Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами

Авторы патента:


Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами
Терапевтические полипептиды, их гомологи, их фрагменты и их применение для модуляции агрегации, опосредованной тромбоцитами

 


Владельцы патента RU 2524129:

АБЛИНКС Н.В. (BE)

Настоящее изобретение относится к биотехнологии и представляет собой полипептидную конструкцию для лечения, профилактики и облегчения нарушений, связанных с адгезией тромбоцитов и опосредованной тромбоцитами агрегацией или ее дисфункцией, которая включает одно или более однодоменных антител, направленных против фактора фон Виллебранда (vWF), и одно или более однодоменных антител, направленных против сывороточного альбумина (SA). Изобретение также относится к нуклеиновой кислоте, кодирующей такую полипептидную конструкцию, к композициям, содержащим указанную конструкцию, и к ее применению для получения лекарственных средств для профилактики, лечения и облегчения указанных нарушений. Настоящее изобретение позволяет расширить ассортимент лекарственных средств для лечения, профилактики и облегчения нарушений, связанных с адгезией тромбоцитов и опосредованной тромбоцитами агрегацией или ее дисфункцией. 6 н. и 9 з.п. ф-лы, 30 ил., 32 табл., 69 пр.

 

Уровень техники

При повреждении стенок кровеносных сосудов происходит экспонирование субэндотелиальных структур, которые опосредуют адгезию тромбоцитов за счет взаимодействия с фактором фон Виллебранда (von Willebrand factor, vWF). Фактор vWF формирует мостик между коллагеном в разрушенных стенках сосудов и рецептором тромбоцитов - гликопротеином 1b (gp1b) (такое взаимодействие особенно важно в условиях высокого срезывающего напряжения), что приводит к образованию кровоостанавливающих пробок и предотвращению, таким образом, интенсивного кровотечения (Bennet S, Thromb Haemost (2001) Mar; 85(3):395-400). В условиях нормального гемостаза данный процесс обеспечивает заживление ран в поврежденных стенках кровеносных сосудов. Однако при патологических состояниях избыточная функция тромбоцитов может приводить к образованию тромбов. Субъединицы vWF содержат несколько гомологичных доменов, каждый из которых выполняет различные функции. Через домен A3 vWF взаимодействует с коллагеновыми волокнами, а через домен A1 - с рецептором gp1b тромбоцитов. В нормальных условиях тромбоциты с vWF не взаимодействуют. Предполагается, что при связывании vWF с коллагеном в условиях высокого срезывающего напряжения он претерпевает конформационные изменения, что делает возможным его связывание с рецептором тромбоцитов gp1b. Такое обратимое связывание приводит к накоплению тромбоцитов в области поврежденных участков, а затем и к более прочной их адгезии через рецепторы коллагена тромбоцитов (gp1a/IIa, gpVI, gpIV, p65, TIIICBP), что сопровождается их активацией. В конечном итоге это приводит к активации рецептора gp11b/IIIa, связыванию фибриногена и агрегации тромбоцитов.

Ингибиторы агрегации тромбоцитов были выделены из кровососущих организмов, в частности из пиявок. Саратин, полученный из пиявки Hirudo medicinalis, был описан в WO 02/15919 А2 и в статьях Cruz CP et al., Saratin, an inhibitor of von Willebrand factor-dependent platelet adhesion, decreases platelet aggregation and intimal hyperplasia in a rat carotid endarterectomy model. Journal of Vascular Surgery, 2001, 34: 724-729 и Smith TP et al., Saratin, an inhibitor of collagen-platelet interaction, decreases venous anastomotic intimal hyperplasia in a canine dialysis access model. Vase Enovascular Surg, 2003, Jul-Aug; 37(4); 259-269.

На основе антител были разработаны лекарственные препараты, некоторые из которых в настоящее время используются в терапии.

Abciximab (химерный 7Е3 Fab; US 6,071,524, ЕР 0882453), Fab-фрагмент химерного (мышь-человек) антитела 7Е3, который ингибирует связывание лигандов с рецептором тромбоцитов gpIIb/IIIa, был разрешен в декабре 1994 г. для применения на человеке в качестве вспомогательной терапии для предотвращения ишемических осложнений при чрескожных вмешательствах на сердце. Основной вопрос, касающийся безопасности использования ингибиторов gpIIb/IIIa, заключается в риске кровотечений, поскольку мощный анти-тромбоцитный эффект этих лекарственных средств может неблагоприятно влиять на свертываемость крови.

Были получены мышиные антитела против домена A1 vWF (US 2002/0028204 A1; US 6,280,731 и WO 00/10601) и против его активной конформации (US 6,251,393). Эффективность их использования in vivo описана в статьях Kageyama S, et al.: "Effect of humanized monoclonal antibody to von Willebrand factor in a canine model of coronary artrial thrombosis", Eur JPharmacol. 2002 May 17,443(1-3): 143-149, "Anti-human vWF monoclonal antibody, AjvW-2 Fab, inhibits repetitive coronary artery thrombosis without bleeding time prolongation in dogs", Thromb Res., 2001 Mar 1; 101(5):395-404, и "Anti-human von Willebrand factor monoclonal antibody AjvW-2 prevents thrombus deposition and neointima formation after balloon injury in guinea pigs", Arterioscler Thromb Vase Biol. 2000 Oct; 20(10):2303-2308. Антитела AjvW-2 ингибируют агрегацию тромбоцитов человека, индуцированную высоким срезывающим напряжением, и не влияют на агрегацию тромбоцитов в условиях низкого срезывающего напряжения.

Влияние на бабуинов мышиных антител 82D6A3, полученных против домена A3 vWF человека, описано в патенте WO 02/051351 и в статье Dongmei Wu et al., "Inhibition of the von Willebrand (vWF)-collagen interaction by an antihuman vWF monoclonal antibody results in abolition of in vivo arterial platelet thrombus formation in baboons". Hemostasis, thrombosis and vascular biology, 2002, 99: 3623-3628.

Антитела 6В4 представляют собой моноклональные антитела (МоАb), полученные против очищенного gp1b человека. МоАb 6В4 ингибируют vWF-зависимую агглютинацию тромбоцитов человека, индуцированную как ристоцетином, так и ботроцетином. Более того, МоАb 6В4 блокируют индуцированную срезывающим напряжением сдвига адгезию тромбоцитов человека с коллагеном I. При введении бабуинам нативные IgG и их фрагменты F(ab')(2) вызывали почти немедленную тромбоцитопению за счет двухвалентности F(ab')(2), которые опосредуют перекрестное сшивание тромбоцитов, или взаимодействия Fc:Fc рецепторов, что приводит к активации агрегации тромбоцитов (WO 0110911; Cauwenberghs N et al., Arteriosclerosis, Thrombosis and Vascular Biology, 2000, 20: 1347, а также, например, смотри Cadroy Y et al., Blood, 1994, 83: 3218-3224, Becker BH et al., Blood, 1989, 74: 690-694, и тезисы Ravanat С. et al., Thromb. Haemost. 1999, 82: 528a). Осаждение тромбоцитов на богатый коллагеном перикард крупного рогатого скота ингибировалось при введении бабуинам Fab-фрагментов до того, как образовался тромб. Однако когда Fab-фрагменты вводили уже после того, как тромб образовался, дальнейшего ингибирования тромбоза не наблюдалось. Выход белка при экспрессии названных молекул Fab был крайне низок, а метод их получения очень трудоемок.

Цели настоящего изобретения

Цель настоящего изобретения заключается в получении полипептидов, включающих в себя одно или более однодоменных антител, направленных против vWF, A1 домена vWF, A1 домена активированного vWF, A3 домена vWF, gp1b и/или коллагена, гомологов названных полипептидов и/или функциональных фрагментов названных полипептидов, которые могут быть использованы в условиях, требующих модуляции опосредованной тромбоцитами агрегации, и позволяют преодолеть проблемы предшествующего уровня техники. Следующая цель изобретения - разработка способов получения названных полипептидов, способов обработки для получения используемых в медицинской практике инструментов и приборов, покрытых названными полипептидами (например, для РСТА (чрескожная транслюменальная ангиопластика, percutaneous Transluminal Angioplasty), эндопротезирования), способов и наборов для скрининга агентов, модулирующих опосредованную тромбоцитами агрегацию и наборов для диагностики заболеваний, связанных с опосредованной тромбоцитами агрегацией.

Раскрытие изобретения

Были получены однодоменные антитела, позволяющие специфически распознавать молекулы-мишени, участвующие в первом и последующих этапах агрегации тромбоцитов, что позволяет создать более эффективные и безопасные антитромбозные агенты.

Одним из воплощений данного изобретения является полипептидная конструкция, включающая в себя, по меньшей мере, одно однодоменное антитело против любого из: vWF, A1 домена vWF, A1 домена активированного vWF, A3 домена vWF, gp1b или коллагена.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, в которой однодоменное антитело, направленное против A1 домена активированного vWF, специфически распознает конформацию активированного vWF в участке формирования тромба, но не связывается с циркулирующей в крови неактивированной формой vWF.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, которая дополнительно включает, по меньшей мере, одно однодоменное антитело, направленное против одного или более белков сыворотки крови.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, где, по меньшей мере, одним из названных сывороточных белков является любой из следующих белков: сывороточный альбумин, сывороточный иммуноглобулин, тироксин-связывающий белок, трансферрин, фибриноген или их фрагменты.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, где, по меньшей мере, одно однодоменное антитело, направленное против одного или более белков сыворотки крови, соответствует последовательностям, представленным любой из SEQ ID NO:16-19 и 49-61.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO:13-15 и 42-45.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, где, по меньшей мере, одно из однодоменных антител является гуманизированной последовательностью.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, в которой, по меньшей мере, одно из однодоменных антител соответствует последовательности, представленной любой из последовательностей SEQ ID NO:38-41 и 42-45.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO:8-12, 20-22, 32-34 и 42-47.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, где, по меньшей мере, одно однодоменное антитело является VHH антителом представителя семейства мозоленогих (Camelidae).

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, в которой, по меньшей мере, одно однодоменное антитело соответствует последовательности, представленной любой из последовательностей SEQ ID NO:1-7, 23-31, 35-37 и 62-65.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, в которой названное однодоменное антитело является гомологичной последовательностью, функциональной частью или функциональной частью гомологичной последовательности полноразмерного однодоменного антитела.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, где названная полипептидная конструкция является гомологичной последовательностью названной полипептидной конструкции, ее функциональной частью или гомологичной последовательностью ее функциональной части.

Другое воплощение настоящего изобретения - нуклеиновая кислота, кодирующая описанную выше полипептидную конструкцию.

Другое воплощение настоящего изобретения - композиция, включающая описанную выше полипептидную конструкцию и, по меньшей мере, один тромболитический агент для одновременного, раздельного или последовательного введения пациенту.

Другое воплощение настоящего изобретения - описанная выше композиция, где названный тромболитический агент является любым из следующих: стафилокиназой, тканевым активатором плазминогена, стрептокиназой, одноцепочечной стрептокиназой, урокиназой или комплексом ацил-плазминогена и стрептокиназы.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, или описанная выше нуклеиновая кислота, или описанная выше композиция для применения для лечения, профилактики и/или облегчения симптомов расстройств, связанных с опосредованной тромбоцитами агрегацией или ее дисфункцией.

Другое воплощение настоящего изобретения - применение описанной выше полипептидной конструкции, или описанной выше нуклеиновой кислоты, или описанной выше композиции для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов расстройств, связанных с опосредованной тромбоцитами агрегацией или ее дисфункцией.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, или описанная выше нуклеиновая кислота, или описанная выше композиция, или описанное выше применение полипептидной конструкции, нуклеиновой кислоты или композиции, где названные расстройства являются любыми из возникающих при кратковременном ишемическом повреждении головного мозга, нестабильной или стабильной стенокардии, грудной жабе, инсульте головного мозга, инфаркте миокарда, закупорке периферических артерий, рестенозе, шунтировании коронарных сосудов, замене сердечных клапанов или операциях на сердце, таких как ангиопластика, эндопротезирование, эндартерэктомия сонной артерии или атерэктомия.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, или нуклеиновая кислота, или композиция, или описанное выше применение полипептидной конструкции, нуклеиновой кислоты или композиции, где названные расстройства являются любыми из возникающих при образовании неокклюзивных тромбов, образовании окклюзивных тромбов, образовании артериальных тромбов, острой коронарной окклюзии, рестенозе, рестенозе после РСТА или эндопротезирования, образовании тромбов в стенозированных артериях, гиперплазии после ангиопластики, атерэктомии или эндопротезировании артерии, окклюзивном синдроме сосудистой системы или при потере проницаемости больных артерий.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, или нуклеиновая кислота, или композиция, или описанное выше применение полипептидной конструкции, нуклеиновой кислоты или композиции, в условиях, при которых названные нарушения являются бляшками или тромбами, возникающими в условиях высокого срезывающего напряжения.

Другое воплощение настоящего изобретения - описанная выше полипептидная конструкция, или нуклеиновая кислота, или композиция, или описанное выше применение полипептидной конструкции, где названная полипептидная конструкция вводится внутривенно, подкожно, перорально, под язык, местно, назально, вагинально, ректально или в виде ингаляции.

Другое воплощение настоящего изобретения - композиция, включающая описанную выше полипептидную конструкцию, или нуклеиновую кислоту, кодирующую названную полипептидную конструкцию, или описанную выше композицию и фармацевтически приемлемый носитель.

Другое воплощение настоящего изобретения - способ получения описанных выше полипептидов, включающий:

а) культивирование клеток-хозяев, содержащих нуклеиновую кислоту, способную кодировать описанный выше полипептид, в условиях, обеспечивающих экспрессию полипептида, и

б) извлечение полученного полипептида из культуры.

Другое воплощение настоящего изобретения - описанный выше способ, где названные клетки-хозяева являются бактериями или дрожжами.

Другое воплощение настоящего изобретения - способ обработки медицинских инвазивных устройств для предотвращения опосредованной тромбоцитами агрегации вокруг участка вмешательства, включающий стадию нанесения на названные устройства описанных выше полипептидных конструкций.

Другое воплощение настоящего изобретения - инвазивное медицинское устройство для избегания опосредованной тромбоцитами агрегации вокруг участка вмешательства, где названное устройство покрыто описанными выше полипептидными конструкциями.

Другое воплощение настоящего изобретения - способ идентификации агентов, модулирующих опосредованную тромбоцитами агрегацию, включающий в себя:

а) контактирование описанной выше полипептидной конструкции с полипептидом, соответствующим ее мишени, или его фрагментом в присутствии и в отсутствие потенциального модулятора в условиях, обеспечивающих связывание названных полипептидов, и

б) измерение связывания полипептидов на стадии (а), где уменьшение связывания в присутствии названного потенциального модулятора по отношению к связыванию в отсутствие названного потенциального модулятора идентифицирует названный потенциальный модулятор в качестве агента, модулирующего опосредованную тромбоцитами агрегацию.

Другое воплощение настоящего изобретения - наборы для скрининга на агенты, модулирующие опосредованную тромбоцитами агрегацию, описанным выше способом.

Другое воплощение настоящего изобретения - неизвестный агент, модулирующий опосредованную тромбоцитами агрегацию, идентифицированный с помощью описанного выше способа.

Другое воплощение настоящего изобретения - способ диагностики заболеваний или нарушений, характеризующихся дисфункцией опосредованной тромбоцитами агрегации, включающий в себя:

а) контактирование образца с описанной выше полипептидной конструкцией, и

б) детектирование связывания названной полипептидной конструкции с названным образцом, и

в) сравнение связывания, зарегистрированного на стадии (б), со стандартом, где различие в связывании по отношению к указанному образцу является диагностическим признаком для заболевания или нарушения, характеризующегося дисфункцией опосредованной тромбоцитами агрегации.

Другое воплощение настоящего изобретения - набор для диагностики заболевания или нарушения, характеризующегося дисфункцией опосредованной тромбоцитами агрегации, в соответствии с описанным выше способом.

Другое воплощение настоящего изобретения - описанный выше набор, включающий в себя описанную выше полипептидную конструкцию.

Осуществление изобретения

Настоящее изобретение касается полипептидной конструкции, включающей одно или несколько однодоменных антител, каждое из которых специфично к индивидуальной мишени, и выявления того факта, что данная конструкция оказывает модулирующее воздействие на процессы агрегации, опосредованной тромбоцитами.

Мишени

В соответствии с настоящим изобретением мишенями являются vWF, A1 домен vWF, A1 домен активированного vWF, A3 домен vWF, gp1b или коллаген. Перечисленные мишени - это белки млекопитающих, выделенные из представителей таких видов, как кролик, коза, мышь, крыса, корова, теленок, верблюд, лама, обезьяна, осел, морская свинка, курица, овца, собака, кошка, лошадь, и предпочтительно из человека. Аминокислотная последовательность vWF человека представлена в Таблице 30, SEQ ID NO:48.

Мишенями также являются фрагменты vWF, A1 домена vWF, A1 домена активированного vWF, A3 домена vWF, gp1b или коллагена, способные вызывать иммунный ответ. Мишенями также являются фрагменты vWF, A1 домена vWF, A1 домена активированного vWF, A3 домена vWF, gp1b или коллагена, способные связываться с однодоменным антителом, полученным против «родительского» полноразмерного антигена-мишени.

Использованный здесь термин фрагмент относится менее чем к 100% последовательности (например, 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% и т.д.), но включает в себя 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 или более аминокислот. Длина фрагмента достаточна для того, чтобы интересующее взаимодействие устанавливалось с аффинностью 1×10-6 или лучшей.

Использованный здесь термин фрагмент относится также к произвольным вставкам, делециям и заменам одной или более аминокислот, не оказывающим существенного влияния на способность мишени связывать однодоменное антитело, полученное против мишени дикого типа. Число вставленных, делегированных или заменных аминокислот составляет предпочтительно до 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 или 70 аминокислот.

Однодоменное антитело, направленное против мишени - это однодоменное антитело, способное связывать свою мишень с аффинностью лучше, чем 10-6 М.

Однодоменные антитела

Однодоменные антитела - это антитела, чьи определяющие комплементарность участки являются частью однодоменного полипептида. Некоторыми примерами (но не ограничиваясь ими) могут служить антитела, состоящие только из тяжелой цепи, антитела естественно лишенные легких цепей, однодоменные антитела, полученные из канонических антител, содержащих 4 цепи, сконструированные антитела и однодоменные конструкции, не являющиеся фрагментами природных антител. Однодоменными антителами могут быть любые, известные в данной области исследований, и любые однодоменные антитела, полученные в будущем. Однодоменные антитела могут быть выделены из представителей таких видов, как мышь, человек, верблюд, лама, коза, кролик, бык, но не ограничиваясь ими. В соответствии с одним из аспектов настоящего изобретения использованное здесь однодоменное антитело - это встречающееся в природе однодоменное антитело, известное как тяжелоцепочечное антитело, естественно лишенное легких цепей. Такие однодоменные антитела описаны, например, в WO 9404678. Для ясности этот вариабельный домен, происходящий из тяжелоцепочечного антитела, естественно лишенного легких цепей, обозначен здесь как VHH или наночастица (nanobody) для того, чтобы отличать его от канонического VH - фрагмента иммуноглобулинов, содержащих 4 цепи. Такие VHH молекулы могут происходить из антител, продуцируемых представителями семейства Camelidae, например представителями таких видов, как верблюд, лама, одногорбый верблюд, альпака и гуанако. Представители других видов, не входящих в семейство Camelidae, способны продуцировать антитела, естественно лишенные легких цепей, такие VHH молекулы входят в объем настоящего изобретения.

Как известно специалисту и согласно настоящему изобретению, молекулы VHH - это вариабельные домены тяжелых цепей, происходящие из иммуноглобулинов, естественно лишенных легких цепей, таких как, например, антитела, выделенные из представителей семейства Camelidae и описанные в WO 9404678 (в дальнейшем VHH - домены или наночастицы). Молекулы VHH примерно в десять раз меньше, чем молекулы IgG. Это индивидуальные полипептидные молекулы, обладающие высокой стабильностью, они устойчивы к экстремальным значениям рН и температурным условиям. Более того, они устойчивы к действию протеаз, что не является свойством канонических антител. Кроме того, in vitro экспрессия VHH обеспечивает высокий выход правильно уложенных функциональных VHH молекул. И, наконец, антитела, полученные из представителей семейства Camelidae, будут узнавать эпитопы, отличные от тех эпитопов, которые узнаются антителами, полученными in vitro с использованием библиотек антител или в результате иммунизации млекопитающих, не являющихся представителями семейства Camelidae (WO 9749805). По существу, анти-альбуминовые VHH молекулы могут взаимодействовать с сывороточным альбумином, который известен как белок-переносчик, более эффективно. Так как сывороточный альбумин - это белок-переносчик, некоторые эпитопы данного белка могут быть недоступны для связывания, так как уже содержат связанные белки, пептиды или небольшие химические соединения. Так как известно, что VHH молекулы связываются с «необычными» или неканоническими эпитопами, такими как, например, «впадины» (WO 9749805), аффинность таких VHH молекул к циркулирующему альбумину может быть более высокой.

Классы VHH

Настоящее изобретение дополнительно касается полипептидной конструкции, в которой однодоменное антитело - это VHH, направленное против упомянутой здесь мишени, где VHH принадлежит к классу, имеющему последовательность, подобную последовательности человека (гуманизированную последовательность). Класс характеризуется тем, что все VHH несут аминокислоту из группы, включающей глицин, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, тирозин, триптофан, метионин, серин, треонин, аспарагин или глутамин в положении 45, как, например, L45, согласно нумерации по Kabat. Последовательность VHH, представленная последовательностями SEQ ID NO:1 и SEQ ID NO:3, которые связываются с vWF, принадлежит к этому классу гуманизированных полипептидов VHH. По существу, пептиды, принадлежащие к этому классу, демонстрируют высокую степень гомологии аминокислотной последовательности к каркасным участкам VH человека, следовательно, названные пептиды могут быть непосредственно применены на человеке, при этом не ожидается нежелательного иммунного ответа на них, и без обременения дальнейшей гуманизацией.

Поэтому один аспект настоящего изобретения допускает прямое введение нуждающемуся в этом пациенту полипептидной конструкции, включающей одно или более однодоменных антител, аминокислотные последовательности которых соответствуют последовательности, представленной любой из последовательностей SEQ ID NO:1 или SEQ ID NO:3.

Другой класс однодоменных антител из мозоленогих (Camelidae), подобных человеческим, представлен последовательностями SEQ ID NO:16 и 18, которые были описаны в WO 03/035694 и которые содержат гидрофобные FR2 остатки, типично обнаруживаемые в канонических антителах, полученных из человека или других видов, но компенсируют эту потерю в гидрофильности рядом таких остатков, как заряженный остаток аргинина, серин, или незаряженных остатков, таких как глицин, в положении 103, который заменяет консервативный остаток триптофана, присутствующий в VH из двухцепочечных антител. По существу пептиды, принадлежащие к этим двум классам, показывают высокую степень гомологии аминокислотной последовательности к каркасным участкам VH человека, и названные пептиды могут быть прямо введены человеку, при этом не ожидается нежелательного иммунного ответа на них, и без обременения дальнейшей гуманизацией.

Любой из VHH, используемый согласно изобретению, может принадлежать к традиционному классу или к классам антител Camelidae, подобных человеческим. Названные антитела могут быть направлены против полноразмерных мишеней или их фрагментов. Эти полипептиды включают полную аминокислотную последовательность антител Camelidae, а именно Fc и VHH домены, химерные версии тяжелоцепочных антител Camelidae с Fc доменом человека.

Одно или более однодоменных антител полипептидной конструкции, которые направлены против мишени, могут иметь одинаковую последовательность. Альтернативно, они могут не все иметь одинаковую последовательность. В рамках изобретения находится то, что полипептидная конструкция включает однодоменные антитела против мишени, которые не все имеют одинаковую последовательность, но которые направлены против одной и той же мишени или ее фрагмента или одного и более ее антигенов.

Другим аспектом изобретения является то, что полипептидная конструкция включает два или более однодоменных антитела, где любые два однодоменных антитела направлены против разных мишеней, то есть против любого из перечисленных: vWF, A1 домена vWF, A1 домена активированного vWF, A3 домена vWF, gplb или коллагена.

Другим аспектом изобретения является биспецифичная полипептидная конструкция, включающая однодоменное антитело, направленное против A1 домена vWF, A1 домена активированного vWF, и другое однодоменное антитело, направленное против A3 домена vWF. Названная биспецифичная полипептидная конструкция ингибирует взаимодействие между vWF и коллагеном и взаимодействие между vWF и тромбоцитами.

В соответствии с аспектом настоящего изобретения полипептидная конструкция может содержать два или более однодоменных антител, которые были соединены. Однодоменные антитела могут иметь идентичные последовательности и могут быть направлены против одной и той же мишени или антигена. В зависимости от числа связанных VHH мультивалентное VHH может быть двухвалентным (2 VHH), трехвалентным (3 VHH), тетравалентным (4 VHH) или представлять собой молекулы с большим числом валентностей.

Настоящее изобретение также касается выявления того, что описанная здесь полипептидная конструкция, дополнительно включающая одно или более однодоменных антител, каждое из которых направлено против белков сыворотки субъекта, имеет неожиданно значительно большее время полужизни в кровотоке по сравнению со временем полужизни однодоменного антитела (или антител), направленного против мишени, когда оно не является частью названной конструкции. Кроме того, было обнаружено, что названные конструкции проявляют те же благоприятные свойства VHH, такие как способность стабильно сохранять интактность в мыши, высокая устойчивость к экстремальным значениям рН и температурным условиям и высокая аффинность к мишени.

Примеры таких конструкций представлены последовательностями SEQ ID NO: с 13 по 15, которые включают анти-vWF VHH и VHH, направленные против сывороточного альбумина мыши.

Следовательно, другое воплощение настоящего изобретения - полипептидная конструкция, имеющая аминокислотную последовательность, соответствующую последовательности, представленной любой из последовательностей SEQ ID NO: с 13 по 15.

Другие примеры таких конструкций представлены последовательностями SEQ ID NO: с 42 по 45, которые включают гуманизированные анти-vWF VHH и VHH, направленные против сывороточного альбумина мыши.

Следовательно, другое воплощение настоящего изобретения - полипептидная конструкция, имеющая аминокислотную последовательность, соответствующую последовательности, представленной любой из последовательностей SEQ ID NO: с 42 по 45.

Сывороточным белком может быть любой подходящий белок, обнаруженный в сыворотке субъекта, или его фрагмент. Согласно одному аспекту изобретения сывороточный белок - это сывороточный альбумин, иммуноглобулины сыворотки, тироксин-связывающий белок, трансферрин или фибриноген. В зависимости от предполагаемого использования в соответствии со временами полужизни для эффективного лечения и/или компартментализацией антигена-мишени VHH-партнер может быть направлен на взаимодействие с одним из названных выше белков сыворотки крови.

Примерами однодоменных антител, направленных против сывороточного альбумина, являются аминокислотные последовательности, представленные любой из аминокислотных последовательностей SEQ ID NO: с 16 по 19 и с 49 по 61.

Следовательно, другой аспект изобретения - полипептидная конструкция, дополнительно включающая одно или более направленных против сывороточных белков однодоменных антител, где последовательность направленного против сывороточных белков однодоменного антитела соответствует любой из представленных последовательностей SEQ ID NO: с 16 по 19 и с 49 по 61.

Такие конструкции способны циркулировать в сыворотке человека в течение нескольких дней, снижая частоту применения препарата, уменьшая неудобства для пациента и приводя к снижению стоимости лечения. Более того, аспектом изобретения является то, что время полужизни полипептидных конструкций, описанных здесь, может контролироваться посредством количества направленных против сывороточных белков однодоменных антител, присутствующих в конструкции. Контролируемое время полужизни является желательным в определенных обстоятельствах, например при применении определенных доз терапевтических полипептидных конструкций через определенные интервалы времени.

Другое воплощение настоящего изобретения - полипептидная конструкция, описанная выше, дополнительно включающая в себя тромболитический агент.

Названный тромболитический агент может быть нековалентно или ковалентно связан с однодоменным антителом через ковалентные или нековалентные взаимодействия. Такие ковалентные взаимодействия описаны ниже. Нековалентные способы взаимодействия включают белковое взаимодействие, такое, как в случае биотин/стрепавидин, или при образовании иммуноконъюгата.

Альтернативно, тромболитический агент может быть введен одновременно, отдельно или последовательно по отношению к полипептидной конструкции данного изобретения.

Другим аспектом изобретения является композиция, включающая, по меньшей мере, одну описанную выше полипептидную конструкцию и, по меньшей мере, один тромболитический агент для одновременного, раздельного или последовательного введения пациенту.

Одним аспектом изобретения является способ лечения аутоиммунного заболевания, включающий в себя введение индивидууму эффективного количества, по меньшей мере, одной полипептидной конструкции данного изобретения и, по меньшей мере, одного тромболитического агента одновременно, раздельно или последовательно.

Другой аспект изобретения - набор, содержащий, по меньшей мере, одну полипептидную конструкцию изобретения и, по меньшей мере, один тромболитический агент для одновременного, раздельного или последовательного применения на пациенте. Аспектом изобретения является то, что набор может быть использован согласно изобретению. Аспектом изобретения является то, что набор может быть использован для лечения заболеваний, которые здесь перечислены.

Одновременное введение полипептида и тромболитического агента означает то, что пациент применяет их в то же самое время. Например, в виде смеси или композиции, включающей названные компоненты. Некоторыми из примеров являются раствор для внутривенного введения, таблетка, жидкость, крем для местного применения, но, не ограничиваясь ими, где каждый препарат включает интересующие компоненты.

Раздельное введение полипептида и тромболитического агента означает то, что пациенту вводят их в одно и то же время или по существу в одно и то же время. Компоненты представлены в наборе как отдельные несмешанные препараты. Например, полипептид и тромболитический агент могут быть представлены в наборе в виде индивидуальных таблеток. Таблетки могут вводиться пациенту посредством глотания обеих таблеток в одно и то же время или глотанием одной таблетки сразу за другой.

Последовательное введение полипептида и тромболитического агента означает то, что пациент применяет их последовательно. Полипептид и тромболитический агент присутствуют в наборе как отдельные несмешанные препараты. При этом между приемами существует временной интервал. Например, один компонент может быть введен во временном интервале вплоть до 336, 312, 288, 264, 240, 216, 192, 168, 144, 120, 96, 72, 48, 24, 20, 16, 12, 8, 4, 2, 1 или 0,5 часов после другого компонента.

При последовательном введении один компонент может быть введен однократно или любое число раз и в различных дозах перед и/или после введения другого компонента. Последовательное введение может комбинироваться с одновременным или последовательным введением.

Медицинское использование полипептидной конструкции, описанное ниже, также относится к композиции, включающей полипептидную конструкцию, описанную здесь, и, по меньшей мере, один полипептидный тромболитический агент для одновременного, раздельного или последовательного введения пациенту, как описано выше.

Тромболитическими агентами согласно изобретению могут являться, например, стафилокиназа, тканевый активатор плазминогена, стрептокиназа, одноцепочечная стрептокиназа, урокиназа и комплекс ацил-плазминогена и стрептокиназы.

Однодоменные антитела могут быть соединены для образования любой из полипептидных конструкций, описанных здесь, включающей более чем одно однодоменное антитело, используя известные в настоящее время методы или любые методы, которые будут разработаны в будущем. Например, они могут быть слиты посредством химического перекрестного сшивания в результате реакции аминокислотных остатков с органическим модифицирующим агентом так, как описано в статье Blatter et al Biochemistry 24, 1517-1524; EP294703. Альтернативно, однодоменное антитело может быть слито генетически на уровне ДНК, то есть создается полинуклеотидная конструкция, которая кодирует полную полипептидную конструкцию, включающую одно или более направленных против мишени однодоменных антител и одно или более однодоменных антител, направленных против белков сыворотки крови. Метод создания двухвалентных или мультивалентных полипептидных конструкций VHH описан в патентной заявке РСТ WO 96/34103. Один из способов объединения множества однодоменных антител - генетический способ, при котором осуществляется объединение кодирующих последовательностей однодоменных антител либо непосредственно, либо через пептидный линкер. Например, C-концевая часть первого однодоменного антитела может быть связана с N-концом следующего однодоменного антитела. Этот способ связывания может быть использован далее для присоединения дополнительных однодоменных антител с целью конструирования и продукции трех-, четырех-, и т.д. функциональных конструкций.

Полипептидные конструкции, описанные здесь, могут быть созданы квалифицированными специалистами при использовании известных методов в данной области или любым способом, ставшим доступным в будущем, например, посредством иммунизации верблюда и получения из него гибридом или посредством клонирования библиотеки однодоменных антител с использованием известных методов молекулярной биологии и последующей селекции с использованием фагового дисплея.

Один аспект настоящего изобретения касается выявления того, что полипептиды, представленные последовательностями SEQ ID NO: с 1 по 7, которые приведены в Таблице 30, происходящие из VHH животных из семейства Camelidae, связываются с vWF и ингибируют его взаимодействие с коллагеном.

Следовательно, одно из воплощений настоящего изобретения - полипептидная конструкция, где аминокислотная последовательность, по меньшей мере, одного однодоменного антитела соответствует последовательности, представленной любой из последовательностей SEQ ID NO: с 1 по 7.

Другое воплощение настоящего изобретения - полипептидная конструкция, соответствующая аминокислотной последовательности, представленной любой из последовательностей SEQ ID NO: с 8 по 12. Названные последовательности соответствуют моноспецифичным полипептидным конструкциям (как, например, в SEQ ID NO:8 и 11) или гетероспецифичным полипептидным конструкциям, включающим VHH с разными последовательностями (как, например, в SEQ ID NO:9, 10 и 12), которые все направлены против vWF.

Другое воплощение настоящего изобретения - полипептидная конструкция, включающая одно или более однодоменных антител, направленных против vWF.

Агрегация тромбоцитов - очень сложный процесс и в ситуации in vivo взаимодействие vWF с коллагеном имеет место только при высоком срезывающем напряжении, которое наблюдается в малых артериях. Для оценки агрегации тромбоцитов, которое имеет место при высоком срезывающем напряжении, изобретатели провели эксперименты с использованием перфузии. В примере 16 представлены данные, полученные при высоком срезывающем напряжении при использовании последовательностей SEQ ID NO: с 1 по 12, которые специфически связываются с доменом A3 vWF. Этот эксперимент является типичным в плане взаимодействий, которые имеют место при разрушении стенки сосуда в малой артерии (например, при ангиопластике).

Удивительно то, что одновалентные VHH очень хорошо действуют в эксперименте по агрегации тромбоцитов при высоком связывающем напряжении: 50%-ное ингибирование агрегации тромбоцитов было получено в интервале концентраций 0,08-0,3 мкг/мл. Для сравнения, vWF-специфическое антитело IgG, ингибирующее взаимодействие с коллагеном, 82D6A3, ингибирует агрегацию тромбоцитов на 50% при концентрации примерно в двадцать раз более высокой (Vanhoorelbeke K. et al., Journal of Biological Chemistry, 2003, 278: 37815-37821). Полученные результаты оказались неожиданными, в связи с тем что показатели IC50 для одновалентных VHH при твердофазном иммуноферментном анализе (ELISA) до 7 раз хуже, чем показатель IC50 для IgG 82D6A3.

Это четко показывает, что большой размер названных антител затрудняет их взаимодействие с макромолекулами, которые являются инициирующими агрегацию или участвуют в процессе агрегации, такими как молекулы, вовлеченные в агрегацию, опосредованную тромбоцитами. vWF образует мультимеры, объединяющие до 60 мономеров (размеры образующихся мультимеров - до 20 миллионов дальтон). Действительно, было показано, что не все домены A3 доступны для 82D6A3 (Dongmei WU, Blood, 2002, 99, 3623-3628). Более того, большой размер канонических антител будет препятствовать их проникновению в ткань, например, в процессе агрегации, опосредованной тромбоцитами, в месте повреждения стенке кровеносного сосуда.

Наночастицы имеют уникальную структуру, которая состоит из одного вариабельного домена. Молекулы VHH, происходящие из антител животных из семейства Camelidae, входят в разряд самых маленьких из известных интактных антиген-связывающих доменов (примерно 15 килодальтон, или в 10 раз меньше, чем канонические IgG) и, следовательно, удобны для доставки в плотные ткани и для доступа в ограниченное пространство между макромолекулами, участвующими в, или инициирующими процесс агрегации, опосредованной тромбоцитами.

Насколько нам известно, эти эксперименты впервые показали, что маленький размер наночастиц является более выгодным по сравнению с большим размером интактного антитела для ингибирования взаимодействий между такими большими макромолекулами.

Несмотря на маленький размер наночастиц и связанное с этим преимущество в плане проникновения в ткани остается удивительным тот факт, что такая маленькая молекула может ингибировать взаимодействия между большими полимерами, такими как vWF (включающий до 60 мономеров) и коллаген, и с такой высокой эффективностью. Было описано, что только большие мультимерные формы vWF являются гемостатически активными (Furlan, M., 1996, Ann. Hematol. 72: 341-348). Связывание мультимерного vWF с коллагеном осуществляется со сродством, примерно в 100 раз более высоким, чем связывание мономерных фрагментов vWF.

Результаты экспериментов, проводимых в условиях высокого срезывающего напряжения, указывают на то, что пациенту может быть введена более низкая доза. Следовательно, можно ожидать меньшего количества побочных эффектов (таких, как возникновение проблем, связанных с иммуногенностью или кровотечением).

В рамках настоящего изобретения обнаружено, что полипептиды, соответствующие аминокислотной последовательности, представленной любой из последовательностей SEQ ID NO: с 23 по 31 из однодоменных антител ламы, связываются с доменом А1 vWF.

Следовательно, другое воплощение настоящего изобретения - полипептидная конструкция, включающая одно или более однодоменных антител, где, по крайней мере, одно однодоменное антитело соответствует аминокислотной последовательности, представленной любой из последовательностей SEQ ID NO: с 23 по 31.

Другое воплощение настоящего изобретения - полипептидная конструкция, соответствующая аминокислотной последовательности, представленной любой из последовательностей SEQ ID NO: с 32 по 34. Названные последовательности соответствуют двухвалентным полипептидным конструкциям, включающим пептиды VHH с одинаковыми последовательностями, которые оба направлены против домена А1 vWF.

Авторы изобретения провели эксперимент с использованием перфузии в проточной камере для изучения эффекта полипептидных конструкций, включающих аминокислотные последовательности, представленные последовательностями SEQ ID NO: с 23 по 31, на агрегацию тромбоцитов при высоком срезывающем напряжении. Пример 25 обеспечивает данные, полученные при высоком срезывающем напряжении при использовании последовательностей SEQ ID NO:с 23 по 31, которые специфически связываются с доменом А1 vWF.

В рамках настоящего изобретения также обнаружено, что полипептиды, соответствующие аминокислотной последовательности, представленной любой из последовательностей SEQ ID NO: с 62 по 65 из однодоменных антител ламы, избирательно связываются с А1 доменом активной конформации vWF (такой, которую он приобретает после связывания с коллагеном) предпочтительнее, чем со свободно циркулирующим неактивированным vWF. Это приводит к тому, что антитромботические агенты являются более безопасными и более эффективными. Использованное здесь понятие «избирательное связывание» по отношению к А1 домену vWF означает, что антитела ламы имеют, по крайней мере, в десять, а предпочтительно и в сто раз большую аффинность к активной конформации vWF по сравнению со сродством к неактивированной форме.

Поэтому другое воплощение настоящего изобретения - полипептидная конструкция, включающая одно или более однодоменных антител, где аминокислотная последовательность, по меньшей мере, одного однодоменного антитела соответствует последовательности, представленной любой из последовательностей SEQ ID NO: с 62 по 65.

В другом воплощении настоящего изобретения полипептидная конструкция включает одно или более однодоменных антител, направленных против одной и той же мишени, и, кроме того, включает одно или более однодоменных антител, направленных против той же мишени, но против другого эпитопа в том же домене.

Например, аминокислотные последовательности, представленные последовательностями SEQ ID NO:9, 10 и 12, являются гетероспецифичными полипептидными конструкциями, включающими в себя пептиды VHH, направленные против разных эпитопов в домене A3 vWF. Поэтому другим воплощением настоящего изобретения является полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO:9, 10 и 12.

Другим воплощением настоящего изобретения является полипептидная конструкция, где число однодоменных антител, направленных против одной и той же мишени, равно двум и более.

Последовательности, представленные последовательностями SEQ ID NO: с 8 по 11, представляют собой полипептидные конструкции, включающие пептиды VHH, направленные против одних и тех же эпитопов в A3 домене vWF, где оба VHH имеют одинаковые последовательности. Поэтому другим воплощением настоящего изобретения является полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO:8 и 11.

В соответствии с другим воплощением настоящего изобретения полипептидная конструкция включает в себя одно или более однодоменных антител, направленных против одного домена одной и той же мишени, и одно или более однодоменных антител, направленных против той же самой мишени, но против ее другого домена. Примерами разных доменов могут являться А1 и A3 домены vWF.

В другом примере последовательности, представленные последовательностями SEQ ID NO: с 20 по 22, являются гетероспецифичными полипептидными конструкциями, включающими пептиды VHH, направленные против эпитопов, находящихся на разных доменах vWF, то есть на А1 и A3 vWF. Следовательно, другим воплощением настоящего изобретения является полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO: с 20 по 22.

Аспектом изобретения является то, что, по меньшей мере, один пептид VHH в гетероспецифической полипептидной конструкции, направленный против домена А1, узнает активную конформацию vWF. Такое VHH соответствует последовательности, представленной любой из последовательностей SEQ ID NO: с 62 по 65.

Такие полипептидные конструкции могут проявлять гораздо лучшее анти-тромботические действие по сравнению с мономерными VHH. Для изучения влияния этих полипептидных конструкций на агрегацию тромбоцитов при высоком срезывающем напряжении были проведены эксперименты с использованием перфузии в проточной камере. Пример 30 демонстрирует при высоком срезывающем напряжении при использовании гетероспецифичной полипептидной конструкции, включающей анти-vWF-А1 VHH и анти-vWF-A3 VHH.

В рамках настоящего изобретения также обнаружено, что полипептиды, представленные аминокислотными последовательностями SEQ ID NO: с 35 по 37 из однодоменных антител ламы, связываются с коллагеном I типа и/или III типа.

Поэтому другим воплощением настоящего изобретения является полипептидная конструкция, где, по меньшей мере, одно однодоменное антитело соответствует последовательности, представленной любой из последовательностей SEQ ID NO: с 35 по 37.

В другом воплощении настоящего изобретения полипептидная конструкция включает в себя одно или более однодоменных антител, направленных против коллагена I типа и/или III типа, и одно или более однодоменных антител, направленных против одной и той же мишени, но к другому эпитопу в том же самом домене. Последовательности, представленные последовательностями 3Р1-31_3Р2-31 и 3L-41_3P2-31, являются гетероспецифичными полипептидными конструкциями, включающими VHH, направленные против разных эпитопов в коллагене I типа. Следовательно, другое воплощение настоящего изобретения - полипептидная конструкция, соответствующая последовательности, представленной любой из последовательностей SEQ ID NO:46 и 47.

Другой аспект изобретения - полипептидная конструкция, включающая одно или более однодоменных антител, направленных против гликопротеина 1b тромбоцитов.

Были получены мышиные моноклональные антитела против vWF человека, AjvW-2 (IgG), которые ингибируют взаимодействие между гликопротеином 1b (gp1b) тромбоцитов и фактором фон Виллебранда (vWF) при индуцированной ристоцетином или ботроцетином агрегации тромбоцитов человека (номер РСТ заявки WO 00/10601). AjvW-2 Fab ингибирует повторные тромбозы коронарных артерий без увеличения времени кровотечения у собак (Kageyama S, et al., Thromb Res., 2001 Mar 1; 101(5):395-404) и предотвращает отложение тромбов и формирование неоинтимы кровеносных сосудов после повреждения баллонным катетером у морской свинки (Kageyama S, et al., Arterioscler Thromb VascBiol. 2000 Oct; 20(10):2303-2308).

Антитело 6 В4 является моноклональным антителом (МоАb), полученным против очищенного gp1b человека (номер РСТ заявки WO 01/10911 А2). При введении бабуинам нативные IgG и их F(ab')2- фрагменты вызывали почти немедленную тромбоцитопению за счет двухвалентности F(ab')2, которые опосредуют сшивание тромбоцитов или взаимодействие Fc:Fc рецептора, которое опосредует активацию агрегации тромбоцитов. (Cauwenberghs N et al., Arteriosclerosis, Thrombosis and Vascular Biology, 2000, 20:1347, a также, например, смотри Cadroy Y et al., Blood, 1994, 83: 3218-3224, Becker BH et al., Blood, 1989, 74: 690-694, и реферат Ravanat С. et al., Thromb. Haemost. 1999, 82:528а). Налипание тромбоцитов на богатый коллагеном перикард крупного рогатого скота ингибировалось при ведении бабуинам Fab-фрагментов до начала тромбоза. Однако когда Fab-фрагменты вводились уже после того, как тромб сформировался, дальнейшего ингибирования тромбоза не наблюдалось.

Было показано, что сродство Fab-фрагментов к рецепторам тромбоцитов gp1b понижалось в 10 раз по сравнению с нативными IgG или с F(ab')2 - фрагментами (Kd=49,2 нМ, 4,7 нМ и 6,4 нМ соответственно). Показатель IC50 для индуцированной ристоцетином агрегации тромбоцитов также был почти в 10 раз хуже для Fab-фрагментов по сравнению с IgG или F(ab')2 (IC50 - 40 нМ, 4,5 нМ, 7,7 нМ соответственно).

Можно ожидать, что нежелательная тромбоцитопения, вызываемая опосредуемой Fc:Fc рецептором активацией агрегации тромбоцитов и/или F(ab')2-опосредованным сшиванием тромбоцитов, которая наблюдалось при терапевтическом использовании нативных IgG или F(ab')2-фрагментов in vivo, будет избегаться при использовании VHH, так как VHH не содержит Fc и не является двухвалентным. Не будет наблюдаться потери сродства и активности, как это наблюдали в случае с Fab-фрагментом 6В4, так как наночастицы являются уже однодоменными молекулами.

Гуманизированные антитела

Однодоменные антитела, существующие в природе, были обнаружены у ламы, одногорбого верблюда и верблюда, что позволило выявить новый класс терапевтических молекул, которые сочетают преимущества моноклональных антител, например специфичность и низкую токсичность, с преимуществами маленьких молекул, такими как способность проникать в ткань и стабильность. К сожалению, разработка подходящих лекарственных препаратов на основе этих белков имеет недостаток, состоящий в том, что они происходят из животных из семейства Camelidae, а не из человека. Белки, не являющиеся человеческими, содержат аминокислотные остатки, которые могут являться иммуногенными, когда они вводятся пациенту. Хотя исследования показали, что происходящие из животных, принадлежащих к семейству Camelidae, VHH не являются иммуногенными при введении мышам, замена аминокислотных остатков Camelidae на аминокислотные остатки человека является предпочтительной. Такие Гуманизированные полипептиды могут быть в значительной степени неиммуногенными для человека, но сохранять аффинность и активность полипептидов дикого типа.

Гуманизация означает введение таких мутаций, в результате которых иммуногенность при введении пациенту-человеку является минимальной или несуществующей. Гуманизация полипептидов согласно настоящему изобретению включает этап замены одной или большего количества аминокислот Camelidae на их «человеческие» аналоги, обнаруженные в консенсусных последовательностях человека, не приводящей к потере полипептидом его характерных свойств, то есть гуманизация полипептида незначительно влияет на способность полученного полипептида связывать антиген.

Изобретатели определили аминокислотные остатки вариабельного домена антитела (VHH), модификация которых не приводит к уменьшению нативного сродства домена к антигену при снижении его иммуногенности в отношении гетерологических видов; применения пептидов VHH, имеющих модификации определенных остатков, которые полезны для использования у гетерологических видов, и VHH, модифицированные таким образом. Более конкретно изобретение касается получения модифицированных VHH, которые модифицированы для введения человеку, самих полученных VHH и применение таких «гуманизированных» VHH для лечения заболеваний человека.

Изобретатели также обнаружили, что для гуманизации полипептидов VHH необходимы введение и мутагенез только ограниченного числа аминокислот в одной полипептидной цепи, при этом не происходит драматической потери связывающей и/или ингибирующей активности. Другая ситуация в случае гуманизации scFv, Fab, (Fab)2 и IgG, при которой необходимо введение аминокислотных замен в две цепи, легкую и тяжелую цель, и сохранение сборки обеих цепей.

Технология гуманизации может быть осуществлена посредством метода, включающего замену любого из следующих остатков, либо одного, либо в комбинации: остатки в FR1 в положениях 1, 5, 28 и 30, маркерная аминокислота в положении 37, 44, 45 и 47 в FR2, остатки в FR3 - в положениях 74, 75, 76, 83, 84, 93 и 94 и остатки в FR4 - в положениях 103, 104, 108 и 111; нумерация остатков приведена согласно нумерации Kabat. Примеры таких гуманизированных последовательностей приведены в Таблице 30, последовательности SEQ ID NO:2 и с 38 по 41.

Полипептиды, представленные в примерах 63 и 64, имеют высокую степень гомологии с человеческим VH DP-47 зародышевой линии. Для дополнительной гуманизации было необходимо введение и мутагенез ограниченного количества аминокислот в одной полипептидной цепи. Данная гуманизация отличается от гуманизации scFv, Fab, (Fab)2 и IgG, для которой необходимо введение аминокислотных замен в две цепи, легкую и тяжелую цепь, и сохранение сборки обеих цепей.

Полипептиды содержат подобные человеческим аминокислотные остатки в FR2. Для гуманизации необходимо было осуществить мутагенез остатков в FR1 в положениях 1 и 5, мутации были введены при помощи праймера, использованного для репертуарного клонирования, и не встречаются в природе в последовательности ламы. Мутагенез этих остатков не приводил к потере связывающей и/или ингибиторной активности. Гуманизация FR1 также требовала проведения мутагенеза аминокислот в положениях 28. и 30. Мутагенез этих остатков также не приводил к потере связывающей и/или ингибиторной активности.

Для гуманизации также было необходимо осуществить мутагенез остатков в FR3 в положениях 74, 75, 76, 83, 84, 93, 94. Мутагенез этих остатков не приводил к потере связывающей и/или ингибиторной активности.

Для гуманизации также было необходимо осуществить мутагенез остатков в FR4 в положениях 104, 108 и 111. Мутагенез Q108L приводил к снижению продукции пептида в клетках бактерии Escherichia coli. Аминокислота в положение 108 экспонирована в раствор в VHH Camelidae, в то время как в антителах человека это положение спрятано в области контакта VH и VL (Spinelli, 1996; Nieba, 1997). В изолированных доменах VH аминокислота в положении 108 экспонирована в раствор. Введение неполярного гидрофобного лейцина вместо полярного незаряженного глицина может радикально влиять на присущую данной молекуле способность к сворачиванию/стабильность.

Одним из воплощений настоящего изобретения является способ гуманизации VHH, включающий следующие стадии:

(а) замена любого из следующих аминокислотных остатков, либо одного, либо в комбинации:

в положениях 1, 5, 28 и 30 FR1,

маркерная аминокислота в положении 37, 44, 45 и 47 FR2,

остатки в положениях 74, 75, 76, 83, 84, 93 и 94 FR3,

в положениях 103, 104, 108 и 111 FR4;

нумерация остатков приведена согласно нумерации Kabat.

Примеры таких гуманизированных последовательностей приведены в Таблице 30, последовательности SEQ ID NO:2, и с 38 по 41.

Применение антител, полученных из таких источников, как мышь, овца, коза, кролик, и из других видов животных, и гуманизированных производных таких антител в качестве лекарственного средства, применяемого в условиях, при которых требуется модуляция опосредованной тромбоцитами агрегации, является проблематичным по нескольким причинам. Традиционные антитела не стабильны при комнатной температуре и требуют охлаждения при выделении и хранении, что в свою очередь приводит к необходимости использования лабораторного оборудования, хранилищ и аппаратов средств транспортировки с возможностью охлаждения, что увеличивает затраты времени и стоимость. В развивающихся странах заморозка нередко просто не осуществима. Выход при экспрессии таких Fab молекул крайне низок, и метод их наработки является очень трудоемким. Более того, наработка небольших количеств таких антител является дорогой, поскольку системы клеток млекопитающих, необходимые для экспрессии интактных и активных антител, требуют значительных затрат времени и дорогостоящего лабораторного оборудования при крайне малом выходе. Кроме того, эффективность связывания традиционных антител зависит от рН, поэтому их применение за пределами физиологических значений рН, например для остановки желудочных кровотечений или в гастрохирургии, невозможно. Кроме того, традиционные антитела нестабильны при высоких или низких значениях рН и поэтому непригодны для перорального применения. В то же время было показано, что антитела мозоленогих устойчивы в жестких условиях, таких как экстремальные значения рН, денатурирующие агенты и высокие температуры (Ewert S et al., Biochemistry 2002 Mar 19; 41(11):3628-36), что делает их пригодными для перорального применения. Более того, активность связывания традиционных антител зависит от температуры, что делает неудобным их использование в анализах или наборах, когда требуются значительные отклонения от физиологических температур (например, 37±20°C).

Полипептидные конструкции, представленные последовательностями SEQ ID NO: с 1 по 47 и с 49 по 65, и их производные не только обладают всеми положительными свойствами традиционных антител, такими как малая токсичность и высокая селективность, но также обладают дополнительными свойствами. Они лучше растворимы, то есть могут храниться и/или применяться в более высоких концентрациях, нежели традиционные антитела. Они стабильны при комнатной температуре, то есть могут быть выделены, храниться и/или подвергаться транспортировке без применения охлаждающего оборудования, что приводит к уменьшению финансовых затрат, времени и ущерба окружающей среде (описано в примере 61). Другое положительное свойство, отличающее их от традиционных антител - это короткое время полужизни в кровяном русле, которое может быть изменено согласно данному изобретению, посредством, например, связывания с альбумином биспецифичной наночастицы, имеющей одну специфичность против альбумина и вторую - против мишени, связывания с Fc, связывания с VHH (двухвалентные VHHs) или путем модификации ПЭГ (описано в примерах с 41 по 54). Короткое и контролируемое время полужизни необходимо при хирургических процедурах, например при таких, когда требуется ингибирование опосредованной тромбоцитами агрегации на ограниченный промежуток времени. Кроме того, при возникновении кровотечений или иных осложнений доза может быть немедленно снижена. Полипептиды, описанные в настоящем изобретении, сохраняют активность связывания при значениях рН и температуры, находящихся за пределами физиологических диапазонов, таким образом, они могут применяться в тех ситуациях, когда модулирование опосредованной тромбоцитами агрегации необходимо в условиях экстремальных значений рН и температуры, как, например, при хирургических операциях на желудке, контроле желудочных кровотечений, в способах анализа, проводящихся при комнатной температуре, и т.д. Полипептиды, описанные в настоящем изобретении, имеют также более высокую стабильность в условиях экстремальных значений рН и поэтому могут применяться перорально. Полипептиды, описанные в настоящем изобретении, могут быть получены экономически рентабельным способом - ферментативным путем в подходящих организмах-хозяевах, таких как бактерии Escherichia coli и дрожжи, в отличие от традиционных антител, которые требуют дорогостоящего оснащения для поддержания культур клеток млекопитающих, и уровень экспрессии полипептидов в таких организмах может быть достаточно высоким. Например, выход полипептидов, описанных в настоящем изобретении, составляет от 1 до 10 мг/мл (Е.coli) и до 1 г/л (дрожжи). Полипептиды, описанные в настоящем изобретении, также проявляют высокую аффинность в отношении широкого спектра различных типов антигенов и способность связывать эпитопы, не узнаваемые традиционными антителами; например, они образуют длинные основанные на CDR петлеобразные структуры, способные проникать в углубления и ингибировать функцию ферментов. Более того, поскольку связывание обычно осуществляется только через CDR3 петлю, ожидается, что пептиды, происходящие из CDR3, могут быть применены в терапевтических целях (Desmyter et al., J Biol Chem, 2001, 276: 26285-90). Выделение такого пептида описано в примере 65. Полипептиды настоящего изобретения полностью сохраняют связывающие способности при слиянии с другим белком или токсином. Более того, можно ожидать, что в случае использования VHH не будет наблюдаться нежелательная тромбоцитопения, вызванная опосредованной Fc:Fc рецептором активацией агрегации тромбоцитов и/или F(ab')(2)-опосредованным перекрестным сшиванием тромбоцитов, которое наблюдается при использовании интактных IgG или F(ab')(2) в терапевтических целях in vivo (см. Cauwenberghs N. et al., Arteriosclerosis, Thrombosis and Vascular biology, 2000, 20:1347), так как VHH не содержат Fc и не двухвалентны. Таким образом, полипептиды, представленные последовательностями SEQ ID NO: с 1 по 15, с 20 по 47, с 62 по 65, их гомологи или их функциональные части обеспечивают значительную экономию времени и средств при лечении и диагностике заболеваний, связанных с опосредованной тромбоцитами агрегацией, и пациент, нуждающийся в указанных полипептидах, столкнется с меньшим числом проблем, чем при использовании традиционных агентов.

Опосредованная тромбоцитами агрегация - это процесс, в ходе которого коллаген, связанный с vWF, прикрепляется к тромбоцитам и/или к рецепторам тромбоцитов (в этих взаимодействиях участвуют gp1a/11a, gp1b, или коллагеновые рецепторы), что в конечном счете приводит к активации тромбоцитов. Активация тромбоцитов приводит к связыванию фибриногена и в конечном итоге к агрегации тромбоцитов. В рамках данного изобретения находится обеспечение полипептидов, способных модулировать процессы, которые включает в себя опосредованная тромбоцитами агрегация, такие как связывание vWF с коллагеном, связывание vWF с рецептором тромбоцитов, адгезия коллагена к рецептору тромбоцитов, активация тромбоцитов, связывание фибриногена и/или агрегация тромбоцитов. Названные полипептиды происходят из антител представителей семейства Camelidae, направленных против vWF, А1 домена vWF, A1 домена активированного vWF или A3 домена, gp1b или коллагена и обладают теми же преимуществами, что и описанные ранее полипептиды, представленные последовательностями SEQ ID NO: с 1 по 15, с 20 по 47, с 62 по 65.

Согласно аспекту данного изобретения полипептидная конструкция может быть гомологична последовательности полноразмерной полипептидной конструкции. Согласно другому аспекту данного изобретения полипептидная конструкция может являться функциональной частью полноразмерной полипептидной конструкции. Согласно другому аспекту данного изобретения полипептидная конструкция может быть гомологична последовательности полноразмерной полипептидной конструкции. Согласно другому аспекту данного изобретения полипептидная конструкция может являться функциональной частью гомологичной последовательности полноразмерной полипептидной конструкции. Согласно другому аспекту данного изобретения полипептидная конструкция может включать в себя последовательность полипептидной конструкции.

Согласно одному из аспектов данного изобретения однодоменное антитело, использованное для создания полипептидной конструкции, может быть полноразмерным однодоменным антителом (например, VHH) или может быть представлено гомологичной ему последовательностью. Согласно другому аспекту данного изобретения однодоменное антитело, использованное для создания полипептидной конструкции, может быть функциональной частью полноразмерного однодоменного антитела. Согласно другому аспекту данного изобретения однодоменное антитело, использованное для создания полипептидной конструкции, может иметь последовательность, гомологичную последовательности полноразмерного однодоменного антитела. Согласно другому аспекту данного изобретения однодоменное антитело, использованное для создания полипептидной конструкции, может являться функциональной частью последовательности, гомологичной последовательности полноразмерного однодоменного антитела.

Другой аспект настоящего изобретения - это однодоменные антитела, соответствующие любой из последовательностей SEQ ID NO: с 1 по 7, с 16 по 19, с 23 по 31, с 35 по 41, и с 49 по 65, гомологичной им последовательности и/или функциональной части.

Согласно другому аспекту данного изобретения полипептидная конструкция может быть последовательностью, гомологичной родительской последовательности. Согласно другому аспекту данного изобретения полипептидная конструкция может являться функциональной частью родительской последовательности. Согласно другому аспекту данного изобретения полипептидная конструкция может являться функциональной частью последовательности, гомологичной родительской последовательности.

Как используется в контексте данного описания, гомологичные последовательности могут содержать вставки, делеции или замены одной или более аминокислот, не изменяющие существенно функциональные характеристики полипептида. Число вставок, делеции или замен аминокислот предпочтительно до 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 или 70 аминокислот.

Гомологичные последовательности согласно настоящему изобретению включают полипептиды, удлиненные за счет добавления аминокислот с целью формирования тяжелой цепи антитела человека или однодоменного тяжелоцепочечного антитела человека, где это удлинение существенно не изменяет функциональные характеристики немодифицированного полипептида.

Гомологичные последовательности настоящего изобретения могут включать полипептиды, представленные любой из последовательностей SEQ ID NO: с 1 по 47 и с 49 по 65, которые были гуманизированы (как описано в примерах 63 и 64).

Гомологичные последовательности настоящего изобретения могут включать последовательности, соответствующие любой из последовательностей SEQ ID NO: с 1 по 47 и с 49 по 65, которые существуют в других видах животных, входящих в семейство Camelidae, таких, например, как верблюд, лама, одногорбый верблюд, альпака, гуанако и т.д.

Когда гомологичная последовательность демонстрирует идентичность последовательности, это значит, что данная последовательность имеет высокую идентичность последовательности (более чем 70%, 75%, 80%, 85%, 90%, 95% или 98% идентичности последовательности) с родительской последовательностью и предпочтительно характеризуется свойствами, аналогичными свойствам родительской последовательности, а именно аффинностью, причем вышеуказанная идентичность рассчитана с помощью известных методов.

Альтернативно, гомологичной последовательностью может быть также аминокислотная последовательность, полученная путем разрешенных замен по любому числу позиций родительской последовательности в соответствии с приведенной ниже формулой:

Ser замененный на Ser, Thr, Gly, и Asn;

Arg замененный на любой из Arg, His, Gln, Lys, и Glu;

Leu замененный на любой из Leu, Ile, Phe, Tyr, Met, и Val;

Pro замененный на любой из Pro, Gly, Ala, и Thr;

Thr замененный на любой из Thr, Pro, Ser, Ala, Gly, His, и Gln;

Ala замененный на любой из Ala, Gly, Thr, и Pro;

Val замененный на любой из Val, Met, Tyr, Phe, Ile, и Leu;

Gly замененный на любой из Gly, Ala, Thr, Pro, и Ser;

Ile замененный на любой из Ile, Met, Tyr, Phe, Val, и Leu;

Phe замененный на любой из Phe, Trp, Met, Tyr, Ile, Val, и Leu;

Tyr замененный на любой из Tyr, Trp, Met, Phe, Ile, Val, и Leu;

His замененный на любой из His, Glu, Lys, Gln, Thr, и Arg;

Gln замененный на любой из Gln, Glu, Lys, Asn, His, Thr, и Arg;

Asn замененный на любой из Asn, Glu, Asp, Gln и Ser;

Lys замененный на любой из Lys, Glu, Gln, His и Arg;

Asp замененный на любой из Asp, Glu, и Asn;

Glu замененный на любой из Glu, Asp, Lys, Asn, Gln, His, и Arg;

Met замененный на любой из Met, Phe, Ile, Val, Leu, и Tyr.

Гомологичные последовательности согласно настоящему изобретению - это нуклеотидные последовательности длиной более чем 50, 100, 200, 300, 400, 500, 600, 800 или 1000 нуклеотидов, способные к гибридизации с обратным комплементом нуклеотидной последовательности, способной кодировать полипептид, при строгих условиях гибридизации (таких, которые описаны Sambrook et al., Molecular Cloning, Laboratory Manual, Cold Spring Harbor Laboratory Press, New York).

Используемое здесь понятие «функциональная часть» относится к однодоменному антителу достаточной длины, такой, которая обеспечивает интересующее взаимодействие с аффинностью 1×10-6 М или лучшей.

Альтернативно, функциональная часть однодоменного антитела настоящего изобретения включает частичную делецию полной аминокислотной последовательности и, тем не менее, еще сохраняет участок (или участки) связывания и белковый домен (или домены), необходимые для связывания мишени и взаимодействия с мишенью.

Альтернативно, функциональной частью любой из последовательностей SEQ ID NO: с 1 по 7 является полипептид, который имеет частичную делецию полной аминокислотной последовательности и который, тем не менее, еще сохраняет участок (или участки) связывания и белковый домен (или домены), необходимые для ингибирования связывания vWF с коллагеном.

Альтернативно, функциональной частью любой из последовательностей SEQ ID NO: с 23 по 31 и с 62 по 65 является полипептид, который имеет частичную делецию полной аминокислотной последовательности и который, тем не менее, еще сохраняет участок (или участки) связывания и белковый домен (или домены), необходимые для связывания и взаимодействия с A1 доменом vWF.

Альтернативно, функциональной частью любой из последовательностей SEQ ID NO: с 35 по 37 является полипептид, который имеет частичную делецию полной аминокислотной последовательности, но все еще сохраняет участок (или участки) связывания и белковый домен (или домены), необходимые для связывания и взаимодействия с коллагеном.

Альтернативно, функциональная часть имеет частичную делецию полной аминокислотной последовательности полипептида, но все еще сохраняет участок (или участки) связывания и белковый домен (или домены), необходимые для связывания и взаимодействия с антигеном, против которого он был получен. Она включает, но не ограничивается доменами VHH.

Используемое здесь понятие «функциональная часть» по отношению к полипептидной последовательности относится к менее чем 100% последовательности (например, 99%, 90%, 80%, 70%, 60%, 50% и так далее), но включающей 5 или более аминокислот.

«Часть» по отношению к нуклеотидной последовательности, кодирующей полипептидную последовательность, означает последовательность, включающую менее чем 100% последовательности (например, 99%, 90%, 80%, 70%, 60%, 50% и так далее), но содержащую 15 или более нуклеотидов.

Аспектом настоящего изобретения является то, что при введении полипептидной конструкции согласно изобретению может отпадать необходимость инъекции. Традиционные лекарственные препараты на основе антител обладают значительным потенциалом как лекарственные средства, поскольку они проявляют исключительную специфичность к их мишеням и свойственную им низкую токсичность, однако они имеют один важный недостаток: они относительно нестабильны и чувствительны к разрушению протеазами. Из этого следует, что традиционные лекарственные препараты на основе антител не могут применяться орально, сублингвально, местно, назально, вагинально, ректально или в виде ингаляции, поскольку они не обладают устойчивостью к низким значениям рН в этих местах, действию протеаз в этих местах и в крови и/или вследствие их большого размера. Они должны быть введены посредством инъекции (внутривенно, подкожно и так далее) для преодоления некоторых из этих проблем. Для введения препарата посредством инъекции необходим специалист, умеющий правильно и безопасно пользоваться шприцем для лекарственных средств, использующимся для подкожных инъекций, или иглой. Кроме того, требуется стерильное оборудование, жидкая композиция лекарственного полипептида, упаковка в ампулы названного полипептида в стерильной и стабильной форме и, что касается пациента, наличия удобного места для введения иглы. Более того, пациент обычно испытывает физический и психологический стресс перед получением и при получении инъекции.

Аспект настоящего изобретения преодолевает эти проблемы предшествующего уровня техники посредством обеспечения полипептидных конструкций настоящего изобретения. Названные конструкции имеют достаточно маленький размер, устойчивы и стабильны для того, чтобы применяться орально, сублингвально, местно, назально, вагинально, ректально или в виде ингаляции по существу без потери активности. Полипептидные конструкции настоящего изобретения, не требующие использования инъекций, не только сберегают денежные средства и время, но также являются более удобными и комфортными для пациента.

Одно воплощение настоящего изобретения - полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, которое контролирует опосредованную тромбоцитами агрегацию и которое способно проходить по желудочно-кишечному тракту без инактивации вещества.

Как известно специалистам в данной области, если доступна названная полипептидная конструкция, для обеспечения высвобождения максимального количества полипептида в нужном месте (в желудке, в толстой кишке и так далее) может быть применена определенная технология приготовления лекарственного средства. Этот метод доставки является важным для лечения, профилактики и/или облегчения симптомов заболеваний, мишени которых локализованы в пищеварительной системе.

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое способно проходить по желудочно-кишечному тракту без инактивации вещества, путем перорального введения пациенту описанной здесь полипептидной конструкции.

Другим воплощением настоящего изобретения является применение описанной здесь полипептидной конструкции для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое способно проходить по желудочно-кишечному тракту без инактивации.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в пищеварительную систему без инактивации названного вещества, посредством орального введения пациенту описанной здесь полипептидной конструкции.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в кровоток пациента без инактивации вещества посредством перорального введения пациенту описанной здесь полипептидной конструкции.

Другое воплощение настоящего изобретения - описанная здесь полипептидная конструкция для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, контролирующего опосредованную тромбоцитами агрегацию, доставляемая в вагинальный и/или ректальный тракт.

В одном из неограничивающих примеров композиция по изобретению содержит описанную здесь полипептидную конструкцию в форме геля, крема, суппозитория, пленки или в форме губки или вагинального кольца, которое медленно высвобождает активный компонент с течением времени (такие композиции описаны в ЕР 707473, ЕР 684814, US 5629001).

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в вагинальный и/или ректальный тракт, посредством вагинального и/или ректального введения пациенту описанной здесь полипептидной конструкции.

Другим воплощением настоящего изобретения является применение описанной здесь полипептидной конструкции для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в вагинальный и/или ректальный тракт.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в вагинальный и/или ректальный тракт без инактивации названного вещества, посредством введения в вагинальный и/или ректальный тракт пациента полипептидной конструкции, которая описана здесь.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в кровоток пациента без инактивации названного вещества, посредством введения в вагинальный и/или ректальный тракт пациента описанной здесь полипептидной конструкции.

Другое воплощение настоящего изобретения - полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в нос, верхние дыхательные пути и/или легкие.

В одном из неограничивающих примеров композиция изобретения включает полипептидную конструкцию, описанную здесь, в форме назального спрея (например, аэрозоля) или ингалятора. Поскольку полипептидная конструкция имеет маленький размер, она может достигать своей мишени намного более эффективно, чем терапевтические молекулы IgG.

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в верхние дыхательные пути и легкие, посредством введения пациенту полипептидной конструкции, которая описана здесь, путем ингаляции через рот или нос.

Другим воплощением настоящего изобретения является применение описанной здесь полипептидной конструкции для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в нос, верхние дыхательные пути и/или легкие, без инактивации названного полипептида.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в нос, верхние дыхательные пути и легкие без инактивации, посредством введения в нос, верхние дыхательные пути и/или легкие пациента полипептидной конструкции, описанной здесь.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в кровоток пациента без инактивации посредством введения в нос, верхние дыхательные пути и/или легкие пациента полипептидной конструкции, описанной здесь.

Одним воплощением настоящего изобретения является полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в слизистую кишечника, где названное заболевание увеличивает проницаемость слизистой кишечника. Благодаря маленькому размеру полипептидная конструкция, описанная здесь, может проходить через слизистую кишечника и более эффективно попадать в кровоток пациентов, страдающих от заболеваний, которые вызывают увеличение проницаемости слизистой кишечника.

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в слизистую кишечника, где названное заболевание увеличивает проницаемость слизистой кишечника, посредством перорального введения пациенту полипептидной конструкции, которая описана здесь.

Эффективность этого процесса может быть еще более увеличена посредством дополнительного аспекта настоящего изобретения - применения активных транспортных переносчиков. В этом аспекте изобретения VHH является слитым с переносчиком, который усиливает транспорт через стенку кишечника в кровоток. В одном из примеров этим «переносчиком» является второй VHH, который слит с терапевтическим VHH. Такие слитые конструкции получают при использовании известных в данной области методов. VHH-«переносчик» специфически связывается с рецептором на стенке кишечника, который индуцирует активный транспорт через стенку.

Другим воплощением настоящего изобретения является применение полипептидной конструкции, которая здесь описана, для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, доставляемым в слизистую кишечника, где названное заболевание увеличивает проницаемость слизистой кишечника.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в слизистую кишечника без инактивации, посредством перорального введения пациенту полипептидной конструкции настоящего изобретения.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в кровоток пациента без инактивации посредством орального введения пациенту полипептидной конструкции настоящего изобретения.

Эффективность этого процесса может быть еще более увеличена посредством дополнительного аспекта настоящего изобретения - применения активных транспортных переносчиков. В этом аспекте изобретения описанная здесь полипептидная конструкция является слитой с переносчиком, который усиливает транспорт через стенку кишечника в кровоток. В одном из примеров этим «переносчиком» является VHH, который слит с названным полипептидом. Такие слитые конструкции получают при использовании методов, известных в данной области. VHH-«переносчик» специфически связывается с рецептором на стенке кишечника, который индуцирует активный транспорт через стенку.

Одним воплощением настоящего изобретения является полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое способно эффективно проходить через ткани под языком. Композиция указанной полипептидной конструкции, описанной здесь, например таблетка, спрей, капля, помещается под язык и адсорбируются через слизистые мембраны в капиллярную сеть под языком.

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое может эффективно проходить через ткани под языком, посредством сублингвального введения пациенту полипептидной конструкции, описанной здесь.

Другим воплощением настоящего изобретения является применение полипептидной конструкции, которая здесь описана, для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции вещества, контролирующим опосредованную тромбоцитами агрегацию, которое может проходить через ткани под языком.

Аспектом изобретения является способ доставки вещества, которое контролирует опосредованную тромбоцитами агрегацию, в ткани под языком без инактивации, посредством введения пациенту сублингвально полипептидной конструкции, описанной здесь.

Аспектом изобретения является способ доставки вещества, контролирующего опосредованную тромбоцитами агрегацию, в кровоток пациента без инактивации, путем перорального введения пациенту полипептидной конструкции, описанной здесь.

Одним воплощением настоящего изобретения является полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое может эффективно проходить через кожу.

Композиция названной полипептидной конструкции, такая как, например, крем, пленка, спрей, капли, пластырь, помещается на кожу и проникает внутрь.

Аспектом изобретения является способ лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое может эффективно проникать через кожу, посредством местного введения полипептидной конструкции, описанной здесь.

Другим воплощением настоящего изобретения является применение полипептидной конструкции, которая здесь описана, для получения лекарственного средства для лечения, профилактики и/или облегчения симптомов заболеваний, поддающихся модуляции веществом, контролирующим опосредованную тромбоцитами агрегацию, которое способно эффективно проникать через кожу.

Аспектом изобретения является способ доставки вещества, которое контролирует опосредованную тромбоцитами агрегацию, в кожу без инактивации, посредством местного введения пациенту полипептидной конструкции, описанной здесь.

Аспектом изобретения является способ доставки вещества, которое контролирует опосредованную тромбоцитами агрегацию, в кровоток пациента, посредством местного введения пациенту полипептидной конструкции, описанной здесь.

В другом воплощении настоящего изобретения полипептидная конструкция, которая описана здесь, дополнительно содержит однодоменное антитело-переносчик (например, VHH), который действует как активный транспортный переносчик для транспорта названной полипептидной конструкции через просвет легких в кровь.

Полипептидная конструкция дополнительно включает переносчик, который связывается специфически с рецептором, находящимся на слизистой поверхности (эпителиальные клетки бронхов), обеспечивая, таким образом, активный транспорт полипептида из просвета легких в кровь. Однодоменное антитело-переносчик может быть слитым с полипептидной конструкцией. Такие слитые конструкции получены при использовании методов, известных в данной области исследований, и описаны здесь. Однодоменное антитело-переносчик связывается специфически с рецептором на слизистой поверхности, что индуцирует активный перенос через поверхность.

Другой аспект настоящего изобретения - способ определения того, какие однодоменные антитела (например, пептиды VHH) активно переносятся в кровоток при назальном применении. Согласно этому способу фаговая библиотека наивных или иммунных VHH может быть введена назально и в разные временные точки после введения могут быть отобраны пробы крови или органа для выделения фагов, которые были активно перенесены в кровоток. Одним из примеров рецепторов для активного транспорта из просвета легких в кровоток является Fc рецептор N (FcRn). Один аспект настоящего изобретения включает молекулы VHH, идентифицированные при использовании данного способа. Такие VHH могут быть затем использованы в качестве переносчиков VHH для доставки терапевтических VHH к соответствующей мишени в кровотоке при назальном применении.

Одним воплощением настоящего изобретения является полипептидная конструкция, которая описана здесь, для применения в лечении, профилактике и/или облегчении симптомов заболеваний, связанных с опосредованной тромбоцитами агрегацией или ее дисфункцией. Названные нарушения включают такие заболевания, как тромбоцитопеническая (геморрагическая) пурпура (ТТР), кратковременное ишемическое повреждение головного мозга, нестабильная или стабильная стенокардия, инсульт головного мозга, инфаркт миокарда, закупорка периферических артерий, рестеноз. Такие заболевания, кроме того, включают нарушения, возникающие вследствие шунтирования коронарных сосудов, замены сердечных клапанов или операций на сердце, таких как ангиопластика, эндопротезирование или атерэктомия.

Другие нарушения являются любыми из следующих: образование неокклюзивных тромбов, образование окклюзивных тромбов, острая коронарная окклюзия, рестеноз, рестеноз после РСТА или эндопротезирования, образование тромбов в стенозированных артериях, гиперплазия после ангиопластики, атерэктомии или эндопротезирование артерий, окклюзивный синдром сосудистой системы или отсутствие проницаемости в поврежденных артериях.

Одним из аспектов данного изобретения является полипептидная конструкция, описанная в данной работе, для применения для лечения, предупреждения и/или облегчения расстройств или состояний, обусловленных опосредованной тромбоцитами агрегацией или ее дисфункцией, при котором данная полипептидная конструкция вводится внутривенно, подкожно, перорально, сублингвально, местно, назально, вагинально, ректально или посредством ингаляции.

Другой аспект данного изобретения, представленный здесь, - это применение данной полипептидной конструкции для получения лекарственного средства для лечения, предупреждения и/или облегчения расстройств или состояний, обусловленных опосредованной тромбоцитами агрегацией или ее дисфункцией, при котором данная полипептидная конструкция вводится внутривенно, подкожно, перорально, сублингвально, местно, назально, вагинально, ректально или посредством ингаляции.

Другой аспект данного изобретения - это способ лечения, предупреждения и/или облегчения расстройств или состояний, обусловленных опосредованной тромбоцитами агрегацией или ее дисфункцией, включающий в себя введение пациенту полипептидной конструкции, описанной здесь, при котором данная гетероспецифическая полипептидная конструкция вводится внутривенно, подкожно, перорально, сублингвально, местно, назально, вагинально, ректально или посредством ингаляции.

Другой аспект данного изобретения - это полипептидная конструкция, описанная в данной работе, для применения в лечении, для предупреждения и/или облегчения расстройств или состояний, обусловленных опосредованной тромбоцитами агрегацией или ее дисфункцией.

Другой аспект данного изобретения, представленный здесь - это применение полипептидной конструкции, описанной здесь, для получения лекарственных средств для лечения, предупреждения и/или облегчения расстройств или состояний, обусловленных опосредованной тромбоцитами агрегацией или ее дисфункцией.

Полипептидная конструкция данного изобретения может применяться для скрининга на агенты, которые модулируют связывание полипептида с vWF (или с gp1b, или с коллагеном). При обнаружении способом анализа, который измеряет лишь связывание или вытеснение данного полипептида, такие агенты должны быть подвергнуты функциональному тестированию для того, чтобы установить, действительно ли данный агент участвует в модуляции опосредованной тромбоцитами агрегации.

В качестве примера эксперимента по вытеснению можно привести следующий: фаги или клетки, экспрессирующие vWF или его фрагмент, инкубируются в буфере для связывания в присутствии, например, полипептида, представленного последовательностью SEQ ID NO:1, который был заранее помечен, в присутствии или в отсутствие возрастающих концентраций потенциального модулятора. Для подтверждения и калибровки данного способа можно поставить контрольные реакции с участием возрастающих концентраций данного немеченого полипептида. После инкубации проводится обильное отмывание клеток и подходящим способом для данной метки (например, сцинтилляционный счет, оценка интенсивности флуоресценции, и т.д.) измеряют количество связанного меченого полипептида. Уменьшение количества связанного меченого полипептида в присутствии потенциального модулятора на 10% уже достаточно для того, чтобы сделать вывод о вытеснении связанного полипептида потенциальным модулятором. Если в ходе данного эксперимента или других описанных здесь экспериментов потенциальные модуляторы в концентрации не более 1 мкМ вытесняют 50% меченого полипептида (субнасыщающая доза полипептида), то считается, что данные потенциальные модуляторы связываются специфически. Очевидно, что представленный выше способ может быть с легкостью применен для скрининга на потенциальные модуляторы, изменяющие эффективность связывания между полипептидами с последовательностями, соответствующими SEQ ID NO: с 2 по 15, с 20 по 47 и с 62 по 65, или последовательностям описанных здесь полипептидных конструкций, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Альтернативно, связывание или вытеснение может быть оценено методом поверхностного плазменного резонанса (surface plasmon resonance, SPR). Методы поверхностного плазменного резонанса могут использоваться как количественные методы для оценки связывания между двумя молекулами по изменению массы в области неподвижного сенсора, которое обусловлено связыванием или разрывом связей между, например, полипептидом, соответствующим последовательности SEQ ID NO:1, находящимся в водной фазе, и vWF или его фрагментом, иммобилизованным в мембране на сенсоре. Такие изменения массы регистрируются в единицах резонанса в зависимости от шкалы времени после внесения или удаления данного полипептида или потенциального модулятора с помощью Biacore Biosensor (Biacore AB). vWF или его фрагмент может быть иммобилизован на сенсорном чипе (например, researche grade CM5 chip; Biacore AB) в тонкой липидной мембране посредством методов, описанных Salamon et al., (Salamon et al., 1996, Biophys J. 71: 283-294; Salamon et al., 2001, Biophys. J. 80: 1557-1567; Salamon et al., 1999, Trends Biochem. Sci. 24: 213-219; данные статьи включены в описание путем отсылки). Sarrio с коллегами показали, что SPR может быть применен для определения связывания лигандов с аденозиновым рецептором GPCRA(1), иммобилизованным в липидном слое на чипе (Sarrio et al., 2000, Mol. Cell. Biol. 20: 5164-5174, статья включена в описание путем отсылки). Условия связывания полипептидной конструкции данного изобретения в SPR эксперименте могут быть очень тонко подобраны специалистом в данной области с использованием условий, описанных Sarrio с коллегами, в качестве начальных условий эксперимента. Очевидно, что представленный выше метод может быть легко применен для скрининга на потенциальные модуляторы, изменяющие эффективность связывания между полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Методом SPR можно анализировать связывание модуляторов по меньшей мере двумя способами. Во-первых, полипептид, представленный, например, последовательностью SEQ ID NO:1, может быть предварительно связан с иммобилизованным vWF или его фрагментом, за этим следует введение потенциального модулятора в диапазоне концентраций от 0,1 нМ до 1 мкМ. Вытеснение связанного полипептида может быть определено количественно, обеспечивая регистрацию связывания модулятора. Альтернативно, связанный с мембраной vWF или его фрагмент может быть проинкубирован с потенциальным модулятором, а затем подвергнут воздействию, например, полипептида, представленного последовательностью SEQ ID NO:1. Разница в аффинности при связывании между названным полипептидом и vWF или его фрагментом, предынкубированным с модулятором, в сравнении с аффинностью при связывании между названным полипептидом и vWF или его фрагментом в отсутствие модулятора будет демонстрировать связывание или вытеснение названного полипептида в присутствии модулятора. В любом из двух вариантов измерения уменьшение на 10% и более количества названного полипептида, связанного в присутствии потенциального модулятора, по отношению к количеству названного полипептида, связанного в отсутствие потенциального модулятора, свидетельствует о том, что потенциальный модулятор ингибирует взаимодействие vWF или его фрагмента и названного полипептида. Несомненно, описанный выше метод может с легкостью применяться для скрининга на потенциальные модуляторы, которые изменяют связывание между полипептидами, представленными последовательностями SEQ ID NO: со 2 по 15, с 20 по 47 и с 62 по 65 или полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Другой метод определения ингибирования связывания, например, полипептида, представленного любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45 или с 62 по 65, с vWF или его фрагментами использует резонансный перенос энергии флуоресценции (fluorescence resonance energy transfer, FRET). FRET представляет собой квантово-механический феномен, который происходит между донором флуоресценции (Д) и акцептором флуоресценции (А), которые расположены чрезвычайно близко друг от друга (обычно на расстоянии <100 Å), если спектр испускания Д перекрывается со спектром возбуждения А. Тестируемые молекулы, например полипептид, представленный последовательностью SEQ ID NO:1, и vWF или его фрагмент, являются меченными комплементарной парой донорного и акцепторного флуорофоров. Когда vWF и полипептид располагаются в тесном соседстве в результате взаимодействия, флуоресценция, испускаемая при возбуждении флуорофора-донора, будет иметь длину волны, отличающуюся от длины волны испускаемой в ответ на эту длину волны возбуждения в том случае, когда названный полипептид и vWF или его фрагмент не связаны, позволяя оценить количество связанных против несвязанных молекул посредством измерения интенсивности испускания при каждой длине волны. Флуорофоры-доноры, которыми метят vWF или его фрагмент, хорошо известны в данной области. Особый интерес представляют варианты зеленого флуоресцентного белка (Green Fluorescent Protein, GFP) A. Victoria, известные как Cyan FP (CFP, Донор (Д)) и Yellow FP (YFP, Акцептор (А)). Например, вариант YFP может быть получен как слитой белок с vWF или его фрагментом. Векторы для экспрессии вариантов GFP в виде слитых конструкций (Clontech), так же как и меченые флуорофорами реагенты (Molecular Probes), известны в данной области. Добавка потенциального модулятора к смеси флуоресцентно-меченого полипептида и YFP-vWF будет приводить к ингибированию переноса энергии, о чем свидетельствует, например, уменьшение флуоресценции YFP по отношению к пробе без потенциального модулятора. В экспериментах с использованием FRET для выявления взаимодействия vWF: полипептид снижение интенсивности испускания флуоресценции при длине волны акцептора в пробах, содержащих потенциальный модулятор, в сравнении с пробой без потенциального модулятора на 10% или больше указывает на то, что потенциальный модулятор ингибирует взаимодействие vWF: полипептид. Несомненно, описанный выше метод может с легкостью применяться для скрининга на потенциальные модуляторы, которые изменяют связывание между полипептидами, представленными любой из последовательностей SEQ ID NO: со 2 по 15, с 20 по 47, с 62 по 65 или полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Варианты FRET используют тушение флуоресценции для оценки молекулярных взаимодействий. Одна молекула взаимодействующей пары может быть помечена флуорофором, а другая - молекулой, которая тушит флуоресценцию флуорофора, когда находится с ним в близком контакте. Изменение интенсивности флуоресценции при возбуждении указывает на изменение в ассоциации молекул, помеченных парой флуорофор: тушитель. Как правило, увеличение флуоресценции меченого vWF или его фрагмента свидетельствует о том, что полипептидная молекула (например, полипептидная конструкция изобретения), несущая тушитель, была вытеснена. Для экспериментов по регистрации тушения увеличение на 10% и более интенсивности флуоресцентной эмиссии в пробах, содержащих потенциальный модулятор, в сравнении с пробой без потенциального модулятора указывает на то, что потенциальный модулятор ингибирует взаимодействие vWF: полипептид. Несомненно, описанный выше метод может с легкостью применяться для скрининга на потенциальные модуляторы, которые изменяют связывание между полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

В дополнение к методам поверхностного плазменного резонанса и FRET для количественной оценки связывания подходящим методом является измерение поляризации флуоресценции. Величина поляризации флуоресценции для флуоресцентно-меченых молекул зависит от времени корреляции вращения или скорости вращения. Комплексы, которые образовались в результате ассоциации vWF или его фрагмента с флуоресцентно-меченым полипептидом (например, с флуоресцентно-меченым полипептидом, представленным любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45 или с 62 по 65), имеют более высокие значения поляризации, чем меченый полипептид, не образующий комплекс. Введение потенциального ингибитора взаимодействия vWF: полипептид приводит к уменьшению в данной пробе поляризации флуоресценции по сравнению с пробой без потенциального ингибитора, если потенциальный ингибитор разрушает или ингибирует взаимодействие vWF или его фрагмента с названным полипептидом. Поляризация флуоресценции является очень удобной для идентификации маленьких молекул, которые нарушают формирование комплексов vWF: полипептид. Уменьшение на 10% и более поляризации флуоресценции в пробах, содержащих потенциальный модулятор, в сравнении с поляризацией флуоресценции в пробе без потенциального модулятора указывает на то, что потенциальный модулятор ингибирует взаимодействие vWF: полипептид. Несомненно, описанный выше метод может с легкостью применяться для скрининга на потенциальные модуляторы, которые изменяют связывание между полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Другая альтернатива для мониторинга взаимодействия vWF: полипептид -использование биосенсорных способов анализа. Биосенсоры ICS были описаны в статье (Australian Membrane Biotechnology Research Institute; Comell B, Braach-Maksvytis V, King L, Osman P, Raguse B, Wieczorek L, and Pace R. «A biosensor that uses ion-channel switches» Nature 1997, 387, 580). Согласно этой методике ассоциация vWF или его фрагмента и полипептида (например, полипептида, представленного любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45 и с 62 по 65) сопряжена с закрыванием формируемых грамицидином ионных каналов в суспендированных мембранных бислоях, и, таким образом, с поддающемуся измерению изменению в полной проводимости (подобно этому - в импедансе (в полном сопротивлении)) биосенсора. Этот подход является линейным, перекрывая шесть порядков изменения величины проводимости, и является идеально подходящим для широкомасштабного и высокопроизводительного скрининга комбинаторных библиотек малых молекул. Изменение (увеличение или уменьшение) на 10% и более в проводимости в пробе, содержащей потенциальный модулятор, в сравнении с проводимостью в пробе без потенциального модулятора указывает на то, что потенциальный модулятор ингибирует взаимодействие vWF или его фрагмента и названного полипептида. Важно отметить, что в способах анализа, измеряющих взаимодействие vWF или его фрагмента с полипептидом (таким как, например, полипептид, представленный любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45 и с 62 по 65), модулятор взаимодействия, возможно, не обязательно прямо взаимодействует с доменами (доменом) белков, которые физически взаимодействуют с названным полипептидом. Возможно также, что модулятор будет действовать в участке, удаленном от места взаимодействия и, например, вызывать конформационные изменения в vWF. Модуляторы (ингибиторы или агонисты), которые действуют таким способом, тем не менее, интересны как агенты, способные модулировать индуцируемую тромбоцитами агрегацию. Конечно, названный выше метод может с легкостью применяться для скрининга на потенциальные модуляторы, которые изменяют связывание между полипептидными конструкциями, описанными здесь, и макромолекулами, вовлеченными в опосредованную тромбоцитами агрегацию, такими как, например, vWF, gp1b или коллаген, или их фрагменты.

Любой из описанных способов анализа связывания может быть использован для определения присутствия в пробе, например, в пробе ткани, агента, который связывается с vWF или его фрагментом, или воздействует на связывание, например, полипептида, представленного любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45 и с 62 по 65,с vWF. При этом подходе vWF или его фрагмент реагирует с данным полипептидом в присутствии или в отсутствие образца, а эффективность связывания полипептида измеряется подходящим для используемого способа анализа образцом. Падение эффективности связывания полипептида на 10% или более свидетельствует о наличии в образце агента, который модулирует связывание полипептида с vWF либо его фрагментом. Очевидно, что описанный выше метод может быть легко применен для скрининга на потенциальные модуляторы, способные изменять эффективность связывания между описанными здесь полипептидными конструкциями и макромолекулами, вовлеченными в процесс опосредованной тромбоцитами агрегации, такими как, например, vWF, gp1b или коллаген, либо их фрагментами.

Клетки

Клетка, которая может использоваться в соответствии с данным изобретением, предпочтительно выбирается из группы, включающей в себя клетки бактерий, таких как, например, Е.coli, клетки дрожжей, таких как, например, S. cerevisiae, P. pastoris, клетки насекомых или млекопитающих.

Клетка, которая может использоваться в соответствии с данным изобретением, может быть любой клеткой, в которой последовательность нуклеиновой кислоты кодирует полипептид, включающий в себя любую из последовательностей SEQ ID NO: с 1 по 47 и с 49 по 65, или в которую может быть введена полипептидная конструкция данного изобретения, в соответствии с данным изобретением таким образом, чтобы экспрессия белка осуществлялась на природном уровне либо выше природного уровня, как описано здесь. Предпочтительно, чтобы полипептид данного изобретения экспрессирующийся в клетке, проявляя нормальные или близкие к норме фармакологические свойства, как описано здесь. Еще более предпочтительно, чтобы полипептид данного изобретения, экспрессирующийся в клетке, содержал последовательность нуклеотидов, способную кодировать аминокислотную последовательность, представленную в таблице 30, или способную кодировать аминокислотную последовательность, которая как минимум на 70% идентична аминокислотной последовательности, представленной в таблице 30.

В соответствии с предпочтительным воплощением настоящего изобретения клетка выбрана из группы, включающей в себя COS7-клетки, СНО клетки, LM (TK-) клетки, NIH-3Т3 клетки, НЕK-293 клетки, K-562 клетки или клетки астроцитомы 1321N1, но также и другие подходящие для трансфекции клеточные линии.

Вообще, «терапевтически эффективное количество», «терапевтически эффективная доза» и «эффективное количество» означают количество, необходимое для достижения нужного результата или результатов (лечения или предотвращения агрегации тромбоцитов). Каждый специалист в данной области поймет, что эффективность, а следовательно, и «эффективное количество» может отличаться для каждого из разнообразных веществ, ингибирующих опосредованную тромбоцитами агрегацию, используемых в настоящем изобретении. Любой специалист в данной области способен с легкостью оценить эффективность вещества.

Используемый здесь термин «соединение» относится к полипептидной конструкции, описанной здесь, либо к нуклеиновой кислоте, способной кодировать данный полипептид, либо к агенту, идентифицированному при использовании описанных здесь способов скрининга, либо к описанному здесь полипептиду, содержащему одну или более дериватизированных аминокислот.

Термин «фармацевтически приемлемый» означает материал, не являющийся биологически или в других отношениях неподходящим, т.е. материал может быть введен в организм пациента вместе с веществом и при этом не вызывать никаких нежелательных биологических эффектов или нежелательных взаимодействий с любым из входящих в данную фармацевтическую композицию компонентов.

Представленное здесь изобретение пригодно для лечения либо предотвращения состояний опосредованной тромбоцитами агрегации и в соответствии с этим включает в себя введение фармацевтически эффективного количества соединения или композиции, которое ингибирует BTK и которое ингибирует опосредованную тромбоцитами агрегацию.

Представленное здесь изобретение пригодно для лечения либо предотвращения начальных стадий формирования тромба у пациента и включает в себя введение фармацевтически эффективного количества соединения или композиции в соответствии с настоящим изобретением.

Представленное здесь изобретение пригодно для лечения либо предотвращения рестеноза и включает в себя введение фармацевтически эффективного количества соединения или композиции в соответствии с настоящим изобретением.

Одним из аспектов настоящего изобретения является применение соединений настоящего изобретения для лечения либо предотвращения состояний опосредованной тромбоцитами агрегации у пациента, включающее введение фармацевтически эффективного количества соединения в комбинации с другим, таким как, например, аспирин.

Одним из аспектов настоящего изобретения является применение соединений настоящего изобретения для лечения либо предотвращения состояний опосредованной тромбоцитами агрегации у пациента, включающее введение фармацевтически эффективного количества соединения в комбинации с другим, таким как, например, тромболитический агент.

Другим аспектом настоящего изобретения является применение соединения настоящего изобретения для лечения либо предотвращения образования бляшки или тромба у пациента. Такое образование бляшки или тромба может происходить при высоком срезывающем напряжении. Как при тромбозе, так и при повторной окклюзии обратимая адгезия или связывание тромбоцитов при высоком срезывающем напряжении индуцирует их устойчивую адгезию через рецепторы коллагена на тромбоцитах, что приводит к активации тромбоцитов; связывание тромбоцитов через vWF с коллагеном поврежденной стенки сосуда особенно важно при высоком срезывающем напряжении. Авторы настоящего изобретения обнаружили, что полипептидные конструкции настоящего изобретения неожиданно хорошо проявляют себя в условиях высокого срезывающего напряжения (см., например, пример 16.).

Настоящее изобретение не ограничивается введением композиций, включающих одно соединение настоящего изобретения. В рамках настоящего изобретения возможно также обеспечить комбинированное лечение, при котором пациенту, нуждающемуся в этом, вводят композицию, включающую несколько веществ соединений настоящего изобретения.

Список заболеваний и нарушений, при которых наблюдается опосредованная тромбоцитами агрегация, включает в себя (но не ограничивается этим) следующие: нестабильная стенокардия, стабильная стенокардия, грудная жаба, образование эмбола, глубокий тромбоз вен, гемолитический уремический синдром, гемолитическая анемия, острая почечная недостаточность, тромболитические осложнения, тромболитическая тромбоцитопеническая (геморрагическая) пурпура, рассеянная внутрисосудистая комгелопатия, тромбоз, заболевание коронарных сосудов сердца, тромбоэмболические осложнения, инфаркт миокарда, рестеноз, а также образование тромбов при предсердной фибрилляции, хроническая нестабильная стенокардия, кратковременное ишемическое повреждение головного мозга и инсульты, заболевание периферических сосудов, тромбоз артерий, пре-эклампсия, эмболия, рестеноз и/или тромбоз после ангиопластики, эндартерэктомия сонной артерии, анастомоз пересаженных сосудов, а также постоянное применение сердечно-сосудистых устройств. Такие состояния, при которых наблюдается опосредованная тромбоцитами агрегация, могут также возникать при тромбоэмболии и реокклюзии в ходе или после тромболитической терапии, после ангиопластики, а также после шунтирования коронарных сосудов.

В данной области техники хорошо известно, как можно определить ингибирование опосредованной тромбоцитами агрегации, используя стандартные тесты, описанные здесь, либо другие аналогичные тесты. Предпочтительно, чтобы способ приводил как минимум к 10%-ному уменьшению опосредованной тромбоцитами агрегации, включая, например, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% или любое промежуточное значение, более предпочтительно около 90%.

Аналогично этому способ должен обеспечивать как минимум 10%-ное уменьшение внутриклеточной мобилизации кальция, включая, например, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%. Также способ должен обеспечить как минимум 10%-ное уменьшение уровня фосфорилированного PLCg 2, включая, например, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%.

Уменьшение может быть измерено, например, путем сравнения оптической плотности в приборе для измерения скорости агрегации тромбоцитов во времени. Для этого также может быть использован любой другой известный способ измерения. Например, (1) при стимуляции коллагеном уровень коллаген-индуцируемой внутриклеточной мобилизации кальция увеличивается с течением времени, таким образом, измерение может включать в себя измерение коллаген-индуцируемого уровня внутриклеточного кальция или (2) в результате стимуляции коллагеном уровень фосфорилированного PLCg 2 увеличивается с течением времени, таким образом, измерение может включать в себя анализ уровня фосфорилированного PLCg 2.

Клетки могут быть введены в контакт in vitro, например, посредством добавления соединения настоящего изобретения в культуральную среду (путем непрерывной инфузии, путем добавления болюса либо путем замены среды на среду, содержащую соединение) либо посредством добавления соединения во внеклеточную жидкость in vivo (путем локальной доставки, системной доставки, ингаляции, внутривенной инъекции, доставки при помощи болюса или непрерывной инфузии). Длительность «контакта» с клеткой или популяцией клеток определяется временем, в течение которого концентрация соединения находится на физиологически эффективном уровне или на предположительно физиологически эффективном уровне в культуральной среде, либо во внеклеточной жидкости, омывающей клетку или клетки. Предпочтительно, чтобы длительность контакта была от 1 до 96 часов, наиболее предпочтительно - 24 часа, но это время может меняться в зависимости от времени полужизни соединения и может быть оптимизировано специалистом в данной области посредством рутинных экспериментов.

Соединение, пригодное в настоящем изобретении, может быть включено в фармакологические композиции и введено в организм млекопитающего, будь то больной человек или домашнее животное, в виде разнообразных форм, адаптированных в зависимости от способа введения, например, при применении перорально или парентерально, интраназально путем ингаляции, внутривенно, внутримышечно, местно или подкожно.

Соединение настоящего изобретения также может быть введено в организм при помощи генно-терапевтических методов доставки. Для примера см. U.S. Patent No. 5,399,346, который включен в описание во всей полноте путем отсылки. При использовании генно-терапевтических методов доставки исходные клетки, трансфицированные геном соединения настоящего изобретения, могут быть дополнительно трансфицированы тканеспецифическими промоторами для того, чтобы адресно доставлять к конкретным органам, тканям, трансплантатам, опухолям или клеткам.

Таким образом, настоящее соединение может вводиться систематически, например перорально, в комбинации с фармацевтически приемлемым носителем, таким как, например, инертный разбавитель или усвояемый съедобный носитель. Они могут быть заключены в мягко- или твердостенные желатиновые капсулы, могут входить в состав таблеток или добавляться непосредственно в пищевой рацион пациента. Для перорального терапевтического введения активное соединение может комбинироваться с одним (или более) наполнителем и применяться в форме проглатываемых таблеток, защечных таблеток, пастилок, капсул, эликсиров, суспензий, сиропов, облаток и тому подобного. Такие композиции и препараты должны содержать как минимум 0,1% активного вещества. Процентный состав композиций и препаратов может, разумеется, изменяться, и для удобства содержание может составлять от примерно 2 до примерно 60% веса конкретной стандартной лекарственной формы. Количество активного соединения в таких терапевтически полезных композициях такое, которое позволяет получать эффективный уровень дозировки.

Таблетки, пастилки, пилюли, капсулы и тому подобное могут также включать следующее: связующие вещества, такие как камедь трагаканта, акации, кукурузный крахмал или желатин; наполнители, такие как дикальций-фосфат; диспергирующий агент, такой как кукурузный крахмал, картофельный крахмал, альгиновая кислота и тому подобное; смазочный материал, такой как стеарат магния; также в них могут быть добавлены подсластитель, такой как сахароза, фруктоза, лактоза или аспартам, или ароматизатор, такой как перечная мята, масло грушанки или вишневый ароматизатор. Когда стандартной лекарственной формой является капсула, то в дополнение к перечисленным выше материалам может быть добавлен жидкий носитель, такой как растительное масло либо полиэтиленгликоль. Множество других материалов могут входить в состав оболочки или любым другим способом изменять физические параметры твердых стандартных лекарственных форм. Например, таблетки, пилюли или капсулы могут быть покрыты желатином, воском, шеллаком или сахаром или тому подобным. Сироп или эликсир могут содержать активное соединение, сахарозу или фруктозу как подсластитель, метил и пропилпарабены как консерванты, краситель и ароматизаторы, такие как вишневый или апельсиновый. Очевидно, что все материалы, используемые для приготовления любой стандартной лекарственной формы, должны быть фармацевтически приемлемыми и по существу не токсичными в применяемых количествах. Кроме того, активное соединение может быть включено в состав продолжительно высвобождающихся препаратов или устройств с замедленным высвобождением.

Активное соединение также может быть введено внутривенно или внутрибрюшинно путем инфузии или инъекции. Раствор активного соединения или его солей может быть приготовлен на воде в некоторых случаях с добавлением нетоксичного сурфактанта. Дисперсионные системы могут быть также приготовлены на основе глицерина, жидких полиэтиленгликолей, триацетилглицерина и их смесей, а также на основе масел. При обычных условиях хранения и применения эти медикаменты содержат консерванты для предотвращения роста микроорганизмов.

Фармацевтические лекарственные формы, пригодные для инъекций и инфузии, могут включать в себя стерильные растворы, или дисперсионные системы, или стерильные порошки, содержащие активный ингредиент, которые адаптированы для приготовления extemporal стерильных растворов для инфузии или инъекции или дисперсионных систем, которые при необходимости заключены в липосомы. В любом случае конечная лекарственная форма должна быть стерильной, жидкой и стабильной в условиях изготовления и хранения. Жидким носителем или наполнителем может быть растворитель или жидкая дисперсионная среда, включая, например, воду, этанол, многоатомный спирт (например, глицерин, пропиленгликоль, жидкие полиэтиленгликоли и тому подобное), растительные масла, нетоксичные эфиры глицерина и подходящие смеси этих компонентов. Необходимая текучесть может поддерживаться, например, за счет формирования липосом, за счет образования частиц необходимого размера в случае дисперсионных систем либо за счет использования сурфактантов. Предотвратить заражение микроорганизмами можно при помощи разнообразных антибактериальных и фунгицидных агентов, таких как, например, парабены, хлоробутанол, фенол, сорбиновая кислота, тимерозал и тому подобное. Во многих случаях предпочтительно включение изотонических агентов, таких как, например, сахара, буферы или хлорид натрия. Пролонгированная абсорбция инъецируемых композиций может быть обеспечена посредством добавления в композицию агентов, замедляющих абсорбцию, например моностеарата алюминия или желатина.

Стерильные инъецируемые растворы готовятся путем включения активного соединения в нужном количестве в соответствующий растворитель в сочетании, если это необходимо, с множеством других ингредиентов, перечисленных выше, с последующей стерилизацией фильтрованием. В случае стерильных порошков для приготовления стерильных растворов для инъекций предпочтительными методами приготовления являются вакуумная сушка и лиофилизация, которые позволяют получать порошок активного соединения плюс любые необходимые дополнительные ингредиенты, присутствовавшие в предварительно стерилизованных фильтрованием растворах.

Для местного введения настоящее соединение может использоваться в чистом виде, например, когда оно представляет собой жидкости. Тем не менее, как правило, желательно наносить их на кожу в виде композиций или составов в комбинации с дерматологически приемлемым носителем, который может быть как жидким, так и твердым.

Пригодные твердые носители включают такие тонкоизмельченные твердые вещества как тальк, глина, микрокристаллическая целлюлоза, кварц, окись алюминия и тому подобное. Пригодные жидкие носители включают в себя воду, гидроксиалкилы или гликоли, либо смеси вода-спирт/гликоль, в которых эффективное количество настоящего соединения может быть растворено или диспергировано при необходимости с помощью нетоксичных сурфактантов. Вспомогательные вещества, такие как отдушки либо дополнительные противомикробные агенты, могут быть добавлены с целью оптимизации свойств лекарственного препарата для конкретного вида применения. Получаемые в результате жидкие композиции могут применяться с использованием абсорбирующих подушечек, использоваться для пропитки бинтов и других перевязочных материалов или распыляться на пораженный участок при помощи помповых или аэрозольных распылителей.

Загустители, такие как синтетические полимеры, жирные кислоты, соли и эфиры жирных кислот, длинноцепочечные спирты, модифицированные целлюлозы или модифицированные минеральные материалы, могут быть также применены с жидкими носителями для формирования текучих паст, гелей, мазей, мыла и тому подобного для нанесения непосредственно на кожу пациента.

Примеры пригодных дерматологических композиций, которые могут применяться для доставки вещества на кожу, хорошо известны в данной области: см., например, Jacquet et al. (U.S. Pat. № 4,608,392), Geria (U.S. Pat. № 4,992,478), Smith (U.S. Pat. № 4,559,157) и Wortzman (U.S. Pat. № 4,820,508).

Пригодные дозировки вещества могут быть определены посредством сравнения их активности in vitro и активности in vivo на животных моделях. Методы для экстраполяции эффективных дозировок при пересчете с мыши и других животных на человека известны в данной области: см., например, U.S. Pat. № 4,938,949.

Вообще, концентрация соединения (соединений) в жидкой композиции, такой как примочка, будет составлять примерно от 0,1% до 25% по весу, предпочтительно примерно от 0,5% до 10% по весу. Концентрация в полутвердой или твердой композиции, такой как гель или порошок, будет около 0,1-5% по весу, предпочтительно около 0,5-2,5% по весу.

Количество соединения, или его активной соли, или производного, необходимое для использования при лечении, будет варьировать в зависимости не только от выбранного типа соли, но также и от пути введения, природы заболевания, которое лечат, а также возраста и общего состояния пациента и в конечном счете будет зависеть от решения лечащего врача или клинициста. Также дозировка вещества варьирует в зависимости от мишени, которой может являться клетка, опухоль, ткань, трансплантат или орган.

Нужная доза может быть удобно представлена в виде единичной дозы либо в виде дробных доз, вводимых через соответствующие временные интервалы, например как две, три, четыре или более суб-доз в день. Суб-доза сама по себе может быть также разделена, например, на множество дискретных нерегулярных введений, таких как множественные ингаляции при помощи инсуфлятора либо закапывание множества капель в глаза.

Режим введения может включать длительное, ежедневное лечение. Под словом «длительное» имеется в виду лечение продолжительностью как минимум две недели, но, предпочтительно, несколько недель, месяцев или лет. Необходимые изменения в диапазоне дозировок могут быть определены специалистом в данной области путем только рутинных экспериментов с учетом приведенных здесь сведений. Смотри Remington's Pharmaceutical Sciences (Martin, E.W., ed. 4), Mack Publishing Co., Easton, PA. Дозировка может также регулироваться личным врачом в случае каких-либо осложнений.

Настоящее изобретение обеспечивает агент, который является модулятором опосредованной тромбоцитами агрегации.

Потенциальным агентом может быть синтетический агент, либо смесь агентов, или натуральный продукт (например, растительный экстракт либо культуральный супернатант). Понятие «потенциальный агент» согласно настоящему изобретению включает в себя маленькую молекулу, которая может быть синтезирована, натуральный экстракт, пептиды, белки, углеводы, жиры и т.д.

Агенты - потенциальные модуляторы - могут быть отобраны из больших библиотек синтетических или натуральных агентов. В настоящее время используется множество методик случайного или направленного синтеза агентов на основе сахаридов, пептидов и нуклеиновых кислот. Библиотеки синтетических агентов являются коммерчески доступными от многих компаний, таких как Maybridge Chemical Co. (Trevillet, Cornwall, UK.), Comgenex (Princeton, NJ), Brandon Associates (Merrimack, NH) и Microsource (New Milford, CT). Доступна библиотека редких химических соединений фирмы Aldrich (Milwaukee, WI). Комбинаторные библиотеки также доступны и могут быть приготовлены. Альтернативно, библиотеки природных агентов Pan Laboratories (Bothell. WA) или MycoSearch (NC) в форме бактериальных, грибных, растительных либо животных экстрактов доступны или могут быть легко приготовлены при помощи широко известных в данной области методов. Кроме того, натуральные или полученные синтетическим путем библиотеки и агенты могут быть легко модифицированы при помощи обычных химических, физических, а также биохимических методов.

Пригодные агенты могут быть найдены внутри множества классов химических соединений. Пригодными агентами могут быть органические агенты или маленькие органические агенты. Маленькие органические агенты имеют молекулярный вес более 50, но менее 2500 дальтон, предпочтительно менее чем 750, еще более предпочтительно - менее 350 дальтон. Типичные классы включают гетероциклические соединения, пептиды, сахариды, стероиды и тому подобное. Агенты могут быть модифицированы с целью повышения их эффективности, стабильности, фармацевтической совместимости и тому подобного. Структурная идентификация агента может быть использована для выявления, производства или скрининга дополнительных агентов. Например, когда пептидные агенты идентифицированы, они могут быть модифицированы различными способами с целью повышения их стабильности, таким способом может быть использование неприродных аминокислот, таких как D-аминокислоты, в частности D-аланин, использование модификации аминокислот амино- или карбоксильного конца, например, посредством ацилирования либо алкилирования аминогруппы и этерификации либо амидирования карбоксигруппы, и тому подобное.

Для первичного скрининга пригодная концентрация потенциального агента в соответствии с настоящим изобретением составляет от 10 мкМ до примерно 100 мкМ или более (например, 1 мкМ, 10 мкМ, 100 мкМ, 1 М и т.д.). Концентрации, использующиеся при первичном скрининге, будут использованы как максимальные вместе с девятью дополнительными концентрациями, где дополнительные концентрации определяются путем уменьшения концентрации, использованной в первичном скрининге, в соответствии с полулогарифмическими интервалами (например, для 9 дополнительных концентраций) для вторичных скринингов либо для построения концентрационных зависимостей.

Высокопроизводительный набор для скрининга

Высокопроизводительный набор для скрининга (отбора) согласно настоящему изобретению включает в себя все необходимые средства и среды для осуществления определения агента, который модулирует опосредованную тромбоцитами агрегацию при взаимодействии с мишенью в соответствии с настоящим изобретением, как, например, vWF либо его фрагментом в присутствии полипептида (например, полипептида, соответствующего SEQ ID NO: с 1 по 15, с 20 по 34, с 38 по 45, с 62 по 65 или полипептидной конструкции), предпочтительно в диапазоне концентраций от 1 мкМ до 1 мМ. Данный набор включает в себя следующее: рекомбинантные клетки настоящего изобретения, содержащие в себе и экспрессирующие нуклеотидную последовательность, кодирующую vWF, либо его фрагмент, которые выращиваются в соответствии с настоящим изобретением на твердой подложке, такой как микротитрационный планшет, предпочтительно микротитрационный планшет на 96 лунок, с применением методов, хорошо известных специалистам в данной области, в особенности так, как описано в WO 00/02045. Альтернативно, vWF либо его фрагмент может быть предоставлен в очищенном виде для проведения иммобилизации на, например, микротитрационном планшете на 96 лунок специалистом в данной области. С другой стороны, vWF либо его фрагмент может быть представлен в наборе в предварительно иммобилизованном состоянии на, например, микротитрационном планшете на 96 лунок. Альтернативно, в том случае когда макромолекула, в отношении которой осуществляется скрининг, является gp1b, gp1a/IIa или коллагеном, названные воплощения будут включать gp1b, gp1a/IIa или коллаген, полипептид или кодирующую его полинуклеиновую кислоту соответственно вместо vWF. Набор может содержать более, чем одну макромолекулу (например, макромолекулу и/или полинуклеиновую кислоту vWF, gp1b или коллагена). Модулирующие агенты согласно настоящему изобретению при концентрациях от примерно 1 мкМ до 1 мМ или более добавляются в определенные лунки в присутствии подходящей концентрации полипептидной конструкции, причем названная концентрация названного полипептида находится, предпочтительно, в диапазоне от 1 мкМ до 1 мМ. Набор может содержать более, чем один полипептид.

Эксперименты по связыванию осуществляются согласно способам, уже описанным здесь, и результаты сравниваются с базовым уровнем, например, связывания vWF или его фрагмента с полипептидом, таким как, например, полипептид, представленный любой из последовательностей SEQ ID NO: со 2 по 15, с 20 по 34, с 38 по 45 или с 62 по 65, но в отсутствие добавленного модулирующего агента. Лунки, в которых обнаружено как минимум в 2 раза, предпочтительно - в 5 раз, более предпочтительно - в 10 раз и наиболее предпочтительно - в 100 раз или более, увеличение или уменьшение в связывании vWF-полипептид (например) по сравнению с уровнем активности в отсутствие модулятора, отбираются для дальнейшего анализа.

Другие наборы, пригодные согласно изобретению

Изобретение предусматривает наборы, пригодные для скрининга на модуляторы опосредованной тромбоцитами агрегации, так же как и наборы, пригодные для диагностики заболеваний или нарушений, характеризующихся нарушением регуляции опосредованной тромбоцитами агрегации. Наборы, пригодные согласно изобретению, могут содержать изолированный vWF или его фрагмент. Альтернативно или в дополнение, набор может включать клетки, трансформированные для экспрессии vWF или его фрагмента. В дополнительном воплощении набор согласно изобретению может включать полинуклеотид, кодирующий vWF или его фрагмент. Еще в дополнение набор согласно изобретению может включать специфические праймеры, полезные для амплификации vWF или его фрагмента. Альтернативно, молекула, в отношении которой осуществляется скрининг, представляет собой gp1b или коллаген, выше названное воплощение будет нести полипептид или полинуклеиновую кислоту gp1b, gp1a/IIa или коллагена, или их фрагмент соответственно вместо vWF. Набор может включать более чем одну макромолекулу (например, макромолекулу или полинуклеиновую кислоту vWF, gp1b или коллагена, или их фрагмент). Набор, пригодный согласно изобретению, может включать изолированный полипептид, представленный любой из последовательностей SEQ ID NO: с 1 по 15, с 20 по 47 или с 62 по 65, их гомологи или их функциональные части, или полипептидную конструкцию в соответствии с изобретением. Набор согласно изобретению может включать клетки, трансформированные для экспрессии названного полипептида. Набор может содержать более чем один полипептид. В дополнительном воплощении набор согласно изобретению может включать полинуклеотид, кодирующий макромолекулу, например, vWF, gp1b или коллаген или их фрагмент. В следующем дополнительном воплощении набор согласно изобретению может включать специфические праймеры, пригодные для амплификации макромолекул, таких как, например, vWF, gp1b или коллаген или их фрагмент. Все наборы согласно изобретению будут включать указанные выше объекты или комбинации объектов и материалы для их упаковки. Наборы будут также включать инструкцию по применению набора.

Медицинские устройства

Настоящее изобретение также предусматривает инвазивные медицинские устройства, покрытые полипептидной конструкцией настоящего изобретения либо агентом, выявленным посредством способа отбора настоящего изобретения, для применения в устройствах в случае необходимости. Неограничивающие примеры устройств включают хирургические трубки, окклюзионные средства и устройства для протезирования. Область применения данных устройств - хирургические процедуры, которые требуют модуляции опосредованной тромбоцитами агрегации вокруг участка вмешательства.

Одним из воплощений настоящего изобретения является способ обработки инвазивных медицинских устройств для предотвращения опосредованной тромбоцитами агрегации вокруг участка вмешательства, заключающийся в нанесении на названные устройства описанных выше полипептидных конструкций либо агентов в соответствии с настоящим изобретением.

Другое воплощение настоящего изобретения - это инвазивные медицинские устройства, избегающие опосредованной тромбоцитами агрегации вокруг участка вмешательства, где названные устройства покрыты полипептидной конструкцией либо агентом в соответствии с настоящим изобретением.

ПРИМЕРЫ

Изобретение иллюстрируется следующими неограничивающими примерами.

Подписи к примерам

Пример 1. Иммунизация ламы 002

Пример 2. Репертуарное клонирование

Пример 3. Создание библиотеки, приготовление фагов

Отбор лигандов для vWF, ингибирующих взаимодействие с коллагеном:

Пример 4. Отбор лигандов для vWF, ингибирующих взаимодействие с коллагеном: первый и второй раунды пэннинга

Пример 5. Функциональная характеристика лигандов vWF: ингибирование VHH связывания vWF с коллагеном

Пример 6. Экспрессия и очистка VHH

Пример 7. Определение связывания с vWF с помощью ELISA

Пример 8. Специфичность разных VHH

Пример 9. Ингибирование ELISA очищенными VHH

Пример 10. Секвенирование клонов

Пример 11. Эпитопное картирование

Пример 12. Экспрессия и очистка двухвалентных или биспецифичных VHH

Пример 13. Связывание с vWF в ELISA

Пример 14. Ингибирование ELISA очищенными VHH

Пример 15. Стабильность двухвалентных или биспецифичных конструкций в плазме крови человека

Пример 16. Оценка ингибирования VHH в условиях высокого срезывающего напряжения

Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами:

Пример 17. Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами: пэннинг

Пример 18. Скрининг на связывание с А1 доменом vWF

Пример 19. Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами: МАТСНМ

Пример 20. Связывание очищенных VHH с vWF в ELISA

Пример 21. Ингибирование ELISA очищенными VHH

Пример 22. Секвенирование клонов

Пример 23. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Пример 24. Экспрессия и очистка двухвалентных VHH

Пример 25. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Приготовление биспецифичных конструкций для vWF-специфичных VHH:

Пример 26. Устройство и последовательность биспецифичных конструкций

Пример 27. Экспрессия и очистка биспецифичных конструкций

Пример 28. Связывание с vWF

Пример 29. Сравнение ингибирования связывания vWF с коллагеном биспецифичными конструкциями и одновалентными VHH

Пример 30. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Скрининг на лиганды для коллагена типа I и типа III:

Пример 31. Отбор лигандов для коллагена типа I

Пример 32. Тестирование связывания VHH с коллагеном типа I и типа III методом ELISA

Пример 33. Секвенирование клонов

Пример 34. Связывание очищенных VHH с коллагеном типа I и типа III

Пример 35. Отбор лигандов для коллагена типа I, ингибирующих взаимодействие с vWF

Пример 36. Тестирование связывания VHH с коллагеном типа I и типа III методом ELISA

Пример 37. Секвенирование клонов

Пример 38. Связывание очищенных VHH с коллагеном типа I и типа III

Пример 39. Тестирование ингибирования связывания vWF с коллагеном коллаген-специфичными VHH методом ELISA

Пример 40. Тестирование ингибирования агрегации тромбоцитов коллаген-специфичными VHH в условиях низких и высоких срезывающих напряжений

Увеличение времени полужизни VHH:

Пример 41. Иммунизация ламы

Пример 42. Репертуарное клонирование

Пример 43. Создание библиотеки, приготовление фагов

Пример 44. ELISA фагов

Пример 45. Отбор: первый и второй раунд биопэннинга

Пример 46. Скрининг индивидуальных клонов после биопэннинга

Пример 47. Распределение фрагментов после рестрикции эндонуклеазой Hinf1 и Секвенирование.

Пример 48. Тестирование перекрестного взаимодействия с альбумином разных видов животных

Пример 49. Экспрессия и очистка

Пример 50. ELISA очищенных наночастиц на MSA

Пример 51. Устройство и последовательность биспецифичных конструкций

Пример 52. Экспрессия и очистка биспецифичных конструкций

Пример 53. Функциональность обоих VHH в биспецифичных конструкциях

Пример 54. Сравнение ингибирования связывания vWF с коллагеном биспецифичными конструкциями и одновалентными VHH

Отбор лигандов для gp1b, ингибирующих взаимодействие с vWF:

Пример 55. Отбор лигандов для gplb

Пример 56. Скрининг на лиганды с помощью ELISA

Пример 57. Связывание очищенных VHH с gp1b

Пример 58. Секвенирование клонов

Пример 59. Тестирование ингибиторных свойств VHH, специфичных к gp1b

Пример 60. Оценка ингибирования VHH в условиях высокого срезывающего напряжения

Покрытие эндопротезов, трубок, баллонов для эндопротезирования, катетеров и трансплантационного материала VHH:

Пример 61. Стабильность VHH

Пример 62. Иммобилизация VHH в полимере

Гуманизация С37:

Пример 63. Выравнивание С37 с DP-47

Пример 64. Мутагенез С37

Фрагменты анти-vWF VHH

Пример 65. Экспрессия VHH-CDR3 фрагмента vWF-C37

Пример 66. Отбор на рекомбинантном A1 (rA1) в первом и втором раундах биопэннинга

Пример 67. Скрининг индивидуальных клонов после биопэннинга

Пример 68. Распределение фрагментов после рестрикции эндонуклеазой Hinf1 и секвенирование.

Пример 69. Ингибирование ELISA

ПРИМЕРЫ

Пример 1. Иммунизация ламы 002

Одну ламу иммунизировали смесью vWF и коллагенов типа I и типа III. Все названные антигены вовлечены в первые стадии взаимодействий, приводящих к агрегации тромбоцитов (фигура 1). Схема иммунизации представлена в таблице 1.

Пример 2. Репертуарное клонирование

Лимфоциты из периферической крови (PBLs) выделяли центрифугированием в градиенте плотности (Ficoll-Paque plus, Amersham Biosciences) и использовали для выделения тотальной РНК (Chomczynski and Sacchi 1987). кДНК получали из 100 мкг тотальной РНК с помощью обратной транскриптазы MMLV (Gibco BRL) с использованием олиго d(T)-олигонуклеотидов. кДНК очищали экстракцией смесью фенол/хлороформ, осаждали этанолом и затем использовали как матрицу для амплификации репертуара VHH.

При первой ПЦР (полимеразной цепной реакции) репертуар участков генов как обычных (1,6 т.п.н.), так и тяжелоцепочечных (1,3 т.п.н.) антител был амплифицирован с использованием специфичного к лидерной последовательности праймера (5'-GGCTGAGCTCGGTGGTCCTGGCT-3') и олиго d(T)-праймера (5'-AACTGGAAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTT-3'). Полученные фрагменты ДНК разделяли электрофорезом в агарозном геле и выделяли из геля очищенный фрагмент 1,3 т.п.н., кодирующий сегменты тяжелоцепочечных антител. Вторая реакция ПЦР проводилась с использованием смеси обратных FR1 праймеров и того же самого прямого олиго d(Т)-праймера. Продукты ПЦР расщепляли рестриктазами SfiI (сайт введен в FR1-праймер) и BstEII (сайт естественно присутствует в FR4). После гель-электрофореза фрагмент ДНК размером около 400 пар оснований был очищен из геля и лигирован по соответствующим сайтам рестрикции в фагомиду рАХ004 для получения библиотеки клонов VHH после электропорации Esherichia coli TG1. Размер библиотеки составил 1,4×107 к.о.е., при этом все клоны содержали вставку нужного размера.

Пример 3. Создание библиотеки, приготовление фагов

Библиотеку выращивали при 37°C в 10 мл двухкратной среды TY, содержащей 2% глюкозы и 100 мг/мл ампициллина до достижения значения оптической плотности при 600 нм, равного 0,5. Были добавлены фаги М13КO7 (1012), после чего смесь инкубировали при 37°C 2 раза по 30 мин, сначала без встряхивания, затем со встряхиванием при 100 об/мин. Клетки центрифугировали 10 мин при 4500 об/мин при комнатной температуре. Осадок бактерий ресуспендировали в 50 мл двухкратной среды TY, содержащей 100 мкг/мл ампициллина и 25 мкг/мл канамицина и инкубировали в течение ночи при 37°C при интенсивном встряхивании при 250 об/мин. Ночную культуру центрифугировали 15 мин при 10000 об/мин при 4°C. Фаги осаждали ПЭГ (20% полиэтиленгликоля и 1,5 М NaCl) и центрифугировали 30 мин при 10000 об/мин. Осадок ресуспендировали в 20 мл PBS (забуференный фосфатом физиологический солевой раствор). Фаги повторно осаждали ПЭГ и центрифугировали 30 мин при 20000 об/мин при 4°C. Осадок растворяли в 5 мл PBS, содержащего 1% казеин. Фаги титровали путем инфицирования клеток TG1 при величине оптической плотности при 600 нм, равной 0,5, и высева на чашки с агаром, содержащим 100 мкг/мл ампициллина и 2% глюкозы. Число трансформантов соответствовало числу фагов (=б.о.е.). Фаги хранили при -80°C в 15% глицерине.

Отбор лигандов для vWF, ингибирующих взаимодействие с коллагеном (фигура 2).

Пример 4. Отбор лигандов для vWF, ингибирующих взаимодействие с коллагеном: первый и второй раунды пэннинга

Лунки в микропланшете сенсибилизировали 2 мкг/мл vWF или раствором PBS, содержащим 1% казеин. После инкубации в течение ночи при 4°C лунки блокировали раствором PBS, содержащим 1% казеин, в течение 3 ч при комнатной температуре. В лунки добавляли 200 мкл фагов. Через 2 ч инкубации при комнатной температуре лунки промывали 10 раз раствором PBS-Tween и 10 раз PBS. Фаги специфически элюировали 100 мкл коллагена типа III в концентрации 100 мкг/мл. Элюцию проводили в течение ночи при комнатной температуре. Элюированными фагами инфицировали клетки TG1, находящиеся в экспоненциальной фазе роста, затем клетки высевали на чашки с агаром, содержащим 100 мкг/мл ампициллина и 2% глюкозы. Этот эксперимент повторяли для второго раунда пэннинга в тех же условиях, которые описаны выше. Результаты пэннинга представлены в таблице 2.

Пример 5. Функциональная характеристика лигандов vWF: ингибирование VHH связывания vWF с коллагеном

Лунки в микропланшете сенсибилизировали в течение ночи коллагеном типа III в концентрации 25 мкг/мл в PBS при 4°C. Планшеты промывали 5 раз раствором PBS-Tween и блокировали 2 ч при комнатной температуре в растворе PBS, содержащем 1% казеин. Планшеты промывали 5 раз раствором PBS-Tween. 100 мкл раствора vWF с концентрацией 2 мкг/мл (vWF преинкубировали при 37°C 15 мин) смешивали с 20 мкл периплазматического экстракта, содержащего антитела VHH (описано в Примере 6) и инкубировали 90 мин при комнатной температуре в лунках микропланшетов. Планшеты промывали 5 раз раствором PBS-Tween. Анти-vWF-HRP моноклональные антитела (DAKO) разводили в 3000 раз в PBS и инкубировали 1 час. Планшеты промывали 5 раз раствором PBS-Твин и измеряли связывание vWF с использованием ABTS/H2O2. Сигналы измеряли через 30 мин при 405 нм. Результаты, представленные в Таблице 3, показывают, что ингибиторы были получены после первого и второго раундов пэннинга.

Пример 6. Экспрессия и очистка VHH

Были изготовлены плазмиды для лигандов для vWF, ингибирующих взаимодействие с коллагеном типа III, которыми трансформировали электрокомпетентные клетки WK-6. Одиночная колония использовалась для получения ночной культуры в среде LB, содержащей 2% глюкозы и 100 мкг/мл ампициллина. Ночную культуру разводили в 100 раз в 300 мл среды ТВ, содержащей 100 мкг/мл ампициллина, и инкубировали при 37°C до достижения оптической плотности при 600 нм, равной 0,5. В среду добавляли 1 мМ IPTG и инкубировали культуру еще 3 часа при 37°C или в течение ночи при 28°C.

Культуры центрифугировали 20 мин при 10000 об/мин при 4°C. Осадок замораживали на ночь или на 1 час при -20°C. Вслед за этим осадок размораживали при комнатной температуре в течение 40 мин, ресуспендировали в 20 мл PBS и встряхивали на льду в течение 1 часа. Фракцию периплазмы получали центрифугированием в течение 20 мин при 4°C при 20000 об/мин. Супернатант, содержащий VHH, наносили на Ni-NTA и очищали до гомогенного состояния. Выход VHH рассчитывали по коэффициенту экстинкции. Результаты суммированы в таблице 4.

Пример 7. Определение связывания с vWF методом ELISA

Микротитрационный планшет был сенсибилизирован раствором vWF 2 мкг/мл, в течение ночи при 4°C. Планшеты блокировали в течение 2-х часов при комнатной температуре с помощью 300 мкл 1% казеина в PBS. Далее планшеты промывали три раза с использованием раствора PBS-Tween. Серии разведении всех очищенных проб инкубировали в течение двух часов при комнатной температуре. Затем планшеты отмывали шесть раз с использованием раствора PBS-Tween, после чего связывание VHH детектировали посредством инкубации с мышиным анти-myc mАВ 1/2000 в PBS в течение одного часа при комнатной температуре, и последующей инкубации с анти-мышиным конъюгатом с HRP (horse radish peroxidase, пероксидаза хрена) 1/1000 в PBS, также в течение одного часа при комнатной температуре. Окрашивание осуществлялось с использованием субстрата ABTS/H2O2, сигналы измеряли по прошествии 30 минут при длине волны 405 нм. Эффективность связывания как функция концентрации очищенного VHH представлена на фигуре 3.

Пример 8. Специфичность разных VHH

Микротитрационный планшет был сенсибилизирован раствором vWF 2 мкг/мл и трех других антигенов, не вовлеченных в процесс агрегации тромбоцитов, но которыми была также иммунизирована лама 002. ELISA проводили так, как описано в примере 7, с использованием 670, 67 и 6,7 нМ VHH. Результаты суммированы в таблице 5. Результаты демонстрируют, что ингибирующие VHH специфичны к vWF.

Пример 9. Ингибирование ELISA очищенными VHH

Ингибирование ELISA было выполнено, как описано в Примере 5, но с использованием уменьшающихся концентраций VHH и человеческой плазмы крови с разведением 1/60 вместо очищенного VHH либо неразведенной человеческой плазмы крови. Результаты представлены на фигуре 4. Концентрация VHH, приводящая к ингибированию на 50% (IC50), приведена в таблице 6.

Пример 10. Секвенирование клонов

Клоны были просеквенированы с использованием универсального обратного праймера М13. Аминокислотные последовательности представлены в таблице 30 (SEQ ID NO:1, 3, 4, 5, 6 и 7).

Пример 11. Эпитопное картирование

Клонирование A3 домена vWF в pBAD-Oprl-ss

Вектор pBAD-Oprl-strep-spec использовался для того, чтобы A3 домен vWF в виде слитого белка с белком Oprl был экспонирован на поверхности клеток Е.coli UT5600 (F-ara-14 leuB6 azi-6 lacY1 proC14 tsx-67 entA403 trpE38 rfbD1 rpsL109 xy1-5 mt1-1 thi1 DompT fepC266) (Cote-Sierra et al., 1998, Gene, 221: 25-34). Ген, кодирующий A3 домен vWF (201 аминокислота), был амплифицирован с использованием праймеров A3 for и A3 back путем полимеразной цепной реакции (ПЦР).

A3for: CTG GTG CTG CAG AGG TGA AGC TTC GGA GAG GGG CTG CAG АТС

A3back: АТС CAT GCA AAT CCT СТА GAA TCC AGA GCA CAG TTT GTG GAG

Фрагмент ДНК и вектор расщепляли с использованием эндонуклеаз рестрикции HindIII к XbaI, лигировали и трансформировали в UT5600 (=pBAD-vWFA1/pBAD-vWFA3). Трансформированные клетки высевали на чашки с LB-агаром, содержащим 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина.

Плазмида pBAD-vWFA3 была трансформирована в UT5600 F-клетки, после чего клетки высевали на чашки с LB-агаром, содержащим 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Одиночная колония была использована для инокуляции среды LB, содержащей 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Клетки растили в течение ночи при 37°C и 200 оборотах в минуту. На следующий день клетки индуцировали добавлением арабинозы до конечной концентрации 0.2% и дополнительно инкубировали 1 час при 37°C и 150 оборотах в минуту. Тотальные клеточные лизаты кипятили в восстанавливающем буфере, разделяли электрофоретически в 12%-ном полиакриламидном геле, содержащем SDS (SDS-электрофорез) и осуществляли перенос на нитроцеллюлозный фильтр для Western-анализа. Перенесенные таким образом белки детектировали с использованием моноклонального анти-Oprl антитела (SH2.2) (Cote-Sierra et al., 1998, Gene. 221: 25-34). Далее использовали конъюгат анти-мышиного IgG со щелочной фосфатазой (Sigma) и блоты проявляли с использованием BCIP/NBT (фигура 5).

Плазмида pBAD-vWF-А3 была трансформирована в UT5600 F-клетки, после чего клетки высевали на чашки с LB-агаром, содержащим 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Одиночная колония была использована для инокуляции среды LB, содержащей 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Клетки растили в течение ночи при 37°C и 200 оборотах в минуту. На следующий день клетки индуцировали добавлением арабинозы до конечной концентрации 0,2% и дополнительно инкубировали 1 час при 37°C и 150 оборотах в минуту. Микротитрационный планшет в течение ночи при 4°C был сенсибилизирован раствором моноклонального анти-Oprl антитела (SH2.2), разведенным в PBS в соотношении 1/1000, и блокирован в течение 2-х часов при комнатной температуре с использованием PBS, содержащего 1% казеина. После индукции осуществляли связывание целых клеток с планшетом в течение одного часа при комнатной температуре. Затем планшеты отмывали пять раз с использованием раствора PBS-Tween. Препараты фагов из единичных колоний связывались с планшетом в течение двух часов при комнатной температуре. Затем планшеты отмывали пять раз с использованием раствора PBS-Tween. Анти-М13 - HRP конъюгат использовался для детекции связывания фагов с клетками Е.coli, экспрессирующими A3 домен, либо с нерелевантным антигеном на их поверхности. Планшеты отмывали пять раз с использованием раствора PBS-Tween. Окрашивание осуществлялось с использованием субстрата ABTS/H2O2 и сигналы были измерены по прошествии 30 минут при длине волны 405 нм. Результаты суммированы в таблице 7.

Пример 12. Экспрессия и очистка двухвалентных или биспецифичных VHH

Был сконструирован продукционный вектор рАХ11 для Е.coli (фигура 6), который позволяет осуществлять двухстадийное клонирование двухвалентных либо биспецифичных VHH.

Первым клонируется VHH, которое будет находиться на С-конце, с использованием эндонуклеаз рестрикции PstI и BstEII, тогда как на второй стадии вставляют второе VHH с использованием эндонуклеаз рестрикции SfiI и NotI, которые не имеют сайтов расщепления внутри последовательности первого гена. Данная процедура позволяет избежать введения новых сайтов путем амплификации и, таким образом, риска ведения ошибок в результате ПЦР. Последовательности представлены в таблице 30 (SEQ ID NO:8, 9, 10, 11 и 12).

Белок был экспрессирован и очищен, как описано в примере 6. Дополнительная стадия очистки с использованием superdex 75 была необходима для удаления некоторых одновалентных продуктов деградации (5-10%). Полученные выходы при экспрессии и очистке двухвалентных белков из 1 литра Е.coli суммированы в таблице 8.

Пример 13. Связывание с vWF в ELISA

Связывание с vWF тестировали методом ELISA, как описано в примере 7, и сравнивали со связыванием одновалентного VHH. Результаты приведены на фигуре 7. Из результатов четко следует, что двухвалентное и биспецифичное VHH проявляет более сильное связывание с vWF по сравнению с одновалентным VHH.

Пример 14. Ингибирование ELISA очищенными VHH

Ингибирование связывания VHH с коллагеном тестировали для одновалентных в сравнении с двухвалентными VHH, как описано в примере 5. В данном случае в параллельных пробах вместо очищенного VHH использовали плазму крови человека, бабуина и свиньи соответственно в разведении 1/60. Значения IC50 суммированы в таблице 9.

Пример 15. Стабильность двухвалентных или биспецифичных конструкций в плазме крови человека

Стабильность двухвалентных конструкций тестировали посредством инкубации при 37°C в плазме крови человека. АМ-4-15-3/АМ2-75 были инкубированы в плазме крови человека в концентрации 38 мкг/мл при 37°C. Пробы отбирали по прошествии 1, 2, 3, 6 и 24 часов инкубации. Пробы разводили в 10 раз и анализировали методом Western-анализа. Результаты суммированы на фигуре 8 и показывают, что двухвалентная конструкция стабильна в течение как минимум 24 часов при 37°C в плазме человека.

Пример 16. Оценка ингибирования VHH в условиях высокого срезывающего напряжения

Стеклянные покровные стекла (18×18 мм, Menzel Glaser) были отмыты в течение ночи раствором хромпика (2% трехокись хрома) и промыты дистиллированной водой перед напылением. Мономерный коллаген типа III был солюбилизирован в 50 ммоль/л уксусной кислоте и напылен на покровное стекло с плотностью 30 мкг/см2 с помощью ретушеровочного аэрографа (Badger model 100, Badger Brush Co). После процедуры напыления поверхность коллагена была блокирована в течение часа 1% раствором альбумина человека в PBS (10 ммоль/л фосфатный буфер, рН 7,4, и 0,15 моль/л NaCl) для предотвращения неспецифического связывания белков в течение последующей перфузии. Эксперименты по перфузии на поверхности коллагена типа III осуществляли в специально разработанной маленькой перфузионной камере с параллельными пластинами со строго определенными реологическими характеристиками, вмещающей покровное стекло. Цельная кровь была получена посредством венепункции у добровольцев. Кровь прокачивали через перфузионную камеру при помощи инфузионного насоса Harvard (pump 22, model 2400-004; Harvard, Natisk, MA). Время перфузии составляло 5 минут. Три покровных стекла были вставлены в камеру. 5 мл цельной крови были предварительно нагреты при 37°C в течение 5 минут в присутствии или без добавления VHH, затем кровь рециркулировала через камеру в течение 5 минут при уровне срезывающего напряжения на стенке, равном 300 с-1 либо 1600 с-1. Покровные стекла вынимали, промывали, фиксировали 0,05% глутаральдегидом, обезвоживали метанолом и прокрашивали Мау-Grunwald/Giemsa. Адгезия тромбоцитов была количественно оценена с помощью светового микроскопа (при 1000-кратном увеличении), соединенного с компьютеризированным анализатором изображений (AMS 40-10, Saffron Walden, UK). Адгезию тромбоцитов представляли как процент поверхности, покрытой тромбоцитами. Результаты суммированы в таблицах 10 и 11.

Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами (фигура 9).

Пример 17. Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами: пэннинг

Иммунопробирки сенсибилизировали раствором vWF 2 мкг/мл или PBS, содержащим 1% казеина. После инкубации в течение ночи при 4°C, пробирки были блокированы PBS, содержащим 1% казеина, в течение 3-х часов при комнатной температуре. В пробирки были добавлены 200 мкл фагов, и объем был доведен добавлением PBS до конечного объема 2 мл. После двух часов инкубации при комнатной температуре иммунопробирки промывали 10 раз с использованием раствора PBS-Tween и 10 раз раствором PBS. Связанные фаги были элюированы 2 мл 0,2 М глицинового буфера рН=2,4. Элюцию осуществляли в течение 20 минут при комнатной температуре. Элюированными фагами были инфицированы клетки TG1, находящиеся в стадии экспоненциального роста. После чего клетки были высеяны на чашки с питательной средой LB-агар, содержащей 100 мкг/мл ампициллина и 2% глюкозы. Результаты пэннинга представлены в таблице 12.

Пример 18. Скрипит на связывание с А1 доменом vWF

Вектор pBAD-Oprl-strep-spec использовался для того, чтобы А1 домен vWF в виде слитого белка с белком Oprl был экспонирован на поверхности клеток Е. сой UT5600 (F-ara-14 leuB6 azi-6 lacY1 proC14 tsx-67 entA403 trpE38 rfbD1 rpsL109 xy1-5 mt1-1 thi1 DompT fepC266) (Cote-Sierra et al., 1998, Gene, 221: 25-34). Ген, кодирующий А1 домен vWF (219 аминокислот), был амплифицирован при помощи ПЦР с использованием ПЦР-праймеров А1 for и A1 back.

A1for: CCG GTG AGC CCC ACC ACT СТА AGC TTG GAG GAC АТС TCG GAA CCG

A1back: CCC CAG GGT CGA AAC CCT СТА GAG CCC CGG GCC CAC AGT GAC

Фрагмент ДНК и вектор расщепляли с использованием эндонуклеаз рестрикции HindIII и XbaI, лигировали и трансформировали в UT5600 (=pBAD-vWFA1/pBAD-vWFA3). Трансформированные клетки высевали на чашки с LB-агаром, содержащим 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина.

Плазмида pBAD-vWFA1 была трансформирована в F- клетки UT5600, после чего клетки высевали на чашки с LB-агаром, содержащим 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Одиночная колония была использована для инокуляции среды LB, содержащей 20 мкг/мл стрептомицина, 50 мкг/мл спектиномицина. Клетки растили в течение ночи при 37°C и при 200 оборотах в минуту. На следующий день клетки индуцировали добавлением арабинозы до конечного содержания 0,2% и дополнительно (инкубировали 1 час при 37°C и 150 оборотах в минуту. Тотальные клеточные лизаты кипятили в восстанавливающем буфере, разделяли электрофоретически в 12%-ном полиакриламидном геле, содержащем SDS, и осуществляли перенос на нитроцеллюлозный фильтр для Western-анализа. Перенесенные таким образом белки детектировали с использованием моноклонального анти-Oprl антитела (SH2.2) (Cote-Sierra et al., 1998, Gene, 221: 25-34). Далее использовали конъюгат анти-мышиного IgG со щелочной фосфатазой (Sigma) и блоты проявляли с использованием BCIP/NBT (фигура 10).

ELISA проводили, как описано в примере 11. Результаты суммированы в таблице 13. Результаты свидетельствуют в пользу того, что получено VHH, специфичное к A1 домену vWF.

Пример 19. Отбор лигандов для vWF, ингибирующих взаимодействие с тромбоцитами: МАТСНМ

Клетки Е.coli, экспрессирующие A1 домен vWF (Пример 18), использовались для МАТСНМ эксперимента: клетки UT5600, трансформированные pBAD-Opri-A1, выращивали и индуцировали 0,2% арабинозой. Клетки промывали и инкубировали с фагами в течение одного часа при комнатной температуре. Эта смесь была промыта семь раз с использованием раствора PBS-Tween и фаги были элюированы при помощи TG1 клеток, находящихся в стадии экспоненциального роста. Мы осуществляли первый и второй раунд селекции. Результаты суммированы в таблице 14.

Пример 20. Связывание очищенных VHH с vWF в ELISA

VHH, специфичные к A1 домену vWF, были экспрессированы и очищены, как описано в примере 6. Эффективность связывания с vWF в ELISA была определена, как описано в примере 7. Результаты представлены на фигуре 11.

Пример 21. Ингибирование ELISA очищенным VHH

Микротитрационный планшет был сенсибилизирован раствором антител, специфичных к рецептору тромбоцитов gp1b, при концентрации 5 мкг/мл в PBS, в течение ночи при 4°C. Далее планшет промывали пять раз с использованием раствора PBS-Tween и блокировали в течение 2-х часов при комнатной температуре, используя 300 мкл 1% казеина в PBS. После чего планшет повторно промывали три раза с использованием раствора PBS-Tween. Рецептор тромбоцитов gp1b (gp1b) вносили в лунки планшета в концентрации 1 мкг/мл и осуществляли связывание в течение двух часов при комнатной температуре. Затем планшет отмывали пять раз с использованием раствора PBS-Tween. VHH (A38 (негативный контроль) и А50 (лиганд для vWFA1)) был добавлен в понижающейся концентрации. Плазма, содержащая VHH, была проинкубирована в течение пяти минут при 37°C при разведении 1/128. Ристоцетин был добавлен в конечной концентрации 760 мкг/мл, и смесь была добавлена к VHH. Эта смесь инкубировалась в течение 30 минут при комнатной температуре. После чего 100 мкл этой смеси вносили в лунку микротитрационного планшета и инкубировали в течение 90 минут при комнатной температуре. Затем планшет отмывали пять раз с использованием раствора PBS-Tween. Конъюгант моноклонального антитела анти-vWF с HRP разводили в PBS в 3000 раз и инкубировали в течение часа. Затем планшет отмывали пять раз с использованием раствора PBS-Tween и связывание vWF детектировали с использованием субстрата ABTS/H2O2. Сигналы были измерены по прошествии 30 минут при длине волны 405 нм. Результаты суммированы в фигуре 12.

Пример 22. Секвенирование клонов

Клоны были просеквенированы с использованием универсального обратного праймера М13. Аминокислотные последовательности представлены в таблице 30 (SEQ ID NO:23, 24, 25, 26, 27, 28, 29, 30 и 31).

Пример 23. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Эксперименты в условиях высокого срезывающего напряжения осуществляли, как описано в примере 16. Адгезию тромбоцитов выражали как процент поверхности, покрытой тромбоцитами. Результаты суммированы в таблицах 15 и 16.

Пример 24. Экспрессия и очистка двухвалентных VHH

Двухвалентные молекулы были сконструированы, как описано в примере 12. Последовательности представлены в таблице 30 (SEQ ID NO:32, 33 и 34). Белок был экспрессирован и очищен, как описано в примере 6. Была необходима дополнительная стадия очистки на superdex 75 для удаления некоторого количества одновалентных продуктов деградации (5-10%).

Пример 25. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Эксперименты в условиях срезывающего напряжения осуществляли, как описано в примере 16. Адгезию тромбоцитов выражали как процент поверхности, покрытой тромбоцитами. Результаты суммированы в таблицах 17 и 18.

Приготовление биспецифичных конструкций для vWF-специфичных VHH (фигура 13)

Пример 26. Устройство и последовательность биспецифичных конструкций

Конструкции были получены, как описано в примере 12, с использованием одного VHH, специфичного к vWF и ингибирующего взаимодействие с коллагеном, и второго VHH, также специфичного к vWF, но ингибирующего взаимодействие с рецептором тромбоцитов gp1b. Последовательности представлены в таблице 30 (SEQ ID NO:20, 21 и 22).

Пример 27. Экспрессия и очистка биспецифичных конструкций

Белок был экспрессирован и очищен, как описано в примере 6. Была необходима дополнительная стадия очистки на superdex 75 для удаления некоторого количества одновалентных продуктов деградации (5-10%). Выходы, полученные после экспрессии и очистки биспецифичного белка из 1 л культуры клеток Е.coli, суммированы в таблице 19.

Пример 28. Связывание с vWF

Связывание с vWF определяли методом ELISA, как описано в примере 7. Результаты представлены на фигуре 14.

Пример 29. Сравнение ингибирования связывания vWF с коллагеном биспецифичными конструкциями и одновалентными VHH

Ингибирование связывания vWF с коллагеном одновалентными в сравнении с ингибированием биспецифичными конструкциями определяли, как описано в примере 5. Значения IC50 суммированы в таблице 20.

Пример 30. Оценка ингибирования посредством VHH в условиях высокого срезывающего напряжения

Эксперименты в условиях срезывающего напряжения осуществляли, как описано в примере 16. Адгезию тромбоцитов выражали как процент поверхности, покрытой тромбоцитами. Результаты суммированы в таблицах 21 и 22.

Скрининг на лиганды для коллагена типа I и типа III

Пример 31. Отбор лигандов для коллагена типа I

Микротитрационный планшет был сенсибилизирован коллагеном типа I в концентрации 25 мкг/мл. Фаги были получены, как описано в примере 3, далее осуществлялось их связывание с лунками микротитрационного планшета после внесения их в лунки, который блокировали в течение двух часов. После промывания фаги элюировали 0,1 М глициновым буфером рН=4,5. Результаты суммированы в таблице 23.

Пример 32. Тестирование связывания VHH с коллагеном типа I и типа III методом ELISA

Клоны тестировали на связывание методом ELISA, как описано в примере 7, но в данном случае лунки микротитрационного планшета были сенсибилизированы коллагеном типа I или типа III в концентрации 25 мкг/мл в PBS. Результаты суммированы в таблице 24.

Пример 33. Секвенирование клонов

Клоны были просеквенированы с использованием универсального обратного праймера М13. Аминокислотные последовательности представлены в таблице 30 (SEQ ID NO:35, 36 и 37).

Пример 34. Связывание очищенных VHH с коллагеном типа I и типа III

VHH были экспрессированы и очищены, как описано в примере 6. Микротитрационный планшет был сенсибилизирован коллагеном типа I или типа III в концентрации 25 мкг/мл и блокирован. Лиганды вносились в двукратных разведениях, и связывание детектировали, как описано в примере 7. Результаты представлены на фигуре 16.

Пример 35. Отбор лигандов для коллагена типа I, ингибирующих взаимодействие с vWF

Микротитрационный планшет был сенсибилизирован коллагеном типа I в концентрации 25 мкг/мл. Фаги были получены, как описано в примере 3, и далее осуществлялось их связывание с лунками микротитрационного планшета после внесении их в лунки, который блокировали в течение двух часов. После промывания фаги элюировали vWF в концентрации 300 мкг/мл. Второй и третий раунды отбора осуществляли таким же способом.

Пример 36. Тестирование связывания VHH с коллагеном типа I и типа III методом ELISA

Клоны тестировали на связывание с коллагеном типа I и типа III методом ELISA, как описано в примере 34.

Пример 37. Секвенирование клонов

Клоны были просеквенированы с использованием универсального обратного праймера М13.

Пример 38. Связывание очищенных VHH с коллагеном типа I и типа III

VHH были экспрессированы и очищены, как описано в примере 6. Микротитрационный планшет был сенсибилизирован коллагеном типа I или типа III в концентрации 25 мкг/мл и блокирован. Лиганды вносились в двукратных разведениях, и связывание детектировали, как описано в примере 34.

Пример 39. Тестирование ингибирования связывания vWF с коллагеном коллаген-специфичными VHH методом ELISA

Тестирование ингибирования связывания проводили, как описано в примере 5.

Пример 40. Тестирование ингибирования агрегации тромбоцитов коллаген-специфичными VHH в условиях низких и высоких срезывающих напряжений

Эксперименты в условиях срезывающего напряжения осуществляли, как описано в примере 16. Адгезию тромбоцитов выражали как процент поверхности, покрытой тромбоцитами.

Увеличение времени полужизни VHH

Пример 41. Иммунизация ламы

Одна лама была иммунизирована сывороточным альбумином человека (HAS). Схема иммунизации приведена в таблице 25.

Пример 42. Репертуарное клонирование

Библиотека была получена, как описано в примере 2. Размер библиотеки соответствовал 2×107 к.о.е., и все клоны содержали вставку нужного размера.

Пример 43. Создание библиотеки, приготовление фагов

Фаги были приготовлены, как описано в примере 3.

Пример 44. ELISA фагов

Микротитрационный планшет (Maxisorp) был сенсибилизирован раствором 1% казеина в PBS или сывороточного альбумина человека (HSA) с концентрацией 5 мкг/мл в течение ночи при 4°C. Планшет был промыт три раза с использованием раствора PBS-Tween (0,05% Tween20) и блокирован в течение 2 часов при комнатной температуре 200 мкл раствора 1% казеина в PBS. Затем планшет промывали пять раз с использованием раствора PBS-Tween. Фаги были приготовлены, как описано выше, и внесены в лунки в последовательных двукратных разведениях. Затем планшеты отмывали пять раз с использованием раствора PBS-Tween. Связанные фаги детектировали при помощи конъюгата мышиного моноклонального антитела анти-М13 с пероксидазой хрена (horse radish peroxidase, HRP), разведенного 1 к 2000 раствором PBS. Планшеты отмывали пять раз с использованием раствора PBS-Tween. Окрашивание осуществлялось с использованием субстрата ABTS/H2O2 и сигналы были измерены по прошествии 30 минут при длине волны 405 нм. Результаты представлены на фигуре 17 и свидетельствуют о наличии в библиотеке специфичных к HSA наночастиц.

Пример 45. Отбор: первый и второй раунд биопэннинга

Лунки микротитрационного планшета были сенсибилизированы раствором сывороточного альбумина мыши (MSA) с концентрацией 10 мг/мл или раствором 1% казеина в PBS. После инкубации при 4°C в течение ночи лунки были блокированы PBS, содержащим 1% казеин, в течение 3 часов при комнатной температуре. 200 мкл фагов был добавлено в лунки. После 2 часов инкубации при комнатной температуре лунки были промыты 10 раз с использованием раствора PBS-Tween и 10 раз PBS. Связанные фаги элюировали 100 мкл 0,2 М глицинового буфера с рН=2,4. Элюции осуществляли в течение 20 минут при комнатной температуре. Элюированными фагами были инфицированы TG1 клетки Е.coli, находящиеся в стадии экспоненциального роста, после чего клетки были высеяны на чашки с питательной средой LB-агар, содержащей 100 мкг/мл ампициллина и 2% глюкозы. Второй раунд поводили в тех же условиях, как описано выше. Результаты суммированы в таблице 26.

Пример 46. Скрининг индивидуальных клонов после биопэннинга

ELISA: связывание с сывороточным альбумином человека (HSA) и сывороточным альбумином мыши (MSA)

Экстракты периплазмы были получены, как описано в примере 6. Микротитрационный планшет был сенсибилизирован раствором сывороточного альбумина человека (HSA) с концентрацией 5 мкг/мл, сывороточного альбумина мыши (MSA) с концентрацией 5 мкг/мл или раствором 1% казеина в PBS в течение ночи при 4°C. Планшеты были блокированы в течение 2 часов при комнатной температуре 300 мкл раствора 1% казеина в PBS. Планшеты промывали три раза с использованием раствора PBS-Tween. Фракция периплазмы была получена для 23 индивидуальных клонов после первого и второго раунда отбора, и ей давали связываться с лунками микротитрационного планшета. Планшеты промывали шесть раз с использованием раствора PBS-Tween, после этого проводили детекцию связывания наночастиц посредством инкубации с мышиным анти-гистидиновым моноклональным антителом Serotec MCA 1396 (разведение 1/1000) в PBS в течение 1 часа при комнатной температуре и последующей инкубации в течение 1 часа при комнатной температуре с конъюгатом вторичных анти-мышиных антител со щелочной фосфатазой, разведенным PBS 1/2000. Для окрашивания использовали субстрат PNPP (паранитрофенилфосфат, 2 мг/мл в 1 М диэтаноламине, 1 мМ Mg2SO4, рН=9,8), сигналы регистрировали по прошествии 30 минут при длине волны 405 нм. Результаты суммированы в таблице 27.

Пример 47. Распределение фрагментов после рестрикции эндонуклеазой Hinfl и секвенирование

На клонах с положительным ответом проводили ПЦР после второго раунда пэннинга, используя набор праймеров, связывающихся с последовательностью вектора. ПЦР-продукт был рестрицирован эндонуклеазой Hinfl и нанесен на агарозный гель. Для дальнейшего анализа были отобраны 4 клона с разным распределением фрагментов после рестрикции эндонуклеазой Hinfl. Эти клоны были секвенированы, полученные результаты суммированы в таблице 30 (SEQ ID NO:16, 17, 18 и 19).

Пример 48. Тестирование перекрестного взаимодействия с альбумином разных видов животных

Был проведен SDS-электрофорез в полиакриламидном геле и блоттинг на нитроцеллюлозную мембрану препаратов плазмы (разведение 1/10) из разных видов животных (бабуин, свинья, хомяк, человек, крыса, мышь и кролик). Фаги были получены, как описано в примере 3, для клонов MSA 21, MSA 24, MSA 210, MSA 212 и для нерелевантной наночастицы. Фаги были использованы для связывания с нитроцеллюлозой с перенесенными блоттингом сывороточными альбуминами, далее несвязавшиеся фаги отмывали. Связывание детектировали при помощи конъюгата анти-М13 поликлонального антитела с пероксидазой хрена при использовании для детекции субстрата DAP. Результаты представлены на фигуре 18.

Из этих результатов можно сделать вывод, что все 4 лиганда являются перекрестно-реагирующими с сывороточными альбуминами свиньи, человека, мыши (в меньшей степени для MSA212) и хомяка. MSA 21 является также перекрестно-реагирующим с сывороточным альбумином кролика. С нерелевантной наночастицей связывания не наблюдалось (не показано). В контрольном эксперименте SDS-электрофорез в полиакриламидном геле был проведен с разными пробами плазмы, разведенными 1/100 PBS. Гель был прокрашен кумасси. Из фигуры 19 мы можем сделать вывод, что уровни альбумина во всех препаратах плазмы являются высокими, за исключением плазмы кролика с низкими уровнями альбумина.

Пример 49. Экспрессия и очистка

Белок был экспрессирован и очищен, как описано в примере 6.

Пример 50. ELISA очищенных наночастиц на MSA

Микротитрационный планшет был сенсибилизирован раствором MSA с концентрацией 5 мкг/мл в течение ночи при 4°C. После промывки планшет был блокирован в течение 2-х часов при комнатной температуре 1%-ым раствором казеина в PBS. Пробы в двойной повторности были нанесены, начиная с концентрации 2500 нМ с последующими разведениями 1/3, и связывание осуществлялось в течение 2-х часов при комнатной температуре. Поликлональная кроличья сыворотка против наночастицы была добавлена при разведении 1/1000 (К208) и проба инкубировалась в течение 1 часа при комнатной температуре. Для детекции использовали конъюгат анти-кроличьих антител со щелочной фосфатазой при разведении 1/1000 и прокрашивание с субстратом PNPP. Результаты представлены на фигуре 20.

Пример 51. Устройство и последовательность биспецифичных конструкций

Биспецифичные конструкции были получены с использованием одного VHH, специфичного к альбумину (MSA21), и второго VHH, специфичного к vWF (фигура 21). Конструкции были получены, как описано в примере 12. Последовательности представлены в таблице 30 (SEQ ID NO: 13, 14 и 15).

Пример 52. Экспрессия и очистка биспецифичных конструкций

Белок был экспрессирован и очищен, как описано в примере 6. Была необходима дополнительная стадия очистки на superdex 75 для удаления некоторого количества одновалентных продуктов деградации (5-10%).

Пример 53. Функциональность обоих VHH в биспецифичных конструкциях

Микротитрационный планшет был сенсибилизирован раствором мышиного сывороточного альбумина с концентрацией 5 мкг/мл в течение ночи при 4°C. После промывки планшет был блокирован в течение 2-х часов 1%-ым раствором казеина в PBS. Связывание биспецифичных белков в лунках осуществлялось в течение 2-х часов при комнатной температуре. После отмывания планшета плазма крови человека, собаки и свиньи была добавлена в различных разведениях, связывание осуществлялось в течение 2-х часов при комнатной температуре. Связывание vWF детектировали с конъюгатом анти-vWF-пероксидаза хрена (DACO) при разведении 1/3000. Для окрашивания использовали субстрат АВТS/Н2O2. Результаты представлены на фигуре 22 и указывают на то, что функциональность обоих VHH в биспецифичной конструкции сохраняется.

Пример 54. Сравнение ингибирования связывания vWF с коллагеном биспецифичными конструкциями и одновалентными VHH

Ингибирование связывания vWF с коллагеном одновалентными в сравнении с ингибированием биспецифичными конструкциями определяли, как описано в примере 5. Значения IC50 суммированы в таблице 28. Результаты указывают на то, что ингибиторные свойства VHH в биспецифичной конструкции сохраняются.

Отбор лигандов для gp1b, ингибирующих взаимодействие с vWF (фигура 23)

Иммунизация, репертуарное клонирование и получение фагов были осуществлены, как описано в примерах 1, 2, 3.

Пример 55. Отбор лигандов для gp1b

Микротитрационный планшет был сенсибилизирован раствором мышиного моноклинального антитела (mАВ) против rgp1b. Планшет был блокирован и rgp1b связывался в течение 2-х часов при комнатной температуре при концентрации 5 мкг/мл. Планшет был промыт. Фаги были получены, как описано выше, далее осуществлялось их связывание в лунках микротитрационного планшета. После промывки планшета фаги элюировали 0,1 М глициновым буфером рН=4,5. Второй раунд пэннинга осуществляли таким же образом.

Пример 56. Скрининг на лиганды с помощью ELISA

Экстракты периплазмы были получены, как описано в примере 6. Супернатант вносили в лунки, сенсибилизированные mАВ и затем gp1b, как описано в Примере 55. Серии разведении всех очищенных препаратов инкубировали в течение 2-х часов при комнатной температуре. Затем планшеты промывали шесть раз с использованием раствора PBS-Tween, после чего детектировали связывание VHH посредством инкубации с конъюгатом мышиного анти-His моноклонального антитела с пероксидазой хрена в разведении 1/2000 в PBS в течение 1 часа при комнатной температуре, за которым следовало окрашивание с использованием субстрата АВТS/Н2О2. Сигналы регистрировали по прошествии 30 минут при длине волны 405 нм.

Пример 57. Связывание очищенных VHH с gp1b

Фракции периплазмы были получены, как описано в примере 6. Супернатант, содержащий WH, был нанесен на Ni-NTA и очищен до гомогенного состояния. Выход VHH был рассчитан в соответствии с коэффициентом экстинции. ELISA проводилась, как описано в примере 55.

Пример 58. Секвенирование клонов

Клоны были просеквенированы с использованием универсального обратного праймера М13.

Пример 59. Тестирование ингибиторных свойств VHH, специфичных к gp1b

Ингибиторные свойства VHH были тестированы методом ELISA, как описано в примере 21.

Пример 60. Оценка ингибирования VHH в условиях высокого срезывающего напряжения

Эксперименты в условиях срезывающего напряжения осуществляли, как описано в примере 16. Адгезию тромбоцитов выражали как процент поверхности, покрытой тромбоцитами.

Покрытие эндопротезов, трубок, баллонов для эндопротезирования, катетеров и трансплантационного материала VHH

Пример 61. Стабильность VHH

VHH C37 инкубировали при 37°C и измеряли ингибирование связывания VHH с коллагеном в разные временные точки посредством использования метода ELISA, как описано в Примере 7. Результаты, которые сравнивали с результатами ингибирования VHH, хранящимся при -20°C, представлены на Фигуре 24. Для сравнения показаны активности scFv против В3 антигена (Renter et al., Protein Engineering, 1994, 7: 697-704) и названного scFv, модифицированного посредством введения дисульфидной связи между каркасными остатками 44 и 105 для увеличения его стабильности (dsFv). Было показано, что dsFv теряет 40% активности после 60-ти часов инкубации при 37°C. После одного года инкубации при 37°C были проанализированы ингибиторные свойства C37 в сравнении со свойствами C37, хранящегося в морозильной камере. ELISA проводили в соответствии с методикой, описанной в примере 5, с плазмой крови человека при конечном разведении 1/200. Результаты представлены на фигуре 25 и указывают на то, что функциональные свойства полностью сохраняются (значение IC50 составляет 0,085 мкг/мл для C37, хранящегося при 37°C, против 0,1 мкг/мл для C37, хранящегося при -20°C). Исходя из полученных данных можно ожидать, что VHH будет иметь длительный срок хранения.

Пример 62. Иммобилизация VHH в полимере

Смесь была приготовлена из 0,5 мл 30%-ного акриламида, 1 мл 1М Трис (Tris) рН=7,5, 3,5 мл H2O, 35 мкл 10%-ного персульфата аммония, 3,5 мкл TEMED. В некоторые лунки был добавлен VHH C37 до конечной концентрации 10 мкг/мл. Смесь полимеризовалась в лунках 96-луночного микротитрационного планшета в течение 3-х часов при комнатной температуре. Плазма крови человека была добавлена в разных разведениях начиная с неразведенной плазмы. После одного часа инкубации при комнатной температуре планшет был промыт, затем был добавлен конъюгат анти-VHH-пероксидаза хрена (DACO) в разведении 1/2000, затем производилась инкубация в течение одного часа при комнатной температуре. После промывки планшета был добавлен субстрат ABTS/H2O2, оптическую плотность измеряли при длине волны 405 нм. Результаты представлены на фигуре 26. Результаты указывают на то, что VHH сохраняет свои функциональные свойства при иммобилизации в полимере.

Гуманизация С37

Пример 63. Выравнивание С37 с DP-47

Выравнивание С37 наночастицы (SEQ ID NO:1) и человеческого VH3 зародышевой линии (DP-47) выявило высокую степень гомологии:

- 4 аминокислотные замены в FR1 в позиции 1, 5, 28 и 30

- 4 аминокислотные замены в FR3 в позиции 74, 75, 84 и 94

- 3 аминокислотные замены в FR4 в позиции 104, 108 и 111, как показано на фигуре 27.

Пример 64. Мутагенез С37

С37 был мутирован при использовании метода сайт-направленного мутагенеза, не основанного на полимеразной цепной реакции, в соответствии с методикой, описанной Chen и Ruffner (Chen and Ruffner, Amplification of closed circular DNA in vitro. Nucleic Acids Research, 1998, 1126-1127) и коммерциализованной Stratagene (Quickchange site-directed mutagenesis).

Плазмидная ДНК была использована в качестве матрицы в комбинации с двумя мутагенными праймерами (таблица 29), вводящими определенную мутацию (мутации). Использовали два праймера, каждый из которых комплементарен противоположным цепям матричной плазмидной ДНК. В полимеразной реакции с использованием Pfu ДНК-полимеразы каждая цепь удлинялась начиная с последовательности праймера в течение циклической программы при использовании ограниченного количества циклов. Это приводило к получению смеси цепей дикого типа и мутированных цепей. Расщепление эндонуклеазой рестрикции DpnI полученной смеси приводит к отбору мутированной синтезированной in vitro ДНК. ДНК осаждали и трансформировали в Е.coli, а затем анализировали на предмет требуемых мутаций посредством анализа последовательности. Клон с нужной последовательностью был назван C37-hum, аминокислотная последовательность представлена в таблице 30 SEQ ID NO:2.

Экспрессия и очистка C37-hum осуществлялись, как описано в примере 6. Ингибирование связывания vWF с коллагеном для С347 сравнивали с эффективностью связывания для C37-hum, как описано в примере 5. Результаты представлены на фигуре 28. Они четко показывают, что гуманизированная версия С37 полностью сохраняет функциональные свойства.

Позициями, которые, тем не менее, нуждаются в гуманизации, являются: Q1, Q5, D104, Q108 и I111. Мы можем гуманизировать позиции 1 и 5 без потери ингибирования постольку, поскольку эти аминокислоты были введены праймером и не представлены в нативной последовательности ламы. Мы можем также гуманизировать позицию 111, поскольку мы выделили VHH, идентичный С37 во всем, кроме замены I111V (АМ-2-75 SEQ ID NO:3), с теми же самыми функциональными характеристиками (пример 9 и таблица 6).

Аминокислота в положении 108 VHH мозоленогих экспонирована в раствор, в то время как в антителах человека это положение погружено в области контакта VH и VL доменов (Spinelli, 1996; Nieba, 1997). В изолированных доменах VH положение 108 экспонировано в раствор. Введение неполярного гидрофобного лейцина вместо полярного незаряженного глицина может приводить к драматическому изменению присущей данной молекуле способности к сворачиванию/стабильности.

Фрагменты анти-vWF VHH

Пример 65. Экспрессия VHH-CDR3 фрагмента vWF-C37

CDR3 участок С37 был амплифицирован с использованием смыслового праймера, локализованного в области каркасного участка 4 (Прямой: CCCCTGGTCCCAGTTCCCTC) и антисмыслового праймера, локализованного в области каркасного участка 3 (Обратный: TGTGCTCGCGGGGCCGGTAC).

Для клонирования CDR-3 фрагмента в pAX10 был осуществлен второй раунд амплификации посредством ПЦР со следующими праймерами, обеспечивающими введение необходимых сайтов рестрикции:

Обратный праймер SfiI:

GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCTCGCGGGGCCGGTAC

Прямой праймер NotI:

GTCCTCGCAACTGCGCGGCCGCCCCCTGGTCCCAGTTCCCTC

ПЦР проводили в объеме реакционной смеси 50 мкл используя 50 пмоль каждого праймера. Условия реакции первичной ПЦР -11 минут при 94°C, вслед за этим проводили 30 циклов 30/60/120 секунд при 94/55/72°C соответственно и инкубацию 5 минут при 72°C. Все реакции осуществляли с 2,5 мМ MgCl2, 200 мкМ dNTP и 1,25 ед. полимеразы (AmpliTaq Gold DNA polymerase, Roche Diagnostics, Brussels, Belgium).

После расщепления эндонуклеазами рестрикции SfiI и NotI продукт полимеразной цепной реакции клонировали в pAX10

Выделение конформационно-специфичных анти-vWF VHH

Пример 66. Отбор на рекомбинантном A1 (rA1) в первом и втором раундах биопэннинга

Микротитрационный планшет был сенсибилизирован раствором рекомбинантного А1 домена vWF (rA1) с концентрацией 5 мкг/мл или 1%-ным раствором казеина в PBS. После инкубации в течение ночи лунки были блокированы в течение 3-х часов при комнатной температуре 1%-ным раствором казеина в PBS. 200 мкл фагов было добавлено в лунки. После инкубации в течение 2-х часов при комнатной температуре лунки были промыты 10 раз раствором PBS-Tween и 10 раз раствором PBS. Связанные фаги были элюированы 100 мкл 0,2 М глицинового буфера рН=2,4. Элюцию осуществляли в течение 20 минут при комнатной температуре. Элюированными фагами были инфицированы TG1 клетки, находящиеся в стадии экспоненциального роста. После чего клетки были высеяны на чашки с питательной средой LB-агар, содержащей 100 мкг/мл ампициллина и 2% глюкозы. Второй раунд осуществляли в условиях, описанных выше, за исключением того, что фаги были ресуспендированы в vWF 10 мкг/мл. Лунки микротитрационного планшета были промыты 7 раз по 30 минут раствором 10 мкг/мл vWF. Результаты представлены в таблице 31.

Пример 67. Скрининг индивидуальных клонов после биопэннинга ELISA: связывание с rA1 и vWF

Одиночную колонию засевали для получения ночной культуры в среду LB, содержащую 2% глюкозы и 100 мкг/мл ампициллина. Эта ночная культура была разведена в 100 раз средой ТВ, содержащей ампициллин 100 мкг/мл, и инкубировалась при 37°C до оптической плотности при 600 нм, равной 0,5. 1 мМ IPTG добавляли в культуру и инкубировали ее в течение дополнительных 3 часов при 37°C либо в течение ночи при 28°C. Культуры центрифугировали 20 минут при 10000 оборотов в минуту при 4°C. Осадок замораживали в течение ночи либо в течение одного часа при -20°C. После этого осадок размораживали при комнатной температуре в течение 40 минут, затем ресуспендировали в PBS и встряхивали на льду 1 час. Фракцию периплазмы получали посредством центрифугирования в течение 20 минут при 20000 оборотов в минуту при 4°C. Супернатант, содержащий VHH, использовали для дальнейшего анализа.

Микротитрационный планшет был сенсибилизирован раствором rA1 с концентрацией 2 мкг/мл или vWF с концентрацией 1 мкг/мл в течение ночи при 4°C. Планшеты были блокированы в течение 2-х часов при комнатной температуре 300 мкл 1%-ного раствора казеина в PBS. Планшеты промывали три раза раствором PBS-Tween. Фракцию периплазмы получали из 192 индивидуальных клонов после второго раунда селекции и добавляли в лунки микротитрационного планшета для осуществления связывания. Планшеты промывали шесть раз раствором PBS-Tween, после чего связывание наночастиц детектировали посредством инкубации с поликлональной кроличьей сывороткой против наночастиц (разведение 1/2000) в PBS в течение 1 часа при комнатной температуре и последующей инкубации в течение 1 часа при комнатной температуре с конъюгатом козьих анти-кроличьих антител с пероксидазой хрена (разведение 1/2000) в PBS. Окрашивание проводили с использованием субстрата ABTS/H2O2. Сигналы были измерены по прошествии 30 минут при длине волны 405 нм. Результаты суммированы в таблице 32. Мы можем заключить, что 50 клонов связываются с rА1 и не связываются с vWF.

Пример 68. Распределение фрагментов после рестрикции эндонуклеазой Hinfl и секвенирование

После второго раунда пэннинга на клонах с положительным ответом на rА1 и с негативным ответом на vWF проводили ПЦР, используя набор праймеров, связывающихся с последовательностью вектора. ПЦР-продукт был рестрицирован эндонуклеазой Hinfl и нанесен на агарозным гель. Для дальнейшего анализа были отобраны 30 клонов с разным распределением фрагментов после рестрикции эндонуклеазой Hinfl. Эти клоны анализировали более детально методом ELISA, как описано в примере 67. Было четко показано, что 4 из 30 клонов проявляют гораздо большую аффинность к rА1, чем к vWF. Данные представлены на фигуре 29 (связывание с rА1) и 30 (связывание с vWF). Эти клоны были секвенированы, полученные результаты суммированы в Таблице 30 (SEQ ID NO: с 62 по 65).

Пример 69. Ингибирование ELISA

Ингибирование связывания vWF с gp1b наночастицами оценивали методом ELISA. Микротитрационный планшет был сенсибилизирован в течение ночи при 4°C раствором антител, специфичных к рецептору gp1b тромбоцитов, при концентрации в PBS - 5 мкг/мл. Далее планшет промывали пять раз с использованием раствора PBS-Tween и блокировали в течение 2-х часов при комнатной температуре, используя 300 мкл 1% казеина в PBS. После чего планшет повторно промывали три раза с использованием раствора PBS-Tween. В лунки микротитрационного планшета вносили плазму крови в разведении 1/2 и осуществляли связывание в течение полутора часов при 37°C. Планшет промывали пять раз с использованием раствора PBS-Tween. VHH добавляли в понижающихся концентрациях. Плазма, содержащая vWF, была проинкубирована в течение пяти минут при 37°C при разведении 1/50. Ристоцетин был добавлен в конечной концентрации 1 мг/мл и смесь была добавлена к VHH. Эта смесь инкубировалась в течение одного часа при 37°C. После чего 50 мкл этой смеси вносили в лунку микротитрационного планшета и инкубировали в течение 90 минут при 37°C. Затем планшет отмывали пять раз с использованием раствора PBS-Tween. Вносили в лунки конъюгат моноклонального антитела анти-vWF с пероксидазой хрена, разведенный в PBS в 3000 раз, и инкубировали в течение часа. Затем планшет отмывали пять раз с использованием раствора PBS-Tween и связывание vWF детектировали с использованием субстрата ABTS/H2O2. Сигналы были измерены по прошествии 30 минут при длине волны 405 нм.

Краткое описание фигур

Фигура 1, Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов.

Фигура 2. Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов. Показано VHH, ингибирующее взаимодействие между vWF и коллагеном.

Фигура 3. Связывание очищенного VHH с vWF при регистрации методом ELISA, как описано в примере 7.

Фигура 4. Тестирование ингибирования VHH связывания vWF с коллагеном методом ELISA, как описано в примере 9.

Фигура 5. Результат, полученный методом Western-блоттинга, демонстрирующий экспрессию A3 домена vWF в виде слитого с Oprl белка, на поверхности клеток E.coli, как описано в примере 11.

Фигура 6. Рестрикционная карта сайта множественного клонирования РАХ011, используемого для конструирования двухвалентных и биспецифичных наночастиц.

Фигура 7. Связывание одновалентных VHH с очищенным vWF в сравнении со связыванием двухвалентных и биспецифичных VHH в анализе ELISA, как описано в примере 13.

Фигура 8. Стабильность биспецифичных VHH в плазме человека при инкубации при 37°C в течение 24 часов, как описано в примере 15.

Фигура 9. Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов. Показано VHH, ингибирующий взаимодействие между vWF и тромбоцитами.

Фигура 10. Результат, полученный методом Western-блоттинга, демонстрирующий экспрессию А1 домена vWF в виде слитого с Oprl белка, на поверхности клеток E.coli, как описано в примере 18.

Фигура 11. Связывание очищенного VHH с vWF при регистрации методом ELISA, как описано в примере 20.

Фигура 12. Ингибирование связывания gp1b с vWF посредством А50 и A38 (негативный контроль), как описано в примере 21.

Фигура 13. Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов. Представлена биспецифичная конструкция, содержащая одно VHH, специфичное к vWF и ингибирующее взаимодействие vWF с коллагеном, и второе VHH, специфичное к vWF, но ингибирующее взаимодействие между vWF и тромбоцитами.

Фигура 14. Связывание с vWF в ELISA, как описано в примере 28.

Фигура 15. Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов. Показано VHH, специфичное к коллагену, ингибирующее взаимодействие между vWF и коллагеном.

Фигура 16. Связывание очищенного VHH с коллагеном типа I и типа III при регистрации методом ELISA, как описано в примере 34.

Фигура 17. Анализ фагов методом ELISA, демонстрирующий наличие в библиотеке HSA-специфичных наночастиц, как описано в примере 44.

Фигура 18. Связывание фагов, экспрессирующих лиганды для альбумина, с плазмой, перенесенной блоттингом на нитроцеллюлозу, как описано в примере 48.

Фигура 19. Окрашивание кумасси препаратов плазмы после проведения SDS-электрофореза, как описано в примере 48.

Фигура 20. Связывание очищенных наночастиц с альбумином мыши при регистрации методом ELISA, как описано в примере 50.

Фигура 21. Биспецифичная конструкция, содержащая одно VHH, связывающееся с альбумином, и второе VHH, связывающееся с vWF, сконструированная с целью увеличения времени полужизни, как описано в примере 51.

Фигура 22. Демонстрация функциональности обоих VHH в биспецифичной конструкции при использовании метода сэндвич-ELISA, как описано в примере 53.

Фигура 23. Взаимодействия, вовлеченные в первые стадии агрегации тромбоцитов. Показано VHH, специфичное к gplb, ингибирующее взаимодействие между vWF и тромбоцитами.

Фигура 24. Остаточная активность С37, хранившегося при -20°C, в сравнении с активностью С37, хранившегося при 37°C, вплоть до 194 часов. Стабильность С37 сравнивается со стабильностью scFv, специфичного к В3-антигену, и его стабилизированной формы, dsFv (стабилизирована двумя дисульфидными связями), как описано в примере 61.

Фигура 25. Ингибирующая активность С37, хранившегося при -20°C, в сравнении с активностью С37, хранившегося при 37°C в течение 1 года, как описано в примере 61.

Фигура 26. Связывание vWF из плазмы человека с С37, иммобилизованным в акриламиде, как описано в примере 62.

Фигура 27. Выравнивание аминокислотной последовательности С37 с последовательностью DP-47 зародышевой линии человека, как описано в примере 63.

Фигура 28. Ингибирование связывания vWF с коллагеном при использовании С37 и C37hum, зарегистрированное методом ELISA, как описано в примере 64.

Фигура 29. Связывание клонов A11, А12, А13, А14, А15 и А16 с rА1 при регистрации методом ELISA.

Фигура 30. Связывание клонов А11, А12, А13, А14, А15 и А16 с vWF при регистрации методом ELISA.

ТАБЛИЦЫ

Таблица 1. Схема, использованная для иммунизации ламы 002, в соответствии с примером 1.

Таблица 2. Бляшкообразующие единицы (б.о.е.) после одного или двух раундов пэннинга на vWF в сравнении с PBS-казеином, как описано в примере 4. Б.о.е. для vWF (антиген), поделенное на б.о.е. казеина (неспецифическое связывание) = степень обогащения.

Таблица 3. Количество ингибиторов против количества клонов, протестированных после первого и второго раундов пэннинга, как описано в примере 5.

Таблица 4. Выход (мг/литр культуры) после экспрессии и очистки VHH, синтезированных в клетках E.coli WK6, как описано в примере 6.

Таблица 5. Оптическая плотность при 405 нм (OD 405) для связывания VHH в ELISA с vWF и 3-мя антигенами, которыми также иммунизировалась лама 002 в соответствии с примером 8.

Таблица 6. Концентрация VHH (нМ), необходимая для ингибирования связывания vWF с коллагеном на 50% (IC50), как описано в примере 9.

Таблица 7. Эпитопное картирование связывания VHH с vWF и ингибирование взаимодействия с коллагеном, как описано в примере 11.

Таблица 8. Выход очищенного белка (мг) на литр культуры для двухвалентных и биспецифичных VHH, как описано в примере 12.

Таблица 9. Значения IC50 для одновалентных по сравнению с двухвалентными и биспецифичными VHH. Ингибирование тестировалось с плазмой человека, свиньи и бабуина, как описано в примере 14.

Таблица 10. Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 с-1), как описано в примере 16.

Таблица 11. Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 с-1), как описано в примере 16.

Таблица 12. Бляшкообразующие единицы (б.о.е.) после одного раунда пэннинга на vWF, как описано в примере 17. Б.о.е. vWF (антиген), поделенное на б.о.е. для казеина (неспецифическое связывание) = степень обогащения.

Таблица 13. Результаты скрининга в ELISA индивидуальных колоний на связывание с vWF и А1 доменом vWF, как описано в примере 18.

Таблица 14. Результаты, полученные после одного раунда МАТСНМ на клетках pBAD-Oprl-A1, как описано в примере 19.

Таблица 15. Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 с-1), как описано в примере 23.

Таблица 16. Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 с-1), как описано в примере 23.

Таблица 17. Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях гидродинамических сдвигах (1600 с-1), как описано в примере 25.

Таблица 18. Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 с-1), как описано в примере 25.

Таблица 19. Выход после экспрессии и очистки биспецифичных конструкций, как описано в примере 27.

Таблица 20. Значения IC50 для наночастиц, биспецифичных к А1 и A3 домену vWF, как описано в примере 29.

Таблица 21. Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях сдвигах (1600 с-1), как описано в примере 30.

Таблица 22. Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 с-1), как описано в примере 30.

Таблица 23. Формирующие бляшки единицы (б.о.е.) после одного раунда пэннинга на коллагене типа I, как описано в примере 31. Б.о.е. для vWF (антиген), поделенное на б.о.е. для казеина (неспецифическое связывание) = степень обогащения.

Таблица 24. Количество клонов, связывающихся с коллагеном типа I и типа III, после одного раунда отбора, как описано в примере 32.

Таблица 25. Схема иммунизации для сывороточного альбумина человека, как описано в примере 41.

Таблица 26. Результаты, полученные после одного и двух раундов пэннинга на сывороточном альбумине мыши, как описано в примере 45.

Таблица 27. Клоны были отобраны после одного и двух раундов отбора, после чего получали экстракты периплазмы. Эти клоны анализировали в ELISA на связывание с альбумином человека и мыши, как описано в примере 46.

Таблица 28. Значения IC50 для биспецифичных наночастиц против альбумина и против vWF, как описано в примере 54.

Таблица 29. Последовательности праймеров, использованных для гуманизации С37, как описано в примере 64.

Таблица 30. Перечень аминокислотных последовательностей пептидов данного изобретения и аминокислотная последовательность фактора фон Виллебранда (vWF) человека. В последовательности vWF человека домены А1 и A3 выделены жирным шрифтом.

Таблица 31. Результаты, полученные после двух раундов пэннинга на rА1 домене vWF, как описано в примере 66.

Таблица 32. Анализ методом ELISA отобранных клонов на связывание с rА1 и vWF, как описано в примере 67.

Таблица 1
Схема, использованная для иммунизации ламы 002, в соответствии с примером 1
Лама 002, дни иммунизации vWF Коллаген типа I Коллаген типа III
0 100 мкг 100 мкг 100 мкг
7 100 мкг 100 мкг 100 мкг
14 50 мкг 50 мкг 50 мкг
21 50 мкг 50 мкг 50 мкг
28 50 мкг 50 мкг 50 мкг
35 50 мкг 50 мкг 50 мкг
Таблица 2
Бляшкообразующие единицы (б.о.е.) после одного или двух раундов пэннинга на vWF в сравнении с PBS-казеином, как описано в примере 4. Б.о.е. для vWF (антиген), поделенное на б.о.е. для казеина (неспецифическое связывание) = степень обогащения
раунд Б.о.е. для vWF Б.о.е. для казеина Степень обогащения
Первый 1×107 2.5×105 40
Второй 5×108 2.5×106 200
Таблица 3
Количество ингибиторов против количества клонов, протестированных после первого и второго раундов пэннинга, как описано в примере 5.
раунд Количество ингибиторов против количества протестированных клонов
Первый 4/800
Второй 4/96
Таблица 4
Выход (мг/литр культуры) после экспрессии и очистки VHH, синтезированных в клетках E.coli WK6, как описано в примере 6
Название VHH Выход (мг/литр культуры)
22-2L-34 1,4
Т76 2,9
АМ-4-15-3 2,2
22-4L-16 2,8
С37 3,8
АМ-2-75 3,6

Таблица 6
Концентрация VHH (нМ), необходимая для ингибирования связывания vWF с коллагеном на 50% (IC50), как описано в примере 9
Название VHH IC50 (нМ) для плазмы человека (разведение 1/60) IC50 (нМ) для неразведенной плазмы человека
22-2L-34 10 -
Т76 30 -
AM-4-1S-3 7 200
22-4L-16 4 1000
С37 3 -
АМ-2-75 2 100
Таблица 7
Эпитопное картирование связывания VHH с vWF и ингибирование взаимодействия с коллагеном, как описано в примере 11
Название VHH Связывание с A3 доменом vWF
22-2L-34 Да
Т76 Нет
22-4L-16 Нет
С37 Да
АМ-2-75 Да
Таблица 8
Выход очищенного белка (мг) на литр культуры для двухвалентных и специфичных VHH, как описано в примере 12
NH2-концевое VHH СООН-концевое VHH Выход в мг/литр культуры
АМ-2-75 АМ-4-15-3 3,2
АМ-4-15-3 АМ-4-15-3 2,3
АМ-4-15-3 АМ-2-75 4,0
АМ-2-75 АМ-2-75 1,0
АМ-2-75 22-4L-16 3,0
Таблица 9
Значения IC50 для одновалентных по сравнению с двухвалентными и биспецифичными VHH. Ингибирование тестировалось с плазмой человека, свиньи и бабуина, как описано в примере 14
Первое VHH Второе VHH IC50 (нг/мл) для плазмы человека IC50 (нг/мл) для плазмы бабуина IC50 (нг/мл) для плазмы свиньи
АМ-2-75 150 400 50
АМ-4-15-3 50 200 40
22-4L-16 15 70 7
АМ-2-75 АМ-4-15-3 3 5 6
АМ-4-15-3 АМ-2-75 2 8 3
АМ-4-15-3 АМ-4-15-3 5 10 7
АМ-2-75 22-4L-16 8 20 10
АМ-2-75 АМ-2-75 5
Таблица 10
Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 c-1), как описано в примере 16
Концентрация (мкг/мл) % Ингибирования
АМ-2-75 0,2 0
АМ-2-75 0,3 12
АМ-2-75 0,4 56
АМ-2-75 0,6 97
АМ-2-75 0,8 96
АМ-4-15-3 0,05 0
АМ-4-15-3 0,1 75
АМ-4-15-3 0,25 74
АМ-4-15-3 0,5 86
АМ-4-15-3 1 91
22-4L-16 0,1 32
22-4L-16 0,5 54
22-4L-16 0,75 86
22-4L-16 2 97
22-4L-16 10 99
АМ-4-15-3/АМ-4-15-3 0,05 0
АМ-4-15-3/АМ-4-15-3 0,075 23
АМ-4-15-3/АМ-4-15-3 0,1 37
АМ-4-15-3/АМ-4-15-3 0,15 56
АМ-4-15-3/АМ-4-15-3 0,2 98
АМ-4-15-3/АМ-4-15-3 1,9 100
АМ-4-15-3/АМ-2-75 1,9 100
АМ-2-75/АМ-4-15-3 0,05 2
АМ-2-75/АМ-4-15-3 0,1 36
АМ-2-75/АМ-4-15-3 0,2 96
АМ-2-75/АМ-4-15-3 0,35 91
АМ-2-75/АМ-4-15-3 0,4 98
АМ-2-75/АМ-2-75 0,04 5
АМ-2-75/АМ-2-75 0,1 26
АМ-2-75/АМ-2-75 0,2 52
АМ-2-75/АМ-2-75 0,3 80
АМ-2-75/АМ-2-75 0,4 99
АМ-2-75/АМ-2-75 0,83 100
AM-2-75/22-4L-16 1,17 99
Таблица 11
Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 c-1), как описано в примере 16
Концентрация (мкг/мл) % Ингибирования
АМ-2-75 10 20
АМ-4-15-3 10 17
22-4L-16 10 22
АМ-4-15-3/АМ-4-15-3 10 23
АМ-4-15-3/АМ-2-75 10 21
АМ-2-75/АМ-4-15-3 10 18
АМ-2-75/АМ-2-75 2 32
AM-2-75/22-4L-16 10 13
Таблица 12
Бляшкообразующие единицы (б.о.е.) после одного раунда пэннинга на vWF, как описано в примере 17. Б.о.е. для vWF (антиген), поделенное на б.о.е. для казеина (неспецифическое связывание) = степень обогащения
Б.о.е. для vWF Б.о.е. для казеина Степень обогащения
1.5×107 1×104 1500
Таблица 13
Результаты скрининга в ELISA индивидуальных колоний на связывание с vWF и А1 доменом vWF, как описано в примере 18
Число клонов, положительных к vWF / Общее число протестированных клонов Число клонов, положительных к А1 / Общее число протестированных клонов
344/380 5/570
Таблица 14
Результаты, полученные после одного раунда МАТСНМ на клетках pBAD-Oprl-A1, как описано в примере 19
Раунд Число клонов, положительных к vWF / Общее число протестированных клонов Число клонов, положительных к А1 / Общее число протестированных клонов
Первый 1/96
Второй 45/348 12/348
Таблица 15
Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 c-1), как описано в примере 23
Концентрация (мкг/мл) % Ингибирования
2A1-4L-129 13,5 26
2A1-4L-129 20 50
2L-A1-15 9,7 30
2L-A1-15 25 45
А50 10,2 20
2A1-4L-79 11,1 20
2A1-4L-34 11,1 3
Z29 10,6 0
I53 9,7 0
М53 10,6 0
Таблица 16
Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 c-1), как описано в примере 23
Концентрация (мкг/мл) % Ингибирования
2A1-4L-129 10 0
2L-A1-15 10 3
А50 25 0
2A1-4L-79 25 15
Таблица 17
Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 c-1), как описано в примере 25
Концентрация (мкг/мл) % Ингибирования
2A1-4L-79/2A1-4L-79 25 54
2LA1-15/2LA1-15 25 45
Таблица 18
Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 с-1), как описано в примере 25
Концентрация(мкг/мл) % Ингибирования
2A1-4L-79/2A1-4L-79 25 0
2LA1-15/2LA1-15 25 23
Таблица 19
Выход после экспрессии и очистки биспецифичных конструкций, как описано в примере 27
NH2-концевое VHH СООН-концевое VHH Выход в мг/литр культуры
2A1-4L-79 АМ-4-15-3 7,5
2A1-4L-79 АМ-2-75 2
2A1-4L-79 22-4L-16 2,5
Таблица 20
Значения IC50 для наночастиц, биспецифичных к А1 и A3 домену vWF, как описано в примере 29
NH2-концевое VHH СООН-концевое VHH IC50, (нг/мл)
2A1-4L-79 АМ-4-15-3 10
АМ-4-15-3 - 45
2A1-4L-79 АМ-2-75 12
АМ-2-75 - 40
2A1-4L-79 22-4L-16 10
22-4L-16 - 10
2A1-4L-79 - >10000
Таблица 21
Ингибирование агрегации тромбоцитов при высоких срезывающих напряжениях (1600 c-1), как описано в примере 30
Концентрация (мкг/мл) % Ингибирования
2A1-4L-79/AM-4-15-3 12 100
2A1-4L-79/AM-2-75 0,02 0
2A1-4L-79/AM-2-75 0,1 28
2A1-4L-79/AM-2-75 0,5 79
2A1-4L-79/AM-2-75 1 95
2A1-4L-79/22-4L-16 12 96
Таблица 22
Ингибирование агрегации тромбоцитов при низких срезывающих напряжениях (300 c-1), как описано в примере 30
Концентрация (мкг/мл) % Ингибирования
2A1-4L-79/AM-4-15-3 10 15
2A1-4L-79/AM-2-75 10 25
2A1-4L-79/22-4L-16 10 27
Таблица 23
Бляшкообразующие единицы (б.о.е.) после одного раунда пэннинга на коллагене типа I, как описано в примере 31. Б.о.е. для vWF (антиген), поделенное на б.о.е. для казеина (неспецифическое связывание) = степень обогащения
Фаги, элюированные с коллагена типа I 5×106
Фаги, элюированные с казеина 4×104
Степень обогащения 100
Таблица 24
Количество клонов, связывающихся с коллагеном типа I и типа III, после одного раунда отбора, как описано в примере 32
Коллаген типа I 15/32
Коллаген типа III 7/32
Казеин 0/32
Таблица 25
Схема иммунизации для сывороточного альбумина человека, как описано в примере 41
День иммунизации HAS, лама 006
0 100 мкг
7 100 мкг
14 50 мкг
21 50 мкг
28 50 мкг
35 50 мкг
Таблица 26
Результаты, полученные после одного и двух раундов пэннинга на сывороточном альбумине мыши, как описано в примере 45
Первый раунд Второй раунд
Б.о.е. для сывороточного альбумина мыши 2,5×107 2,5×107
Б.о.е. для казеина 5×103 2,5×103
Степень обогащения 5000 10000
Таблица 27
Клоны были отобраны после одного и двух раундов отбора, после чего получали экстракты периплазмы. Эти клоны анализировали в ELISA на связывание с альбумином человека и мыши, как описано в примере 46
Первый раунд Второй раунд
ELISA сывороточный альбумин мыши 1/16 15/16
ELISA сывороточный альбумин человека 1/16 15/16
ELISA казеин 0/16 0/16
Таблица 28
Значения IC50 для биспецифичных наночастиц против альбумина и против vWF, как описано в примере 54
IC50 (нг/мл)
АМ-2-75 100
MSA21/AM-2-75 60
АМ-4-15-3 155
MSA21/AM-4-15-3 245
22-4L-16 100
MSA21/22-4L-16 140
Таблица 29
Последовательности праймеров, использованных для гуманизации С37, как описано в примере 64
Мутация Матрица Последовательность праймера
A74S+N75K+Р84А Дикий тип 5' - AGA GAC ААС ТСС AAG AAC ACG СТG ТАТ СТG САА АТG ААС АGС СТG АGА GСТ GАG GАС АСG-3' Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
A74S+N75K+P84A+R94K A74S+N75K+P84A 5' - AT TAC ТGТ GСТ ААА GGG GCC GGT ACT AGT T - 3' Tyr Cys Ala Lys Gly Ala Gly Thr Ser
N28T+N30S A74S+N75K+P84A+R94K A74S+N75K+P84A+R94K 5' - ТСС ТGТ GСА GСС ТСС GGА ТТС ACT TTC AGT TGG TA - 3' Ser Cys Ala Ala Ser Oly Phe Thr Phe Ser Trp
Таблица 30
Перечень аминокислотных последовательностей пептидов данного изобретения и аминокислотная последовательность фактора фон Виллебранда (vWF) человека. В последовательности vWF человека домены А1 и A3 выделены жирным шрифтом
Название SEQ ID NO: Последовательность
VHH против A3 vWF
С37 1 QVQLQESGGGLVQPGGSLRLSCAASGFNTNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNANNTLYLQMNSLRPEDTAVYYCA RGAGTSSYLPQRGNWDQGTQVTISS
C37-hum 2 QVQLQESGGGLVQPGGSLRLSCAASGFTPSWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNSKNALCLQMNSARAEDTAVYACA KGAGTSSYLPQRGNWDQGTQVTISS
АМ-2-75 3 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNANNTLYLQMNSLRPEDTAVYYCA RGAGTSSTLTQRGNWDQGTQVTVSS
22-2L-34 4 QVQLQDSGGGLVQAGGSLRLSCAASVRIPTSYAMGWFRQAPGKEREFV AAINRSGKSTYYSDSVEGRFTISRDNAKNTVSLQMDSLKLEDTAVYYCA ADYSGSYTSLWSRPERLDWGQGTQVTVFS
22-4L-16 5 QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFV AAISWSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYC VADTGGISWIRTQGYNYWGQGTQVTVSS
Т76 6 QVQLQESGGGLVQPGESLRLSCAASGSIFSINTMGWYGQAPGKQRELVA SITFGGVTNYADSVKGRFTISRDNTNDTVYLQMNSLKPEDTAVYICNAV TWGGLTNYWGQGTQVTVSS
АМ-4-15-3 7 QVQLQDSGGGLVQPGGSLRLACAASGSIFSINSMGWYRQAPGKQRELV AHALADGSASYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCN TVPSSVTKGYWGQGTQVTVSS
VHH против A3 домена vWF: бивалентные или биспецифичные
АМ-4-15-3/АМ-4-15-3 8 QVQLQDSGGGLVQPGGSLRLACAASGSIFSINSMGWYRQAPGKQRELV AHALADGSASYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCN TVPSSVTKGYWGQGTQVTVSSEPKTPKPQPAAAQVQLQDSGGGLVQPG GSLRLACAASGSIFSINSMGWYRQAPGKQRELVAHALADGSASYRDSV KGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTVPSSVTKGYWGQGT QVTVSS
АМ-4-15-3/АМ-2-75 9 QVQLQDSGGGLVQPGGSLRLACAASGSIFSINSMGWYRQAPGKQRELV AHALADGSASYRDSVKGRPTISRDNAKNTVYLQMNSLKPEDTAVYYCN TVPSSVTKGYWGQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPG GSLRLSCAASGFNFNWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSV KADSPSSETTPTTRCICNEQPETEDTAVYYCARGAGTSSYLPQRGNWDQ GTQVTVSS
АМ-2-75/АМ-4-15-3 10 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNANNTLYLQMNSLRPEDTAVYYCA RGAGTSSYLPQRGNWDQGTQVTVSSEPKTPKPQPAAAQVQLQDSGGGL VQPGGSLRLACAASGSIFSINSMGWYRQAPGKQRELVAHALADGSASY RDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTVPSSVTKGYW GQGTQVTVSS
АМ-2-75/АМ-2-75 11 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNANNTLYLQMNSLRPEDTAVYYCA RGAGTSSYLPQRGNWDQGTQVTVSSQVQLQESGGGLVQPGGSLRLSCA ASGFNFNWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKGRFTISR DNANNTLYLQMNSLRPEDTAVYYCARGAGTSSYLPQRGNWDQGTQVT VSS
АМ-2-75/22-4L-16 12 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNANNTLYLQMNSLRPEDTAVYYCA RGAGTSSYLPQRGNWDQGTQVTVSSEPKTPKPQPAAAQVQLVESGGGL VQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSGGSTY YADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCVADTGGISWIR TQGYNYWGQGTQVTVSS
VHH против vWF+VHH против мышиного сывороточного альбумина
MSA21/A М-2-75 13 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRPGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRFTSRDNAKNTLYLQMNSLKPEDTAVYYCT IGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPGGSLR LSCAASGFNFNWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKADS PSSETTPTTRCICNEQPETEDTAVYYCARGAGTSSYLPQRGNWDQGTQV TVSS
MSA21/A М-4-15-3 14 QVQLQESGGGLVQPGGSLRLSCEASGPTFSRPGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRFTSRDNAKNTLYLQMNSLKPEDTAVYYCT IGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQLQDSGGGLVQPGGSLR LACAASGSIFSINSMGWYRQAPGKQRELVAHALADGSASYRDSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCNTVPSSVTKGYWGQGTQVT VSS
MSA21/22 -4L-16 15 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRPTSRDNAKNTLYLQMNSLKPEDTAVYYCT IGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQLVESGGGLVQAGGSLR LSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSGGSTYYADSVKGR FTISRDNAKNTVYLQMNSLKPEDTAVYYCVADTGGISWIRTQGYNYWG QGTQVTVSS
VHH против сывороточного альбумина мыши
MSA21 16 QVQLQESGGGLVQPGGSLRLSCEASGPTFSRFGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYC TIGGSLNPGGQGTQVTVSS
MSA24 17 QVQLQESGGGLVQPGNSLRLSCAASGFTFRNFGMSWVRQAPGKEPEWV SSISGSGSNTIYADSVKDRFTISRDNAKSTLYLQMNSLKPEDTAVYYCTI GGSLSRSSQGTQVTVSS
MSA210 18 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGKGLEWV SAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLRPEDTAVYYCV IGRGSPSSQGTQVTVSS
MSA212 19 QVQLQESGGGLVQPGGSLRLTCTASGFTFRSFGMSWVRQAPGKGLEWV SAISADGSDKRYADSVKGRFTISRDNGKKMLTLDMNSLKPEDTAVYYC VIGRGSPASQGTQVTVSS
MSAc16 49 AVQLVESGGGLVQAGDSLRLSCWSGTTFSSAAMGWFRQAPGKEREPV GAIKWSGTSTYYTDSVKGRFTISRDNVKNTVYLQMNNLKPEDTGVYTC AADRDRYRDRMGPMTTTDFRFWGQGTQVTVSS
MSAc112 50 QVKLEESGGGLVQTGGSLRLSCAASGRTFSSFAMGWFRQAPGREREFV ASIGSSGITTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTGLCYCA VNRYGIPYRSGTQYQNWGQGTQVTVSS
MSAc110 51 EVQLEESGGGLVQPGGSLRLSCAASGLTFNDYAMGWYRQAPGKERDM VATISIGGRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAIYYCV AHRQTWRGPYLLWGQGTQVTVSS
MSAc114 52 QVQLVESGGKLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGKEREF VAGSGRSNSYNYYSDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYY CAASTNLWPRDRNLYAYWGQGTQVTVSS
MSAc116 53 EVQLVESGGGLVQAGDSLRLSCAASGRSLGIYRMGWFRQVPGKEREPV AAISWSGGTTRYLDSVKGRFTISRDSTKNAVYLQMNSLKPEDTAVYYC AVDSSGRLYWTLSTSYDYWGQGTQVTVSS
MSAc119 54 QVQLVEFGGGLVQAGDSLRLSCAASGRSLGIYKMAWFRQVPGKEREFV AAISWSGGTTRYTOSVKGRFTLSRDNTKNMVYLQMNSLKPDDTAVYYC AVDSSGRLYWTLSTSYDYWGQGTQVTVSS
MSAc15 55 EVQLVESGGGLVQAGGSLSLSCAASGRTFSPYTMGWFRQAPGKEREFL AGVTWSGSSTFYGDSVKGRFTASRDSAKNTVTLEMNSLNPEDTAVYYC AAAYGGGLYKDPRSYDYWGRGTQVTVSS
MSc111 56 AVQLVESGGGLVQAGGSLRLSCAASGFTLDAWPIAWFRQAPGKEREGV SCIRDGTTYYADSVKGRFTISSDNANNTVYLQTNSLKPEDTAVYYCAAP SGPATGSSHTPGIYWNLRDDYDNWGQGTQVTVSS
MSAc115 57 EVQLVESGGGLVQAGGSLRLSCAASGFTFDHYTIGWFRQVPGKEREGV SCISSSDGSTYYADSVKGRFTISSDNAKNTVYLQMNTLEPDDTAVYYCA AGGLLLRVEELQASDYDYWGQGIQVTVSS
MSAc18 58 AVQLVDSGGGLVQPGGSLRLSCTASGFTLDYYAIGWFRQAPGKEREGV ACISNSDGSTYYGDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCA TADRHYSASHHPFADFAFNSWGQGTQVTVSS
MSAc17 59 EVQLVESGGGLVQAGGSLRLSCAAYGLTFWRAAMAWFRRAPGKEREL WARNWGDGSTRYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY YCAAVRTYGSATYDIWGQGTQVTVSS
MSAc120 60 EVQLVESGGGLVQDGGSLRLSCIFSGRTFANYAMGWFRQAPGKEREFV AAINTWGGTTNYADALKGRFTISRDNTKNTAFLQMNSLKPDDTAVYYC AAREWPFSTIPSGWRYWGQGTQVTVSS
MSAc14 61 DVQLVESGGGWVQPGGSLRLSCAASGPTASSHAIGWPRQAPGKEREFV VGINRGGVTRDYADSVKGRFAVSRDNVKNTVYLQMNRLKPEDSAIYIC AARPEYSFTAMSKGDMDYWGKGTLVTVSS
VHH против А1 домена vWF+VHH против A3 домена vWF
2A1-4L-79/AM-4-15-3 20 QVQLQDSGGRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKEREFV APIGSDSSTLYTSSVRGRFTISKDNGKNTVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSSEPKTPKPQPAAAQVQLQDSG GGLVQPGGSLRLACAASGSIFSINSMGWYRQAPGKQRELVAHALADGS ASYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTVPSSVTK GYWGQGTQVTVSS
2A1-4L-79/AM-2-75 21 QVQLQDSGGRLVKAGASLRLSCAASGRTFSSLPMAWPRQAPGKEREFV AFIGSDSSTLYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSSEPKTPKPQPAAAQVQLQESG GGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEWVSTISTYGE PRYADSVKADSPSSETTPTTRCICNEQPETEDTAVYYCARGAGTSSYLPQ RGNWDQGTQVTVSS
2A1-4L-79/22-4 L-16 22 QVQLQDSGGRLVKAGASLRLSCAASGRTFSSLPMAWPRQAPGKEREFV AFIGSDSSTLYTSSVRGRFTISRDNGKNVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSSEPKTPKPQPAAAQVQLVESG GGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSGG STYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCVADTGGIS WIRTQGYNYWGQGTQVTVSS
VHH против А1 домена vWF
A50 23 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYRMGWFRQAPGKEREFV AAISRRGDNVYYADSVKGRFAISRDNAESTLYLQMNSLKPEDTAVYYC AAHVTVSAITLSTSTYDYWGQGTQVTVSS
I53 24 QVQLQDSGGGLVQAGGSLRLSCAASGRTKDMAWFRQPPGKEREFVAVI YSSDGSTLVAASVKGRPTISRDNAKNTVYLQMTSLKPADTAVYYCATS RGYSGTYYSTSRYDYWTGGTQVTVSS
Z29 25 QVQLQESGGGSVQAGDSLTLSCAASGRTFSMHAMGWFRQAPGKEREF VAAISPSAFTEYADSLKGRFTVSRDNAKKLVWLQMNGLKPEDTAAYYC AARRGAFTATTAPLYDYWGQGTQVTVSS
M53 26 QVQLQDSGGGLVQAGESLRLSCGTSGRTFGRRAMAWFRQAPGKERQF VAWIARYDGSTLYADSVKGRFTISRDDNKNTMYLHMNNLTPEDTAVY YCAAGPRGLYYESRYEYWGQGTLVTVSS
2A1-4L-79 27 QVQLQDSGGRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKEREFV AFIGSDSSTLYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSS
2A1-4L-129 28 QVQLQESGGGLVQAGASLRLSCAASGRSFSSYPMAWFRQAPGKEREFV VFIGSDHSTLYSTSVRGRFTISRDNAKNTVYLQMMNLKPEDTAVYYCA ARNSAWSSGIYYRETSYDYWGQGTQVTVSS
2A1-4L-34 29 QVQLQDSGGGSVQAGASLRLSCAASGGTFSSYAMAWFRQAPGKEREFV GFIGSDGSTLYSSSVRGRFTISRDNAKNTVALQMMNLKPEDTAVYYCAA RARYSGIYYRETDYPYWGQGTQVTVSS
2A1-4L-78 30 QVQLQESGGGLVQAGASLRLSCTASGRSFGGFPMGWPRQAPGKEREFV SGLTRSLFTVYADSVKGRPTVSTDNTKNTVYLQMNSLKPEDTAVYYCA ARPDLYAYSRDPNEYDYWGQGTQVTVSS
2LA1-15 31 QVQLQDSGGGLVQSGGSLRLACAASGRIVSTYAMGWFRQSPGKEREFV ATVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAKTKRTGIFTTAR MVDYWGQGTQVTVSS
VHH против А1 домена vWF: биспецифичные и бивалентные
2A1-4L-79/2А1-4L-79 32 QVQLQDSGGRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKEREFV AFIGSDSSTLYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSSEPKTPKPQPAAAQVQLQDSG GRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKEREFVAFIGSDSST LYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCAARSSAFSSGI YYREGSYAYWGQGTQVTVSS
2LA1-15/2LA1-15 33 QVQLQDSGGGLVQSGGSLRLACAASGRIVSTYAMGWFRQSPGKEREFV ATVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAKTKRTGIFTTAR MVDYWGQGTQVTVSSEPKTPKPQPAAAQVQLQDSGGGLVQSGGSLRL ACAASGRIVSTYAMGWFRQSPGKEREFVATVKGRFTISRDNAKNTLYL QMNSLKPEDTAVYYCAKTKRTGIFTTARMVDYWGQGTQVTVSS
А50/А50 34 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYRMGWFRQAPGKEREFV AAISRRGDNVYYADSVKGRFAISRDNAESTLYLQMNSLKPEDTAVYYC AAHVTVSAITLSTSTYDYWGQGTQVTVSSEPKTPKPQPAAAQVQLQESG GGLVQAGGSLRLSCAASGRTFSSYRMGWFRQAPGKEREFVAAISRRGD NVYYADSVKGRPAISRDNAESTLYLQMNSLKPEDTAVYYCAAHVTVSA ITLSTSTYDYWGQGTQVTVSS
VHH против коллагена
3Р1-31 35 QVQLQESGGGLVQAGGSLRLSCAASGRTFRRYAMGWYRQAPGKQREL VAAITSGGRTSVADTVKGRPTISSDNAKNTVYLQMNSLKPEDAAVYYC TLYNSTTNYYNQSPSSWGQGTQVTVSS
3L-41 36 QVQLQDSGGGLVQAGGSLRLSCAASGRTFRRYAMGWYRQAPGKQRVL VAAITSNGRPSVADSVKGRFTISSDTAKNTVYLQMNSLKPEDTALYYCT LYNTSADYYNQSPSSWGQGTQVTVLS
3Р2-31 37 QVQLQESGGGLVQAGDSLRLSCAASGRTFTMGWFRQAPGKERQFVAA LTWTGGSPVYADSVKGRFTTWRVLDNNTVYLHMNSLKPEDTAVYHCA AARTYYGNISEYYDYWGQGTQVTVSS
Гуманизированные VHH против vWF
С37-3 38 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RGAGTSSYLPQRGNWDQGTQVTISS
С37-4 39 QVQLQESGGGLVQPGGSLRLSCAASGFNFNWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KGAGTSSYLPQRGNWDQGTQVTISS
С37-8 40 EVQLLESGGGLVQPGGSLRLSCAASGFTFSWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KGAGTSSYLPQRGNWDQGTQVTISS
С37-10 41 EVQLLESGGGLVQPGGSLRLSCAASGFTFSWYPMSWVRQAPGKGLEW VSTISTYGEPRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KGAGTSSYLPQRGNWDQGTLVTVSS
Гуманизированные VHH против vWF+VHH против сывороточного альбумина мыши
MSA21/C 37-hum 42 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYC TIGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPGGSL RLSCAASGFTFSWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKGR FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGAGTSSYLPQRGNWDQG TQVTISS
MSA24/ C37-hum 43 QVQLQESGGGLVQPGNSLRLSCAASGFTFRMFGMSWVRQAPGKEPEWV SSISGSGSNTIYADSVKDRFTISRDNAKSTLYLQMNSLKPEDTAVYYCTI GGSLSRSSQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPGGSLRL SCAASGFTFSWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKGRPTI SRDNSKNTLYLQMNSLRAEDTAVYYCAKGAGTSSYLPQRGNWDQGTQ VTISS
MSA210/ C37-hum 44 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGKGLEWV SAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLKPEDTAVYYCV IGRGSPSSQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPGGSLRLS CAASGFTFSWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKGRPTIS RDNSKNTLYLQMNSLRAEDTAVYYCAKGAGTSSYLPQRGNWDQGTQV TISS
MSA212/ C37-hum 45 QVQLQESGGGLVQPGGSLRLTCTASGPTFRSFGMSWVRQAPGKGLEWV SAISADGSDKRYADSVKGRFTISRDNGKKMLTLDMNSLKPEDTAVYYC VIGRGSPASQGTQVTVSSEPKTPKPQPAAAQVQLQESGGGLVQPGGSLR LSCAASGFTFSWYPMSWVRQAPGKGLEWVSTISTYGEPRYADSVKGRP TISRDNSKNTLYLQMNSLRAEDTAVYYCAKGAGTSSYLPQRGNWDQGT QVTISS
VHH против коллагена: биспецифичные
3P1-31/3P2-31 46 QVQLQESGGGLVQAGGSLRLSCAASGRTFRRYAMGWYRQAPGKQREL VAAITSGGRTSVADTVKGRFTISSDNAKNTVYLQMNSLKPEDAAVYYC TLYNSTTNYYNOSPSSWGOGTOVTVSSEPKTPKPOPAAAOVOLOESGG GLVQAGDSLRLSCAASGRTFTMGWFRQAPGKERQFVAALTWTGGSPV YADSVKGRFTTWRVLDNNTVYLHMNSLKPEDTAVYHCAAARTYYGNI SEYYDYWGQGTQVTVSS
3L-41/3P2-31 47 QVQLQDSGGGLVQAGGSLRLSCAASGRTFRRYAMGWYRQAPGKQRVL VAAITSNGRPSVADSVKGRFTISSDTAKNTVYLQMNSLKPEDTALYYCT LYNTSADYYNOSPSSWGOGTOVTVLSEPKTPKPOPAAAOVOLOESGGG LVQAGDSLRLSCAASGRTFTMGWFRQAPGKERQFVAALTWTGGSPVY ADSVKGRFTTWRVLDNNTVYLHMNSLKPEDTAVYHCAAARTYYGNIS EYYDYWGQGTQVTVSS
Специфичные к конфермации VHH против vWF
A11 62 EVQLVESGGRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKEREFV AFIGSDSSTLYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCAA RSSAFSSGIYYREGSYAYWGQGTQVTVSS
A12 63 QVQLVESGGGLVQAGGSLRLSCTASGRTFSTYALGWFRQVPGKGREFIA VIYWRDGSSLYSDSVKGRFTISKDNAKNTVYLQMNSLKPEDTAVYYCA NRHDSRGTYYSSRGYDYWGQGTQVTVSS
A13 64 QVQLVESGGGLVQAGGSLRLSCAASGRTKDMAWFRQPPGKEREFVAVI YSSDGSTLVAASVKGRFTISRDNAKNTVYLQMTSLKPADTAVYYCATS RGYSGTYYSTSRYDYWGQGTQVTVSS
A15 65 QVQLVESGGGLVQAGGSLRLSCAASGRTKDMAWFRQPPGKEREFVAVI YSSDGSTLVAASVTGRFTISRDNAKNMVYLQMTSLKPADTAVYYCASS RGYSGTYYSTSRYDYWGQGTQVTVSS
vWF человека
Human vWF 48 MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDPVNTFDGSM YSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNG TVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQV LLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGE QWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPP VALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPV CPAGMEYRQCVSPCARTCQSLHDMEMCQERCVDGCSCPEGQLLDEGLC VESTECPCVHSGKRYPPGTSLSRDCNTCICRNSQWICSNEECPGECLVTG QSHFKSFDNRYFTFSGICQYLLARDCQDHSFSIVIETVQCADDRDAVCTR SVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDLRIQHTVTASV RLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLT PSGLAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACA VLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAAACA GRGVRVAWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEA CLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYC
EDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCP CFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYL TFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKR VTILVEGGEIELFDGEVNVKRPMKDETHFEWESGRYIILLLGKALSVVW DRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGN SWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCN KLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWR TATLCPQSCEERNLRENGYECEWRYNSCAPACQVTCQHPEPLACPVQC VEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSD PEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLH DFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFWDMMERLRISQKWV RVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVL KYTLFQIFSKTORPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKK VIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSY LCDLAPEAPPPTLPPHMAQVTVGPGLRNSMVLDVAFVLEGSDKIGEA DFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDI LQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTG NPASDEIKRLPGDIQWPIGVGPNANVQELERIGWPNAPILIQDFETLPRE APDLVLQRCCSGEGLQIPTLSPAPDCSQPLDVILLLDGSSSFPASYFDE MKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNWPEKAHLLS LVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAWILVTD VSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNW KLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLP DQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEETCGCRW TCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQDLEVILHNGACS PGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVN VYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDEN GANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHC QVLLLPLFAECHKVLAPATFYAICQQDSCHQEQVCEVIASYAHLCRTNG VCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCDGNVSSCGDHPSEGCF CPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLS GRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCD LPPVPHCERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTL RKTQCCDEYECACNCVNSTVSCPLGYLASTATNDCGCTTTTCLPDKVC VHRSTIYPVGQFWEEGCDVCTCTDMEDAVMGLRVAQCSQKPCEDSCRS GFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQWASPENP CLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCE RMEACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCN PCPLGYKEENNTGECCGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTH FCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPE CNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQC SCCSPTRTEPMQVALHCTNGSWYHEVLNAMECKCSPRKCSK
Таблица 31
Результаты, полученные после двух раундов пэннинга на rА1 домене vWF, как описано в примере 66
Первая библиотека Вторая библиотека Третья библиотека
Б.о.е. для rА1 1×108 2×107 4×109
Б.о.е. для казеина 2×104 2×104 2×104
Степень обогащения 5000 1000 200000
Таблица 32
Анализ методом ELISA отобранных клонов на связывание с rА1 и vWF, как описано в примере 67
Первая библиотека Вторая библиотека Третья библиотека
ELISA rA1 54/64 51/64 49/64
ELISA vWF 36/64 35/64 33/64

1. Полипептидная конструкция для лечения, профилактики и/или облегчения нарушений, связанных с адгезией тромбоцитов и/или опосредованной тромбоцитами агрегацией или ее дисфункцией, включающая:
a) по меньшей мере, одно однодоменное антитело, направленное против фактора фон Виллебранда (vWF), где, по меньшей мере, одно однодоменное антитело соответствует последовательности, представленной любой из SEQ ID NO:1-7, или
i) последовательности, гомологичной любой из SEQ ID NO:1-7 со степенью идентичности более чем 70% по отношению к родительской последовательности; или
ii) функциональной части любой из SEQ ID NO:1-7, которая сохраняет взаимодействие с мишенью со сродством 1×10-6 М или лучшим; или
iii) функциональной части любой из SEQ ID NO:1-7, которая содержит частичную делецию полной аминокислотной последовательности, но все еще сохраняет сайт (сайты) связывания и белковый домен (белковые домены), необходимые для связывания и взаимодействия с мишенью; и
b) по меньшей мере, одно однодоменное антитело, направленное против сывороточного альбумина (SA), где, по меньшей мере, одно однодоменное антитело соответствует последовательности, представленной любой из SEQ ID NO:16-19, или
i) последовательности, гомологичной любой из SEQ ID NO:16-19 со степенью идентичности более чем 70% по отношению к родительской последовательности.

2. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело представляет собой домен VHH.

3. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело представляет собой VHH домен, включающий в положении 45 в соответствии с нумерацией Kabat аминокислоту, выбранную из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина, пролина, фенилаланина, тирозина, триптофана, метионина, серина, треонина, аспарагина и глутамина.

4. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело представляет собой VHH домен, включающий в положении 103 в соответствии с нумерацией Kabat аминокислоту, выбранную из группы, состоящей из аргинина, серина или незаряженного остатка, необязательно глицина.

5. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело представляет собой VHH домен, полученный путем иммунизации верблюда и получения из него гибридомы, или путем клонирования библиотеки однодоменных антител и последующей селекции VHH с использованием фагового дисплея.

6. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело является гуманизированным.

7. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело представляет собой гуманизированный домен VHH.

8. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело является гуманизированным путем замены одной или более аминокислот Camelidae на соответствующий человеческий аналог, встречающийся в консенсусной последовательности человека.

9. Полипептидная конструкция по п.1, где, по меньшей мере, одно однодоменное антитело является гуманизированным путем замены любого из следующих остатков или по одному, или в комбинации: положения 1, 5, 28 и 30 в FR1, маркерные аминокислоты в положениях 37, 44, 45 и 47 в FR2, положения 74, 75, 76, 83, 84, 93 и 94 в FR3, и положения 103, 104, 108 и 111 в FR4, причем нумерация положений приведена согласно нумерации Kabat.

10. Полипептидная конструкция по п.1, где С-конец первого однодоменного антитела соединен с N-концом следующего однодоменного антитела.

11. Композиция для лечения, профилактики и/или облегчения нарушений, связанных с адгезией тромбоцитов и/или опосредованной тромбоцитами агрегацией или ее дисфункцией, содержащая эффективное количество полипептидной конструкции по любому из пп.1-10 и фармацевтически приемлемый наполнитель.

12. Композиция для лечения, профилактики и/или облегчения нарушений, связанных с адгезией тромбоцитов и/или опосредованной тромбоцитами агрегацией или ее дисфункцией, содержащая эффективное количество полипептидной конструкции по любому из пп.1-10, адаптированной для выбранного пути введения, где путь введения является оральным или парэнтеральным, интраназальным или путем ингаляции, внутривенным, внутримышечным, местным или подкожным путем, и фармацевтически приемлемый наполнитель.

13. Нуклеиновая кислота, кодирующая полипептидную конструкцию по любому из пп.1-10.

14. Применение полипептидной конструкции по любому из пп.1-10 для получения лекарственного средства для профилактики, лечения и/или облегчения нарушений, связанных с опосредованной тромбоцитами агрегацией, где указанные нарушения являются любыми из образования неокклюзивных тромбов, образования окклюзивных тромбов, образования артериальных тромбов, острой коронарной окклюзии, рестеноза, рестеноза после РСТА или эндопротезирования, образования тромбов в стенозированных артериях, гиперплазии после ангиопластики, атерэктомии или эндопротезирования артерий, окклюзивного синдрома сосудистой системы или потери проницаемости больных артерий.

15. Применение полипептидной конструкции по любому из пп. 1-10 для получения лекарственного средства для профилактики, лечения и/или облегчения нарушений, связанных с опосредованной тромбоцитами агрегацией, где указанные нарушения являются любыми из возникших вследствие нестабильной стенокардии, стабильной стенокардии, грудной жабы, образования эмбол, тромбоза глубоких вен, гемолитического уремического синдрома, гемолитической анемии, острой почечной недостаточности, тромболитических осложнений, тромболитической тромбоцитопенической (геморрагической) пурпуры, рассеянной внутрисосудистой комгелопатии, тромбоза, заболевания коронарных сосудов сердца, тромбоэмболических осложнений, инфаркта миокарда, рестеноза, а также образование тромбов при предсердной фибрилляции, хронической нестабильной стенокардии, кратковременного ишемического повреждения головного мозга и инсульта, заболевания периферических сосудов, тромбоза артерий, преэклампсии, эмболии, рестеноза и/или тромбоза после ангиопластики, эндартерэктомии сонной артерии, анастомоза пересаженных сосудов, а также постоянного применения сердечно-сосудистых устройств.



 

Похожие патенты:

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты нуклеиновых кислот, каждый из которых кодирует аминокислотную последовательность тяжелой цепи иммуноглобулина IgG1.

Изобретение относится к области биотехнологии, конкретно к выделенным моноклональным антителам, в частности CDR-привитым гуманизированным антителам, которые связываются с эпитопом молекулы RAGE человека и, в частности обладают способностью ингибировать связывание RAGE с различными лигандами.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложено IL-1β-связывающее антитело или его IL-1β-связывающий фрагмент, включающее вариабельную область тяжелой цепи и легкой цепи.

Изобретение относится к области иммунологии. Предложен вариант полипептида Fc человеческого IgG с заменами 259I и 308F, где нумерация положений приведена согласно индексу EU Kabat.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты выделенного моноклонального антитела, специфичного к hGM-CSF, где каждый вариант характеризуется тяжелой и легкой цепью.

Настоящее изобретение относится к области биотехнологии и медицины. Предложен способ создания антитела и его функциональных фрагментов, направленных против опухолевого антигена, экспрессируемого на поверхности опухоли, устойчивой по меньшей мере к одному противоопухолевому соединению, основанный на применении для иммунизации измельченного гомогената, и/или суспензии, и/или клеточного лизата, происходящих из такой опухоли.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложен связывающий белок для связывания одной или более мишеней, содержащий четыре полипептидные цепи, которые образуют четыре функциональных антигенсвязывающих сайта.

Изобретение относится к области иммунологии и медицины. Представлено антитело для восстановления центральной нервной системы, содержащее антиген-связывающий участок, который специфично связывается с полипептидом Nogo А человека или NiG человека (SEQ ID NO: 2 и 3, соответственно, приведенные в описании), где указанный антиген-связывающий участок содержит: CDR-H1-6А3 (SEQ ID NO:8), CDR-H2-6А3 (SEQ ID NO:9) и CDR-H3-6А3 (SEQ ID NO:10); и CDR-L1-6А3 (SEQ ID NO:11), CDR-L2-6А3 (SEQ ID NO:12) и CDR-L3-6А3 (SEQ ID NO:13).

Группа изобретений относится к биотехнологии, генной и белковой инженерии, конкретно к рекомбинантной плазмидной ДНК pG1-Rm7, обеспечивающей в клетках Escherichia coli синтез гибридного белка G1-Rm7, способного связывать фактор некроза опухолей и обладающего биолюминесцентной активностью люциферазы Renilla muelleri, где указанная плазмидная ДНК включает нуклеотидную последовательность SEQ ID NO: 1, и может быть использована в медицине.

Настоящая группа изобретений относится к области биотехнологии. Предложено гуманизированное анти-CD79b антитело и его антигенсвязывающий фрагмент, полученные из мышиного антитела MA79b и имеющие по существу аналогичную с ним аффинность связывания CD79b.

Изобретение относится к области биохимии, в частности к искусственным белкам-иммуногенам, имеющим свойства антигенов меланомы. Заявлен искусственный ген, кодирующий полиэпитопный белок-иммуноген MEL-TCI-A0201, содержащий множественные цитотоксические рестриктированные HLA-A*0201 и Т-хелперные эпитопы антигенов меланомы NY-ESO-1, MART1, MAGE-A1, MAGE-A3, MAGE-A11, MAGE-C1, имеющий последовательность длиной 1535 п.н., представленную на Фиг.

Изобретение относится к области биотехнологии и иммунологии. Представлено антитело, которое представляет собой нейтрализующее антитело против VEGFR-2/KDR, гипервариабельные участки которого являются идентичными гипервариабельным участкам антитела TTAC 0001 против VEGFR-2/KDR, слитое со связывающим доменом ангиопоэтина 2, являющимся лигандом Tie-2, для лечения рака посредством ингибирования ангиогенеза.

Изобретение относится к области биотехнологии и может быть использовано в сельском хозяйстве и пищевой промышленности. Сконструированы рекомбинантные нуклеотидные последовательности (НП), кодирующие полипептиды (ДГЛК-синтазы), которые состоят из дельта-9-элонгазы и дельта-8-десатуразы, независимо и раздельно проявляющих присущие им ферментативные активности.

Изобретение относится к области биотехнологии, конкретно к рекомбинантной продукции белков человека, и может быть использовано для получения гибридного рекомбинантного эритропоэтина человека.

Изобретение относится к области биотехнологии и может быть использовано для получения рекомбинантного интерферона альфа-2 человека. Гибридные белки GFN80 и GFN100 конструируют на основе рекомбинантныго интерферона альфа-2 человека, слитого с N-конца с аминокислотной последовательностью полипептида S(G4S)16 или S(G4S)20 соответственно.

Изобретение относится к области медицины и касается рекомбинантных химерных полипептидов, несущих эпитопы различных иммунодоминантных белков спирохет комплекса Borellia Burgdorferisensu lato, и способа серодиагностики иксодового клещевого боррелиоза.

Настоящее изобретение относится к области биохимии. Предложен слитый белок для лечения заболеваний, опосредованных конечными продуктами гликирования (AGE), состоящий из фрагмента варианта рецептора конечных продуктов гликирования (RAGE) человека, имеющего две точечные мутации H217R и R221H, и фрагмента константного домена иммуноглобулина человека IgG4, при необходимости соединенных линкером.

Группа изобретений относится к биотехнологии, генной и белковой инженерии, конкретно к рекомбинантной плазмидной ДНК pG1-Rm7, обеспечивающей в клетках Escherichia coli синтез гибридного белка G1-Rm7, способного связывать фактор некроза опухолей и обладающего биолюминесцентной активностью люциферазы Renilla muelleri, где указанная плазмидная ДНК включает нуклеотидную последовательность SEQ ID NO: 1, и может быть использована в медицине.

Настоящая группа изобретений относится к области биотехнологии. Предложено гуманизированное анти-CD79b антитело и его антигенсвязывающий фрагмент, полученные из мышиного антитела MA79b и имеющие по существу аналогичную с ним аффинность связывания CD79b.
Наверх