Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli



Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli
Способ получения рекомбинантного антигена g2 хантавируса добрава в клетках e.coli

 


Владельцы патента RU 2509805:

Федеральное государственное бюджетное учреждение "Институт полиомиелита и вирусных энцефалитов им. М.П. Чумакова" РАМН (RU)

Изобретение относится к области биотехнологии и касается способа получения рекомбинантного антигена G2 хантавирусов. Представленный способ характеризуется тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKDHLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3 (фиг.2), вводят в клетки E.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатурата, проводят хроматографию и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом. Представленное решение позволяет улучшить воспроизводимость и чувствительность иммуноферментного анализа при диагностике ГЛПС. 7 ил.

 

Область техники, к которой относится изобретение: Изобретение относится к области биотехнологии, в частности, к получению рекомбинантного антигена G2 хантавирусов с характеристиками, позволяющими улучшить воспроизводимость и чувствительность иммуноферментного анализа при диагностике ГЛПС.

Уровень техники: геморрагическая лихорадка с почечным синдромом (ГЛПС) - вирусный нетрансмиссивный зооноз, занимает в России ведущее место по числу заболевших среди природно-очаговых инфекций.

Наиболее эффективным методом борьбы с ГЛПС является специфическая профилактика, то есть вакцинация населения эндемичных регионов [1-3]. В настоящее время коммерческие вакцины против ГЛПС производятся только в Китае, однако ни одна из этих вакцин не может применяться в европейских регионах России, так как не обеспечивает защиты от вирусов Пуумала и Добрава - возбудителей ГЛПС в этих регионах [4-7].

Для изготовления и контроля вакцины против вирусов Пуумала и Добрава необходимо решить проблему разработки эффективных серологических методов на основе белков внешней оболочки - энвелопа хантавирусов. Однако до настоящего времени задача получения полноразмерных коммерческих препаратов белков энвелопа G1 и G2 хантавирусов не решена нигде в мире, что обусловлено их токсичностью по отношению к бактериальным клеткам.

Недавно был получен рекомбинантный антиген НТ-Δ12, представляющий собой фрагмент белка G2 хантавируса Добрава, сохраняющий иммуногенность полноразмерного продукта, но не проявляющий токсичности по отношению к клеткам продуцента (пат. заявка RU №2010141819 от 13.10.2010). При этом данный белок накапливался в клетках E.coli в виде телец включения [8-10]. Вследствие этого, при использовании антигена НТ-Δ12 в иммунологических тестах, необходимо проводить предварительную ренатурацию продукта, что в свою очередь негативно сказывается на чувствительности и воспроизводимости иммунологического теста.

Целью нашей работы является разработка способа повышения качественных характеристик антигена НТ-Δ12 за счет изменения его структуры.

Раскрытие изобретения: сущностью изобретения является способ повышения качественных характеристик рекомбинантного антигена G2 (НТ-Δ12) для его использования в иммунологических тестах при диагностике ГЛПС благодаря улучшению растворимости целевого белка-антигена G2 хантавируса Добрава за счет стабилизации его глобулярной структуры бета-структурным мини-доменом фолдона фибритина колифага JS98C3. Таким образом, настоящее изобретение относится к способу получения белка-антигена G2 хантавируса Добрава с заданными качественными характеристиками (белок GHF) для повышения воспроизводимости и чувствительности иммуноферментного анализа при диагностике ГЛПС. Способ предусматривает следующие стадии:

1) получение плазмидной конструкции pGHF, несущей трифункциональный слитой ген;

2) экспрессия и анализ выхода белка GHF;

3) хроматография белка GHF на колонке Sepharose 6 FF;

4) проведение иммунохимических тестов.

Краткое описание графических изображений:

Фиг.1. Плазмидная конструкция pGHF принципиальная схема.

Фиг.2. Последовательность трифункционального слитого гена, кодирующего производное пептида НТ, в составе конструкции pGHF.

- Последовательность гена GFP подчеркнута волнистой линией;

- Последовательность гена пептида НТ из состава кДНК вируса Добрава закрашена серым;

- Последовательность гена фолдона фибритина подчеркнута пунктиром;

Фиг.3. Электрофоретический анализ продуктов экспрессии конструкции pGHF в растворимой (1) и нерастворимой (2) фракции лизата клеток Е.coli JM109, затрансформированных конструкцией pGHF. Белки разделены в денатурирующем 15% ПААГ. На рисунке (а) показан общий белок (гель окрашен Coomassie Blue R-250), на рисунке (б) представлено свечение белка в геле под УФ-излучением.

Фиг.4. Хроматография белка GHF на колонке Sepharose 6 FF. Оптическая плотность при λ=280 нм представлена на графике (1).

Пунктирными линиями обозначен диапазон фракций, содержащих белок GHF (В1-В8).

Фиг.5. Изучение антигенной активности белка GHF методом твердофазного иммуноферментного анализа. Планшеты активированы белками-антигенами GHF (а) и НК6 (б). Пулы сывороток крови больных ГЛПС (вирусы Добрава, Пуумала, Хантаан) и здоровых доноров использовали в разведении от 50 до 3200 раз с шагом 2 раза. На оси ординат указана величина А450 каждой точки за вычетом фона (контроль без добавления сыворотки человека). На графиках представлены реакции белков-антигенов с сыворотками крови больных ГЛПС (1) и с сыворотками крови здоровых доноров (2).

Осуществление изобретения:

Методология исследования:

1) получение конструкции pGHF,

2) экспрессия и анализ выхода белка GHF,

3) хроматография белка GHF,

4) проведение иммунохимических тестов.

1) Получение конструкции

Получение конструкции проводили по следующей схеме:

В ранее описанную конструкцию рЕТ-НТ-Δ12 (пат. заявка RU №2010141819 от 13.10.2010), несущую ген пептида НТ, клонировали ген фолдона фибритина из конструкции pET-cd-32a [11]. При этом и векторную конструкцию рЕТ-НТ-Δ12 расщепляли по сайтам SpeI и, XhoI, а вставку из конструкции pET-cd-32a извлекали рестрикцией по сайтам XbaI и XhoI.

Далее в уникальный сайт XbaI полученной конструкции на базе вектора рЕТ23а вводили синтетический ДНК-дуплекс, составленный из заранее фосфорилированных олигонуклеотидов:

5' CTAGCGGGGGCGCCGGAGGA 3',

5' CTAGTCCTCCGGCGCCCCCG 3'.

Далее полученную конструкцию на основе рЕТ23а использовали в качестве матрицы для ПЦР с уникальным праймером

5' ggagatctGCTAGCGGGGGCGCCGGAGGAATTAATTCgag 3'

и со стандартным праймером T7terminator.

Полученный продукт ПЦР длиной 600 п.н. расщепляли рестриктазами BglII и XholI и клонировали в вектор pGem3z, расщепленный по сайтам BamHI и SalI.

Вставку «НТ+ фолдон фибритина» из конструкции pGem3z извлекали рестрикцией по сайтам SacI и PstI и клонировали в экспрессионный вектор pQE30-GFP, содержащий ген зеленого флуоресцентного белка GFP на базе вектора pQE30 (Qiagen) [12] по тем же сайтам.

В составе конструкции (фиг.1 и 2) можно выделить следующие элементы:

- экспрессионный вектор pQE30 (Qiagen);

- ген зеленого флуоресцентного белка GFP (Evrogen);

- фрагмент полилинкера вектора pGem-3z (Promega);

- ген Ht из конструкции рЕТ-НТ-12;

- фрагмент полилинкера вектора pGem-3z (Promega);

- ген фолдона фибритина фага JS98C3 [11].

2) Экспрессия и анализ выхода белка

Конструкцию pGHF вводили в клетки штамма Е.coli JM109. Селекцию колоний осуществляли по двум параметрам: по ампицилиноустойчивости и по наличию зеленой флуоресцентной окраски колоний. Полученный продуцент культивировали при 30°С в жидкой среде (0,5% дрожжевой экстракт, 1% пептон, 0,5% NaCl) с добавлением 100 мкг/мл ампициллина в колбах Эрленмейера объемом 750 мл (30 мл среды на колбу) в течение 14-18 часов. Посевной материал представлял собой смыв культуры клеток с чашек с агаризованной средой (0,5% дрожжевой экстракт, 1% пептон, 1,5% агар, 0,5% NaCl), полученных высевом первичных трансформантов. Возраст трансформантов - около 40 часов с момента окончания трансформации, температура культивирования - 30°С. Доза засева - 5×108 клеток на колбу. Индукцию промотора в клетках продуцента проводили IPTG.

Оценку накопления целевого продукта в клетках Е.coli осуществляли с помощью электрофоретического анализа суммарных белков рекомбинантного продуцента по Лэммли. Для этого из грубого клеточного лизата каждой культуры отбирали по 100 мкл. Лизат подвергали центрифугированию при 14000 G. в течение 15 мин и разделяли растворимую и нерастворимую клеточную фракции. Белки солюбилизировали в 30 мкл буфере Лэммли и анализировали состав белков с помощью денатурирующего SDS-электрофореза в 15% ПААГ (фиг.3). Флуоресцентное свечение белков растворимой фракции в геле наблюдали в районе 47 кДа, что соответствует расчетной массе белка GHF. Белки нерастворимой фракции флуоресцентного свечения не имели.

3) Хроматография белка

Грубый клеточный лизат культуры JM109 (GHF) подвергали центрифугированию при 8000 G. в течение 1 часа и разделяли растворимую и нерастворимую клеточную фракции. Белок из растворимой фракции подвергали первоначальной очистке путем двойного высаливания сульфатом аммония. Первый осадок, полученный путем осаждения 1,2% раствором (NH)4SO2, удаляли из фракции, последующий второй осадок (после осаждения 2% раствором (NH)4SO2), содержащий целевой белок GHF, собирали центрифугированием при 8000 G в течение 1 часа. Осадок суспендировали в 8 мл буфера (10 мМ Tris-HCl, 130 мМ NaCl, pH=7,8).

Основной целью хроматографии белка - производного пептида НТ в денатурирующих условиях являлось удаление примесей нуклеиновых кислот, формирующих коллоид с участием белков и препятствующих эффективному применению других методов хроматографии. При этом удаление из препарата примесей клеточных белков Е.coli рассматривалась лишь как побочная задача.

Полученный раствор белка GHF в объеме 15 мл наносили на колонку Sepharos 6 FF (GE Healthcare, США, высота 24 см, объем 48 мл), уравновешенную буфером А. Элюцию проводили линейным градиентом NaCl от 0 до 0,5 М в хроматографическом буфере В (Tris-HCl, 100 мМ) со скоростью 8 мл/мин (фиг.4).

Фракции для дальнейшей работы, содержащие целевой белок GHF, отбирали, оценивая присутствие флюоресцентной зеленой окраски в растворе. Отобранные фракции по 10 мл объемом каждая объединяли и подвергали концентрированию и очистке на HisLink Protein Purification Resin (Promega). Материал фракций белка GHF, полученный в результате, оказался иммунохимически чистым и электрофоретически гомогенным, что позволило непосредственно использовать его для проведения иммунохимических тестов.

4) Проведение иммунохимических тестов

В качестве формата проведения анализа был выбран вариант тИФА с непосредственной сорбцией рекомбинантного белка-антигена GHF на поверхность иммунологического планшета. Препаратом для сравнения служил белок-антиген НК6. В процессе сорбции белковые препараты GHF и НК6 разводили в 20-50 раз карбонат-бикарбонатным буфером (КГБ), доводя концентрацию общего белка в растворе до 10 мкг/мл. Полученный раствор вносили в иммунологические планшеты на 1 сутки, после чего проводили блокирование неспецифического связывания на подложке с помощью 1% БСА в буфере КГБ. На следующей стадии проведения анализа проводилось серийное титрование пулов сывороток крови больных ГЛПС и, в качестве сравнения, здоровых доноров. При этом пул сывороток крови включал больных ГЛПС, инфицированных вирусом Добрава, Пуумала и Хаантан. Сыворотки крови брали в разведении от 50 до 3200 раз с шагом 2 раза. В качестве контрольного образца использовали лунки планшета, в которые вместо разведенной сыворотки человека вносили буфер PBS («конъюгатный контроль»).

В заключение все лунки планшета обрабатывали антивидовым конюгатом против IgG человека, меченным пероксидазой, и субстратом ТМВ в присутствии пероксида водорода. Сигнал мерили на планшетном сканере-спектрофотометре при λ=450 нм. Результаты определений представлены на фиг.5.

Полученные результаты доказывают, что повышение растворимости рекомбинантного антигена за счет изменения его структуры приводит к увеличению разрешающей способности иммунологического анализа для диагностики ГЛПС.

Список использованных источников

1. Maes P., Clement J., Van Ranst M. Recent approaches in hantavirus vaccine development. - Expert Rev Vaccines. - 2009 - V.8, №1, P.67-76.

2. Cho H.W., Howard C.R., Lee H.W. Review of an inactivated vaccine against hantaviruses. - Intervirology. - 2002 - V.45, №4-6, P.328-333.

3. Song G. Epidemiological progresses of hemorrhagic fever with renal syndrome in China. - Chin Med J (Engl). - 1999 - V.112, №5, P.472-477.

4. Oya A. Japanese encephalitis vaccine. - Acta Paediatr Jpn. - 1988 - V.30, №2, Р.175-184.

5. Choi Y. Ahn C.J., Seong K.M., Jung M.Y., Ahn B.Y. Inactivated Hantaan virus vaccine derived from suspension culture of Vero cells. - Vaccine. - 2003 - V.21, №17-18, P.1867-1873.

6. Lee H.W., Chu Y. K., Woo Y.D. Immune responses after two or three doses of Hantavax vaccination against Hantaan virus // Proc. fifth international conference on hemorrhagic fever with renal syndrome, hantavirus pulmonary syndrome and hantaviruses. Lion, Franch - 2001. - P.234-242.

7. Ruan Y., Xu X., Liu W„ Deng X, Weng S, Zhou W, Wang Q, Chen L, Fang L, Xu Z, Yan Q, Liu W, Dong G, Gu H, Yu Y, Xu Z. A study on immunogenicity and safety of bivalent inactivated vaccine against hemorrhagic fever with renal syndrome. - Zhonghua Yu Fang Yi Xue Za Zhi. - 1999 - V.33, №6, P.340-342.

8. Hooper J.W., Kamrud K.I., Elgh F., Custer D., Schmaljohn C.S. DNA vaccination with hantavirus M segment elicits neutralizing antibodies and protects against seoul virus infection. - Virology. - 1999 - V.255, №2, P.269-278.

9. Kallio-Kokko H., Leveelahti R., Brummer-Korvenkontio M., Lundkvist A., Vaheri A., Vapalahti O. Human immune response to Puumala virus glycoproteins and nucleocapsid protein expressed in mammalian cells. - J Med Virol. - 2001 - V.65, №3, P.605-613

10. Huang H., Li X., Zehua Z. Genetic immunization with Hantavirus vaccine combining expression of G2 glycoprotein and fused interleukin-2. - Genetic Vaccines and Therapy. - 2008 - V.6. - P.15-21.

11. Латыпов О.Р., Голомидова А.К., Летаров А.В. Характеристика продукта гена wac бактериофага JS98C3, близкородственного фагу JS98 // Вестник КГУ. 2007. Т.149. С.112-122.

12. Шевелев А.Б., Хоменков В.Г., Кузнецова Т.В., Ковалев Л.И., Лагодная Н.В. Создание продуцента миостатина в виде слитого белка с 6His-GFP на основе Е.coli и изучение его иммуногенности. Сборник статей «Медико-биологические технологии повышения работоспособности в условиях напряженных физических нагрузок». Министерство образования и науки Российской Федерации, Москва, 2004, С.140-150.

Фиг. 2

Способ получения рекомбинантного антигена G2 Хантавируса Добрава в клетках E.coli, характеризующийся тем, что ДНК конструкции pGHF, кодирующая слитый белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с последовательностью аминокислот SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKDHLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3 (фиг.2), вводят в клетки E.coli, культивируют трансформированные данной конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с помощью денатурата, проводят хроматографию и используют полученный продукт для выявления специфических антител в сыворотке больных геморрагической лихорадкой с почечным синдромом.



 

Похожие патенты:

Изобретение относится к области микробиологии и молекулярной генетики и касается рекомбинантного полипептида А2, ДНК, его колирующей, штамма продуцирующего полипептид А2 и способов использования такого рекомбинантного полипептида.

Изобретение относится к области биотехнологии, а именно к способу получения рекомбинантного антигена G2 хантавируса Добрава в клетках Е.coli. Способ характеризуется тем, что ДНК конструкции рНК6, указанной на фиг.1, кодирующая слитой белок из трех частей, где N-концевое положение занимает зеленый флуоресцентный белок GFP, центральное - пептид длиной 73 а.о.

Изобретение относится к биотехнологии, в частности к генетической инженерии, и позволяет получать микробиологическим синтезом по упрощенной технологии новый гибридный полипептид GST- MPT64 со свойствами видоспецифичного белка-антигена Mycobacterium tuberculosis MPT64 (также cоответствующего гомологичному белку MPB64 Mycobacteriumbovis), который может быть использован для ранней диагностики туберкулезной инфекции, вызванной одним из двух видов - Mycobacterium tuberculosis или Mycobacterium bovis.

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. .

Изобретение относится к области биотехнологии и может быть использовано в биохимии, протеомике и фармакологии для экспрессии и получения сложных трансмембранных белков из бактериальных штаммов-продуцентов.

Изобретение относится к области генной и белковой инженерии и касается рекомбинантной плазмидной ДНК pER-Hir, кодирующей гибридный белок, способный к автокаталитическому расщеплению с образованием [Leu1, Thr2]-63-десульфатогирудина, штамму Escherichia coli ER2566/pER-Hir - продуценту указанного белка и способу получения генно-инженерного [Leu1, Thr2]-63-десульфатогирудина.
Изобретение относится к области биотехнологии и генной инженерии и представляет собой рекомбинантную плазмиду pHisTevTSIB0821 для экспрессии в клетках Escherichia coli пролидазы TSIB_0821 из археи Thermococcus sibiricus.

Изобретение относится к биотехнологии, а именно к рекомбинантной плазмидной ДНК, кодирующей ферментативно-активную часть полипептида липазы, белка пищеварительного тракта пчелиной огневки длиной в 504 аминокислотных остатков.

Изобретение относится к области биотехнологии и касается рекомбинантных векторов, используемых для производства противогриппозных вакцин. Охарактеризованы рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа и способ ее использования.

Изобретение относится к области биотехнологии и касается рекомбинантных векторов, которые могут быть использованы для противогриппозных вакцин. Охарактеризованы рекомбинантная псевдоаденовирусная частица на основе генома аденовируса человека 5 серотипа и способ ее использования в качестве компонента для создания вакцины против вируса гриппа А субтипа H1N1.

Настоящее изобретение относится к области биохимии, и представляет собой способ получения 2S,4R-монатина или его соли, предусматривающий контактирование 4R-IHOG с аминотрансферазой L-аминокислоты в присутствии L-аминокислоты, и способ получения 2R,4R-монатина или его соли, предусматривающий изомеризацию 2S,4R-монатина.

Изобретение относится к области биохимии, в частности к вариантам антител против рецептора IL-6, вариабельные области тяжелой и легкой цепи которых модифицированы путем введения аминокислотных замен.

Изобретение относится к области биотехнологии и касается способа синтеза целевого секретируемого белка человека в клетках дрожжей Saccharomyces cerevisiae. Способ включает культивирование в подходящих условиях дрожжей Saccharomyces cerevisiae и секрецию целевого белка, причем секреция направлена лидерным полипептидом, имеющим аминокислотную последовательность SEQ ID NO1 и представляющим собой вариант про-области лидерного полипептида белка PpPIR1 Pichia pastoris.

Изобретение относится к области биотехнологии. Описана модифицированная липидами двухцепочечная РНК, включающая антисмысловую нить, нуклеотидная последовательность которой комплементарна целевой последовательности в целевом гене, и смысловую нить, нуклеотидная последовательность которой комплементарна антисмысловой нити.

Изобретение относится к биотехнологии, в частности к новым глицерол-3-фосфатацилтрансферазам и полинуклеотидам, их кодирующим. Настоящее изобретение относится также к вектору экспрессии и трансформанту, содержащему полинуклеотид, а также способу получения липидной композиции или композиции на основе жирных кислот с использованием трансформанта.

Изобретение относится к области биотехнологии, а именно к рекомбинантному гибридному ингибитору ангиогенеза и к способу его получения. Рекомбинантный гибридный ингибитор ангиогенеза представляет собой белок, указанный на фиг.1.

Изобретение относится к области биотехнологии и касается получения генетической конструкции, обеспечивающей синтез в клетках Escherichia coli рекомбинантного белка p35d. Представлены: рекомбинантная плазмидная ДНК pQE-p35d, обеспечивающая синтез рекомбинантного белка p35d вируса оспы коров и содержащая в соответствии с физической и генетической картой плазмиды, приведенной на фиг. 2: плазмидный вектор pQE30, фрагмент, кодирующий олигопептид MRGSHHHHHHG и фрагмент размером 717 п.о., кодирующий фрагмент белка р35 вируса оспы коров с 1 по 239 аминокислотный остаток (фиг.1а); штамм бактерий Escherichia coli XL1Blue/pQE-p35d В-1252 - продуцент рекомбинантного белка p35d вируса оспы коров, содержащий рекомбинантную плазмидную ДНК pQE-p35d, депонированный в Коллекции бактерий, бактериофагов и грибов ФБУН ГНЦ ВБ «Вектор» под регистрационным номером В-1252 и рекомбинантный белок p35d вируса оспы коров. Охарактеризованные решения могут быть использованы для создания тест-систем и конструирования субъединичных вакцин против ортопоксвирусных инфекций. 3 н. п. ф-лы, 7 ил., 5 пр.
Наверх