy). В другом варианте реализации функциональный домен представляет собой белок или пептид, который обеспечивает увеличение периода полужизни связывающей молекулы в сыворотке. Примером такого белка является сывороточный альбумин или Fc-фрагмент IgG, который может увеличивать период полужизни связывающей молекулы в сыворотке, благодаря своей способности связываться с FcγRn (неонатальный рецептор к Fc). В дополнительных вариантах реализации функциональный домен может представлять собой цитокин.

В дополнительном аспекте связывающие молекулы согласно настоящему изобретению могут быть конъюгированы с молекулой-меткой или токсином. В случае если метка или токсин представляют собой белок, конъюгирование со связывающей молекулой можно осуществить посредством образования пептидной связи или химического конъюгирования. Таким образом, связывающая молекула согласно данному аспекту изобретения может находиться в форме гибридного белка, где метка или токсин соединены со связывающей молекулой пептидной связью, предпочтительно линкерным пептидом, или может находиться в форме химического конъюгата. Во избежание сомнений, термин конъюгирование в данной заявке обозначает, что два компонента физически связаны друг с другом химической связью, включающая пептидную связь (таким образом, конъюгаты включают гибридные белки), сложноэфирную связь или дисульфидный мостик.

Конъюгирование связывающей молекулы согласно настоящему изобретению с молекулой-меткой, например радиоактивной меткой, или флюоресцентной, или люминесцентной меткой (в том числе хемилюминесцентной), позволяет применять связывающую молекулу в качестве реагента для иммунологического окрашивания. Такой реагент можно применять для детекции, например, инфильтрирующих ткани NK-клеток, макрофагов или тучных клеток, экспрессирующих FcγRIIIA, или, в случае если связывающая молекула демонстрирует специфичность к дополнительному антигену, в комплексах для детектирования, состоящих из молекулы, связывающаей NK-клетку, и дополнительного антигена. Детекция последних может быть особенно полезна в диагностике заболевания или при наблюдении прогрессирования заболевания или ремиссии.

В случае если связывающая молекула согласно настоящему изобретению конъюгирована с молекулой токсина, например, рибозилтрансферазой, сериновой протеазой, активатором гуанилциклазы, кальмодулин-зависимой аденилциклазой, рибонуклеазой, ДНК-алкилирующим агентом или ингибитором митоза (например, доксорубицином) и т.п., ее можно применять для направленного воздействия на NK-клетки и макрофаги и их уничтожения. Такую связывающую молекулу можно таким образом применять как иммуноподавляющий агент. Специалисту в данной области будет понятно, что в данном аспекте настоящего изобретения предпочтительно, чтобы связывающая молекула демонстрировала специфичность только по отношению к одному антигену, т.е. FcγRIIIA. Подавления иммунной системы можно также достичь с помощью связывающих молекул, включающих моновалентный антигенсвязывающий фрагмент, который связывается селективно и специфично с FcγRIIIA, или состоящих из такого фрагмента. Такие моновалентные связывающие молекулы являются предпочтительными, поскольку они действуют как молекулы, блокируюющие рецептор FcγRIIIA, не образуют поперечные связи и, следовательно, не активируют NK-клетку или макрофаг. Предпочтительные моновалентные антигенсвязывающие фрагменты, направленные к FcγRIIIA, включают scFv, Fab, VH, VL и CDR.

Специалисту в данной области понятно, что в качестве альтернативы соединению с меткой или токсином посредством химического конъюгирования, можно также применять пептидные метки или пептидные токсины. Например, связывающая молекула согласно настоящему изобретению может также экспрессироваться в форме гибридного белка, соединенного с N- или C-концевой меткой, такой как, например, тетра-, пента- или гекса-гистидиновой меткой, c-myc или т.п.

Связывающие молекулы согласно настоящему изобретению можно получить путем экспрессии нуклеиновых кислот, кодирующих их, в любой подходящей системе для экспрессии белков. Таким образом, в дополнительном аспекте настоящего изобретения предложены полинуклеотиды, кодирующие связывающие молекулы согласно настоящему изобретению. Полинуклеотиды, которые особенно подходят для применения в данном аспекте настоящего изобретения, кодируют гипервариабельные участки (CDR), описанные в Таблице 1 выше. В частности, специалист, имея последовательность аминокислот гипервариабельных областей (CDR) легкой и тяжелой цепи из таблицы 1, сможет вывести последовательности полинуклеотидов, кодирующие различные гипервариабельные участки легкой и тяжелой цепей, из следующих последовательностей нуклеиновых кислот:

SEQ ID №1:

gaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctca;

SEQ ID №2:

tcctatgagctgatgcagccaccctcagtgtccgtgtcctcaggacagacagccagcatcccctgctctggagataaattggaggaaaaatatgtttcctggtatcaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №3:

tcctatgagctgacacagccactctcagagtcagtggcccagggacagacggccaggattacctgtgggggaaacaacattgaaagtagaaatgttcactggtaccagcagaagccaggccaggcccctgtgttggtcatctatagggataacaaccggccctctgggatccctgagcgattctctggctccaattcggggaacatggccaccctgaccatcagcagagcccaagccggggatgcagctgactattactgtcaggtgtgggacaactacactgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №4:

tcctatgagctgacacagccaccctcagtggcagtggccccaggaaagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatctatagggatagcaaccggccctctgggatccctgagcgattctctggctccaactcggggaacacggccaccctgaccatcagcagagcccaagccggggatgaggctgacttttattgtcaggtgtgggacaactatattgtgctgttcggcggagggaccaagctgaccgtcctg

SEQ ID №5:

caggctgtgctgactcagccgccctcagtgtcagtggccccaggacagacggccaggattccctgtgagggaaacaacattggaagtaaaaatgtccactggtatcggcagaagccaggccaggtccctgtcctggtcatgtatgatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №6:

cagcctgtgctgactcagccactctcagtgtcagtggccccgggacagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtactggtcatctatagggacagcagccggccctctgggatccctgagcgactctctggctccaactcgggggacacggccaccctgaccatcagcagagcccaggccggggatgaggctgactattactgtcaggtgtgggacgactacattgtggtcttcggcggagggaccaagctgaccgtccta

SEQ ID №7:

tcctatgagctgacacagccaccctcggtgtcagtgaccccaggacagacggccacgattacctgcggggcaaacgacattggaaaaagaaatgtccactggtaccaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №8:

cagcctgtgctgactcagccatcctcggtgtcagtggccccaggacagacggccacgatctcctgtgggggacacaacattgggagtaaaaatgtgcactggtaccagcagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtccta

SEQ ID №1 кодирует вариабельную область тяжелой цепи scFv человека, селективно и специфично связывающегося с FcγRIIIA, но не связывающегося специфично с FcγRIIIB. SEQ ID №№2-8 кодируют вариабельные области легких цепей scFv человека, которые селективно и специфично связываются с FcγRIIIA, но которые не связываются специфично с FcγRIIIB. Соответственно, SEQ ID №№1-8 также являются примерами полинуклеотидов согласно настоящему изобретению, и их можно применять при создании дополнительных связывающих молекул согласно настоящему изобретению.

Полинуклеотиды, кодирующие мультиспецифичные связывающие молекулы согласно настоящему изобретению, в частности связывающие молекулы с двумя специфичностями, можно создать, как описано в WO 03/025018, с применением нуклеиновых кислот, кодирующих домены VH и VL антитела, которое связывается селективно и специфично с FcγRIIIA, но не связывается специфично с FcγRIIIB, в комбинации с нуклеиновыми кислотами, кодирующими домены VH и VL антитела, обладающего специфичностью к дополнительному антигену.

Для экспрессии связывающей молекулы в подходящей системе для экспрессии белков полинуклеотид, кодирующий связывающий белок, функционально соединяют с подходящим промотором и, возможно, с подходящим терминатором транскрипции. Это можно осуществить путем введения полинуклеотида согласно настоящему изобретению в геном хозяина и применения промотора, присутствующего в геноме хозяина, для управления экспрессией полинуклеотида. Кроме того, полинуклеотид согласно настоящему изобретению можно вводить в клетки-хозяева в составе вектора, включающего полинуклеотид, функционально связанный с промотором и, возможно, с терминаторной областью. Такие векторы образуют еще один дополнительный аспект изобретения.

Как правило, промотор, с которым в составе вектора фунционально соединен полинуклеотид, кодирующий связывающую молекулу, представляет собой любой промотор, способный направлять экспрессию связывающей молекулы в клетке-хозяине, в которую предстоит ввести полинуклеотид и вектор. Таким образом, если желательно осуществлять экспрессию связывающей молекулы в бактериальной клетке, промотор должен быть функционально активен в этой бактериальной клетке. Аналогично, если необходима экспрессия связывающей молекулы в грибной системе экспрессии, промотор должен быть функционально активным в клетке гриба, и такая же логика действует, если необходимо ввести конструкт в систему экспрессии, на основе клеток млекопитающих, клеток насекомых или растений. В случае если полинуклеотиды согласно настоящему изобретению функционально связаны с подходящим участком терминатора транскрипции, то он опосредует терминацию транскрипции в клетках-хозяевах, в которых должна экспрессироваться связывающая молекула согласно настоящему изобретению. Терминаторы транскрипции, пригодные для этой цели, описаны в данной области техники.

В предпочтительных вариантах реализации полинуклеотиды согласно настоящему изобретению могут также быть функционально с сигнальной последовательностью, которая способна направлять экспрессию связывающей молекулы в определенное место в клетке или вне клетки. Например, в некоторых вариантах реализации может быть желательно, чтобы клетка-хозяин, секретировала связывающую молекулу, которая в ней экспрессируется. В этом случае сигнальная последовательность кодирует сигнал к секреции. В данной области описаны соответствующие сигналы к секреции бактерий, и одним из таких примеров является лидерная последовательность PelB. В других вариантах реализации, например, в тех, которые включают экспрессию в клетках эукариот, может быть желательным сохранить экспрессию связывающей молекулы в эндоплазматическом ретикулуме (ЭР). В этом случае сигнальная последовательность включает последовательность, необходимую для удерживания в ЭР, кодирующую мотив "KDEL" (SEQ ID №54), и в частности, кодирующую последовательность "SEKDEL" (SEQ ID №55).

Полинуклеотиды согласно настоящему изобретению можно также оптимизировать по составу кодонов согласно способам, легкодоступным в данной области, с предпочтением кодонов, подходящих для конкретного выбранного организма-хозяина для экспрессии.

Полинуклеотиды и векторы можно вводить в клетки-хозяева с применением любой подходящей методики. Для клеток эукариот такие методики включают трансфекцию с фосфатом кальция, применение диэтилаиноэтил-декстрана, электропорацию, бомбардировку частицами, опосредуемую липосомами трансфекцию или трансдукцию с применением ретровирусов, аденовирусов или других вирусов, например осповакцины, или, в случае клеток насекомых, бакуловирусов. Для клеток бактерий подходящие способы могут включать трансформацию с хлоридом кальция, электропорацию или трансфекцию с применением бактериофагов. Для клеток растений подходящие способы включают агробактериальную трансформацию, электропорацию, микроинъекцию в растительные клетки и протопласты, бомбардировку микрочастицами, бактериальную бомбардировку, в частности, метод «fibre» или «whisker», в зависимости от конкретного вида растения., которое подвергают трансформации Таким образом, в дополнительном аспекте настоящее изобретение обеспечивает клетки-хозяева, включающие полинуклеотиды или векторы согласно настоящему изобретению. Таким образом, клетки-хозяева из организмов, описанных ниже, и включающие полинуклеотиды или векторы согласно настоящему изобретению также следует рассматривать как конкретные варианты реализации данного аспекта.

Подходящие системы экспрессии для экспрессии связывающих молекул согласно настоящему изобретению включают микробные экспрессии в клетках микробов, например, бактерий (например, экспрессионные системы Е. coli. Bacillus) и системы экспрессии в клетках грибов, например, дрожжи (такие как, например, Saccharomyces cerevisiae, Schizosaccharomyces pombe, виды Pichia, виды Hanensula) и другие системы экспрессии в клетках грибов (например, системы экспрессии в клетках мицеллиальных грибов, полученных из видов Aspergillus, Trichoderma reese и Neurospora crassa)); системы экспрессии в клетках млекопитающих, например, клетках CHO, клетках NS0, клетках HEK 293; системы экспрессии в клетках насекомых и системы экспрессии в клетках растений. Сафлор является особенно предпочтительной растительной экспрессионной системой. Специалисту известны такие экспрессионные системы, полностью описанные в данной области техники.

Настоящее изобретение также обеспечивает способы получения связывающих молекул согласно настоящему изобретению. Таким образом, в дальнейшем аспекте предложен способ получения связывающей молекулы, описанной в данной заявке, который включает введение в клетку-хозяина полинуклеотида или вектора согласно настоящему изобретению и культивирование указанных клеток-хозяев в условиях, при которых экспрессируется связывающая молекула. Условия для выращивания и поддержания клеток-хозяев, а также способствующие экспрессии связывающих молекул согласно настоящему изобретению такими клетками-хозяевами, полностью описаны в данной области техники. В одном варианте реализации способ дополнительно включает выделение и, возможно, дальнейшую очистку связывающей молекулы.

В случае если связывающая молекула согласно настоящему изобретению включает молекулу-метку или молекулу токсина, химически конъюгированную со связывающей молекулой, конъюгированную связывающую молекулу можно получить путем введения полинуклеотида или вектора согласно настоящему изобретению в клетку-хозяина, культивирования клетки-хозяина в условиях, при которых происходит экспрессия связывающей молекулы согласно настоящему изобретению, выделения экспрессированной связывающей молекулы и конъюгирования выделенной связывающей молекулы с подходящей меткой или токсином. Как правило, стадия конъюгирования включает применение гетеробифункциональных агентов, которые вызывают образование дисульфидных или тиоэфирных связей, как описано в данной области (стандартные методики, относящиеся к применению перекрестносшивающих агентов, см., например, в Hermanson, G.T. "Bioconjugate Techniques" Academic Press, London, 1996).

Специалисту ясно, что в некоторых вариантах реализации настоящего изобретения может быть желательным увеличение периода полужизни связывающей молекулы в циркулирующей крови в организме. Этого можно достичь различными способами, например, путем конструирования связывающей молекулы в форме гибридного белка, например, с альбумином, как описано выше в настоящей заявке. Дополнительные способы увеличения периода полужизни молекулы в сыворотке хорошо известны и включают, например, пегилирование, сиалилирование и гликозилирование. Соответственно, настоящее изобретение охватывает связывающие молекулы, как описано выше, которые пегилированы, сиалилированы и гликозилированы

Настоящее изобретение включает также композиции, включающие связывающую молекулу, и по меньшей мере один дополнительный компонент. Например, специалисту в данной области понятно, что при выделении связывающей молекулы из клеток-хозяев после экспрессии, можно получить композиции, включающие в значительной степени очищенную связывающую молекулу, но содержащие также примесь, разбавитель, буфер или т.п. Такие промежуточные композиции могут подходить для непосредственного дальнейшего применения, либо связывающую молекулу можно подвергать дополнительной очистке.

Композиции согласно настоящему изобретению могут также включать связывающую молекулу согласно настоящему изобретению в комбинации с любым подходящим фармацевтически приемлемым носителем, наполнителем, разбавителем и/или стабилизатором. Специалисту известны такие компоненты, описанные в данной области. Предпочтительно такая композиция находится в любой форме, подходящей для введения пациенту, в частности в форме, подходящей для парентерального введения, например путем инъекции или инфузии.

В случае если композиция предназначена для инъекции или инфузиии, она может иметь форму суспензии, раствора или эмульсии в масляной или водной среде и содержать агенты для приготовления препарата, например, суспендирующие, консервирующие, стабилизирующие и/или диспергирующие агенты. Кроме того, связывающая молекула или композиция могут быть в сухой форме, для восстановления перед применением с помощью соответствующей стерильной жидкости.

Связывающие молекулы и композиции согласно настоящему изобретению, в частности мультиспецифичные связывающие молекулы и композиции, содержащие таковые, можно применять для диагностики и/или лечения заболевания, такого как, например, аутоиммунное заболевание, воспалительное заболевание, инфекционное заболевание (включая болезнь трансплантат-против-хозяина), аллергия и рак (например, лимфома не-Ходжкина; хронический лимфолейкоз; лимфома/болезнь Ходжкина; солидные опухоли, например, при раке груди, раке яичников, раке толстой кишки, раке почек или раке желчных протоков; минимальное остаточное заболевание; метастатические опухоли, например метастазы в легких, костях, печени или мозге).

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к антигену CD19 или CD20, могут быть особенно полезны при лечении лимфомы не-Ходжкина.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EGFR1, можно могут быть особенно полезны при лечении типов раков, при которых экспрессия EGFR1 увеличена или изменена, например, рака груди, мочевого пузыря, головы и шеи, предстательной железы, почек, немелкоклеточного рака легких, колоректального рака и глиома.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к антигену ТФ, можно могут быть особенно полезны в лечении рака груди или толстой кишки и/или метастазов в печень.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к CD30, могут быть особенно полезны в лечении болезни Ходжкина.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к альфа-цепи рецептора IL4 (IL4R альфа), могут быть особенно полезна в лечении солидных опухолей, в частности, карциномы груди, яичников, системы почек, головы и шеи, злокачественной меланомы и связанной со СПИДом саркомы Калоши.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EGFR3/HER3 и/или EGFR2/neu, могут быть особенно полезны в лечении рака груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к IGFR, могут быть особенно полезны в лечении рака предстательной железы, колоректального рака, рака яичников или рака груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к CD5, могут быть особенно полезны в лечении хронического лимфолейкоза.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к MUC-1, могут быть особенно полезны в лечении рака желудка и рака яичников.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к EpCAM, могут быть особенно полезны в лечении карцином толстой кишки, почек и груди.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к PLAP, могут быть особенно полезны в лечении рака яичников или яичка.

Мультиспецифичные связывающие молекулы согласно настоящему изобретению, у которых по меньшей мере одна дополнительная специфичность направлена к OFA-iLR, могут быть особенно полезны в лечении метастатических опухолей.

В дополнительном аспекте настоящее изобретение обеспечивает применение связывающей молекулы, как описано выше, в производстве лекарственного препарата для лечения аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака (например, лимфомы не-Ходжкина; хронического лимфолейкоза; лимфомы Ходжкина; солидных опухолей, например, при раке груди, раке яичников, раке толстой кишки, раке почек или раке желчных протоков; минимальном остаточном заболевании; метастатических опухолях, например, дающих метастазы в легкие, кости, печень или мозг). В случае если определенные мультиспецифичные связывающие молекулы описаны выше как обладающие особенной полезностью в лечении определенного заболевания, эти связывающие молекулы можно также применять в производстве лекарственных препаратов для данного определенного заболевания.

В еще одном аспекте связывающие молекулы согласно настоящему изобретению можно применять в качестве реагентов для окрашивания клеток, экспрессирующих FcγRIIIA. В случае, если связывающая молекула обладает специфичностью к по меньшей мере одному дополнительному антигену, ее можно применять в качестве реагента, с помощью которого можно идентифицировать комплексы молекулы, связывающейся с клетками, экспрессирующими FcγRIIIA, с антигеном. Связывающие молекулы согласно настоящему изобретению также можно применять для анализа и типирования взятых у пециента образцов ex vivo, таких как биомаркеры, а также для выделения NK-клеток для терапии ex-vivo.

Таким образом, в другом аспекте предусмотрен набор, включающий связывающую молекулу, как описано выше, и средства для детекции связывающей молекулы, связанной с FcγRIIIA. В случае если связывающая молекула помечена радиоактивной меткой или хемилюминесцентной меткой, средства детекции могут включать пленку, чувствительную к радиоактивной или хемилюминесцентной метке. В случае если связывающая молекула соединена с гистидиновой меткой последовательностью или меткой c-myc, набор может включать антитело, узнающее эту метку.

Различные аспекты и варианты реализации настоящего изобретения проиллюстрированы более подробно при помощи примеров. Очевидно, что можно осуществить незначительные модификации, не выходящие за пределы объема изобретения, и специалисту понятно, что можно получить дополнительные антитела и антигенсвязывающие фрагменты для применения в настоящем изобретении, как описано в Примере 2 данной заявки, а их свойства в отношении связывания с различными изоформами FcγRIII и даже с различными аллельными формами Fc RIIIA, можно проанализировать, как описано в разделе Примеры данной заявки.

Во избежание сомнений, термины «FcγRIII», «FcγRIIIA» и «FcγRIIIB» используются в данной заявке равнозначно с терминами «CD16», «CD16A» (обозначающим изоформу A CD16) и «CD16B» (обозначающим изоформу B CD16), соответственно.

КРАТКОЕ ОПИСАНИЕ ФИГУР

Фигура 1: Результаты твердофазного ИФА, демонстрирующие связывание scFv 50NI с иммобилизованном на стрептавидине CD16-Fc

Планшеты для ИФА покрывали 500 нг стрептавидина и 300 нг IgG человека (Sigma-Aldrich, Taufkirchen, Germany) на лунку в 100 мМ NaHCO3, pH 8,6. Затем адсорбировали 300 нг биотинилированного CD16A-Fc в течение 30 минут при комнатной температуре в ФБР.

Иммобилизованный на стрептавидине CD16-FC, стрептавидин и IgG человека инкубировали с 1 мкг/мл MAT мыши (мини антитела, Mab) или 50 мкл неочищенного экстракта периплазмы клона 50NI в ФБР/TWEEN 0,1%/2% обезжиренном сухом молоке. Связывание MAT A9 детектировали антителом козы к антителам мыши, конъюгированным с ПХ. Связывание scFv 50NI детектировали с помощью антитела к пента-His, конъюгированного с ПХ (анти-His-ПХ). Оптическую плотность при 450 нм для субстрата ПХ тетраметил бензидина (ТМБ) измеряли после остановки реакции добавлением 50 мкл 0,5 M серной кислоты.

Фигура 2: scFv человека со зрелой аффинностью к CD16 связывается с трансфецированными клетками, экспрессирующими CD16A, но не клетками, экспрессирующими CD16B. Клетки BW мыши и клетки BW, стабильно трансфецированные CD16A (BW/CD16A), клетки HEK-293 и клетки HEK-293, трансфецированные CD16B (293/CD16B), CD16A (293/CD16A) или NKp46 (293/NKp46), окрашивали 10 мкг/мл MAT A9 (анти-CD16) или MAT 195314 (анти-NKp46), а затем 15 мкг/мл конъюгированных с флюорохромом FITC антител козы к IgG мыши. scFv к CD16 (анти-CD16) применяли в концентрации 50 мкг/мл и детектировали 10 мкг/мл MAT 13/45/31-2 (к гекса-His), а затем конъюгированным с FITC антител козы к IgG мыши. Средние интенсивности флуоресценции, полученные при анализе методом проточной цитометрии корректировали путем вычитания значений флуоресценции клеток, окрашенных только вторичными реагентами, и наносили на график.

Фигура 3: Твердофазный ИФА рекомбинантного CD16A-Fc и CD16B.

Рекомбинантные белки CD16A-Fc и CD16B наносили в концентрации 80 нМ в 0,1 M NaHCO3 с pH 8,8. Лунки блокировали ФБР, 2% обезжиренным молоком. Связывание scFv с рекомбинантными белками и с gp34-Fc (отрицательный контроль) детектировали при помощи антител к с-Мус, конъюгированных с ПХ (10 мкг/мл). После инкубации с анти-CD16 MAT A9 (1 мкг/мл) следовала обработка антителом козы к Ig мыши, конъюгированным с ПХ (0,5 мкг/мл). Иммобилизованные рекомбинантные CD16B непосредственно детектировали путем окрашивания конъюгатом анти-His-ПХ (1 мкг/мл), а иммобилизованные гибридные белки, связанные с Fc, анализировали с помощью IgG против антител человека, конъюгированного с ПХ (0,5 мкг/мл). В качестве субстрата для ПХ применяли 50 мкл ТМБ. После остановки реакции добавлением 50 мкл 0,5 M H2SO4, измеряли оптическую плотность при 450 нм.

Фигура 4: Запуск перенаправленной цитотоксичности в свежеизолированных NK-клетках одноцепочечным антителом scFv человека, обладающим зрелой аффинностью к CD16. NK-клетки выделяли из периферической крови здорового донора и обогащали, а затем применяли в качестве эффекторных клеток в анализе цитотоксичности с мечеными кальцеином клетками Р815 в качестве клеток-мишеней. Эффекторные клетки (E) и клетки-мишени (T) инкубировали в течение 3 часов при соотношении Е:Т, равном 10:1, в присутствии 1 мкг/мл указанных антител. Процент специфичного лизиса рассчитывали на основании измеренных значений флюоресценции высвобожденного кальцеина в над осадочной жидкости. Средние значения и стандартные отклонения, полученные по трем повторам, наносили на график.

Фигура 5: Анализ методом проточной цитометрии scFv со зрелой аффинностью к CD16 в ПМЯ и NK-клетках. Полиморфноядерные клетки (ПМЯ) и клетки-естественные киллеры (NK) выделяли из периферической крови здорового донора и применяли для окрашивания и анализа методом поточной цитометрии. Клетки окрашивали 10 мкг/мл анти-CD16 MAT A9 и анти-CD56 MAT B159, а затем 15 мкг/мл конъюгированных с FITC IgG козы к антителам мыши. Все scFv применяли в концентрации 50 мкг/мл и детектировали 10 мкг/мл антитела к (His)6, а затем 15 мкг/мл конъюгированных с FITC IgG козы к антителам мыши. Средние интенсивности флуоресценции, полученные при анализе методом поточной цитометрии корректировали путем вычитания значений флюоресценции клеток, окрашенных только вторичными реагентами, и наносили на график.

Фигура 6: Выравнивание последовательностей аминокислот аллельных вариантов изоформ CD16A и CD16B. Сигнальные пептиды выделены серым. Звездочки и курсив обозначают различия между аллельными вариантами CD16B. Отличия между изоформами CD16A и CD16B показаны жирным подчеркнутым шрифтом. Положение полиморфизма CD16A 158 Val/Phe обозначено прямоугольником.

Фигура 7: Твердофазный ИФА различных изоформ CD16. Лунки планшета MaxisorpTM покрывали 100 мМ NaHCO3, содержащим 200 нг CD16A-Fc48R/158V, CD16A-Fc48R/158F, CD16B-FcSH, CD16B-FcNA1, CD16B-FcNA2 и NKp46-Fc. Все антигены инкубировали с [А] scFv 4-LS21, а затем с конъюгированнм с ПХ антит-His антителом или [Б] с MAT A9, а затем с антителом козы к антителам мыши, конъюгированным с ПХ (минимальная перекрестная реактивность по отношению к IgG человека). scFv к NKp46, применяемое как первичное антитело, служило отрицательным контролем.

Фигура 8: Специфичный цитолиз клеток-мишеней NK-клетками, активированными TandAb. 1×104 указанных меченных кальцеином клеток L540CY (результаты представлены на панели [А]) или клеток-мишеней JOK-1 (результаты представлены на панели [Б]) инкубировали в течение 3 часов с 1×105 NK-клеток в присутствии указанных концентраций антитела TandAb CD30×CD16 (закрашенный ромб) или TandAb CD19×CD16 (незакрашенный ромб). В качестве контроля клетки-мишени инкубировали с NK-клетками без антитела (закрашенный квадрат). Процент специфического лизиса вычисляли на основании измеренных значений флюоресценции высвобожденного кальцеина и методом анализировали нелинейной регрессии с применением программы GraphPadPrism.

ПРИМЕРЫ

Пример 1: Временная экспрессия и очистка гибридного белка CD16A-Fc человека

Секретируемую растворимую форму гибридного белка CD16A-Fc человека плолучали в клетках HEK-293 после временной трансфекции плазмидой pCDM-CD16-Fc, кодирующей CD16A человека, соединенный с Fc-фрагментом IgG1 человека (Mandelboim et al., 1999, см. выше).

Клетки HEK-293 (номер в ATCC CRL-1573) культивировали полной среде DMEM (среда DMEM с добавлением 10% фетальной телячьей сыворотки (ФТС), инактивированной нагреванием, 2 мМ L-глутамина, 100 ед./мл пенициллина G натрия и 100 мкг/мл стрептомицина сульфата; все реагенты получены от Invitrogen, Karlsruhe, Германия) при 37°C при увлажненной атмосфере с 5% CO2. Трансфекцию клеток с применением фосфата кальция проводили следующим образом.

За день до трансфекции 1,5×106 клеток в культуральные чашки диаметром 10 см со средой DMEM. 10 мкг плазмидной ДНК смешивали с 500 мкл 250 мМ CaCl2, затем эту смесь добавляли по каплям к 500 мкл 2×HEBS буфера (280 мМ NaCl, 1,5 мМ Na2HPO4, 50 мМ HEPES, pH 7,05) и инкубировали в течение 15 минут при комнатной температуре. К смеси для трансфекции добавляли 9 мл полной среды DMEM, перемешивали и переносили в одну чашку с клетками HEK-293, из которой предварительно удалили культуральную среду. На следующий день среду для трансфекции заменяли на бессывороточную среду DMEM (среда DMEM с добавлением 2 мМ L-глутамина, 100 ед./мл пенициллина G натрия и 100 мкг/мл стрептомицина сульфата и с добавлением 1 × добавки Insulin-Transferrin-Selenium-A (инсулин-трансферрин-селен-А, все реагенты получены от Invitrogen). Супернатанты, содержащие секретированный гибридный белок CD16A-Fc, собирали дважды в течение двух-шести дней после трансфекции в зависимости от жизнеспособности клеток. После каждого сбора к клеткам добавляли свежую бессывороточную среду. Собранные супернатанты центрифугировали для удаления клеток и остатков клеток и помещали на хранение при -80°C до использования для очистки гибридного белка. Процедуру трансфекции повторяли до получения примерно 1,2 л супернатанта, содержащего гибридные белки CD16A-Fc.

Очистку рекомбинантного гибридного белка CD16A-Fc проводили на колонке объемом 2 мл с белком A (Protein A SepharoseTM Fast Flow, Amersham Pharmacia). Колонку уравновешивали десятью объемами DMEM с pH 7 (Invitrogen; с добавлением 100 мкг/мл стрептомицина, 100 ед./мл пенициллина, 1 × инсулин-трансферрин-селена-А и 2 мМ L-глютамина). Перед помещением супернатанта клеточной культуры (1200 мл) на колонку его пропускали через стерильный фильтр с размером отверстий 0,2 мкм и корректировали pH до значения 7 добавлением смеси 0,1 M глицин/HCl с pH 2,7. Раствор пропускали через колонку под действием силы тяжести при 4°C. Затем промывали колонку 10 объемами DMEM с pH 7. Элюирование проводили 6 объемами смеси 0,1 M глицин/HCl с pH 2.7. Фракции объемом 1 мл собирали непосредственно в 55 мкл 1 M Tris/HCl с pH 8.8.

Анализ фракций под номерами 1-10 в 12% ПАА-геле показал, что подавляющее большинство гибридного белка находится во фракциях 2-7. Эти фракции объединяли и диализировали дважды против 5 л ФБР с pH 7,0. Как показало определение концентрации белка по Бредфорду (Bradford, 1976, Anal. Biochem. 72: 248-254), общий выход гибридного белка CD16A-Fc составил 21 мг - т.е. было получено 17,5 мг гибридного белка на литр супернатанта культуры клеток.

Пример 2: Идентификация и выделение антитела, специфичного к CD16.

Гибридный белок CD16A-Fc применяли для скрининга обширной библиотеки фагового дисплея scFv, полученных из IgM, которую получили с применением способов, аналогичных описанным ранее (Dörsam et al., 1997 FEBS Letts 414: 7-13, Little et al., 1999 J. Immunol. Methods 231:3-9, Schwarz et al., FASEB J. 18: 1704-6). Клоны в этой библиотеке содержали последовательности нуклеотидов между последовательностью, кодирующей scFv, и геном pIII бактериофага M13, кодирующим гексагистидиновую метку, стоп-кодон amber и эпитоп c-myc.

500 мкг белка CD16A, соединенного с Fc, биотинилировали с применением ECL модуля для биотинилирования (Amersham Pharmacia Biotech, Uppsala, Швеция) и использовали в трех раундах селекции против библиотеки фагового дисплея. Перед селекцией библиотеку подвергали предварительной адсорбции последовательно на покрытом полистиролом стрептавидине и на IgG человека (Sigma-Aldrich, Tauflkirchen, Германия), чтобы удалить элементы, которые могут связываться с этими белками. Приблизительно 1012 фагов из фаговой библиотеки ресуспендировали в ФБР с 0,1% буфере tween и 2% обезжиренного молока, инкубировали с растворимым биотинилированным гибридным белком CD16A-Fc. Комплексы фаг-антиген иммобилизовали с помощью покрытых стрептавидином магнитных частиц с применением магнитного сепаратора (Dynal, Oslo, Норвегия. Фаги, которые не связывались специфично с целевым антигеном, удаляли путем 10 этапов промывки ФБР с 0,1% tween. Связавшиеся молекулы элюировали с применением глицин-HCl с pH 2,2, и после нейтрализации смесью 2 M Tris/HCl с pH 8,0, использовали элюат для инфицирования свежевыращенных клеток Е. coli XL1 Blue, находящихся в фазе логарифмического роста (ОП600 0,2-0,5). Клетки, успешно трансформированные фагмидами, кодирующими scFv человека, подвергали селекции на устойчивость к ампицилину и затем инфицировали хелперным фагом M13K07, чтобы получить потомство фага, несущего на поверхности scFv для последующей селекции in vitro. После 3-го раунда селекции индивидуальные колонии выращивали на среде LB, содержащей 100 мкг/мл ампициллина и 20 мкг/мл тетрациклина при 30°C в 2 мл планшетах PP-Masterblock (Greiner, Frickenhausen, Германия). Клетки собирали путем центрифугирования и ресуспендировали в 200 мкл 200 мМ Tris-HCl с pH 7,5, содержащим 20% сахарозы, 1 мМ ЭДТА. В ходе 1 часа инкубации на льду наружная мембрана разрушалась и растворимые белки периплазмы, включая scFv, высвобождались в культуральную среду. После удаления сферопластов и остатков клеток путем центрифугирования неочищенные экстракты периплазмы анализировали путем твердофазного ИФА на scFv, связывающиеся с гибридным белком CD16A-Fc. В трех отдельных случаях выявили один клон (50NI).

Поскольку отбор этого клона по аффинности из библиотеки фагового дисплея проводили с применением Fc-гибридного белка человека необходимо было показать специфичность клона 50NI к той части молекулы, которая представляет собой CD16.

Экстракты периплазмы из клона 50NI получали, как описано выше, и тестировали методом твердофазного ИФА (ELISA) на его способность связываться с гибридным белком CD16A-Fc и IgG человека. Мышиное B качестве контроля применяли моноклональное анти-CD16 антитело мыши (Hombach et al. 1993 Int. J. Cancer 55: 830-836). Планшеты MaxisorbTM для твердофазного ИФА предварительно покрывали 500 нг стрептавидина и 300 нг IgG человека (Sigma-Aldrich, Taufkirchen, Германия) на лунку в 100 мМ NaHCO3 с pH 8,6. Затем проводили иммобилизацию 300 нг биотинилированного CD16A-Fc в течение 30 мин при комнатной температуре в ФБР.

Связавшийся со стрептавидином CD16A-Fc, стрептавидин и IgG человека инкубировали с 1 мкг/мл MAT A9 или 50 мкл неочищенного экстракта периплазмы из клона 50NI в смеси ФБР/TWEEN 0,1%/2% сухого обезжиренного молока. Связывание MAT A9 детектировали при помощи AT козы к AT мыши, конъюгированного с ПХ (0,5 мкг/мл, Dianova, Hamburg, Германия), а связывание scFv 50NI детектировали при помощи антитела к пента-His, конъюгированного с ПХ (1 г/мл, Qiagen, Hilden, Germany). 50 мкл ТМБ (KPL, Maryland, USA), использовали в качестве субстрата для ПХ и осуществляли реакцию окрашивания. Реакцию останавливали 50 мкл 0,5 M H2SO4 и измеряли оптическую плотность при 450 нм.

Результаты представлены на Фигуре 1. MAT A9 и scFv 50NI четко узнают биотинилированный гибридный белок CD16A-Fc, связанный со стрептавидином. scFv 50NI не давал сигнала ни с IgG человека, ни с стрептавидином по отдельности. Антитело к His ПХ-конъюгат, используемый как вторичный реагент, не демонстрировало неспецифичного связывания с антигеном. Однако, конъюгат AT козы к AT мыши с ПХ, используемый в качестве вторичного реагента для детекции MAT A9, вызывал некоторое фоновое окрашивание вследствие перекрестной реактивности с Fc-фрагментом гибридного белка CD16 и IgG человека, используемого в качестве отрицательного контроля.

Эти результаты убедительно показывают, что scFv 50NI демонстрирует специфичность по отношению к части гибридного белка, представляющей собой CD16A, но не Fc-фрагменту.

Пример 3: Тестирование scFv 50NI методом сортировки клеток с возбуждением флуоресценции (FACS) с различными клеточными линиями, стабильно экспрессирующими изоформы CD16, МПК и гранулоцитами человека.

Для определения того, обнаруживает ли 50NI scFv связывание с нативным белком CD16A на поверхности клетки, неочищенный периплазматический экстракт scFv тестировали методом поточной цитометрии на двух линиях клеток, экспрессирующих CD16A или CD16B, соответственно. Для этой цели применяли линию клеток BW/CD16A, экспрессирующую CD16A (Mandelboim et al., 2001, Nature 409: 1055-1060);) и линию клеток 293-CD16 (клетки HEK-293 стабильно трансфецированные плазмидой, кодирующей аллель NA-2 изоформы CD16B человека).

Чтобы оценить, обладает ли 50NI scFv способностью связываться с CD16A, экспрессируемым на поверхности естественных киллеров (NK) и/или с CD16B, присутствующем на поверхности нейтрофильных гранулоцитов (van de Winkel and Capel, 1993, см. выше; van Spriel et al., 2000, Immunol. Today 21(8): 391-397), его тестировали на связывание со свежевыделенными мононуклеарами периферической крови (МПК), состоящими на 10-20% из NK-клеток, и с полиморфно-ядерными клетками (ПЯК), представленными более чем на 95% CD16B-положительными нейтрофильными гранулоцитами методом поточной цитометрии.

MAT A9 мыши и экстракты периплазмы клона scFv18 A9 мыши (scFv полученный из MAT A9) применяли в качестве контролей.

3.1 Рост линий клеток и выделение МПК и ПЯК.

Клетки BW/CD16A культивировали в среде DMEM с добавлением инактивированной нагреванием 10% фетальной телячьей сыворотки (ФТС), 2 мМ L-глутамина, 100 ед/мл пенициллина G натрия, 100 мкг/мл стрептомицина сульфата, 1% заменимых аминокислот и 5 мг/мл G418. Клетки 293/CD16B культивировали в среде DMEM с добавлением инактивированной нагреванием 10% фетальной телячьей сыворотки (ФТС), 2 мМ L-глутамина, 100 ед/мл пенициллин G натрия, 100 мкг/мл стрептомицина сульфата и 0,5 мг/мл G418. Нетрансфецированные исходные линии клеток BW и 293 культивировали, как описано выше для стабильных трансфектантов, но в середе с отсутствием G418.

МПК и ПЯК выделяли из гепаринизированной периферической крови, полученной от здорового донора, путем центрифугирования в градиенте плотности. Кровь дважды разбавляли ФБР, наносили слоями на двойную подложку, состоящую из 12 мл Histopaque-1119TM (Sigma-Aldrich) и верхнюю подложку из 12 мл Histopaque-1077. Центрифугирование осуществляли при 800g в течение 25 мин. МПК, расположенные на верхней подложке Histopaque-1077TM (Sigma-Aldrich), и ПЯК, расположенные на подложке Histopaque-1119TM, собирали и промывали 3 раза ФБР перед использованием.

3.2 Выделение экстрактов периплазмы, содержащих scFv 50NI и scFv18 A9

Неочищенные экстракты периплазмы, содержащие scFv, выделяли из 5 мл бактериальных культур. Свежепосеянные бактерии выращивали в течение ночи при 37°C в среде LB, содержащей 50 мМ глюкозы, 100 мкг/мл ампициллина и 20 мкг/мл тетрациклина. Ночные культуры разводили до ОП600нм=0,1 в середе LB с ампициллином и тетрациклином и продолжали выращивание при 37°C до ОП600нм=0,8. Бактерии собирали путем центрифугирования и ресуспендировали в среде LB, содержащей 0,1 мМ изопропил-β-D-тиогалактопиранозида (IPTG), 100 мкг/мл ампициллина и 20 мк/мл тетрациклина. После инкубации стимулированных бактерий в течение ночи при 21°C получали 300 мкл экстрактов периплазмы, как описано для твердофазного ИФА. Перед использованием в анализе методом FACS экстракты периплазмы диализировали против ФБР в течение ночи.

3.3 Поточная цитометрия

Для анализа методом проточной цитометрии 1×106 клеток BW, BW/CD16A, HEK-293, 293/CD16B, МПК и ПЯК окрашивали либо антителом А9, либо экстратом периплазмы, содержащими scFv18A9 и 50NI.

1×106 клеток инкубировали с 100 мкл диализированных экстратов периплазмы или с MAT A9 (10 мкг/мл) в течение 45 минут на льду. В инкубационную смесь антитела/scFv с МПК и ПЯК добавляли поликлональные IgG человека в концентрации 1 мг/мл, чтобы блокировать рецепторы Fc на поверхности субпопуляций МПК и ПЯК. После промывки буфером для FACS (ФБР с добавлением 2% инактивированной нагреванием фетальной телячьей сыворотки и 0,1% азида натрия) клетки инкубировали на льду в течение 45 минут с 0,1 мл 0,01 мг/мл анти-(His)6 MAT 13/45/31-2 мыши (Dianova, Hamburg, Германия) в том же буфере. После второго цикла промывки клетки инкубировали с 0,1 мл 0,015 мг/мл конъюгированных с FITC антителами козы к IgG мыши (Dianova, Hamburg, Germany) при тех же условиях. Затем клетки промывали еще раз и ресуспендировали в 0,5 мл буфера для FACS, содержащего 2 мкг/мл пропидия йодида (Sigma-Aldrich), для устранения мертвых клеток. Флюоресценцию 1×104 окрашенных клеток измеряли с применением поточного цитометра Beckman-Coulter Epics XL. Среднюю интенсивность флюоресценции рассчитывали с применением System-11 и программы Ехро32 (Beckman-Coulter, Krefeld, Germany). Флюоресценцию, обусловленную фоновым окрашиванием клеток только вторичными агентами, вычитали из результатов и строили гистограммы (не представлены) для облегчения анализа.

3.4 Результаты

Моноклональное анти-CD16 антитело A9 мыши и полученное из A9 анти-CD16 scFv18 служили в качестве положительных контролей и отчетливо демонстрировали связывание с BW/CD16A по сравнению с нетрансфецированными исходными клетками (BW). scFv 50NI также показывал четкое окрашивание клеток BW/CD16A на уровне, сравнимом A9.

И моноклональное антитело A9, и scFv18 A9 демонстрировали прочное связывание с трансфецированными клетками 293/CD16B, экспрессирующими на поверхности изоформу CD16B, тогда как 50 N1 не связывались с этой линией линией клеток.

Моноклональное антитело А9 и scFv18 A9 демонстрировали отчетливое окрашивание субпопуляции МПК, представляющих фракцию NK-клеток. scFv 50NI дакже демонстрировал связывание с этой субпопуляцией.

В отличие от A9 и полученного на основе A9 scFv, оба из которых демонстрировали отчетливый сигнал с очищенными гранулоцитами, 50 N1 scFv не связывался с ПЯК.

Эти данные указывают на то, что scFv 50NI специфично связывается с изоформой CD16A и не связывается с изфоформой CD16B. scFv 50NI также узнает не только рекомбинантные CD16A, но и нативный антиген, экспрессируемый на поверхность NK-клеток.

Пример 4: Связывание анти-СВ16 scFv 50NI человека с обогащенными NK-клетками.

Чтобы продемонстрировать, что субпопуляция МПК, которую, как показано в примере 3, узнает 50NI, включает клетки-естественные киллеры (NK), выделяли обогащенную популяцию NK-клеток из МПК и анализировали ее связывание с scFv 50NI методом поточной цитометрии.

МПК выделяли из гепаринизированной периферической крови здоровых доноров путем центрифугирования в градиенте плотности. Образцы крови разбавляли в два раза ФБР и наносили слоями на подложку Histopaque-1077TM (Sigma-Aldrich) и центрифугировали при 800 g в течение 25 минут. МПК, расположенные на границе раздела, собирали и промывали 3 раза ФБР. Для выделения NK-клеток МПК ресуспендировали в 2% ФТС/ФБР и подвергали одному раунду отрицательной селекции с применением набора EasySEPTM для отрицательного обогащения NK-клеток (CellSystems) согласно инструкциям изготовителя. Окрашивание МПК и NK-клеток и анализ методом поточной цитометрии проводили, в целом, как описано в примере 3 выше: 1×106 клеток окрашивали 10 мг/мл MAT A9 или моноклонального анти-CD56 антитела MAT B159 (BD Biosciences/Pharmingen) и затем 15 мкл конъюгированных с FITC антителам козы к IgG мыши. Антитела scFv18 A9 мыши и антитела scFv 50NI человека применяли для окрашивания в концентрации 50 мкг/мл, и клетки, связавшиеся scFv, детектировали 10 мкг/мл MAT к (His)6 и затем 15 мкл конъюгированных с FITC IgG козы против антител мыши. Все окрашивания проводили в присутствии 1 мг/мл поликлональных IgG человека. Мертвые клетки исключали при помощи окрашивания пропидия йодидом, как описано выше. Анализ данных проводили, как описано в Примере 3 выше.

4.1 Результаты

Окрашивание МПК анти-CD56 и анти-CD16 антителами четко выявило субпопуляцию, представляющую фракцию NK-клеток. scFv 50NI также узнавали аналогичную небольшую популяцию клеток, указывая на связывание с NK клетками.

После отрицательного обогащения NK-клеток, все четыре антитела/scFv продемонстрирвали однозначное окрашивание. В то время, как анти-CD56 MAT демонстрировало связывание со всей популяцией NK-клеток, небольшая доля клеток не окрашивалась антителами к CD16. Это может свидетельствовать о присутствии некоторых клеток с CD16-отрицательным фенотипом.

Пример 5: Измерение потока Са2+ после связывания scFv 50NI.

CD16A, рецептор к IgG с низкой аффинностью, экспрессируется в большинстве NK-клеток периферической крови человека совместно с иммунорецепторным тирозин-богатым активаторным мотивом (ITAM), содержащим γ-цепь FcεRI или ζ-цепь комплекса TCR/CD3. Связывание CD16A с антителами или иммунными комплексами инициирует цитотоксичность NK-клеток и секрецию цитокинов. Активация включает фосфорилирование γ-цепи или ζ-цепи, соответственно, и последующую внутриклеточную передачу сигнала, например, мобилизацию Са2+.

Чтобы проверить, обладают ли анти-CD16 антитела scFv 50NI человека NK-активирующими свойствами, проводили измерения потока Са2+ в свежевыделенных NK-клетках после лигирования поверхностных рецепторов моноклональными анти-CD16 антителами или анти-CD16 scFv. Поскольку некоторым анти-CD16 антителам для достижения отчетливого увеличения концентрации внутриклеточного кальция необходимо перекрестное связывание вторичными реагентами, для перекрестного связывания связавшихся с клетками анти-CD16 антител применяли анти-с-myc и анти-(His)6 антитела в комбинации с IgG к антителам мыши.

Для получения NK выделяли МПК из гепаринизированной периферической крови здорового донора центрифугированием в градиенте плотности. Образцы крови разбавяли в два раза ФБР, наносили слоями на подложку Histopaque-1077TM и центрифугировали при 800g в течение 25 минут. МПК, расположенные на границе раздела, собирали и промывали 3 раза ФБР. Для выделения NK-клеток МПК ресуспендировали в 2% ФТС/ФБР и подвергали одному раунду отрицательной селекции с применением набора EasySEPTM для отрицательно обогащения NK-клеток (CellSystems) согласно инструкциям изготовителей. NK-клетки промывали однократно BBSS (сбалансированным солевым раствором Хэнкса) и затем метили индикатором кальция фтор-4-ацетоксиметиловым (AM) эфиром (Molecular Probes, Leiden, Нидерланды) в концентрации 2 мкМ в течение 30 минут при комнатной температуре в темноте. После промывки HBSS клетки инкубировали в течение дополнительных 20 минут в BBSS до полной деэтерификации внутриклеточных AM эфиров и еще раз промывали HBSS. Для анализа изменения концентрации внутриклеточного кальция методом поточной цитометрии аликвоты меченых NK-клеток сначала измеряли без какого-либо антитела на поточном цитометре Beckman-Coulter Epics XL, чтобы определить фоновую флюоресценцию. Через примерно 60 сек добавляли анти-CD16 антитела (2 мкг MAT A9 или 5 мкг scFv18 A9 или 5 мкг scFv 50NI) и продолжали измерение. На 180 сек после старта к пробе MAT A9 добавляли 20 мкг поликлональных антител козы против IgG мыши (КПМ) для перекрестного связывания A9, связавшегося с CD16 на поверхности NK-клеток. Для перекрестного связывания scFvs добавляли 2,5 мкг анти-(His)6 MAT мыши 13/45/31-2 и 2,5 мкг анти-c-myc MAT 9E10 перед продолжением измерения. В случае проб с scFv 20 мкг антител козы против IgG мыши добавляли в более поздний момент времени для дальнейшего перекрестного связывания анти-(His)6 MAT и/или анти-c-myc MAT, связавшихся с scFv. Определяли среднюю интенсивность флуоресценции на коротких интервалах с применением программы Ехро32 (Beckman-Coulter, Krefeld, Germany) и строили график зависимости от времени (не показан).

Кривые флюорометрии, полученные для свежевыделенных NK-клеток, ясно показывают, что MAT A9 вызывает значительное увеличение концентрации внутриклеточного кальция при перекрестном связывании с антителами к IgG мыши, что проявляется в более высоких сигналах флюоресценции. В отличие от MAT A9, scFv полученный ииз A9 (scFv18 A9) вызывает незначительное увеличение или вообще не вызывает увеличения концентрации внутриклеточного кальция даже после перекрестного связывания с антителами к (His)6, к c-myc и к IgG мыши. Тем не менее, антитело scFv 50NI человека после лигирования связанного с клеточной поверхностью scFv с перекрестно связывающими антителами давало отчетливый (хотя несколько слабый) сигнал флюоресценции. Это показывает, что scFv 50NI человека обладает связывающими характеристиками, соответствующими способности активировать NK-клетки через CD16A.

Пример 6: Созревание аффинности scFv 50NI путем «перетасовки» (shuffling) легких цепей

Для получения анти-CD16 scFv с повышенной аффинностью создали библиотеку с цепями на основе клона 50NI путем перегруппировки VH цепи 50NI с набором генов VL.

Наборы генов Vκ и Vλ вырезали из ДНК pEXHAM1, полученных из обширной библиотеки «наивных» scFv человека, описанной ранее (Schwarz et al., см. выше, 2004). Этот набор отражает примерно 105 индивидуальных вариантов каждой из Vκ и Vλ цепей. В результате перегруппировки тяжелой цепи 50NI путем клонирования по MluI и NotI сайтам pEXHAM1 и трансформации клеток Е. coli XL1 blue (1,8 кВ, кювета длиной 0,1 см, 25 мкФ, 200 'Ω) 1 мкг вектора были получены библиотеки из 2,6×106 (Vκ) и 2,2×106 (Vλ) элементов.

Анализ последовательностей 32 произвольно выбранных клонов после трансформации показал, что каждый клон содержит индивидуальную легкую цепь, а 24 клона показали экспрессию полноразмерных scFv детектируемую при помощи анти-His антител (Qiagen, Hilden, Germany) в анализе методом Вестерн-блот.

Проводили четыре раунда селекции на биотинилированном гибридном белке CD16A-Fc, как описано в примере 2. Давление селекции, благоприятствующее связывающим молекулам с высокой аффинностью, создавали последовательным ограничением концентрации антигена (1-й раунд - 20 нМ, 2-й раунд 1 нМ, 3-й раунд 0,1 нМ, 4-й раунд 0,01 нМ). Библиотеки перестановок κ и λ поддерживали раздельно.

Приблизительно 108 бактериофагов из каждой библиотеки, ресуспендированных в смеси ФБР/0,1% TWEEN/2% обезжиренного молока, инкубировали с биотинилированным гибридным белком CD16A-Fc. Комплексы фаг-антиген «спасали» добавлением покрытых стрептавидином магнитных частиц, а неспецифичные антигенсвязывающие фаги удаляли с помощью десяти стадий промывки ФБР/0,1% TWEEN. На первой стадии связавшиеся элементы элюировали с применением глицин-HCl с pH 2,2. После нейтрализации смесью 2 M Tris/HCl с pH 8 добавляли свежевыращенные Е. coli XL1 Blue (средняя фаза логарифмического роста ОП600 0,2-0,5) для извлечения фагов, которые невозможно было удалить при помощи низкого уровня pH. Клетки, элюированные кислым раствором для элюирования, также смешивали с клетками-хозяевами XL1 blue, в стадии логарифмического роста.

Клетки, успешно трансформированные фагмидами, кодирующими scFv человека, отбирали по устойчивости к ампициллину и затем заражали хелперным фагом M13K07, в результате чего получали фаг, презентирующий scFv, для последующей селекции in vitro. В последующих раундах селекции операции с фагами, полученными путем кислого элюирования и инфицирования XL1 blue, проводили отдельно. После 3-го и 4-го раундов селекции по аффинности индивидуальные колонии тестировали твердофазным ИФА (ELISA), как описано в примере 2.

Ни один из исследованных клонов из библиотеки с перестановками κ, не показал значительных сигналов, которые были бы выше, чем у исходного клона 50NI, выращенного в качестве контроля в том же основном блоке. Тем не менее провели секвенирование нескольких клонов, и они оказались идентичными исходному клону, что указывает на то, что не было найдено ни одной подходящей κ-цепи, которая бы улучшала характеристики связывания.

Анализ клонов, полученных из библиотеки с перегруппировками λ, напротив, выявил многочисленные клоны, дающие сигналы до пяти раз большие, чем у контроля. После 3-го раунда биопэннинга для секвенирования выбрали 30 клонов, а после 4-го раунда - 34 клона. Секвенирование проводили с помощью Long Read Tower (Visible Genetics, Toronto, Канада) с использованием набора Deaza Kit (Visible Genetics, Toronto Канада), следуя инструкциям производителя. Кислое элюирование связавшихся фаговых частиц или прямое инфицирование клеток-хозяев не оказали заметного влияния на последующее распределении клонов. Было выявлено пять различных групп и несколько отдельных обогащенных клонов. В Таблице 2 представлены различные группы.

Таблица 2
Обозначения клонов, представляющих определенную группу в последующих примерах выделены жирным шрифтом
Группа Общая частота 3-ий раунд - проведено секвенирование 30 клонов 4-ый раунд - проведено секвенирование 34 клонов
A 19/64 3-LB1, 3-LB24, 3-LB36, 3-LB48, 3-LS1, 3-LS4, 3-LS19 4-LB28, 4-LB34, 4-LB27, 4-LB43, 4-LS6, 4-LS10, 4-LS22, 4-LS26, 4-LS68; 4-LS80, 4-LS88
B 9/64 3-LB3, 3-LB41, 3-LS23, 3-LS35, 3-LS87 4-LB46, 4-LS38, 4-LS12, 4-LS39
C 13/64 3-LB5, 3-LB10, 3-LB32, 3-LS17, 3-LS22, 3-LS79, 3-LS36, 3-LS89 4-LB4, 4-LB13, 4-LB41 4-LS25, 4-LB25
D 5/64 3-LS72 4-LS73, 4-LB32, 4-LB33, 4-LB33
Е 5/64 4-LS14, 4-LS37, 4-LS87, 4-LS72, 4-LS44
единичные 3-LB6, 3-LB23, 3-LS49; 3-LS34, 3-LS60, 3-LS28, 3-LS30, 3-LS55, 3-LS40 4-LS5, 4-LB14, 4-LS21, 4-LS46

Клоны, образующие группу A, представляют исходный клон 50NI, который также присутствует в «перетасованной» библиотеке вследствие присутствия повторно лигированного или не вырезанного исходного вектора либо благодаря перегруппировке при создании библиотеки. Эти данные коррелируют с тем фактом, что клоны из этой группы давали самый слабый сигнал в твердофазном ИФА.

Все другие группы содержат заново сгруппированные легкие цепи, демонстрирующие повышенные, по сравнению с исходным клоном, сигналы в твердофазном ИФА,. Клоны из группы C и D обнаружили после 3-го и 4-го раунда селекции в сопоставимых количествах.

Анализ последовательностей с применением программы для выравнивания V-base (http://vbase.mrc-cpe.cam.ac.uk) показал, что все новые Vλ цепи относятся к семейству VL3, также как и цепь VL из исходного клона.

Последовательности аминокислот общей цепи VH, имеющейся у всех клонов, представлены в данной заявке как SEQ ID №9, а специфические цепи VL для клонов 50NI, 3-LB3, 3-LB5, 3-LB6, 3-LS49, 4-LS14 и 4-LS21 представлены в данной заявке как SEQ ID №10-16 соответственно. Последовательность нуклеиновых кислот, кодирующая общую цепь VH, представлена в данной заявке как SEQ ID №1, а последовательности нуклеиновых кислот, кодирующие отдельные цепи VL для клонов 50NI, 3-LB3, 3-LB5, 3-LB6, 3-LS49, 4-LS14 и 4-LS21, представлены в данной заявке как SEQ ID №2-8 соответственно. Последовательности аминокислот отдельных гипервариабельных участков (CDR) даны в Таблице 1, при этом первый элемент в таблице представляет гипервариабельные участки общей тяжелой цепи, а затем идут гипервариабельные участки легкой цепи для 50NI, 3-LB3, 3-LB5, 3-LB6, 3-LS49, 4-LS14 и 4-LS21 (показаны как элементы 2-8 соответственно).

Пример 7: Анализ scFv со зрелой аффинностью методом сортировки с возбуждением флюоресценции (FACS) на клеточных линиях, трансфецированных CD16A и CD16B

Предварительный анализ неочищенных периплазматических экстрактов из всех индивидуальных клонов методом FACS показал, что все scFv с перегруппированными цепями сохраняли способность связываться CD16A. Для этого теста применяли клетки HEK-293, временно трансфецированные CD16A (данные не представлены). На основании данного теста, для дальнейшего анализа выбрали клоны 3-LB3, 3-LB5, 3-LB6, 3-LS49, 4-LS14 and 4-LS21.

Нуклеиновые кислоты, кодирующие эти scFv, субклонировали в вектор экспрессии pSKK2, в котором их клонировали с сохранением рамки считывания с N-концевой лидерной последовательностью PelB, и C-концевыми гексагистидиновой и с-myc метками. Эти субклоны имеют следующие последовательности нуклеотидов:

pSKK2-50NI (SEQ ID №36)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtatcctatgagctgatgcagccaccctcagtgtccgtgtcctcaggacagacagccagcatcccctgctctggagataaattggaggaaaaatatgtttcctggtatcaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKK2-3-LB3 (SEQ ID №37)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtatcctatgagctgacacagccactctcagagtcagtggcccagggacagacggccaggattacctgtgggggaaacaacattgaaagtagaaatgttcactggtaccagcagaagccaggccaggcccctgtgttggtcatctatagggataacaaccggccctctgggatccctgagcgattctctggctccaattcggggaacatggccaccctgaccatcagcagagcccaagccggggatgcagctgactattactgtcaggtgtgggacaactacactgtgctattcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKK2-3-LB5 (SEQ ID №38)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtatcctatgagctgacacagccaccctcagtggcagtggccccaggaaagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatctatagggatagcaaccggccctctgggatccctgagcgattctctggctccaactcggggaacacggccaccctgaccatcagcagagcccaagccggggatgaggctgacttttattgtcaggtgtgggacaactatattgtgctgttcggcggagggaccaagctgaccgtcctgggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKK2-3-LB6 (SEQ ID №39)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtacaggctgtgctgactcagccgccctcagtgtcagtggccccaggacagacggccaggattccctgtgagggaaacaacattggaagtaaaaatgtccactggtatcggcagaagccaggccaggtccctgtcctggtcatgtatgatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKX2-3-LS49 (SEQ ID №40)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtacagcctgtgctgactcagccactctcagtgtcagtggccccgggacagacggccaggattacctgtgggggaaacaacattggaagtaaaaatgtgcactggtaccagcagaagccaggccaggcccctgtactggtcatctatagggacagcagccggccctctgggatccctgagcgactctctggctccaactcgggggacacggccaccctgaccatcagcagagcccaggccggggatgaggctgactattactgtcaggtgtgggacgactacattgtggtcttcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgcccccccggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKK2-4-LS14 (SEQ ID №41)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtatcctatgagctgacacagccaccctcggtgtcagtgaccccaggacagacggccacgattacctgcggggcaaacgacattggaaaaagaaatgtccactggtaccaacagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

pSKK2-4-LS21 (SEQ ID №42)

atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcggaggtccagctggtacagtctggagcagaggtgaaaaagcccggggagtctctgaaggtttcctgcaaggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcaccatgacccgggacacgtccacgagcacagtctacatggagcttagcagcctgagatctgaggacacggccgtgtattactgtgctagaggtagtgcttattactacgattttgctgactactggggccagggaaccctggtcaccgtctcctcagggagtgcatccgccccaacccttaagcttgaagaaggtgaattttcagaagcacgcgtacagcctgtgctgactcagccatcctcggtgtcagtggccccaggacagacggccacgatctcctgtgggggacacaacattgggagtaaaaatgtgcactggtaccagcagaggccaggccagtcccctgtgttggtcatttatcaggataataagcggccctcagggatccctgagcgattctctggctccaactctgggaacacagccactctgaccatcagcgggacccaggcgatggatgaggctgactactattgtcaggtgtgggacaattacagtgtgctattcggcggagggaccaagctgaccgtcctaggtcagcccaaggctgccccctcggtcactctgttcccgccgtccgcggccgctggatccgaacaaaagctgatctcagaagaagacctaaactcacatcaccatcaccatcactaa

Последовательность нуклеотидов, кодирующая лидерную последовательность PelB, представляет собой atgaaatacctattgcctacggcagccgctggcttgctgctgctggcagctcagccggccatggcg (SEQ ID №43).

Последовательность нуклеотидов, кодирующая линкерную область между вариабельными доменами легких и тяжелых цепей каждого scFv, представляет собой gaagaaggtgaattttcagaagca (SEQ ID №44).

Последовательности нуклеотидов метки с-myc и гекса-гистидиновой метки представляют собой gaacaaaagctgatctcagaagaagaccta (SEQ ID №45) и catcaccatcaccatcac (SEQ ID №46), соответственно.

Векторы, включающие субклоны, применяли для трансформации E. coli RV308, экспрессировали в культурах, помещенных в 2-литровые колбы на качалке, и очищали путем аффинной хроматографии с иммобилизованным ионом металла (immobilized metal ion affinity chromatography, IMAC) согласно Le Gall et al. (2004, J. Immunol. Methods 285: 111-127).

Чтобы оценить, сохраняют ли scFv после перегруппировки цепей свою специфичность по отношению к CD16A, как указано для 50NI в Примере 3, трансфецированные линии клеток, экспрессирующие либо CD16A, либо CD16B тестировали с применением scFv, очищенного методом IMAC. Для анализа методом поточной цитометрии применяли следующие линии клеток: трансфецированные BW и трансфектантов BW/CD16A, как описано ранее. Клетки 293 и трансфектанты 293-CD16B выращивали, как описано ранее. 293-CD16A и 293-NKp46 получали путем временной трансфекции клеток 293 плазмидами, кодирующими внеклеточные домены CD16A или NKp46, соответственно, соединенные с трансмембранным и цитоплазматическим доменом ζ-цепи CD3 человека (pcDNA3-CD16A-zeta и pcDNA3-NKp46-zeta, полученные от Dr. О. Mandelboim, Университет Иерусалима, Израиль). Временную трансфекцию осуществляли кальций-фосфатным методом, как описано в Примере 1 и использовали клетки для поточно-цитометрического окрашивания и анализа через два дня после временной трансфекции. Поточно-цитометрическое окрашивание и анализ проводили в целом, как описано ранее. 1×106 указанных клеток окрашивали 50 мкг/мл очищенного scFv, затем 10 мкг/мл MAT 13/45/31-2 (к гексагистидиновой метке) и 15 мкг/мл конъюгированного с FITC козлиного антимышиного IgG.

Чтобы показать, что трансфецированные клетки экспрессируют соответствующие антигены на свою поверхность, клетки параллельно окрашивали 10 мкг/мл MAT A9 и моноклональным анти-NKp46 MAT 195314 (R&D Systems, Wiesbaden, Германия). MAT A9 и 195314 детектировали с применением 15 мкг/мл конъюгированного с FITC IgG козы к AT мыши. Средние интенсивности флюоресценции, полученные при анализе методом поточной цитометрии, скорректировали путем вычитания величины флюоресценции при окрашивании только вторичными реагентами. Результаты представлены на Фигуре 2.

MAT A9, применяемое в качестве положительного контроля, как и предполагалось, дает окрашивание при связывании со всеми линиями клеток, трансфецированными CD16, независимо от изоформы. Не наблюдали связывания с NKp46-трансфектантами, в то время как как окрашивание MAT 195314, направленным против NKp46, четко показывало, что клетки были успешно трансфецированы контрольной плазмидой, кодирующей NKp46.

Исходное анти-CD16 scFv 50NI человека, применяемое в качестве контроля, показало слабое окрашивание двух линий клеток, экспрессирующих CD16A на поверхность (клеток BW/CD16A и 293/CD16A). Свежевыделенное scFv с перегруппированными легкими цепями, напротив, демонстрировало улучшенное связывание с этими клетками. Ни один из новых вариантов не связывался с клетками 293, стабильно трансфецированными CD16B, демонстрируя специфичность по отношению к A изоформе CD16.

Пример 8: Тестирование фрагментов scFv со зрелой аффинностью на свежевыделенных ПЯК и обогащенных NK-клетках.

Чтобы оценить, сохраняют ли «улучшенные» scFv способность специфично связываться с CD16A, экспрессируемыми на поверхность лейкоцитов, свежевыделенные ПЯК и обогащенные NK-клетки из крови донора окрашивали, как описано ранее с применением scFv, очищенных методом IMAC. Обогащение NK-клеток проводили путем отрицательной селекции, как описано ранее. Средние интенсивности флюоресценции, полученные при анализе методом поточной цитометрии, представлены на Фигуре 5.

Окрашивание обогащенной популяции лейкоцитов анти-CD16 MAT A9 и анти-CD56 MAT B 159 четко демонстрирует, что популяция состоит из CD16+/CD56+ NK-клеток периферической крови. MAT A9 и scFv мыши, полученному из A9, окрашивали фракцию CD16A-положительных NK-клеток и демонстрировали сигнал такой же силы в случае CD16B-положительных гранулоцитов.

MAT A9 узнавало субпопуляцию (18,5%) МПК, соответствующую CD16-положительным NK-клеткам. наблюдали прочное связывание с обогащенными NK-клетками и выделенными гранулоцитами (данные не представлены).

Исходный клон 50NI показал слабое, но отчетливое связывание с обогащенными NK-клетками, в то время как окрашивания гранулоцитов не наблюдали. Варианты 3-LB3, 3-LB5, 3-LB6, 3-LS49, 4-LS14 и 4-LS21 со зрелой аффинностью демонстрировали характер окрашивания, схожий с таковым у 50NI, но с более сильными сигналами связывания. Эти данные дополнительно подтверждают тот факт, что scFv со зрелой аффинностью способны специфично различать две изоформы CD16 и специфично связываться с CD16A.

Пример 9: Твердофазный ИФА рекомбинантного CD16A-Fc и CD16B

Для получения дополнительных данных, касающихся специфичности scFv по отношению к CD16A, проводили твердофазный ИФА с применением гибридного белка CD16A-Fc (Пример 1) и коммерчески доступного рекомбинантного CD16B-Fc (аллель NA-2; свободный от БСА; RD Systems). В качестве отрицательного контроля применяли гибридный белок gp34-Fc. Рекомбинантные белки адсорбировали в течение ночи в концентрации 80 нМ в 100 мМ NaHCO3 при pH 8,8.

Детекцию scFv, связавшихся с рекомбинантными белками, проводили с применением антитела к с-myc, конъюгированному с ПХ (10 мкг/мл). Положительный контроль включал MAT A9 (1 мкг/мл), а затем антителами козы к IgG мыши, конъюгированными с ПХ (0,5 мкг/мл). Связывание с рекомбинантным CD16B исследовали путем прямого окрашивания антителами к His-ПХ (1 мкг/мл), а связывание с гибридными Fc белками тестировали с помощью антител к IgG человека, конъюгированных с ПХ (0,15 мкг/мл).

Все scFv демонстрировали прочное связывание с CD16A-Fc, тогда как связывания с CD16B не наблюдали (Фигура 3). Было отмечено слегка повышенное фоновое связывание для gp34-Fc. Это, возможно, было обусловлено незначительным неспецифическим связыванием с gp34-Fc, так как все вторичные антитела, протестированные в отдельности, также обнаруживали слегка повышенные фоновые сигналы для этого белка.

Как и ожидали, А9 строго узнавали CD16A-Fc. Однако нужно учитывать, что вторичное антитело козы к AT мыши, конъюгированное с ПХ, демонстрирует значительную перекрестную реактивность по отношению к рекомбинантному белку Fc человека (см. контроль с антителом козы к антитела мыши-ПХ отдельно). Воспроизведение данного анализа с применением предварительно адсорбированных Антител козы к IgG мыши, конъюгированных с ПХ с минимальной перекрестной реактивностью по отношению к IgG человека (данные не представлены) не выявило значительного уменьшения фонового связывания.

MAT A9 показало отчетливый сигнал на CD16B, на который не оказывали влияние вторичные реагенты.

Пример 10: Анализ рекомбинантного CD16A-Fc методом Вестерн-блот в восстанавливающих и невосстанавливающих условиях

Для дальнейшего исследования все анти-CD16A scFv тестировали на связывание методом Вестерн-блот с рекомбинантным CD16A-Fc и NKp46-Fc.

CD16A-Fc и NKp46-Fc, которые использовали в качестве отрицательного контроля, разделяли с применением 12% ДСН-геля в восстанавливающих условиях и 8% геля в невосстанавливающих условиях. Белки переносили на нитроцеллюлозную мембрану путем электроблоттинга. После окрашивания Ponceau S, мембрану разрезали на полосы шириной 5 мм. Каждую нитроцеллюлозную полоску отдельно инкубировали с scFv (4 мкг/мл) в ФБР, 0,1% Tween, 2% обезжиренном молоке. Детекцию осуществляли с помощью антитела к пента-His, конъюгированного с ПХ (1 мкг/мл), с применением диаминобензидина (ДАБ) в качестве субстрата для пероксидазы. Контрольные полосы инкубировали с A9 (1 мкг/мл) или антителом к NKp46 195314, а затем с антителом козы к IgG мыши, конъюгированным с ПХ (0,2 мкг/мл, минимальная перекрестная реактивность). В качестве дополнительного положительного контроля применяли IgG козы к AT человека, (0,16 мкг/мл) для детекции Fc-фрагмента гибридных белков.

Моноклональные антитела A9 и 195314 узнавали антиген при восстанавливающих, а также при невосстанавливающих условиях. Антитело козы к AT мыши, конъюгированное с ПХ, применяемое в качестве вторичного реагента для MAT A9, обнаруживало незначительную перекрестную реактивность с Fc-фрагментом гибридного белка CD16A-Fc. Связывание scFv с CD16, напротив, наблюдали только в невосстанавливющих условиях, что свидетельствует о том, что для распознавания необходима вторичная структура, стабилизированная дисульфидными мостиками. Исходный клон 50NI демонстрирует более слабый сигнал, чем scFv со зрелой аффинностью. Не было выявлено связывания scFv 3-LB6, и ни один из scFv не обнаруживал перекрестной реактивности с контрольным белком NKp46-Fc, что подтверждает его специфичность по отношению к CD16.

Пример 11: Анализ scFv методом гель-проникающей хроматографии на колонке Superdex 200

Чтобы определить, обусловлена ли более высокая аффинность вариантов scFv улучшением одновалентного связывания, исследовали олигомерный состав препаратов белков на колонке для гель-фильтрации Superdex 200. В качестве стандарта испольщовали калибровочный набор для гель-фильтрации LMW Gel Filtration Calibration Kit (Amersham Pharmacia Biosciences, Freiburg, Германия). Таблица 3 дает краткую характеристику молекулярных форм, присутствующих в отдельных препаратах белков.

Таблица 3
Молекулярные формы scFv, присутствующие в отдельных препаратах белков. 3-LB5 не анализировали вследствие низкой концентрации белка
scFv Мономер Димер
3-LS49 67,2% 32,8%
3-LB3 87,8% 12,2%
3-LB6 100% -
4-LS14 57,6% 42,4%
4-LS21 100% -

Гель-проникающая хроматография четко показала, что scFv 3-LB6 и 4-LS21 являются исключительно мономерными.

3-LS49, 3-LB3 и 4-LS14, напротив, показали значительную долю димерных молекул, что указывает на то, что улучшенные связывающие свойства этих молекул могут быть обусловлены не только более высокой аффинностью, как в случае 3-LB6 и 4-LS21, но могут также отражать эффект авидности вследствие формирования димеров.

Пример 12: Определение аффинности scFv путем поверхностного плазменного резонанса (ППР)

Константы аффинности (значения KD) scFv определяли методом ППР с применением биосенсорной системы BIAcore 2000 (Amersham-Pharmacia). Гибридный белок CD16A-Fc и БСА, применяемый в качестве отрицательного контроля, иммобилизовали на сенсорном чипе СМ5, покрытом карбоксиметилдекстраном с применением стандартного реагента NHS/EDC для образования аминной связи (BIAcore). Очищенные scFv разбавляли в буфере HBS-EP (BIAcore, Uppsala, Швеция). Данные по связыванию получали путем пропускания различных концентраций антител scFv (100 нМ, 200 нМ, 400 нМ, 800 нМ и 1600 нМ) через иммобилизованный антиген. Положительным контролем служило анти-CD16 MAT A9. Все измерения ППР проводили при постоянной скорости потока 20 мкл/мин в буфере HBS-EP при 25°C. Каждый введенный образец (100 мкл) находился в контакте с антигеном в течение 5 минут. Диссоциация продолжалась 30 минут. После каждого цикла поверхность сенсорного чипа промывали буфером HBS-EP. Сигналы от контрольного канала, покрытого БСА, вычитались автоматически. Константы кинетики вычисляли согласно модели связывания Ленгмюра 1/1 с применением программы BIAevaluation версии 3.0 (BIAcore). Рассчитанные «off» и «on» константы скорости и соответствующие величины KD суммированы в таблице 3.

Согласно расчетам KD для MAT A9, применяемого в качестве контроля, составила 1,75×10-9 М, что согласуется со значением 1,55×10-9 М, описанным в литературе (Renner et al., 2001 Cancer Immunol. Immunother. 50: 102-108). Кроме того, исходя из результатов стационарного процесса для scFv 50NI, 4-LS21 и 3-LB6 методом ППР, получили были выведены равновесные константы диссоциации.

Таблица 4
Данные по кинетике связывания для отдельных scFv
scFv kon (M-1s-1) koff (s-1) KD=koff/kon (М) Keq (M)
50NI (1,76±1,37)×104 (2,17±0,55)×10-2 1,23×10-6 2,56×10-6
4-LS21 (5,60±1,88)×104 (6,30±0,48)×10-3 1,13×10-7 2,03×10-7
3-LB6 (5,48±0,48)×104 (6,52±0,44)×10-3 1,19×10-7 1,06×10-7
3-LS49 (2,93±1,05)×104 (4,01±0,93)×10-3 1,37×10-7 н.о.
3-LB3 (2,16±0,44)×104 (2,97±0,48)×10-3 1,38×10-7 н.о.
4-LS14 (5,09±0,99)×104 (5,57±1,31)×10-3 1,09×10-7 н.о.
3-LB5 (7,33±0,44)×104 (2,97±0,48)×10-3 4,05×10-8 н.о.
МАТ А9 (1,01±0,46)×105 (1,77±0,84)×10-4 1,75×10-9 н.о.

Константы кинетики, рассчитанные независимо этими двумя методами, хорошо согласуются, и прямое сравнение с исходным клоном 50NI выявило более чем двадцатикратное увеличение аффинности в результате перегруппировки легких цепей. Все три scFv образуют популяции исключительно мономерных белков (ср. Таблица 3, Пример 11), что указывает на то, что улучшение свойств связывания обусловлено более высокой аффинностью, основанной на оптимизации взаимодействия антиген-scFv, а не на эффекте авидности.

scFv 3-LS49, 3-LB-3 и 3-LS14 обнаруживают сравнимые значения Ко, но демонстрируют негомогенную популяцию молекул, включающую значительный процент димерных молекул (ср. таблица 2, пример 13). Таким образом, улучшенная аффинность данных антител может быть по меньшей мере частично обусловлена мультивалентным связыванием.

Пример 13: Индукция потока Са2+ в NK-клетках путем связывания обладающего зрелой аффинностью анти-CD16 scFv

Чтобы оценить, сохраняет ли scFv со зрелой аффинностью способность вызывать мобилизацию Са2+ в NK-клетках периферической крови, как показано для исходного анти-CD16scFv 50NI, выделяли NK-клетки из периферической крови, обогащали их, и использовали для измерения потока Са2+ путем поточной цитометрии, как описано выше в Примере 5.

Результаты четко показывают, что добавление Анти-(His)6 MAT, а затем поликлональных антител козы к IgG мыши (КПМ) в отдельности не вызывало значительных изменений концентрации внутриклеточного кальция в свежеизолированных NK-клетках. Однако четкое увеличение сигнала флюоресценции наблюдалось при добавлении scFv 50NI и их перекрестном связывании Анти-(His)6 MAT, а затем КПМ, как уже было показано в Примере 5.

При добавлении обладающего зрелой аффинностью анти-CD16 scFv (3-LS49 или 4-LS21, используемых в качестве иллюстрирующих примеров) увеличение индуцированного сигнала после перекрестного связывания с анти-(His)6 антителом а затем КПМ было по меньшей мере таким же сильным, как сигнал, запускаемый 50NI. Таким образом, можно сделать вывод, что все scFv, полученные из scFv 50NI человека путем перегруппировки цепей, сохраняют способность активировать NK-клетки и запускать мобилизацию внутриклеточного кальция путем связывания с CD16A.

Пример 14; Запуск цитолитической активности в свежеизолированных NK-клетках

CD16A вовлечен в антитело-зависимую клеточную цитотоксичность (АЗКЦ), опосредуемую NK-клетками. In vitro было показано, что активирующие моноклональные антитела изотипа IgG, специфичные к CD16, могут инициировать гибель FcR-положительных линий клеток-мишеней. Чтобы определить, способны ли обладающие зрелой аффинностью анти-С016А scFv, запускающие мобилизацию кальция в NK-клетках, также опосредовать цитотоксичность NK, указанные scFv анализаировали методом перенаправленного цитолиза (redirected killing assay) со свежевыделенными NK-клетками против FcR-положительных клеток мыши Р815. Поскольку scFv лишены Fc-фрагмента IgG, их применяли совместно с моноклональным анти-(His)6 антителом мыши. Перенаправленный лизис клеток измеряли путем анализа высвобождения кальцеина.

NK-клетки выделяли из МПК здорового донора и обогащали, как описано выше. Анализ методом поточной цитометрии показал, что популяция NK-клеток состоит из 81% CD16-положительных и 94% CD56-положительных клеток; CD3-позитивные или CD19-позитивные не были детектированы в значительных количествах (данные не представлены). Линию клеток мыши Р815 (любезно предоставленная Dr. G. Moldenhauer, DKFZ, Heidelberg, Германия) культивировали в среде RPMI 1640 с добавлением 10% инактивированной нагреванием фетальной телячьей сыворотки (ФТС), 2 мМ L-глутамина, 100 ед./мл пенициллина G натрия, 100 мкг/мл стрептомицин сульфата и 50 мкМ β-меркаптоэтанола. Для проведения анализа клетки-мишени Р815 метили 10 мкМ CalceinAM (Molecular Probes) в среде RPMI 1640 без ФТС в течение 30 минут при 37°C. После двукратной промывки средой RPMI 1640 меченые клетки Р815 ресуспендировали в среде RPMI 1640 с 10% инактивированной нагреванием ФТС, 2 мМ L-глутамина, 100 ед./мл пенициллина G натрия, 100 мкг/мл стрептомицина сульфата до плотности 1×106/мл. Из этой суспензии в отдельные лунки 96-луночного круглодонного микротитрационного планшета высевали 50 мкл, что соответствует 1×104 клеток. 1×105 свежеизолированых NK-клеток в 50 мкл добавляли в лунки, в результате чего получали соотвношение эффектор-мишень 10:1. Анти-CD16 антитела и контрольные антитела добавляли в лунки до конечной концентрации 1 мкг/мл, и если это указано, добавляли 1 мкг/мл анти-(His)6 MAT мыши 13/45/31-2. Моноклональные антитела OKT3 (анти-CD3 MAT), анти-(His)6 А9 и 13/45/31-2 были любезно предоставлены Dr. G. Moldenhauer, DKFZ, Heidelberg, Германия. Антитело B159 к CD56 было приобрели в BD Biosciences/Pharmingen (Heidelberg, Германия), а 195314 к NKp46 - в R&D Systems (Wiesbaden, Германия). Планшеты инкубировали в течение 3 часов при 37°C в увлажненной атмосфере с 5% СО2. В некоторые лунки добавляли 1% Triton X 100 (Roth, Karlsruhe, Германия) для максимального лизиса клеток-мишеней. Спонтанное высвобождение кальцеина определяли при инкубировании клеток-мишеней без эффекторных клеток и без антител. После инкубации микротитрационные планшеты центрифугировали при 500 g в течение 5 минут, и брали 100 мкл супернатанта для измерения флюоресценции (F) высвободившегося кальцеина при помощи универсального считывающего устройства при 520 нм (Victor3, Perkin Elmer, Rodgau, Германия). Процент лизиса рассчитывали по формуле: [F(пробы)-F(споитан.)]/[F(максимальн.)-F(спонтан.)]×100%, определяли средние значения и среднеквадратичные отклонения для проб в трех посторах, и строили диаграмму на Фигуре 4.

Как и предсказывали, анти-CD3 OKT3, анти-CD56 В159 и анти-(His)6 MAT, используемые в качестве контрольных антител,, вызывали только фоновый лизис, как и пробы без антител. Это показывает, что связывания антитела с неактивирующим рецептором, таким как CD56, не достаточно для индукции цитотоксичности NK-клеток. Кроме того, контрольные антитела исключают цитотоксические эффекты IgG, которые связываются с рецепторами Fc на клетках-мишенях Р815, но не с эффекторными молекулами на поверхности NK-клеток. В противоположность этому, MAT 195314 (к NKp46) и А9 (к CD16), которые оба имеют в качестве мишеней активирующие рецепторы NK, индуцировали активный лизис мишеней Р815 в пределах 35% и 65% соответственно. Лизис клеток-мишеней в присутствии scFv к CD16 составлял от 1,8% до 11,5%, что свидетельствует о том, что scFv в отдельности не могут активировать NK-клетки. Однако добавление анти-(His)6 MAT, которое облегчает перекрестное связывание и связывание с FcR-положительными клетками-мишенями Р815, индуцировало активный лизис во всех пробах. В случае scFv 4-LS21co зрелой аффинностью, почти 60% клеток-мишеней подвергались лизису. Для сравнения исходный анти-CD16 scFv 50NI в комбинации с анти-(His)6 MAT индуцировал лишь незначительное усиление перенаправленного цитолиза мишеней Р815 NK-клетками.

Результаты анализа перенаправленной цитотоксичности для обладающих зрелой аффинностью анти-CD16 scFv четко показывают, что анти-CD16A scFv не только вызывает мобилизацию кальция в NK-клетках, но также инициирует цитотоксичность NK.

Пример 15: Получение последовательностей нуклеотидов, кодирующих вариант CD16A-Fc48R/158F человека и три различных аллельных варианта CD16B-Fc

FcγRIII человека существует в виде двух изоформ, FcγRIIIA (трансмембранный белок) и FcγRIIIB (ГФИ-заякоренный), имеющих 96%-ую идентичность по последовательности во внеклеточных иммуноглобулин-связывающих областях (van de Winkel & Capel, 1993). Для этих двух изоформ описаны различные аллельные варианты (Koene et al., 1997 Blood 90: 1109-1114; Koene et al., 1998 Blood 91: 673-679). На Фигуре 6 показано выравнивание последовательностей аминокислот аллельных вариантов изоформ A и B.

Растворимый гибридный белок CD16A-Fc, синтезируемый в клетках HEK-293 после временной трансфекции плазмидой pCDM-CD16-Fc и описанный в Примере 1, представляет собой CD16A-Fc48R/158V человека (Mandelboim et al., 1999, см. выше). У людей наблюдается двуаллельный полиморфизм в положении 158 этой изоформы (FcγRIII-A 158Val/Phe), который влияет на аффинность рецептор FeγRIII-A к IgG на поверхности натуральных клеток-киллеров. Для FcγRIII-A 158 Val (валин в положении 158) показано более высокое сродство к IgG, по сравнению с аллельной формой 158 Phe (Koene et al., 1997 см. выше).

Чтобы продемонстрировать свзывание scFv 4-LS21 с вариантом, содержащим Phe, проводили сайт-направленный мутагенез pCDM-CD16A-Fc48R/158V, в результате которого получали pCDM-CD16A-Fc48R/158F. 10 нг плазмиды pCDM-CD16A-Fc48R/158V инкубировали с 125 нг праймеров Р41, 5' CTGCAGGGGGCTTTTTGGGAGTAAAAATGTG 3' (SEQ ID №47) и P42, 5' CACATTTTTACTCCCAAAAAGCCCCCTGCAG 3' (SEQ ID №48), 25 мМ каждого из dNTP и 2,5 единицы ДНК-полимеразы PfuUltra HF DNA (Stratagene). Реакцию проводили по следующей схеме 30 сек при 95°C, затем 16 циклов: 30 сек при 95°C, 60 сек при 66°C и 318 сек в 68°C. Продукт разрезали ферментом рестрикции DpnI в течение 3 часов и в заключение реакцию останавливали инкубированием при 80°C в течение 20 минут. Химически компетентные клетки TOP10/P3 (Invitrogen) трансформировали 2 мкл реакционной смеси и наносили 150 мкл на чашки с с гемолизированной кровью (LB), содержащие 10 мкг/мл тетрациклина и 25 мкг/мл ампициллина. Последовательность нуклеотидов, кодирующую pCDM-CD16A-Fc48R/158F, проверяли путем секвенирования. CD16A-Fc48R/158F экспрессировали и очищали, как описано в Примере 1.

Рецептор FcγRIIIB экспрессируется у людей в виде трех различных аллельных вариантов, обозначаемых NA1, NA2 и SH, соответственно (Koene et al., 1997 supra, Koene et al., 1998, см. выше). Geneart (Regensburg, Германия) синтезировали три синтетических гена, кодирующих внеклеточный домен аллельных форм CD16B человека Последовательности нуклеиновых кислот клонировали в виде фрагмента HindIII/BamHI в плазмиду pSEC, содержащую последовательность нуклеотидов Fc-фрагмента рецептора. CD16B CD16B-FcNA1, CD16B-FcNA2 и CD16B-FcSH экспрессировали и очищали, как описано в Примере 1.

Пример 16: Анализ различных аллельных вариантов CD16 человека методом Вестерн-блот

Чтобы продемонстрировать специфичность scFv 4-LS21 к изоформе CD16A, проводили Вестерн-блоттинг различных аллельных вариантов CD16A и CD16B. 750 нг каждого из CD16A-Fc48R/158V, CD16A-Fc48R/158F, CD16B-FcSH, CD16B-FcNA1, CD16B-FcNA2 и NKp46-Fc (отрицательный контроль) наносили на 8% ДСН-гель в невосстанавливающих условиях и переносили на мембрану.

Анти-CD16 scFv A9, анти-CD16A и анти-NKp46 scFv (отрицательный контроль), инкубировали в концентрации 4 мкг/мл с блотом. Детекцию связавшихся с рекомбинантными белками scFv осуществляли при помощи анти-His антител, конъюгированных с ПХ (1 мкг/мл). В качестве контроля применяли конъюгированные с ПХ античеловеческие IgG и конъюгированные с ПХ анти-His антитела (1 мкг/мл).

scFv 4-LS21 показал прочное связывание только с аллельными формами CD16A: связывания с аллелями CD16B не наблюдалось. Это четко демонстрирует специфичность 4-LS21 scFv человека к изоформе A CD16 и показывает, что 4-LS21 узнает оба аллельных варианта CD16A. В противоположность этому анти-CD16 scFv A9 мыши демонстрировал одинаковое связывание со всеми аллельными вариантам как CD16A, так и CD16B.

Пример 17: Твердофазный ИФА различных аллельных вариантов CD16 человека

Чтобы дополнительно продемонстрировать специфичность scFv 4-LS21 изоформе CD16A провели твердофазный ИФА с применением различных аллельных вариантов. Лунки планшета MaxisorpTM покрывали 100 мМ NaHCO3, содержащим 200 нг CD16A-Fc48R/158V, CD16A-Fc48R/158F, CD16B-FcSH, CD16B-FcNA1, CD16B-FcNA2 или NKp46-Fc (отрицательный контроль) соответственно.

Анти-CD16A scFv 4-LS21 и анти-NKp46 scFv инкубировали в планшете в концентрации 4 мкг/мл. Детекцию scFv, связавшихся с рекомбинантными белками, осуществляли с помощью анти-His антител, конъюгированных с ПХ (1 мкг/мл). scFv 4-LS21 демонстрировал прочное связывание с обеими аллельными формами CD16A, при этом связывания с аллелями CD16B не наблюдалось (Фигура 7A), что, таким образом, демонстрирует четкую специфичность 4-LS21 scFv к изоформе CD16A.

В параллельном анализе (Фигура 7В) исследовали анти-CD16 MAT A9 (1 мкг/мл) на планшете с аналогичным покрытием. После инкубации с MAT A9 (1 мкг/мл) проводили инкубацию с антителами козы к IgG мыши, конъюгированными с ПХ, в концентрации 0,5 мкг/мл (минимальная перекрестная реактивность с Fc человека). MAT A9 прочно связывалось со всеми аллельными вариантами (как CD16A, так и CD16B).

Пример 18: Сравнение аффинности scFv 4-LS21 и моноклонального AT A9 к различным аллельным формам CD16 человека методом поверхностного плазменного резонанса (ППР)

Константы аффинности (значения KD) scFv 4-LS21 и MAT A9 для аллельных вариантов CD16A-Fc48R/158V, CD16A-Fc48R/158F, CD16B-FcSH, CD16B-FcNA1, CD16B-FcNA2 определяли методом ППР с применением биосенсорной системы BIAcore 2000 (Amersham-Pharmacia) следуя протоколу, описанному в Примере 12. Расчетные константы скоростей «off» и «on» и соответствующие величины KD суммированы ниже в Таблице 5.

Как и ожидали в случае MAT A9 (используемого в качестве контроля), для всех аллельных вариантов была определена KD в диапазоне 4-6×10-9 М, что свидетельствует о промискуитентном связывании MAT A9 со всеми аллелями всех форм. В противоположность этому, scFv 4-LS21 опять оказался высоко специфичным по отношению к изоформе CD16A. 4-LS21 scFv имел KD в диапазоне 6×10-8 M для CD16A-Fc48R/158V и в диапазоне 4×10-8 M для CD16A-Fc48R/158F, что указывает на то, что 4-LS21 scFv связывается в обеими аллельными формами CD16A с приблизительно одинаковой аффинностью. 4-LS21, напротив, не обнаруживал связывания ни с одной из аллельных форм CD16B.

Таблица 5
Данные по кинетике связывания scFv 4-LS21 и MAb A9 с аллельными вариантами CD16A и CD16B
scFv/MAT Изоформа и аллельный вариант kon (M-1s-1) koff (s-1) KD (M)(koff/kon)
4-LS21 CD16A 5,54±1,97×104 3,42±0,14×10-3 6,17×10-8
МАТ А9 Fc48R/158V 7,86±2,16×104 4,06±1,0×10-4 5,17×10-9
4-LS21 CD16A 7,13±2,47×104 3,23±0,09×10-3 4,53×10-8
МАТ А9 4-LS21 Fc48R/158F 9,94±3,46×104 3,80±1,0×10-4 3,82×10-9
МАТ А9 4-LS21 CD16B FcSH 7,79±1,90×104 нет связывания 5,28±4,93×10-4 1,14×10-8
МАТА9 CD16B FcNA1 7,72±4,86×104 нет связывания 4,87±4,72×10-4 8,91×10-9
4-LS21 МАТА9 CD16B FcNA2 7,57±2,90×104 нет связывания 4,78±4,23×10-4 9,63×10-9

Пример 19: Конструирование плазмиды pSKK3 CD30×CD16LS21 TandAb/(G2S)3 для экспрессии молекулы TandAb в бактериях

Гены, кодирующие вариабельные домены VH and VL анти-CD30 и анти-CD16A антител, получали из гибридомы HRS-3 или библиотеки scFv человека, соответственно, с применением плазмид pHOG_scFv(G2S)3 αCD30 (HRS-3) и pSKK2_scFv αCD16A (LS21).

VH αCD16LS21 амплифицировали путем полимеразной цепной реакции с праймерами Р34, 5' CATCACGATATCAGAACCACCGGAGCCGCCGCTACCACCTGAGGACACGGTGACCAGGGTTCCC 3' (SEQ ID №49) и Р36, 5' CCGGCCATGGCGCAGGTCCAGCTGGTACAGTCTGG 3' (SEQ ID №50) для введения последовательности нуклеиновых кислот, кодирующей линкер из 9 аминокислот (GlyGlySer)3 (SEQ ID №51) в 3' конец продукта ПЦР. Образующийся продукт ПЦР разрезали ферментами рестрикции Nco I/Eco RV и клонировали в Nco I/Eco RV pHOG_scFv(G2S)3αCD30 (HRS-3) с получением гибридной плазмиды pHOG_VHαCD16LS21(G2S)3VLαCD30(G2S)3VHαCD30.

VL антитела 4-LS21 к CD16A амплифицировали путем полимеразной цепной реакции с праймерами Р35, 5' GGTCACCGTCTCCTCAGGTGGTAGCGGCGGCTCCGGTGGTTCTTCCTATGTGCTGACTCAGCCATCCTC 3' (SEQ ID №52), and P37, 5' CCTCTAGATTAGTGATGGTGATGGTGATGGGATCCTAGGACGGTCAGCTTGGTCCC 3' (SEQ ID №53) для введения последовательности нуклеиновых кислот, кодирующей линкер из 9 аминокислот (GlyGlySer)3 (SEQ ID №52) в 5' конца продукта ПЦР. Образующийся продукт ПЦР разрезали ферментами рестрикции Bsm BI/Xba I и клонировали в линеаризованную рестрицированную растриктазами Bsm BI/Xba I гибридную плазмиду pHOC_VHαCDLS21(G2S)3VLαCD30(G2S)3VHαCD30, в результате чего получали плазмиду pHOG CD30×CD16LS21 TandAb/(G2S)3. Эту плазмиду разрезали при помощи NcoI/XbaI и лигировали в линеаризованную NcoI/XbaI плазмиду pSKK3.

Пример 20: Конструирование плазмид pSKK3 CD19×CD16LS21 Tandab/(G2S)3 для экспрессии молекул TandAb в бактериях

Гены, кодирующие вариабельные домены VH и VL анти-CD19 антитела, получали из гибридомы HD37 с применением плазмиды pSKK3_scFv(G2S)3 αCD19 (HD37).

Плазмиду pSKK3_scFv(G2S)3 αCD19 (HD37) разрезали Nco I/Bsm BI и очищали вставку на агарозном геле. Очищенный фрагмент затем разрезали ферментом рестрикции Eco RV. Фрагмент, рестрицированный Eco RV/Bsm BI, клонировали в линеаризованную Eco RV/Bsm BI плазмиду pHOG CD30×CD16LS21 TandAb/(G2S)3, в результате чего получали плазмиду pHOG CD19×CD16LS21 TandAb/(G2S)3. Плазмиду pHOG CD19×CD16LS21 TandAb/(G2S)3 разрезали NcoI/XbaI и лигировали в линеаризованную NcoI/XbaI плазмиду pSKK3. В результате получали плазмиду pSKK3 CD19×CD16ALS21 TandAb/(G2S)3, кодирующую TandAb к CD19 × к CD16A.

Пример 21: Экспрессия и очистка молекул CD30×CD16LS21 TandAb/(G2S)3 и CD19×CD16LS21 TandAb/(G2S)3 в бактериях

Образцы штамма RV308 Е. coli K12 (Maurer et al., 1980, J. Mol. Biol. 139: 147-161), трансформированные плазмидами экспрессии pSKK3 CD30×CD16LS21 TandAb/(G2S)3 и pSKK3 CD19×CD16LS21 TandAb/(G2S)3, выращивали в течение ночи в среде 2×YT с 50 мкг/мл ампициллина и 100 мМ глюкозы (2×YTGA) при 28°C. Разведения (1:50) ночных культур в 2×YTGA выращивали в колбах при 28°C с перемешиванием при 200 об./мин. Когда культуры достигали ОП600 равной 0,8, бактерии осаждали путем центрифугирования при 9500 g в течение 15 минут при 20°C и ресуспендировали в таком же объеме свежей среды YTBS (2×YT, содержащая 1 M сорбитола и 2,5 мМ глицина бетаина; Blacwell & Horgan, 1991, FEBS Letters 295: 10-12) с добавлением 50 мкг/мл ампициллина. доводили до конечной концентрации 0,2 мМ средой IPTG, и продолжали выращивание при 21°C в течение 18-20 ч. Клетки собирали путем центрифугирования при 14000 g в течение 20 мин при 4°C. Для выделения растворимых белков периплазмы осажденные бактерии ресуспендировали в 5% исходного объема ледяного 200 мМ Tris HCl, содержащего 20% сахарозы, 1 мМ ЭДТА, с pH 8,0. После инкубации в течение 1 часа на льду с периодическим помешиванием сферопласты центрифугировали при 14000 g в течение 60 минут при 4°C, в результате которого растворимый периплазматический экстрат оставался в супернатанте, а сферопласты вместе с нерастворимыми периплазматическим веществом - в осадке. Фракции периплазмы диализировали против стартового буфера (50 мМ Tris HCl, 1 M NaCl, 50 мМ имидазола, pH 7,0) при 4°C. Диализированный раствор, содержащий рекомбинантный продукт, центрифугировали при 14000 g в течение 30 минут при 4°C. Аффинную хроматографию с иммобилизованным ионом металла (IMAC) проводили при 4°C с применением 1 мл колонки с хелатирующей сефарозой (Chelating Sepharose Fast Flow) (GE Healthcare Biosciences, Freiburg, Германия), нагруженной Cu2+, и уравновешивали 50 мМ Tris-HCl, 1 M NaCl, pH 7,0 (стартовый буфер). Пробы загружали пропусканием пробы через колонку. Затем ее промывали двадцатью стартовым буфером в объеме, равном двадцати объемам колонки, а затем стартовым буфером с добавлением 50 мМ имидазола до достижения минимального значения оптической плотности (280 нм) стока (около тридцати объемов колонки). Адсорбированное вещество элюировали смесью 50 мМ Tris HCl, 1 M NaCl, 300 мМ имидазола с pH 7,0. Элюированные фракции, содержащие молекулы TandAb, идентифицировали методом Вестерн-блот с применением антитела Penta HisTM, свободного от БСА (Qiagen, Hilden, Germany), а затем к атителами козы к IgG мыши, меченными пероксидазой хрена (Dianova, Hamburg, Germany).

Положительные фракции собирали и подвергали буферному обмену со смесью 50 мМ имидазола, 50 мМ NaCl (pH 6,0) или 50 мМ MES, 50 мМ NaCl (pH 5,5)с применением расфасованного PD-10 (GE Healthcare Biosciences, Freiburg, Германия) (CD30×CD16LS21 TandAb/(G2S)3 и CD19×CD16LS21 TandAb/(G2S)3, соответственно). Мутный раствор белка делали прозрачным путем центрифугирования. Конечную очистку выполняли путем ионообменной хроматографии на колонке MonoS HR5/5 (GE Healthcare Biosciences, Freiburg, Германия) в смеси 50 мМ имидазола, 50 мМ NaCl (pH 6,0) или 50 мМ MES, 50 мМ NaCl (pH 5,5) (CD30×CD16LS21 TandAb/(G2S)3 и CD19×CD16LS21 TandAb/(G2S)3, соответственно), с линейным градиентом 0-1 M NaCl. Элюированные фракции, содержащие молекулы TandAb, идентифицировали восстанавливающим 15% ДСН-ПААГ с последующим окрашиванием кумасси. Собирали положительные фракции и заменяли буфер на ФБР, содержащий 50 мМ имидазола и 10 мМ трегалозы (pH 6,0 или 7,0) (CD30×CD16LS21 TandAb/(G2S)3 и CD19×CD16LS21 TandAb/(G2S)3, соответственно) с применением расфасованного PD-10 (GE Healthcare Biosciences, Freiburg, Германия).

Пример 22: Исследование молекул CD30×CD16LS21 Tandab/(G2S)3 и CD19×CD16LS21 TandAb/(G2S)3 методом поточной цитометрии

Для измерения связывания с CD16A, клетки HEK-293 временно трансфецировали с применением кальциево-фосфатного метода плазмидой pcDNA3-CD16A-zeta (Dr. О. Mandelboim, University of Jerusalem, Израиль) и собирали через 40 часов после трансфекции для поточной цитометрии, как описано в Примере 7. Для определения связывания с CD19 применяли линию волосковых клеток лейкемии JOK-1 (Schwartz-Albiez R, Dorken В, Monner DA, Moldenhauer G, (1991) Int Immunol 3:623, любезно предоставлена Dr. G. Moldenhauer, DKFZ, Heidelberg). Для исследования реактивности CD30 проводили окрашивание линии клеток Ходжкина человека L540CY (любезно предоставленных Dr. V. Diehl, University of Cologne, Германия; Карр U, Wolf J, von Kalle C, Tawadros S, Rottgen A, Engert A, Fonatsch C, Stein H, Diehl V. (1992) Ann Oncol. Sep; 3 Suppl 4: 21-3). Окрашивание клеток и анализ проводили, в целом, как описано ранее. Все рекомбинантные антитела детектировали 10 мкг/мл анти гекса-His MAT 13/45/31-2 (Dianova, Hamburg, Германия), а затем 15 мкг/мл конъюгированными с FITC антителами козы к IgG мыши (Dianova).

Анализ методом поточной цитометрии продемонстрировал прочное связывание как CD30×CD16LS21 TandAb, так и антитела CD19×CD16LS21 TandAb с клетками, экспрессирующими соответствующий антиген. Оба антитела TandAb связывались с клетками, экспрессирующими CD16A, с приблизительно одинаковой аффинностью.

Пример 23: Измерение аффинности

Определение значений KD scFv 4-LS21 для аллельных вариантов 48R/158V и 48R/158F антигена CD16A показало сравнимые значения KD, равные около 5×10-8 М, согласно измерению методом поверхностного плазменного резонанса, что показывает, что оба аллельных варианта узнаются примерно с одинаковой аффинностью (см. Пример 12). Эти данные подтвердил анализ с производным 4-LS21 TandAb CD30×CD16LS21, для которого также было показано связывание с обоими аллельными вариантами CD16A с практически одинаковой аффинностью. По сравнению с scFv 4-LS21, для TandAb наблюдали увеличение сродства более чем в 10 раз вследствие повышения авидности.

Пример 24: Исследование молекул CD30×CD16LS21 TandAb/(G2S)3 и CD19×CD16LS21 TandAb/(G2S) путем анализа цитотоксичности

Чтобы определить, могут ли антитела TandAb CD30×CD166LS2l и CD19×CD16LS21 опосредовать in vitro цитотоксичность клеток путем рекрутирования NK-клеток к клеткам-мишеням и активации NK-клеток путем перекрестного связывания активирующих рецепторов, проводили нерадиоактивный анализ цитотоксичности. Общая схема анализа описана Т. Dreier et al. (2002, Int J Cancer 100: 690-697). NK-клетки, которые применяли в качестве эффекторных клеток, обогащены из МПК, как описано ранее. В каждом случае чистоту и экспрессию антигена в обогащенных NK-клетках проверяли методом поточной цитометрии (данные не представлены).

CD30+ клетки-мишени L540CY или CD19+ клетки-мишени JOK-1 или Raji культивировали в среде RPMI 1640 с добавлением 10% ФТС, 2 мМ L-глутамина и 100 межд. ед/мл пенициллина G натрия и 100 мкг/мл стрептомицина сульфата (упоминаемой в данной заявке как среда RPMI; все компоненты приобретены в Invitrogen). Для анализа цитотоксичности клетки метили 10 мкМ кальцеином AM (Molecular Probes/Invitrogen) в течение 30 минут в среде RPMI при 37°C. После мягкой промывки меченые клетки ресуспендировали в среде RPMI до плотности 1×105/мл. Затем 1×104 клеток-мишеней высевали вместе с 1×105 обогащенных NK-клетками либо с CD30×CD16LS21 TandAb либо с CD19×CD16ALS2l TandAb в отдельные лунки круглодонного 96-луночного микротитрационного планшета в общем объеме 200 мкл/лунку. После центрифугирования в течение 2 мин при 200 g пробы инкубировали в течение 3 часов при 37°C в увлажненной атмосфере с 5% CO2. За 15 минут до конца инкубации в лунки, содержащие только клетки-мишени, добавляли 20 мкл 10% Triton X-100 в среде RPMI. Во все другие лунки 20 мкл среды RPMI добавляли. После дополнительного центрифугирования в течение 5 мин при 500 g из каждой лунки отбирали 100 мкл супернатанта клеточной культуры и измеряли флюоресценцию высвобожденного кальцеина при 520 нм с применением устройства считывания флюоресценции для планшетов (Victor 3, Perkin Elmer). На основании измерений рассчитывали специфичный клеточный лизис по следующей формуле: [флюоресценция (пробы) - флюоресценция (спонтан.)] / [флюоресценция (максимальн.) флюоресценция (спонтан.)] × 100%. Флюоресценция (спонтан.), представляет значения флюоресценции клеток-мишеней в отсутствие эффекторных клеток и антител, а флюоресценция (максимальн.) представляет собой общий клеточный лизис, индуцированный добавлением Triton X 100. Сигмоидальные кривые доза-ответ строили с применением программы Prism (GraphPad Software), см. Фигуру 8.

Результаты демонстрируют специфичный клеточный лизис клеток-мишеней активированными TandAb NK-клетками. В TandAb CD19×CD16LS21 не опосредовали лизис клеток-мишеней CD19- L540CY, и, наоборот, TandAb CD30×CD16LS21, напротив, не активировали лизис CD30- JOK-1 клеток NK-клетками B отсутствие NK-клеток ни TandAb CD30×CD16LS21, ни TandAb CD19×CD16LS21 не демонстрировали цитотоксической активности по отношению к клеткам-мишеням.

1. Антитело или его антигенсвязывающий фрагмент, которое обладает специфичностью к FcγRIIIA и не связывается специфично с FcγRIIIB, и включает:
(а) аминокислотную последовательность CDR1 легкой цепи, выбранную из SEQ ID NOS: 20, 23, 26, 29, 33 или 34, последовательность CDR2 легкой цепи, выбранную из SEQ ID NOS: 21, 24, 27, 30, 31 или 35, последовательность CDR3 легкой цепи, выбранную из SEQ ID NOS: 22, 25, 28 или 32; аминокислотную последовательность CDR1, CDR2 и CDR3 тяжелой цепи, включающую последовательности SEQ ID NOS: 17-19; или
(б) аминокислотную последовательность вариабельной области легкой цепи человека, выбранную из SEQ ID NOS: 10-16; и
(в) аминокислотную последовательность вариабельной области тяжелой цепи человека, представленную последовательностью SEQ ID NOS: 9.

2. Антигенсвязывающий фрагмент по п.1, отличающийся тем, что указанный антигенсвязывающий фрагмент выбирают из группы, состоящей из Fv, Fab, ди-Fab, Fab', F(ab')2 и scFv.

3. Антитело или его антигенсвязывающий фрагмент по любому из пп.1 и 2, в котором гипервариабельные участки являются человеческими.

4. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-3, в котором вариабельная область легкой цепи является вариабельной областью легкой цепи человека.

5. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-4, в котором вариабельная область тяжелой цепи является вариабельной областью тяжелой цепи человека.

6. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-5, отличающееся тем, что антитело или антигенсвязывающий фрагмент является полностью человеческим.

7. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-6, которое способно активировать FcγRIIIA-опосредуемые процессы.

8. Антитело или его антигенсвязывающий фрагмент по п.7, которое способно индуцировать опосредованный NK-клетками цитолиз клеток.

9. Мультиспецифичное антитело или его антигенсвязывающий фрагмент, обладающее по меньшей мере двумя специфичностями, обеспечивающими нацеливание макрофагов или NK-клеток на дополнительные антигены или клетки, и включающее антитело или его антигенсвязывающий фрагмент по любому из пп.1-8, которое обладает специфичностью к антигену FcγRIIIA и не связывается специфично с антигеном FcγRIIIB, причем указанное мультиспецифичное антитело или его антигенсвязывающий фрагмент обладает специфичностью к по меньшей мере одному дополнительному антигену, выбранному из группы, состоящей из антигена клеточной поверхности, вируса, бактерии, гриба, микоплазмы, паразита и приона.

10. Мультиспецифичное антитело или его антигенсвязывающий фрагмент по п.9, отличающееся тем, что указанный антиген клеточной поверхности выбран из группы, состоящей из CD19, CD20, CD30, предшественника рецептора ламинина, EGFR1, EGFR2, EGFR3, Ep-CAM, PEAP, антигена Томсена-Фриденрайха, MUC-1, IL4-R альфа, IL13-R, IGFR, FcεRI и CD5.

11. Мультиспецифичное антитело или его антигенсвязывающий фрагмент по п.9, отличающееся тем, что антитело выбрано из группы, состоящей из химерного антитела, антитела с пересаженными CDR, гуманизированного антитела и полностью человеческого антитела.

12. Мультиспецифичное антитело или его антигенсвязывающий фрагмент по п.9, отличающееся тем, что мультиспецифичный антигенсвязывающий фрагмент выбран из группы, состоящей из биспецифичного IgG, IgG-scFv, (scFv)4-IgG, (Fab')2, (scFv)2, (dsFv)2, слитого белка Fab-scFv, (Fab-scFv)2, (scFv)2-Fab, (scFv-CH2-CH3-scFv)2, димерного антитела (bibody), тримерного антитела (tribody), биспецифичного димерного антитела, стабилизированного дисульфидной связью (ds) димерного антитела (diabody), димерного антитела типа «knob-into-whole», одноцепочечного димерного антитела (scDb), тандемного димерного антитела (TandAb), комбинации scFv и димеров антител (flexibody), миниантитела DiBi, [(scFv)2-Fc]2, (scDb-CH3)2, (scDb-Fc)2, ди-димерного антитела (Di-diabody), тандемного антитела (Tandemab).

13. Мультиспецифичное антитело или его антигенсвязывающий фрагмент по п.12, отличающееся тем, что указанное мультиспецифичное антитело или его антигенсвязывающий фрагмент представляет собой димерные антитело (diabody) или тандемное димерное антитело (TandAb).

14. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-8, отличающееся тем, что указанное антитело или его антигенсвязывающий фрагмент способно связываться с аллельным вариантом FcγRIIIA158F с приблизительно такой же аффинностью, с какой оно связывается с аллельным вариантом FcγRIIIA158V.

15. Антитело или его антигенсвязывающий фрагмент по любому из пп.9-13, отличающееся тем, что указанное антитело или его антигенсвязывающий фрагмент способно связываться с аллельным вариантом FcγRIIIA158F с приблизительно такой же аффинностью, с какой оно связывается с аллельным вариантом FcγRIIIA158V.

16. Композиция, подходящая для введения пациенту, для лечения заболевания, в которое вовлечено связывание FcγRIIIA, характеризующаяся тем, что указанная композиция включает антитело или его антигенсвязывающий фрагмент согласно любому из предыдущих пунктов в эффективном количестве и по меньшей мере один дополнительный компонент, выбранный из подходящего фармацевтического наполнителя, разбавителя и стабилизатора.

17. Полинуклеотид, кодирующий антитело или его антигенсвязывающий фрагмент по п.1.

18. Полинуклеотид по п.19, отличающийся тем, что антитело или его антигенсвязывающий фрагмент, обладающее специфичностью к FcγRIIIA, включает
а) вариабельную область легкой цепи человека, кодируемую последовательностью нуклеиновой кислоты, выбранной из группы, состоящей из SEQ ID NOS: 2-8, и
б) вариабельную область тяжелой цепи человека, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 1.

19. Полинуклеотид, кодирующий мультиспецифичное антитело или антигенсвязывающий фрагмент антитела по п.9, причем указанный полинуклеотид кодирует: первую вариабельную область легкой цепи, кодируемую последовательностью нуклеиновой кислоты, выбранной из группы, состоящей из SEQ ID NOS: 2-8, первую вариабельную область тяжелой цепи, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 1, вторую вариабельную область легкой цепи и вторую вариабельную область тяжелой цепи, где указанные вторые вариабельные области легкой и тяжелой цепи обладают аффинностью к CD19.

20. Полинуклеотид по п.19 или 20, кодирующий мультиспецифичное антитело или антигенсвязывающий фрагмент антитела по п.9, причем указанный полинуклеотид кодирует: первую вариабельную область легкой цепи, кодируемую последовательностью нуклеиновой кислоты, выбранной из группы, состоящей из SEQ ID NOS: 2-8, первую вариабельную область тяжелой цепи, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 1, вторую вариабельную область легкой цепи и вторую вариабельную область тяжелой цепи, где указанные вторые вариабельные области легкой и тяжелой цепи обладают аффинностью к CD30.

21. Вектор для экспрессии антитела или антигенсвязывающего фрагмента антитела по любому из пп.1-8, причем указанный вектор включает
(1) полинуклеотид по любому из пп.17 и 18, функционально связанный с областью промотора, или
(2) полинуклеотид по любому из пп.17 и 18, функционально связанный с областью промотора и областью терминатора транскрипции.

22. Вектор для экспрессии антитела или антигенсвязывающего фрагмента антитела по любому из пп.9-13, включающий
(1) полинуклеотид по любому из пп.17-18, причем указанный вектор дополнительно содержит полинуклеотид, кодирующий антитело или антигенсвязывающий фрагмент антитела, обладающий специфичностью к по меньшей мере одному дополнительному антигену, по п.9 или полинуклеотид согласно любому из пп.19-20, функционально связанный с областью промотора, или
(2) полинуклеотид по любому из пп.17-18, причем указанный вектор дополнительно содержит полинуклеотид, кодирующий антитело или антигенсвязывающий фрагмент антитела, обладающий специфичностью к по меньшей мере одному дополнительному антигену, по п.9, или полинуклеотид согласно любому из пп.19-20, функционально связанный с областью промотора и областью терминатора транскрипции.

23. Вектор по любому из пп.21 или 22, отличающийся тем, что полинуклеотид функционально связан с областью промотора и дополнительно связан с сигнальной последовательностью.

24. Клетка-хозяин для экспрессии антитела или его антигенсвязывающего фрагмента по любому из пп.1-8, включающая полинуклеотид по любому из пп.17-18 или вектор согласно п.21.

25. Клетка-хозяин для экспрессии антитела или его антигенсвязывающего фрагмента по любому из пп.9-13, включающая полинуклеотид по любому из пп.19-20 или вектор согласно п.22.

26. Клетка-хозяин по п.24 или 25, отличающаяся тем, что указанная клетка-хозяин выбрана из группы, состоящей из клетки бактерии, клетки гриба, клетки насекомого, клетки млекопитающего и клетки растения.

27. Способ получения антитела или его антигенсвязывающего фрагмента по любому из пп.1-8, включающий введение в клетку-хозяин полинуклеотида согласно любому из пп.17-18, или вектора согласно п.21 и культивирование клетки-хозяина в условиях, в которых происходит экспрессия антитела или его антигенсвязывающего фрагмента.

28. Способ получения антитела или его антигенсвязывающего фрагмента по любому из пп.9-13, включающий введение в клетку-хозяина полинуклеотида согласно любому из пп.19-20, или вектора согласно п.22 и культивирование клетки-хозяина в условиях, в которых происходит экспрессия антитела или его антигенсвязывающего фрагмента.

29. Способ по п.27 или 28, дополнительно включающий выделение и возможно дальнейшую очистку антитела или его антигенсвязывающего фрагмента.

30. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-14 для применения в диагностике аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака.

31. Композиция по п.16 для применения в диагностике аутоиммунного заболевания, воспалительного заболевания, аллергии или рака.

32. Полинуклеотид по п.18 для применения в диагностике аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака.

33. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-14 для применения в лечении аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака.

34. Композиция согласно п.16 для применения в лечении аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака.

35. Полинуклеотид по п.18 для применения в лечении аутоиммунного заболевания, воспалительного заболевания, инфекционного заболевания, аллергии или рака.

36. Антитело или его антигенсвязывающий фрагмент по п.30 или 33, отличающееся тем, что рак выбран из группы, состоящей из неходжкинской лимфомы, хронического лимфолейкоза, болезни Ходжкина, солидной опухоли, минимальной остаточной болезни и метастатической опухоли.

37. Композиция по любому из пп.31 или 34, отличающаяся тем, что рак выбран из группы, состоящей из неходжкинской лимфомы, хронического лимфолейкоза, болезни Ходжкина, солидной опухоли, минимальной остаточной болезни и метастатической опухоли.

38. Полинуклеотид по любому из пп.32 или 35, отличающийся тем, что рак выбран из группы, состоящей из неходжкинской лимфомы, хронического лимфолейкоза, болезни Ходжкина, солидной опухоли, минимальной остаточной болезни и метастатической опухоли.

39. Применение антитела или его антигенсвязывающего фрагмента по любому из пп.1-14 или композиции по п.16 в производстве лекарственного препарата для лечения неходжкинской лимфомы, хронического лимфолейкоза, болезни Ходжкина, солидной опухоли, минимальной остаточной болезни и метастатической опухоли.

40. Применение антитела или его антигенсвязывающего фрагмента по п.10 в качестве реагента для: окрашивания клеток, экспрессирующих FcγRIIIA, исследования профилей клеток пациента ex-vivo или выделения NK-клеток для терапии ex-vivo.

41. Набор для детектирования FcγRIIIA, включающий антитело или его антигенсвязывающий фрагмент по любому из пп.1-14 и средства для детекции антитела или его антигенсвязывающего фрагмента, связанного с FcγRIIIA.



 

Похожие патенты:

Изобретение относится к области биотехнологии, а именно к способу продукции требуемого полипептида (варианты), способу получения фармацевтической композиции, клетке СНО для получения требуемого белка, клетке СНО-реципиенту ДНК, кодирующей требуемый полипептид, способу продукции требуемого полипептида.

Изобретение относится к области биотехнологии, а именно к способу получения клетки СНО, способной продуцировать желаемый полипептид с высоким выходом, клетке, полученной данным способом, способу получения желаемого полипептида, способу количественного увеличения продукции полипептида клеткой СНО с сильной экспрессией переносчика таурина.

Изобретение относится к области биотехнологии и может быть использовано в фармацевтической промышленности. .

Изобретение относится к иммунологии. .

Изобретение относится к терапевтическим композициям, которые содержат анти-CD20 антитела человека или их антиген-связывающие фрагменты по настоящему изобретению. .
Наверх