Средства на основе константной области иммуноглобулина связывающие fc-рецептор



Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор
Средства на основе константной области иммуноглобулина связывающие fc-рецептор

 


Владельцы патента RU 2549676:

ЮНИВЕРСИТИ ОФ МЭРИЛЭНД, БАЛТИМОР (US)
ГЛИКНИК ИНК. (US)

Предложенное изобретение относится к области иммунологии. Раскрыты варианты димерного соединения для образования мультимера, способного к воспроизведению эффекторной функции агрегированного IgG с идентичными мономерами. Каждый мономер димера содержит: мономер шарнирной области IgG2 или мономер изолейциновой молнии, каждый из которых при димеризации формирует мультимеризирующую область, и, по меньшей мере, один мономер Fc-домена, содержащий шарнирную область, домен СH2 и домен СН3 из IgG1. Описано мультимерное соединение, способное к воспроизведению эффекторной функции агрегированного IgG и содержащее два или более димеров. Раскрыты способ изменения иммунного ответа, использующий димер или мультимер, а также способ лечения воспалительного заболевания на основе мультимера. Использование изобретения обеспечивает новые соединения, способные связывать, по меньшей мере, один FcR, выбранныЙ из группы, включающей: FcγRI, FcγRII, FcγRIII, FcγRIV, или их варианта не из человека, что может найти применение в медицине для замены IVIG для лечения широкого спектра заболеваний, включая воспалительные и аутоиммунные заболевания. 4 н. и 3 з.п. ф-лы, 25 ил., 5 табл., 25 пр.

 

Область техники, к которой относится изобретение

[0001] Настоящее изобретение в целом относится к области иммунологии, воспалительных заболеваний и онкоиммунологии. Более конкретно, настоящее изобретение относится к биологически активным биомиметическим молекулам, содержащим Fc-домены иммуноглобулина, к композициям, содержащим такие биомиметики, а также к способам использования таких биомиметиков.

[0002] Изобретение также относится к лечению и профилактике патологических состояний, опосредованных клетками, происходящими из моноцитов, и, более конкретно, к применению стабилизированных функциональных частей Fc-фрагментов IgG при таком лечении и профилактике.

Уровень техники

[0003] Препараты иммуноглобулина из плазмы человека используют с начала 1950-ых для лечения заболеваний, связанных с иммунодефицитом, а позже и более широко для лечения аутоиммунных и воспалительных заболеваний.

[0004] Первоначально препараты иммуноглобулина вводили путем внутримышечной инъекции. Позже использовали иммуноглобулин для внутривенного введения (IVIG), который, как первоначально было показано, являлся эффективным при лечении аутоиммунного заболевания - идиопатической тромбоцитопенической пурпуры (ИТП) (Imbach P, Barandun S, d'Apuzzo V, et al: High-dose intravenous gammaglobulin for idiopathic thrombocytopenic purpura in childhood. Lancet 1981 Jun 6; 1(8232): 1228-31). IVIG человека (обозначенный в настоящей заявке как "hIVIG") представляет собой препарат на основе стерильного, очищенного иммуноглобулина G (IgG), полученного из смешанной плазмы человека, который обычно содержит более чем 95% немодифицированного IgG, с небольшим и переменным количеством иммуноглобулина A (IgA) или иммуноглобулина М (IgM) (см., например, Rutter A, Luger TA: High-dose intravenous immunoglobulins: an approach to treat severe immune-mediated and autoimmune diseases of the skin. J. Am. Acad. Dermatol. 2001 Jun; 44(6):1010-24). На сегодняшний день единственным наиболее распространенным клиническим применением hIVIG является лечение ИТП.

[0005] Несмотря на то, что лечение hIVIG являлось клинически эффективным, у препаратов на основе hIVIG имеется ряд недостатков, к которым относилась вероятность недостаточной стерильности, наличие примесей, недостаточную доступность, а также разброс характеристик препаратов от партии к партии. В частности, в препаратах hIVIG может значительно изменяться содержание иммуноглобулина A (IgA), что может представлять опасность, поскольку IgA вызывает аллергические и анафилактические реакции у реципиентов с дефицитом IgA.

[0006] Ввиду негативных свойств hIVIG существует потребность в улучшенных способах лечения аутоиммунных и воспалительных заболеваний.

[0007] Кроме того, клетки, происходящие из моноцитов, опосредуют многочисленные патологические состояния различных типов. Простое терапевтическое и/или профилактическое средство, предназначенное для применения во многих, если не во всех, таких состояниях было бы бесценным.

Сущность изобретения

[0008] Иммунорегуляторные свойства IVIG обусловлены Fc-доменом молекул IgG. Например, в мышиных моделях ИТП немодифицированный IVIG, как и один Fc-фрагмент, демонстрирует терапевтическую эффективность в восстановлении количества тромбоцитов, тогда как выделеннные Fab-фрагменты IVIG не являются терапевтически эффективными (Samuelsson, A., Towers, T. L. & Ravetch, J.V. Anti-inflammatory Activity of IVIG Mediated Through the Inhibitory Fc Receptor. Science 291, 484-486 (2001)). Более того, Fc, а не Fab-фрагменты IVIG также являются терапевтически эффективными при лечении идиопатической тромбоцитопенической пурпуры как у детей, так и у взрослых (Follea, G. et al. Intravenous plasmin-treated gammaglobulin therapy in idiopathic thrombocytopenic purpura. Nouv Rev Fr Hematol 27, 5-10 (1985); Solal-Celigny, P., Bernard, J., Herrera, A. & Biovin, P. Treatment of adult autoimmune thrombocytopenic purpura with high-dose intravenous plasmin-cleaved gammaglobulins. Scand J Haematol 31, 39-44 (1983); Debre, M. & Bonnet, M.-C. Infusion of Gcgamma fragments for treatment of children with acute immune thrombocytopenic purpura. Lancet 342, 945-49 (1993); Burdach, S.E., Evers, K. & Geurson, R. Treatment of acute idiopathic thrombocytopenic purpura of childhood with intravenous immunoglobulin G: Comparative efficacy of 7S and 5S preparations. J Pediatr 109, 770-775 (1986)).

[0009] Терапевтический эффект IVIG первоначально опосредуется Fc-гамма-рецептором (FcγR) и основан на перекрестном взаимодействии с дендритными клетками (DC) и макрофагами, что обуславливает их долговременный толерогенный эффект. FcγRIIIa играет важную роль в фазе инициации, а FcγRIIb участвует в эффекторной фазе в моделях ИТП на мышах (Samuelsson, A., Towers, T.L. & Ravetch, J.V. Anti-inflammatory Activity of IVIG Mediated Through the Inhibitory Fc Receptor. Science 291, 484-486 (2001); Siragam, V. et al. Intravenous immunoglobulin ameliorates ITP via activating Fc[gamma] receptors on dendritic cells. Nat Med 12, 688 (2006)). Аналогично, исследования на людях показали, что антитела против Fcγ-рецептора эффективны при лечении резистентной формы ИТП (Clarkson, S. et al. Treatment of refractory immune thrombocytopenic purpura with an anti-Fc gamma-receptor antibody. N Engl J Med 314, 1236-1239 (1986)). Важно то, что долговременные толерогенные эффекты обусловлены межклеточными взаимодействиями, как и адаптивный перенос IVIG-обработанных DC эффективен при лечении в моделях ИТП на мышах (Siragam, V. et al. Intravenous immunoglobulin ameliorates ITP via activating Fc[gamma] receptors on dendritic cells. Nat Med 12, 688 (2006)).

[0010] Иммунномодуляторные эффекты IVIG требуют агрегации FcγR. Агрегацию FcγR вызывают димеры IgG, присутствующие в IVIG (5-15% от общего IVIG) (Bleeker, W.K. et al. Vasoactive side effects of intravenous immunoglobulin preparations in a rat model and their treatment with recombinant platelet-activating factor acetylhydrolase. Blood 95, 1856-1861 (2000)). Например, в модели ИТП на мышах обработка IVIG с высоким содержанием "димеров" (димеров полноразмерных молекул иммуноглобулина) приводила к повышению количества тромбоцитов, тогда как "мономеры" IVIG (полноразмерные молекулы иммуноглобулина) не были эффективны (Teeling, J.L. et al. Therapeutic efficacy of intravenous immunoglobulin preparations depends on the immunoglobulin G dimers: studies in experimental immune thrombocytopenia. Blood 98, 1095-1099 (2001)). Кроме того, несмотря на то, что фракционирование на ионообменной смоле и полиэтиленгликоле широко используют при получении IVIG для удаления агрегатов IgG, клиническая эффективность IVIG коррелирует с присутствием димеров в сыворотках пациента (Augener, W., Friedman, B. & Brittinger, G. Are aggregates of IgG the effective part of high-dose immunoglobulin therapy in adult idiopathic thrombocytopenic purpura (ITP)? Blut 50, 249-252 (1985)). Важно то, что процентное содержание димеров также коррелирует с вазоактивными побочными эффектами, которые поддаются терапии с применением ацетилгидролазы (Bleeker, W.K. et al. Vasoactive side effects of intravenous immunoglobulin preparations in a rat model and their treatment with recombinant platelet-activating factor acetylhydrolase. Blood 95, 1856-1861 (2000)).

[0011] Настоящее изобретение относится к биологически активным биомиметическим молекулам, к содержащим их композициям, а также к способам их применения. Указанные биомиметики находят широкое применение для лечения иммунологических и воспалительных заболеваний, включая, помимо прочих, аутоиммунные заболевания, а также в качестве биоиммунотерапевтических средств для лечения злокачественной опухоли. Кроме того, некоторые из указанных биомиметиков также находят применение в качестве реагентов, предназначенных, например, для применения в иммунологическом анализе, осуществляющем проверку функции иммуноцитов, а также при диагностике заболевания. Кроме того, биомиметики и композиции по настоящему изобретению обладают преимуществом, которое состоит в преодолении вышеуказанных ограничений hIVIG. Изобретение также относится к лечению и профилактике патологических состояний, опосредованных клетками, происходящими из моноцитов, и, более конкретно, к применению стабилизированных функциональных частей Fc-фрагментов IgG при таком лечении и профилактике.

[0012] В первом варианте осуществления настоящее изобретение направлено на выделенные последовательные страдомеры, содержащие два или более соединенных мономеров страдомера, где каждый из мономеров страдомера включает два или более мономера Fc-домена, где соединение двух или более мономеров страдомера приводит к формированию двух или более Fc-доменов, и где последовательный страдомер специфично связывается с первым Fcγ-рецептором через первый из двух или более Fc-доменов и со вторым Fcγ-рецептором через второй из двух или более Fc-доменов. В предпочтительном варианте осуществления два или более мономеров страдомера связаны через ковалентную связь, дисульфидную связь или посредством химического поперечного сшивания.

[0013] В предпочтительном варианте осуществления настоящего изобретения выделенные последовательные страдомеры состоят из двух соединенных мономеров страдомера. В другом предпочтительном варианте осуществления выделенные последовательные страдомеры состоят из двух соединенных мономеров страдомера, где оба мономера страдомера включают два мономера Fc-домена и где соединение двух мономеров страдомера приводит к формированию двух Fc-доменов. В первом конкретном примере данных вариантов осуществления, направленном на выделенные последовательные страдомеры, по меньшей мере один из двух Fc-доменов включает шарнирную область IgG и CH2 домен IgG. Во втором конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG и CH2 домен IgG. В третьем конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В четвертом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В пятом конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В шестом конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, а также CH2 домен IgG1 или CH2 домен IgG3. В седьмом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В восьмом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG1. В девятом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG3, CH2 домен IgG3 и CH3 домен IgG3. В десятом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG3.

[0014] Также в указанном первом варианте осуществления каждый из двух или более Fc-доменов относятся к одному классу Fc иммуноглобулина, причем класс Fc иммуноглобулина выбран из группы, состоящей из IgG1, IgG2, IgG3 и IgG4. Альтернативно каждый из двух или более Fc-доменов относятся к различным классам Fc иммуноглобулина, причем указанный класс Fc иммуноглобулина выбран из группы, состоящей из IgG1, IgG2, IgG3 и IgG4.

[0015] Кроме того, в указанном первом варианте осуществления первый и второй Fc-γ рецепторы независимо представляют собой Fc-γ рецептор I, Fc-γ рецептор II, Fc-γ рецептор III или Fc-γ рецептор IV. Предпочтительно и первый, и второй Fc-γ рецепторы являются Fc-γ рецептором IIIa.

[0016] Во втором варианте осуществления настоящее изобретение направлено на выделенные последовательные страдомеры, включающие два соединенных мономера страдомера, где каждый из мономеров страдомера включает два мономера Fc-домена, где соединение двух мономеров страдомера приводит к формированию двух Fc-доменов, где каждый из указанных двух Fc-доменов независимо включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG, и где последовательный страдомер специфично связывается с первым Fc-γ рецептором через первый из двух Fc-доменов и со вторым Fc-γ рецептором через второй из двух Fc-доменов. В предпочтительном варианте осуществления два или более мономера страдомера соединены через ковалентную связь, дисульфидную связь или посредством химического поперечного сшивания.

[0017] В первом конкретном примере указанного второго варианта осуществления каждый из двух Fc-доменов относится к одному классу Fc иммуноглобулина, причем класс Fc иммуноглобулина выбран из группы, состоящей из IgG1, IgG2, IgG3 и IgG4. Во втором конкретном примере каждый из двух Fc-доменов относится к различным классам Fc иммуноглобулина, причем указанный класс Fc иммуноглобулина выбран из группы, состоящей из IgG1, IgG2, IgG3 и IgG4. В третьем конкретном примере по меньшей мере один из Fc-доменов включает шарнирную область IgG и CH2 домен IgG. В четвертом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG и CH2 домен IgG. В пятом конкретном примере по меньшей мере один из Fc-доменов включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В шестом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В седьмом конкретном примере по меньшей мере один из Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В восьмом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В девятом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG1. В десятом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG3, CH2 домен IgG3 и CH3 домен IgG3. В одиннадцатом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG3.

[0018] В третьем варианте осуществления настоящее изобретение относится к выделенным последовательным страдомерам, дополнительно включающим Fab-домен, где каждый из мономеров страдомера включает тяжелую цепь Fab-фрагмента и два мономера Fc-домена, где тяжелая цепь Fab-фрагмента расположена на N-конце или С-конце двух мономеров Fc-домена, где легкая цепь Fab-фрагмента независимо связана с каждой тяжелой цепью Fab-фрагмента, и где Fab-домен обладает антигенсвязывающей активностью. В предпочтительном варианте осуществления каждый из мономеров страдомера дополнительно включает мономер шарнирной области иммуноглобулина, и где мономер шарнирной области иммуноглобулина расположен между тяжелой цепью Fab-фрагмента и двумя мономерами Fc-домена.

[0019] В четвертом варианте осуществления настоящее изобретение направлено на кор-страдомеры, включающие кор-группу, связанную с двумя или более кор-страдомерными единицами, где каждая из двух или более кор-страдомерных единиц включает по меньшей мере один Fc-домен и где каждая из кор-страдомерных единиц независимо выбрана из группы, состоящей из:

(a) Fc-фрагмента, где указанный Fc-фрагмент включает два соединенных мономера Fc-фрагмента, где каждый из указанных мономеров Fc-фрагмента включает мономер Fc-домена и где соединение двух мономеров Fc-фрагмента приводит к формированию Fc-домена,

(b) неполного Fc-фрагмента, где указанный неполный Fc-фрагмент включает два соединенных неполных мономера Fc-фрагмента, где каждый указанный неполный мономер Fc-фрагмента включает мономер Fc-домена и где соединение двух неполных мономеров Fc-фрагмента приводит к формированию Fc-домена,

(c) Fc-домена, где указанный Fc-домен включает два соединенных мономера Fc-домена и где соединение двух мономеров Fc-домена приводит к формированию Fc-домена,

(d) последовательного страдомера, где указанный последовательный страдомер включает два или более соединенных мономеров страдомера, где каждый из указанных мономеров страдомера включает два или более мономеров Fc-домена и где соединение двух или более мономеров страдомера приводит к формированию двух или более Fc-доменов, и

(e) кластерного страдомера, где указанный кластерный страдомер включает два или более мультимеризованных кластерных страдомерных единиц, где каждая указанная кластерная страдомерная единица включает мультимеризирующую область и по меньшей мере один Fc-домен, где каждая указанная кластерная страдомерная единица включает два соединенных мономера кластерной страдомерной единицы, где каждый указанный мономер кластерной страдомерной единицы включает мономер мультимеризирующей области и по меньшей мере один мономер Fc-домена, где соединение двух мономеров кластерной страдомерной единицы приводит к формированию мультимеризирующей области и по меньшей мере одного Fc-домена, и где мультимеризирующие области двух или более кластерных страдомерных единиц мультимеризованы с формированием кластерного страдомера, и

где кор-страдомер специфично связывается с первым Fc-γ рецептором через первую из двух или более кор-страдомерных единиц и со вторым Fc-γ рецептором через вторую из двух или более кор-страдомерных единиц.

[0020] Предпочтительно в указанном четвертом варианте осуществления кор-группа выбрана из группы, состоящей из J-цепи иммуноглобулина, альбумина, липосомы, частицы, пептида и полиэтиленгликоля.

[0021] В предпочтительных вариантах осуществления, относящихся к кор-страдомерам, каждая из двух или более кор-страдомерных единиц независимо является Fc-фрагментом. В альтернативном варианте каждая из двух или более кор-страдомерных единиц независимо является последовательным страдомером.

[0022] В другом предпочтительном варианте осуществления, направленном на кор-страдомеры, кор-страдомер включает две кор-страдомерных единицы, где каждая из двух кор-страдомерных единиц независимо является последовательным страдомером, где последовательный страдомер включает два соединенных мономера страдомера, где оба из указанных мономеров страдомера включают два мономера Fc-домена, и где соединение двух мономеров страдомера приводит к формированию двух Fc-доменов. В первом конкретном примере указанного варианта осуществления по меньшей мере один из Fc-доменов двух или более кор-страдомерных единиц включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. Во втором конкретном примере по меньшей мере один из Fc-доменов двух или более кор-страдомерных единиц включает шарнирную область IgG1 или шарнирную область IgG3, а также CH2 домен IgG1. В третьем конкретном примере каждый из Fc-доменов двух или более кор-страдомерных единиц независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG1. В четвертом конкретном примере по меньшей мере один из Fc-доменов двух или более кор-страдомерных единиц включает шарнирную область IgG и CH2 домен IgG. В пятом конкретном примере каждый из Fc-доменов двух или более кор-страдомерных единиц независимо включает шарнирную область IgG и CH2 домен IgG. В шестом конкретном примере каждый из Fc-доменов двух или более кор-страдомерных единиц независимо включает шарнирную область IgG3, CH2 домен IgG3 и CH3 домен IgG3. В седьмом конкретном примере каждый из Fc-доменов двух или более кор-страдомерных единиц независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG3.

[0023] В указанном варианте осуществления и первый, и второй Fc-γ рецептор независимо представляет собой Fc-γ рецептор I, Fc-γ рецептор II, Fc-γ рецептор III или Fc-γ рецептор IV. Предпочтительно, и первый, и второй Fc-γ рецептор является Fc-γ рецептором IIIa.

[0024] В пятом варианте осуществления настоящее изобретение относится к кластерным страдомерам, включающим две или более мультимеризованные кластерные страдомерные единицы, где каждая кластерная страдомерная единица включает мультимеризирующую область и по меньшей мере один Fc-домен, где каждая кластерная страдомерная единица включает два соединенных мономера кластерной страдомерной единицы, где каждый мономер кластерной страдомерной единицы включает мономер мультимеризирующей области и по меньшей мере один мономер Fc-домена, где соединение двух мономеров кластерной страдомерной единицы приводит к формированию мультимеризирующей области и по меньшей мере одного Fc-домена, где мультимеризирующие области двух или более кластернных страдомерных единиц мультимеризованы с формированием кластерного страдомера, и где кластерный страдомер специфично связывается с первым Fc-γ рецептором через первый Fc-домен и со вторым Fc-γ рецептором через второй Fc-домен.

[0025] В предпочтительных вариантах осуществления мультимеризирующая область выбрана из группы, состоящей из шарнирной области IgG2, CH2 домена IgE, лейциновой, изолейциновой “молнии” и цинкового пальца.

[0026] В другом предпочтительном варианте осуществления кластерные страдомеры включают две, три, четыре или пять мультимеризованных кластерных страдомерных единиц.

[0027] В первом конкретном примере указанного пятого варианта осуществления по меньшей мере один из Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. Во втором конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG1. В третьем конкретном примере по меньшей мере один из Fc-доменов включает шарнирную область IgG и CH2 домен IgG. В четвертом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG и CH2 домен IgG. В пятом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG3, CH2 домен IgG3 и CH3 домен IgG3. В шестом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG3. В седьмом конкретном примере каждый из Fc-доменов независимо включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В восьмом конкретном примере по меньшей мере одна из кластерных страдомерных единиц включает два или более Fc-домена. В девятом конкретном примере каждая кластерная страдомерная единица включает два или более Fc-домена.

[0028] В указанном варианте осуществления и первый, и второй Fc-γ рецептор независимо представляет собой Fc-γ рецептор I, Fc-γ рецептор II, Fc-γ рецептор III или Fc-γ рецептор IV. Предпочтительно и первый, и второй Fc-γ рецептор являются Fc-γ рецептором IIIa.

[0029] В шестом варианте осуществления настоящее изобретение направлено на страдотела, включающие два или более соединенных мономеров страдомера и Fab-домен, где каждый из мономеров страдомера включает тяжелую цепь Fab-фрагмента и два или более мономеров Fc-домена, где тяжелая цепь Fab-фрагмента расположена на N-конце или C-конце двух или более мономеров Fc-домена, где соединение двух или более мономеров страдомера приводит к формированию двух или более Fc-доменов, где легкая цепь Fab-фрагмента независимо соединена с тяжелой цепью Fab-фрагмента каждого мономера страдомера, где Fab-домен обладает антигенсвязывающей активностью и где страдотело специфично связывается с первым Fc-γ рецептором через первый из двух или более Fc-доменов и со вторым Fc-γ рецептором через второй из двух или более Fc-доменов.

[0030] В предпочтительных вариантах осуществления два или более мономера страдомера связаны через ковалентную связь, дисульфидную связь или посредством химического поперечного сшивания.

[0031] В другом предпочтительном варианте осуществления каждый из указанных мономеров страдомера в страдотелах дополнительно включает мономер шарнирной области иммуноглобулина, и где мономер шарнирной области иммуноглобулина расположен между тяжелой цепью Fab-фрагмента и двумя мономерами Fc-домена.

[0032] В конкретном варианте осуществления страдотело включает два соединенных мономера страдомера, где каждый из указанных мономеров страдомера включает тяжелую цепь Fab-фрагмента и два мономера Fc-домена, и где соединение двух мономеров страдомера приводит к формированию двух Fc-доменов. В первом конкретном примере указанного варианта осуществления по меньшей мере один из двух Fc-доменов включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. Во втором конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG, CH2 домен IgG и CH3 домен IgG. В третьем конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG и CH3 домен IgG. В четвертом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG и CH3 домен IgG. В пятом конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В шестом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1 или шарнирную область IgG3, CH2 домен IgG1 или CH2 домен IgG3, а также CH3 домен IgG1 или CH3 домен IgG3. В седьмом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG1. В восьмом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG3, CH2 домен IgG3 и CH3 домен IgG3. В девятом конкретном примере каждый из двух Fc-доменов независимо включает шарнирную область IgG1, CH2 домен IgG1 и CH3 домен IgG3. В десятом конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, а также CH2 домен IgG1 или CH2 домен IgG3. В одиннадцатом конкретном примере по меньшей мере один из двух Fc-доменов включает шарнирную область IgG1 или шарнирную область IgG3, а также CH2 домен IgG1.

[0033] В указанном варианте осуществления и первый, и второй Fc-γ рецепторы независимо представляет собой Fc-γ рецептор I, Fc-γ рецептор II, Fc-γ рецептор III или Fc-γ рецептор IV. Предпочтительно и первый, и второй Fc-γ рецептор являются Fc-γ рецептором IIIa.

[0034] В седьмом варианте осуществления настоящее изобретение направлено на способы изменения иммунного ответа у индивида, включающие введение индивиду, при необходимости, фармацевтической композиции, содержащей терапевтически эффективное количество последовательного страдомера, а также носитель или разбавитель. В предпочтительном варианте осуществления фармацевтическая композиция содержит терапевтически эффективное количество гетерогенной смеси последовательных страдомеров, а также носитель или разбавитель.

[0035] В восьмом варианте осуществления настоящее изобретение относится к способам изменения иммунного ответа у индивида, включающие введение индивиду, при необходимости, фармацевтической композиции, включающей терапевтически эффективное количество кор-страдомера, а также носитель или разбавитель. В предпочтительном варианте осуществления фармацевтическая композиция содержит терапевтически эффективное количество гетерогенной смеси кор-страдомеров, а также носитель или разбавитель.

[0036] В девятом варианте осуществления настоящее изобретение относится к способам изменения иммунного ответа у индивида, включающие введение индивиду, при необходимости, фармацевтической композиции, включающей терапевтически эффективное количество кластерного страдомера, а также носитель или разбавитель. В предпочтительном варианте осуществления фармацевтическая композиция содержит терапевтически эффективное количество гетерогенной смеси кластерных страдомеров, а также носитель или разбавитель.

[0037] В десятом варианте осуществления настоящее изобретение относится к способам изменения иммунного ответа у индивида, включающие введение индивиду, при необходимости, фармацевтической композиции, включающей терапевтически эффективное количество страдотела, а также носитель или разбавитель. В предпочтительном варианте осуществления фармацевтическая композиция включает терапевтически эффективное количество гетерогенной смеси страдотел, а также носитель или разбавитель.

[0038] В одиннадцатом варианте осуществления настоящее изобретение относится к способам скрининга антитела на предмет специфичной активности в отношении клетки иммунной системы, включающим: (a) контакт гомогенной популяции клеток иммунной системы с антителом-кандидатом, (b) измерение активности популяции клеток (a), (c) контакт с гомогенной популяцией клеток того же типа клеток, как в (a), с последовательным страдомером по п.1, (d) измерение активности популяции клеток (c), и (e) сравнение активности, измеренной в (b), с активностью, измеренной в (d), осуществляя, таким образом, скрининг антитела на предмет специфичной активности в отношении клетки иммунной системы. В предпочтительном варианте осуществления антитело-кандидат и последовательный страдомер подбирают в соответствии с видами и изотипом. В другом предпочтительном варианте осуществления сравнение в (e) является отношением активности, измеренной в (d), к активности, измеренной в (b).

[0039] В двенадцатом варианте осуществления настоящее изобретение относится к способам ингибирования активности клетки, происходящей из моноцита (MDC). Способ включает контакт клетки с композицией, содержащей подложку, с которой связан Fc-реагент. Контакт может быть осуществлен in vitro, in vivo или ex vivo. Клетка может находиться в огранизме животного, например, животного с заболеванием, опосредованным клетками, происходящими из моноцитов (MDCMC), или животного, которое подвергается риску развития указанного заболевания. Клетка может являться, например, дендритной клеткой, макрофагом, моноцитом или остеокластом.

[0040] В тринадцатом варианте осуществления настоящее изобретение относится к способам лечения, которые включают введение животному композиции, включающей подложку, с которой связан Fc-реагент, причем животное страдает заболеванием, опосредованным клетками, происходящими из моноцитов (MDCMC), или подвергается риску его развития.

[0041] Ниже приведены варианты осуществления, общие для двух указанных способов (двенадцатого и тринадцатого варианта осуществления).

[0042] Животное может являться, например, человеком.

[0043] Fc-реагент может содержать или представлять собой функциональную часть Fc-фрагмента человека, например, Fc-фрагмент IgG1 человека, Fc-фрагмент IgG3 человека, IgG2 человека или Fc-фрагмент IgG4 человека. Кроме того, он может содержать или представляет собой молекулу IgG. Fc-реагент может также являться или включать функциональную часть Fc-фрагмента не человека.

[0044] Подложка может представлять собой или содержать синтетический полимер, например, нейлон, тефлон, дакрон, поливинилхлорид, ПЭУ (полиэфируретан), ПТФЭ (политетрафторэтилен) или ПММА (полиметилметакрилат). Подложка может содержать или представлять собой металл или металлический сплав, например, нержавеющую сталь, платину, иридий, титан, тантал, никельтитановый сплав или кобальтохромовый сплав. Подложка может содержать или представлять собой ткань животных или препарат ткани животных, например, тканевый или органный трансплантат, кость (например, остеогенную ткань) или хрящ. Подложка может содержать или представлять собой белок, например, коллаген или кератин. Подложка может также представлять собой или содержать полисахарид, например, агарозу. Кроме того, подложка может содержать или представлять собой тканевый матрикс, например, ацеллюлярный тканевый матрикс. Подложка может содержать или представлять собой клетку животного (например, клетку, восстанавливающую ткань, такую как фибробласты или мезенхимальная стволовая клетка). Подложка может содержать или представлять собой соль, например, сульфат кальция. Кроме того, подложка может представлять собой или содержать гель или крем. Также она может содержать или представлять собой силикон или силастик. Также она может содержать или представлять собой натуральное волокно, например, шелк, хлопок или шерсть.

[0045] Подложка может представлять собой комплекс, формирующий поры в мембране или имплантируемое медицинское устройство, такое как стент (например, сосудистый стент, такой как коронарный стент; стент, размещаемый в дыхательных путях, такой как эндотрахеальный или назальный стент; желудочно-кишечный стент, такой как билиарный или панкреатический стент; или мочеточниковый стент, такой как уретральный стент). Также она может являться хирургической нитью (например, шелковой нитью, хромированным кетгутом, нейлоновой, полимерной или металлической нитью, или хирургическим зажимом (например, зажимом при аневризме)). Кроме того, подложка может являться искусственным бедром, искусственным тазобедренным суставом, искусственным коленом, искусственным коленным суставом, искусственным плечом, искусственным плечевым суставом, искусственным пальцевым суставом (руки или ноги), костной пластинкой, костным штифтом, имплантом при переломе кости, имплантом межпозвоночного диска, костным цементом, или прослойкой из костного цемента. Она может являться артериально-венозным шунтом, имплантируемой проволокой, кардиостимулятором, искусственным сердцем, прибором, поддерживающим работу сердца, кохлеарным имплантом, имплантируемым дефибриллятором, стимулятором спинного мозга, стимулятором центральной нервной системы, имплантом перифирического нерва, зубным протезом или зубной коронкой. Кроме того, подложка может являться устройством или сеткой для защиты больших сосудов от эмболии, подкожным устройством, кожным пластырем или пластырем на подслизистую, или имплантируемым устройством для доставки лекарственного средства.

[0046] Подложка может также являться трансплантатом большого кровеносного сосуда, где кровеносный сосуд является, например, сонной артерией, бедренной артерией или аортой. Также она может являться подкожным имплантом, корнеальным имплантом, искусственным хрусталиком или контактной линзой.

[0047] Подложка может находиться в форме, например, листа, гранулы, сетки, частицы порошка, нити, гранулы или волокна. Подложка может содержать или представлять собой твердое, полутвердое или гелеобразное вещество. Таким образом, подложка содержит вещества, которые практически нерастворимы в водных растворителях, например, жирорастворимый липид, такой как липосома.

[0048] MDCMC может являться воспалительным заболеванием, аутоиммунным заболеванием, злокачественной опухолью, нарушением плотности кости, острой инфекцией или хронической инфекцией.

[0049] MDCMC может являться гематоиммунологическим процессом, например, идиопатической тромбоцитопенической пурпурой, аллоиммунной/аутоиммунной тромбоцитопенией, приобретенной иммунной тромбоцитопенией, аутоиммунной нейтропенией, аутоиммунной гемолитической анемией, Парвовирус B19-ассоциированной эритроцитарной аплазией, приобретенным аутоиммунитетом против фактора VIII, приобретенной болезнью фон Виллебранда, множественной миеломой и моноклональной гаммапатией неизвестной этиологии, сепсисом, апластической анемией, истинной эритроцитарной аплазией, анемией Даймонда-Блекфана, гемолитической болезнью новорожденных, иммуноопосредованной нейтропенией, невосприимчивостью к переливанию тромбоцитарной массы, неонатальной посттрансфузионной пурпурой, гемолитическим уремическим синдромом, системными васкулитами, тромбоцитопенической тромбогемолитической пурпурой или синдромом Эвана.

[0050] Альтернативно, MDCMC может являться нейроиммунологическим процессом, например, синдром Гийена-Барре, хронической воспалительной демиелинизирующей полирадикулоневропатией, парапротеинемической IgM демиелинизирующей полиневропатией, миастеническим синдромом Ламберта-Итона, миастенией гравис, многоочаговой двигательной невропатией, боковым амиотрофическим склерозом, ассоциируемым с антителами против GM1, демиелинизацией, рассеянным склерозом и невритом зрительного нерва, синдромом мышечной скованности, паранеопластической дегенерацией мозжечка, вызванной анти-Yo антителами, паранеопластическим энцефаломиелитом, сенсорной невропатией, вызванной анти-Hu антителами, эпилепсией, энцефалитом, миелитом, миелопатией, особенно связанной с Т-лимфотропным вирусом человека первого типа, аутоиммунной диабетической невропатией или острой идиопатической вегетативной невропатией.

[0051] MDCMC может являться ревматическим процессом, например, болезнью Кавасаки, ревматоидным артритом, синдромом Фелти, АНЦА-положительным васкулитом, спонтанным полимиозитом, дерматомиозитом, антифосфолипидными синдромами, повторным самопроизвольным абортом, системной красной волчанкой, ювенильным идиопатическим артритом, синдромом Рейно, CREST-синдромом или увеитом.

[0052] Кроме того, MDCMC может являться дерматоиммунологическим процессом, например, эпидермальным некролизом, гангреной, гранулемой, аутоиммунными заболеваниями кожи с развитием нарывов, включая вульгарную пузырчатку, буллезный пемфигоид и эксфолиативную пузырчатку, витилиго, синдромом стрептококкового токсического шока, склеродермией, системным склерозом, включая диффузный и локальный кожный системный склероз, атопическим дерматитом или стероидозависимым атопическим дерматитом.

[0053] Кроме того, MDCMC может являться скелетно-мышечным иммунологическим заболеванием, например, миозитом с включенными тельцами, некротизирующим фасцитом, воспалительными миопатиями, миозитом, анти-декорин (BJ антиген) миопатией, паранеопластической некротической миопатией, вакуолизирующей миопатией, сцепленной с X-хромосомой, пеницилламин-индуцированным полимиозитом, атеросклерозом, ишемической болезнью сердца или кардиомиопатией.

[0054] MDCMC может также являться желудочно-кишечным иммунологическим процессом, например, пернициозной анемией, аутоиммунным хроническим активным гепатитом, первичным биллиарным циррозом печени, глютеновой энтеропатией, герпетиформным дерматитом, криптогенным циррозом печени, реактивным артритом, болезнью Крона, болезнью Уипла, язвенным колитом или склерозирующим холангитом.

[0055] MDCMC может являться, например, гомологичной болезнью (РТПХ), антитело-опосредованным отторжением трансплантата, отторжением трансплантата костного мозга, постинфекционным воспалением, лимфомой, лейкозом, неоплазией, астмой, сахарным диабетом I типа с антителами против бета-клеток, синдромом Шегрена, смешанным поражением соединительной ткани, болезнью Аддисона, синдромом Фогта-Коянаги-Харады, мембранозно-пролиферативным гломерулонефритом, синдромом Гудпасчера, болезнью Грейвса, тиреоидитом Хашимото, гранулематозом Вегенера, микрополиартеритом, синдромом Черджа-Стросс, узелковым полиартериитом или полиорганной недостаточностью.

[0056] Когда MDCMC является злокачественной опухолью, тогда MDCMC может быть фибросаркомой, миксосаркомой, липосаркомой, хондросаркомой, остеобластической саркомой, хордомой, ангиосаркомой, эндотелиосаркомой, лимфангиосаркомой, лимфангиоэндотелиосаркомой, синовиомой, мезотелиомой, саркомой Юинга, лейомиосаркомой, рабдомиосаркомой, карциномой толстой кишки, раком поджелудочной железы, раком молочной железы, раком яичников, раком предстательной железы, плоскоклеточной карциномой, базальноклеточной карциномой, аденокарциномой, карциномой потовой железы, карциномой сальной железы, папиллярной карциномой, папиллярными аденокарциномами, цистаденокарциномой, медуллярной карциномой, бронхогенной карциномой, почечноклеточной карциномой, гепатомой, карциномой желчных протоков, хориокарциномой, семиномой, таратокарциномой, опухолью Вилмса, раком шейки матки, опухолью яичка, карциномой легкого, мелкоклеточной карциномой легкого, карциномой мочевого пузыря, эпителиальной карциномой, глиомой, астроцитомой, медуллобластомой, краниофарингиомой, эпендимомой, пинеаломой, гемангиобластомой, невромой слухового нерва, олигодендроглиомой, менингиомой, меланомой, нейробластомой, ретинобластомой, лейкозом, лимфомой, множественной миеломой, макроглобулинемией Вальденстрема, миелодиспластической болезнью, болезнью тяжелых цепей, нейроэндокринными опухолями или шванномой.

[0057] Если MDCMC является заболеванием, связанным с нарушением плотности кости, то MDCMC может являться остеопорозом, остеопенией, врожденным остеопетрозом, идиопатическим гипогонадотропным гипогонадизмом, нервной анорексией, незаживающим переломом, постклимактерическим остеопорозом, дефицитом или избытком витамина D, первичным или вторичным гиперпаратиреозом, болезнью щитовидной железы или токсичностью бисфосфоната.

[0058] Когда MDCMC является острой инфекцией, тогда MDCMC может являться: грибковым заболеванием, включая кандидоз, кандидемию или аспергиллез; бактериальным заболеванием, включающим инфекции, вызванные стафилококком, включая метициллин-устойчивый Staphylococcus aureus, стрептококковые инфекции кожи и орофарингеальные заболевания или сепсис, вызванный грамм-отрицательными бактериями; микобактериальной инфекцией, включая туберкулез; вирусной инфекцией, включая мононуклеоз, респираторную синцитиальную вирусную инфекцию или опоясывающий герпес; паразитарной инфекцией, включая малярию, шистосомоз или трипаносомоз.

[0059] Когда MDCMC является хронической инфекцией, тогда MDCMC может являться онихомикозом; бактериальным заболеванием, включая инфекцию Helicobacter pylori; микобактериальной инфекцией, включая туберкулез; вирусной инфекцией, включая инфекцию, вызванную вирусом Эпштейна-Барра, инфекцию, вызванную вирусом папилломы человека, или инфекцию, вызванную вирусом простого герпеса; или паразитарной инфекцией, включая малярию или шистосомоз.

[0060] В четырнадцатом варианте осуществления настоящее изобретение относится к композиции, которая содержит или является имплантируемым или присоединяемым медицинским устройством и Fc-реагентом, связанным с ним.

[0061] В пятнадцатом варианте осуществления настоящее изобретение относится к набору, который содержит имплантируемое или присоединяемое медицинское устройство и Fc-реагент. В обоих указанных вариантах осуществления имплантируемое или присоединяемое медицинское устройство и Fc-реагент могут являться любыми из описанных в настоящей заявке. Набор может дополнительно содержать подходящий контейнер.

[0062] Дополнительные преимущества и признаки настоящего изобретения будут очевидны из последующего подробного описания, фигур и примеров, которые иллюстрируют предпочтительные варианты осуществления изобретения.

[0063] Вышеизложенное в общих чертах довольно широко описывает признаки и технические преимущества настоящего изобретения, чтобы последующее подробное описание изобретения могло быть лучше понято. Дополнительные признаки и преимущества изобретения, которые образуют объект настоящего изобретения, будут описаны далее. Для специалиста в данной области очевидно, что концепция и конкретные раскрытые варианты осуществления изобретения могут использоваться как основа для изменения или проектирования других структур, осуществляя те же самые задачи настоящего изобретения. Для специалиста в данной области очевидно, что такие эквивалентные структуры не выходят за рамки объема и не изменяют сущность настоящего изобретения, сформулированного в прилагаемой формуле изобретения. Новые признаки, которые, как полагают, являются существенными для изобретения, а также его структуры и способа осуществления, вместе с другими объектами и преимуществами, будут более понятны из последующего описания, рассматриваемого в совокупности с сопровождающими фигурами. Впрочем, следует учитывать, что каждая из фигур приведена исключительно в целях иллюстрации и описания, и не должна рассматриваться как ограничивающая настоящее изобретение.

КРАТКОЕ ОПИСАНИЕ ФИГУР

[0064] На фиг.1A схематически показаза нативная структура мономера Fc-фрагмента из IgG1, шарнирная область которого связана с CH2 доменом, который связан с CH3 доменом; на фиг.1B показан самоагрегированный, нативный Fc-фрагмент IgG1, сформированный из двух связанных мономеров Fc-фрагмента.

[0065] На фиг.1C схематически показана нативная структура мономера Fc-фрагмента из IgG3, шарнирная область которого связана с CH2 доменом, который связан с CH3 доменом; на фиг.1D показан самоагрегированный, нативный Fc-фрагмент IgG3, сформированный из двух связанных мономеров Fc-фрагмента.

[0066] На фиг.2A и 2B показаны агрегаты более высокого порядка нативной структуры мономера Fc-фрагмента, показанной на фиг.1B. Фрагменты Fc могут естественно мультимеризоваться в димеры димера (то есть тетрамеры) или даже в агрегаты-мультимеры еще более высокого порядка.

[0067] На фиг.3A схематично показано нативное антитело IgG1, имеющее нативный Fab фрагмент, связанный с Fc-фрагментом в шарнирной области Fc-фрагмента; на фиг.3B показана аналогичная структура IgG3.

[0068] На фиг.4A показан мономер страдомер, состоящий из двух мономеров Fc-домена IgG1; на фиг.4B показана альтернативная структура мономера страдомера, в котором IgG1 Fc - IgG3 Fc - IgE Fc связаны последовательно.

[0069] На фиг.5A и B показаны мономеры страдомера из фиг.4 A и B, автодимеризованные в последовательный страдомер благодаря способности, свойственной составляющим мономерам Fc-домена.

[0070] На фиг.6A показан мономер страдомера, содержащий IgG1 Fc - IgG1 (шарнирная область - CH2); на фиг.6B показан страдомер, содержащий IgG1 (шарнирная область - CH2) - IgG3 (шарнирная область - CH2) - IgE (шарнирная область - CH2).

[0071] На фиг.7A и B показаны мономеры страдомера 6A и B, автодимеризованные в последовательный страдомер благодаря способности, свойственной составляющим мономерам Fc-домена.

[0072] На фиг.7C показан последовательный страдомер, содержащий IgE (шарнирная область)-IgG1 Fc-IgG1 (шарнирная область-CH2)-IgE (CH3). На фиг.7D показан последовательный страдомер, содержащий IgG3Fc - IgG1Fc.

[0073] На фиг.8А показана конструкция страдотела, содержащая Fab с последовательной структурой страдомера, при этом каждый мономер страдомера содержит два мономера IgG1 CH2-CH3, происходящих из Fc-домена; на фиг.8B показана конструкция страдотела, как и в 8A, но при этом в структуре страдомера содержится IgG1 Fc, связанный с IgG3 Fc, связанным с IgE Fc.

[0074] На фиг.9A показано страдотело IgG1 Fc - IgG1 (шарнирная область - CH2); на фиг.9B показано страдотело IgG1 (шарнирная область - CH2) - IgG3 (шарнирная область - CH2) - IgE (шарнирная область - CH2)3.

[0075] На фиг.10A показан мономер страдомера IgG1 (шарнирная область - CH2) - IgG3 CH3 - IgM CH4 и белок J-цепи; на фиг.10B показан кор-страдомер на основе пентамерного страдомера фиг.10A, сформированного в результате соединения через CH4 домен IgM к J-цепи.

[0076] На фиг.10C показан мономер страдомера IgG1 Fc - IgG1 Fc - IgM CH4 и белок J-цепи; На фиг.10D показан кор-страдомер на основе пентамерного страдомера фиг.10C, сформированного в результате соединения через CH4 домен IgM к J-цепи.

[0077] На фиг.11А показан мономер страдомера IgG1 Fc - IgG1 (шарнирная область - CH2). На фиг.11В показано, как мономер страдомера из фиг.11А может автодимеризоваться, формируя последовательный страдомер. На фиг.11C показано, как в том же мономере страдомера из фиг.11A мономерные Fc-домены могут выравниватся с теми же или подобными мономерами Fc-домена на другом мономере страдомера, но не автодимере, формируя, таким образом, страдомер, состоящий из того же мономера страдомера, как и автодимер, но со структурой с эффектом молнии.

[0078] На фиг.12A показан мономер IgG3 Fc - IgG1 Fc страдомера. На фиг.12B показано, что добавление второго IgG3 Fc, сопровождаемое автодимеризацией, может приводить к формированию разветвленного структурированного страдомера IgG3 Fc - IgG1 Fc - IgG3 Fc.

[0079] На фиг.13A показан мономер IgE CH2 - IgG1 Fc - IgG1 (шарнирная область-CH2) - IgE CH4 страдомера. На фиг.13B показан автодимер мономера фиг.13A и выделены два сформированных сайта связыванию FcγR.

[0080] На фиг.14A показан страдомер, состоящий из двух Fc-доменов IgG1, к которым присоединен линкер. На фиг.14B показан страдомер, состоящий из двух последовательных страдомеров (а именно в каждом случае страдомера 2(IgG1 Fc)), соединенных линкером.

[0081] На фиг.15A показаны нуклеотидная (SEQ ID NO:1) и аминокислотная (SEQ ID NO:2) последовательности Fc-фрагмента IgG1 человека. На фиг.15B показаны нуклеотидная (SEQ ID NO:3) и аминокислотная (SEQ ID NO:4) последовательности Fc-фрагмента IgG2 человека. На фиг.15C показаны нуклеотидная (SEQ ID NO:5) и аминокислотная (SEQ ID NO:6) последовательности Fc-фрагмента IgG3 человека. На фиг.15D показаны нуклеотидная (SEQ ID NO:7) и аминокислотная (SEQ ID NO:8) последовательности Fc-фрагмента IgG4 человека.

[0082] На фиг.16 показаны нуклеотидная (SEQ ID NO:17) и аминокислотная (SEQ ID NO:18) последовательности конструкции, включающей (сигнальную последовательность IgK - Fc-фрагмент IgG1 - Fc-фрагмент IgG1). Аминокислотная последовательность IgK сигнала выделена жирным шрифтом. Аминокислотная последовательность первого Fc-фрагмента IgG1 подчеркнута одинарной линией. Аминокислотная последовательность второго Fc-фрагмента IgG1 подчеркнута двойной линией. Серин и лизин, отмеченные звездочкой, являются аминокислотами, которые могут быть подвергнуты мутации с целью изменения связывания с Fc-γ рецептором.

[0083] На фиг.17 показаны нуклеотидная (SEQ ID NO:19) и аминокислотная (SEQ ID NO:20) последовательности конструкции, включающей (сайты рестрикции - сигнальную последовательность IgK - сайты рестрикции - IgG1(шарнирная область-CH2-CH3) - сайты рестрикции - эпитоп таги (V5 и His) - STOP). Аминокислотная последовательность IgK сигнала выделена жирным шрифтом. Аминокислотная последовательность Fc-фрагмента IgG1 подчеркнута одинарной линией. Аминокислотная последовательность V5-тага подчеркнута пунктирной линией. Аминокислотная последовательность His-тага подчеркнута жирной линией.

[0084] На фиг.18 показаны нуклеотидная (SEQ ID NO:21) и аминокислотная (SEQ ID NO:22) последовательности конструкции, включающей {сайты рестрикции - сигнал IgK - сайты рестрикции -IgG1(шарнирная область-CH2-CH3)- сайт XbaI - IgG1(шарнирная область-CH2-CH3) - STOP}. Аминокислотная последовательность сигнала IgK выделена жирным шрифтом. Аминокислотная последовательность первого Fc-фрагмента IgG1 подчеркнута одинарной линией. Аминокислотная последовательность второго Fc-фрагмента IgG1 подчеркнута двойной линией.

[0085] На фиг.19 показаны нуклеотидная (SEQ ID NO:23) и аминокислотная (SEQ ID NO:24) последовательности конструкции, включающей {сайты рестрикции - сигнал IgK - сайты рестрикции -IgG1 (шарнирная область-CH2-CH3) сайт XbaI - IgG1 (шарнирная область-CH2-CH3) - эпитоп таги (V5 и His) - STOP}. Аминокислотная последовательность сигнала IgK выделена жирным шрифтом. Аминокислотная последовательность первого Fc-фрагмента IgG1 подчеркнута одинарной линией. Аминокислотная последовательность второго Fc-фрагмента IgG1 подчеркнута двойной линией. Аминокислотная последовательность V5-тага подчеркнута пунктирной линией. Аминокислотная последовательность His-тага подчеркнута жирной линией.

[0086] На фиг.20A показаны нуклеотидная (SEQ ID NO:31) и аминокислотная (SEQ ID NO:32) последовательности N-концевой сигнальной последовательности FcRgammaIIIa, в которой полиморфизм фенилаланина (F) выделен жирным шрифтом и подчеркнут. Вариабельная нуклеиновая кислота также выделена жирным шрифтом и подчеркнута. На фиг.20B показаны нуклеотидная (SEQ ID NO:33) и аминокислотная (SEQ ID NO:34) последовательности N-концевой сигнальной последовательности FcRgammaIIIa, в которой полиморфизм валина (V) выделен жирным шрифтом и подчеркнут. Вариабельная нуклеиновая кислота также выделена жирным шрифтом и подчеркнута. Обе конструкции содержат C-концевой гекса-His-таг для очистки.

[0087] На фиг.21 показаны нуклеотидная (SEQ ID NO:25) и аминокислотная (SEQ ID NO:26) последовательности конструкции, включающей {сайты рестрикции - сигнал IgK - сайт EcoRV - IgG3 (шарнирная область-CH2-CH3)-IgG1 (шарнирная область-CH2-CH3) - сайты рестрикции - эпитоп таги (V5 и His) - STOP}. Аминокислотная последовательность сигнала IgK выделена жирным шрифтом. Аминокислотная последовательность Fc-фрагмента IgG3 подчеркнута одинарной линией. Аминокислотная последовательность Fc-фрагмента IgG1 подчеркнута двойной линией. Аминокислотная последовательность V5-тага подчеркнута пунктирной линией. Аминокислотная последовательность His-тага подчеркнута жирной линией.

[0088] На фиг.22 показаны нуклеотидная (SEQ ID NO:27) и аминокислотная (SEQ ID NO:28) последовательности конструкции, включающей {сайты рестрикции - сигнал IgK - сайт EcoRV - IgE (CH2) - IgG1 (шарнирная область-CH2-CH3)-IgG1 (шарнирная область-CH2) - IgE (CH4) - STOP}. Аминокислотная последовательность сигнала IgK выделена жирным шрифтом. Аминокислотная последовательность IgE(CH2) домена подчеркнута одинарной линией. Аминокислотная последовательность IgG1 (шарнирная область-H2-CH3) домена подчеркнута двойной линией. Аминокислотная последовательность IgG1 (Шарнирная область-CH2) домена подчеркнута пунктирной линией. Аминокислотная последовательность IgE(CH4) домена подчеркнута волнистой линией.

[0089] На фиг.23A показан Fc-фрагмент, а также показано, что такой Fc-фрагмент состоит из двух мономеров Fc-фрагмента и дополнительно включает Fc-домен (пунктирный круг) и неполные Fc-домены (шарнирная область, CH2 и CH3, как обозначено). На фиг.23B показан состав последовательного страдомера, состоящего из двух мономеров страдомера, которые связаны интер-мономер страдомерной связью. Последовательный страдомер включает по меньшей мере два Fc-домена (обозначенных пунктирными кругами) и может необязательно включать область связывания доменов. На фиг.23C показан состав кор-страдомера, включающего кор-группу, с которой связаны кор-страдомерные единицы, каждая из которых содержит по меньшей мере один Fc-домен. Кор-страдомерные единицы могут являться Fc-фрагментом, последовательным страдомером или кластерной страдомерной единицей. На фиг.23D показан состав кластерного страдомера, включающего мультимеризованные кластерные страдомерные единицы, каждая из которых имеет мультимеризирующую область и область, содержащую по меньшей мере один Fc-домен. Кластерная страдомерная единица может являться Fc-фрагментом или последовательным страдомером. Мультимеризирующая область при мультимеризации формирует головку кластерного страдомера. Ножки кластерного страдомера сформированы областями Fc-доменов кластерных страдомерных единиц, которые пространственно менее сжаты, чем мультимеризованная головка кластерного страдомера.

[0090] На фиг.24 показаны аминокислотные последовательности страдомера, описанного в Таблице 3.

[0091] На фиг.25 показаны аминокислотные последовательности мономеров неполных Fc-доменов (шарнирная область, CH2 и CH3) IgG1, IgG2, IgG3 и IgG4 человека (Kabat, EA, Wu, TT, Perry, HM, Gottesman, KS, and Foeller, C. 1991. Sequences of proteins of immunological interest 5th Ed. US Public Health Services, NIH, Bethesda).

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[0092] Подход к рациональному молекулярному дизайну соединений, описанных в настоящей заявке, которые предназначены для замены hIVIG, включает рекомбинантное и/или биохимическое получение иммунологически активного биомиметика(ов). В предпочтительных способах соединения-заменители тестировали in vitro, чтобы оценить эффективность каждого соединения-заменителя при связывании Fcγ-рецептора и модулировании иммунной функции. Отдельные соединения-заменители отбирали для дальнейшего анализа in vivo, а также оптимизации дозировки/введения. Соединения-заменители могут применяться при лечении, например, аутоиммунных заболеваний, воспалительных заболеваний, остеопороза и злокачественной опухоли. Каждая фаза подробно описана ниже вместе с конкретными примерами осуществлениями.

[0093] Используемые в оригинальном тексте настоящей заявки артикли "a" или "an", при использовании вместе с термином "включающий" в пунктах формулы и/или в описании могут означать "один", но при этом также не исключается значение "один или более," "по меньшей мере один" и "один или более чем один".

[0094] Используемые в настоящем описании термины "биомиметик", "биомиметическая молекула", "биомиметическое соединение", а также подобные термины, относятся к искусственному соединению, которое имитуирует функцию другого соединения, например, смешанных hIVIG, моноклонального антитела или Fc-фрагмента антитела. "Биологически активные" биомиметики являются соединениями, которые обладают биологическими активностями, которые идентичны или по существу идентичны соответствующим природным аналогам. "Иммунологически активные" биомиметики являются биомиметиками, которые проявляют иммунологическую активность, которая по существу идентична активности природных иммунологически активных молекул, таких как антитела, цитокины, интерлейкины и другие иммунологические молекулы, известные в уровне техники. В предпочтительных вариантах осуществления биомиметики настоящего изобретения представляют собой страдомеры и страдотела, определенные в настоящей заявке.

[0095] Иммунологически активные биомиметики настоящего изобретения разработаны таким образом, что они обладают одной или несколькими иммуномодулирующими активностями Fc-домена IgG и включают по меньшей мере (i) первый Fc-домен, способный к связыванию с FcγR, включая FcγRI, FcγRII, FcγRIII и FcγRIV, и (ii) второй Fc-домен, способный к связыванию с FcγR, включая FcγRI, FcγRII, FcγRIII и FcγRIV.

[0096] В следующих параграфах определены элементарные звенья биомиметиков настоящего изобретения как структурно, так и функционально, а также определены биомиметики непосредственно. Однако следует отметить, что, как обозначено выше, каждый из биомиметиков настоящего изобретения имеет по меньшей мере два Fc-домена. Как минимум, Fc-домен является димерным полипептидом (или димерной областью более крупного полипептида), который включает две пептидных цепи или звена (мономера), которые соединены, формируя функциональный сайт связывания Fcγ-рецептора. Таким образом, функциональная форма индивидуальных фрагментов и доменов, описанных в настоящей заявке, существует обычно в димерной (или мультимерной) форме. Мономеры индивидуальных фрагментов и доменов, описанные в настоящей заявке, представляют собой одиночные цепи или звенья, которые должны соединяться со второй цепью или звеном, для того чтобы формировать функциональную димерную структуру.

Fc-фрагмент

[0097] "Fc-фрагмент" является термином из уровня техники, который используется для того, чтобы описать область белка или свернутой структуры белка, которая обычно находится на С-конце иммуноглобулинов (см. фиг. 3A-3B). Fc-фрагмент может быть выделен из Fab фрагмента моноклонального антитела с помощью расщепления папаином, что является неполным и несовершенным процессом (см. Mihaesco C and Seligmann M. Papain Digestion Fragments Of Human IgM Globulins. Journal of Experimental Medicine, VoI 127, 431-453 (1968)). Вместе с Fab фрагментом (содержащим связывающий домен антитела) Fc-фрагмент составляет холо-антитело, что в данном контексте означает полное антитело. Fc-фрагмент состоит из С-концевых частей тяжелых цепей антитела. Каждая из цепей в Fc фрагменте имеет размер приблизительно 220-265 аминокислот, при этом цепи часто связаны через дисульфидную связь. Fc-фрагмент часто содержит одну или несколько независимых структурных петель или функциональных субдоменов. В частности, Fc-фрагмент включает Fc-домен, определенный в настоящей заявке, как минимальная структура, которая связывается с Fcγ-рецептором (см., например, фиг. 1B и 1D). Выделенный Fc-фрагмент состоит из двух мономеров Fc-фрагмента (например, двух С-концевых частей тяжелых цепей антитела, также определенных в настоящей заявке), которые димеризованы. Образующийся при соединении двух мономеров Fc-фрагмента, Fc-фрагмент обладает связывающей активностью в отношении Fcγ-рецептора.

Неполный Fc-фрагмент

[0098] "Неполный Fc-фрагмент" является доменом, включающим неполноразмерный Fc-фрагмент антитела, который все же сохраняет структуру, которая достаточна для того, чтобы обладать такой же активностью, как и Fc-фрагмент, включая Fcγ-рецептор связывающую активность. Неполный Fc-фрагмент, таким образом, может быть лишен части или всей шарнирной области, части или всего CH2 домена, части или всего CH3 области, и/или части или всего CH4 области, в зависимости от изотипа антитела, из которого получен неполный Fc-домен. Пример неполного Fc-фрагмента включает молекулу, включающую верхнюю, центральную и нижнюю шарнирные области плюс CH2 домен IgG3 (Tan, LK, Shopes, RJ, Oi, VT and Morrison, SL, Influence of the hinge region on complement activation, CIq binding, and segmental flexibility in chimeric human immunoglobulins, Proc Natl Acad Sci USA. 1990 January; 87(1): 162-166). Таким образом, в данном примере неполный Fc-фрагмент не содержит CH3 домен, который присутствует в Fc-фрагменте IgG3. Неполные Fc-фрагменты состоят из двух мономеров неполного Fc-фрагмента. Как далее определено в настоящей заявке, при соединении двух таких мономеров неполного Fc-фрагмента образующийся неполный Fc-фрагмент обладает Fcγ-рецептор связывающей активностью.

Fc-домен

[0099] Используемый в настоящей заявке "Fc-домен" описывает минимальную область (в контексте более крупного полипептида) или наименьшую свернутую белковую структуру (в контексте изолированного белка), которая может связаться с или быть связанна Fcγ-рецептором. Как в Fc-фрагменте, так и в неполном Fc-фрагменте Fc-домен явялется минимальной связывающей областью, которая обеспечивает связывание молекулы с Fcγ-рецептором. Хотя Fc-домен может быть ограничен до отдельного полипептида, который может связываться Fcγ-рецептором, все же следует понимать, что Fc-домен может являться частью или всем фрагментом Fc, так же как частью или целым неполным Fc-фрагментом. Когда термин "Fc-домен" используется в настоящем изобретении, квалифицированный специалист будет понимать под этим термином более чем один Fc-домен. Fc-домен состоит из двух мономеров Fc-домена. Как дополнительно определено в настоящей заявке, Fc-домен, образующийся при соединении двух таких мономеров Fc-домена, обладает Fcγ-рецептор связывающей активностью. Таким образом, Fc-домен является димерной структурой, которая функционально может связывать Fcγ-рецептор.

Неполный Fc-домен

[00100] Используемый в настоящей заявке "неполный Fc-домен" описывает часть Fc-домена. Неполные Fc-домены включают отдельные домены константной области тяжелой цепи (например, CHl, CH2, CH3 и CH4 домены), а также шарнирные области иммуноглобулинов различных классов и подклассов. Таким образом, неполные Fc-домены настоящего изобретения включают CH1 домены IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE, CH2 домены IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE, CH3 домены IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE, CH4 домены IgM и IgE и шарнирные области IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE. Неполный Fc-домен настоящего изобретения может дополнительно включать комбинацию более чем одного из указанных доменов и шарнирных областей. Однако отдельные неполные Fc-домены настоящего изобретения и их комбинации не способны связывать FcγR. Таким образом, неполные Fc-домены и их комбинации включают менее чем один Fc-домен. Неполные Fc-домены могут быть соединены с формированием пептида, который обладает Fcγ-рецептор-связывающей активностью, формируя, таким образом, Fc-домен. В настоящем изобретении неполные Fc-домены используются вместе с Fc-доменами в качестве элементарных звеньев для создания биомиметиков настоящего изобретения, определенных в настоящей заявке. Каждый неполный Fc-домен состоит из двух мономеров неполного Fc-домена. Когда два таких мономера неполного Fc-домена соединяются, формируется неполный Fc-домен.

[00101] Как указано выше, каждый из Fc-фрагментов, неполных Fc-фрагментов, Fc-доменов и неполных Fc-доменов являются димерными белками или доменами. Таким образом, каждая из указанных молекул состоит из двух мономеров, которые при соединении формируют димерный белок или домен. Хотя свойства и активность димерных форм были описаны выше, мономерные пептиды описаны далее.

Мономер Fc-фрагмента

[00102] Используемый в настоящей заявке "мономер Fc-фрагмента" является одноцепочечным белком, который в соединении с другим мономером Fc-фрагмента составляет Fc-фрагмент. Мономер Fc-фрагмента, таким образом, является С-концевой частью одной из тяжелых цепей антитела, которые составляют Fc-фрагмент холо-антитела (например, смежной частью тяжелой цепи, которая включает шарнирную область, CH2 домен и CH3 домен IgG) (см. фиг.1A и фиг.1С)). В одном варианте осуществления мономер Fc-фрагмента включает, как минимум, одну цепь шарнирной области (мономер шарнирной области), одну цепь CH2 домена (мономер CH2 домена) и одну цепь области CH3 (мономер CH3 домена), соединенные последовательно с формированием пептида. В другом варианте осуществления мономер Fc-фрагмента включает по меньшей мере одну цепь шарнирной области, одну цепь CH2 домена, одну цепь CH3 домена и одну цепь CH4 домена (мономер CH4 домена), соединенные последовательно с формированием пептида.

Мономер Fc-домена

[00103] Используемый в настоящей заявке "мономер Fc-домена" описывает одноцепочечный белок, который, в соединении с другим мономером Fc-домена, включает Fc-домен, который может связаться с Fcγ-рецептором. При соединении двух мономеров Fc-домена образуется один Fc-домен. Мономер Fc-домена, сам по себе, включающий только одну сторону Fc-домена, не может связать Fcγ-рецептор.

Мономер неполного Fc-домена

[00104] Используемый в настоящей заявке "неполный мономер Fc-домена" описывает одноцепочечный белок, который в соединении с другим неполным мономером Fc-домена составляет неполный Fc-домен. Аминокислотные последовательности шарнирной области неполного Fc-домена, мономеров CH2 и CH3 для IgG1, IgG2, IgG3 и IgG4 приведены на фиг.25. Соединение двух неполных мономеров Fc-домена приводит к образованию одного неполного Fc-домена.

Страдомеры

[00105] В конкретных вариантах осуществления биомиметики настоящего изобретения включают страдомеры. Страдомеры представляют собой биомиметические соединения, способные связывать два или более Fcγ-рецепторов (см., например, фиг.13B). В предпочтительном варианте осуществления страдомеры настоящего изобретения используются для связывания Fcγ-рецепторов на эффекторных клетках, таких как NK-клетки, незрелые дендритные клетки и другие клетки, происходящие из моноцитов. В одном варианте осуществления Fcγ-рецепторы являются Fcγ-рецепторами низкой аффинности. Страдомер может иметь четыре различных физических конформации: последовательную, кластерную, кор- или Fc-фрагмент, каждая из которых описана в следующих параграфах. Как будет очевидно, Fc-фрагменты, неполные Fc-фрагменты, Fc-домены и неполные Fc-домены, описанные выше, используются при конструировании различных конформаций страдомеров. Кроме того, именно отдельные мономеры Fc-домена и мономеры неполного Fc-домена, также описанные выше, после получения самоассоциациируют, формируя димерные структуры, которые и являются страдомерами настоящего изобретения.

Последовательный страдомер

[00106] "Последовательный страдомер" является димерным полипептидом, состоящим из двух линейных мономеров страдомера, которые при соединении формируют два или более Fc-домена. Fc-домены страдомера являются функциональными только в том случае, когда две цепи пептида (мономеры страдомера) связаны (то есть нефункциональные в мономерном состоянии). Таким образом, последовательный страдомер представляет собой биомиметическое соединение, способное связывать два или более Fcγ-рецепторов. В различных вариантах осуществления последовательный страдомер может включать два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать, двенадцать, тринадцать, четырнадцать или более Fc-доменов, а также неполных Fc-доменов. Fc-домены и неполные Fc-домены в последовательном страдомере могут быть связаны доменными связями, как определено ниже.

[00107] Используемый в настоящей заявке "димер страдомера" является определенной формой страдомера, состоящей только из двух страдомеров. В одном варианте осуществления димеры страдомера представляют собой молекулы, сформированные в результате самоагрегации соответствующих мономеров страдомера. В другом варианте осуществления мономеры страдомера в димерах страдомера физически связаны через интер-мономер страдомерные связи, как определено в настоящем описании. "Мультимерный страдомер" состоит из трех или более страдомеров, сформированных в результате самоагрегации мономеров страдомера или образования интер-мономер страдомерных связей, как определено в настоящем описании.

Мономер страдомера

[00108] Используемый в настоящей заявке термин "мономер страдомера" относится к одиночной, цельной пептидной молекуле, которая при соединении по меньшей мере со вторым мономером страдомера формирует полипептид, включающий по меньшей мере два Fc-домена (см., например, фиг.6A-6B, фиг.12A). Хотя в предпочтительных вариантах осуществления последовательные страдомеры состоят из двух соединенных мономеров страдомера (см., например, фиг.5A, 5B, 7A, 7B, 1C, 7D), последовательный страдомер может также содержать три (см. фиг.11C) или более мономеров страдомера. Мономеры страдомера могут быть соединены с формированием страдомеров посредством образования интер-мономер страдомерных связей, или они могут формировать страдомеры посредством самоагрегации.

[00109] Мономер страдомера может иметь такую аминокислотную последовательность, что при соединении с другим мономером страдомера образуется один, два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать, двенадцать, тринадцать, четырнадцать или более Fc-доменов, и формируется страдомер. Мономер страдомера может также иметь такую аминокислотную последовательность, что при соединении с другим мономером страдомера образуется один, два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать, двенадцать, тринадцать, четырнадцать или более неполных Fc-доменов, и формируется страдомер.

[00110] Области мономеров страдомера, которые формируют Fc-домены и неполные Fc-домены в контексте страдомера, могут быть просто расположены от С-конца до N-конца в виде последовательных областей молекулы мономера страдомера (см., например, фиг.4A-4B). В альтернативе, последовательные области мономеров страдомера могут быть связаны через последовательность пептида, которую в настоящей заявке называют "доменной связью". Взаимное расположение отдельных мономеров Fc-домена и мономеров неполного Fc-домена, составляющих мономер страдомера, не является критическим. Однако указанное расположение должно позволять формирование двух функциональных Fc-доменов при соединении двух мономеров страдомера.

[00111] В одном варианте осуществления страдомеров настоящего изобретения получают мономеры страдомера, которые на N-конце пептида содержат мономер Fc-домена или мономер неполного Fc-домена, такие как один или два концевых мономера CH2 домена IgE или мономер неполной шарнирной области IgG3, которые сильно связываются сами с собой, образуя Fc-домен или неполный Fc-домен, соответственно. Каждый из указанных мономеров страдомера имеет необходимое дополнение к мономерам Fc-домена и/или мономерам неполного Fc-домена, чтобы после формирования страдомер мог связывать два Fc-гамма рецептора. Страдомеры, которые образуются в результате соединения таких мономеров страдомера, представляют собой биомиметики, способные связывать два или более Fc-гамма рецепторов. В предпочтительном варианте осуществления N-концевые Fc-домен или неполный Fc-домен содержат дополнительный сайт гликозилирования, например, такой как содержится в CH2 домене IgE.

[00112] В качестве пояснительного примера, квалифицированный специалист поймет, что молекулы страдомеров настоящего изобретения могут быть сконструированы путем получения полинуклеотидной молекулы, которая кодирует различные комбинации мономеров Fc-домена и мономеров неполного Fc-домена, однако комбинация должна быть такой, которая дает минимум два мономера Fc-домена. Такая полинуклеотидная молекула может быть встроена в экспрессионный вектор, который может применяться для трансформации популяции бактерий. Затем мономеры страдомера могут быть получены путем выращивания трансформированных бактерий в соответствующих условиях. Затем мономеры страдомера могут формировать функциональные страдомеры либо посредством самоагрегации мономеров страдомера, либо посредством соединения мономеров страдомера с помощью интер-мономер страдомерных связей. Настоящее изобретение охватывает оба страдомера, сформированные посредством соединения мономеров страдомера, имеющих идентичные аминокислотные последовательности, мономеров страдомера, имеющих по существу аналогичные аминокислотные последовательности, или мономеров страдомера, имеющих различные последовательности. В последнем варианте осуществления аминокислотная последовательность мономеров страдомера, составляющих страдомер, должна иметь лишь такое подобие, чтобы образовывались два или более функциональных Fcγ-рецепторсвязывающих сайта.

[00113] Как указано выше, Fc-домен может функционально определяться своей способностью к связыванию Fcγ-рецептора. В результате конкретная аминокислотная последовательность Fc-домена изменится на основе неполных Fc-доменов, которые составляют Fc-домен. Однако в одном варианте осуществления настоящего изобретения Fc-домен включает шарнирную область и CH2 домен молекулы иммуноглобулина. В другом варианте осуществления Fc-домен включает шарнирную область, CH2 домен и CH3 домен молекулы иммуноглобулина. В другом варианте осуществления Fc-домен включает шарнирную область, CH2 домен, CH3 домен и CH4 домен молекулы иммуноглобулина. В еще одном варианте осуществления Fc-домен включает шарнирную область, CH2 домен и CH4 домен молекулы иммуноглобулина.

Доменная связь

[00114] Как указано выше, "доменная связь" является пептидной связью между мономерами Fc-домена и/или мономерами неполного Fc-домена, которые составляют каждый из отдельных мономеров страдомера последовательных страдомеров или страдотел настоящего изобретения. Доменная связь может включать 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 или более аминокислот. Доменная связь не присутствует между мономерами неполного Fc-домена, которые расположены в своей естественной последовательности. Таким образом, когда используются части мономеров Fc-домена, связанные в естественном порядке, например, шарнирная область, CH2 домен и CH3 домен IgG, данные мономеры неполного Fc-домена включают смежную последовательность, поэтому доменная связь между указанными элементами не нужна. Напротив, например, когда два или более мономеров Fc-домена или мономеров неполного Fc-домена соединены в таком порядке, в котором обычно не расположены, и формируют в результате отдельный мономер страдомера, могут использоваться доменные связи. Примером может являться связь между двумя пептидами шарнирная область/CH2/CH3 с получением отдельного мономера страдомера, составляющего страдомер, который включает: шарнирную область/CH2/CH3/L/шарнирную область/CH2/CH3, где "L" обозначает доменную связь (см., например., фиг.4A, где доменная связь (не показана) образована между CH3 доменом IgG1 и шарнирной областью IgG1). В различных описанных случаях доменная связь может являться одной из природных частей тяжелой цепи, которая присоединяется к шарнирной области CH доменам в мономере Fc-домена антитела. В альтернативе, доменная связь может являться любой другой аминокислотной последовательностью, которая обеспечивает необходимый интервал и гибкость между мономерами Fc-домена и мономерами неполного Fc-домена отдельного мономера страдомера, и которая позволяет отдельным мономерам страдомера соединяться друг с другом, формируя страдомеры настоящего изобретения.

[00115] Квалифицированный специалист сумеет понять, что идентичность доменной связи не особенно важна, при условии что она позволяет двум или более отдельным мономерам страдомера формировать биомиметические соединения настоящего изобретения, и что образующиеся соединения обладают способностью поперечно связывать более одного FcγR. Предполагается, что каждое иммунологически активное биомиметическое соединение предпочтительно содержит по меньшей мере одну доменную связь в каждом мономере страдомера последовательного страдомера или страдотела, которая функционирует так, что поддерживает Fc-домены иммунологически активного биомиметика в пределах ограниченной пространственной области, и которая повышает активность при активации FcγR, например, посредством агрегации Fcγ-рецепторов путем связывания с Fc-доменами в иммунологически активном биомиметике. Предпочтительно, доменные связи обеспечивают такую же или более высокую степень конформационной вариабельности, которую обеспечивает шарнирная область молекул IgG. Все вышеупомянутые связи известны в уровне техники.

Интер-мономер страдомерная связь

[00116] Отдельной связью, присутствующей в биомиметических соединениях настоящего изобретения, является "интер-мономер страдомерная связь", которая расположена между двумя или более отдельными мономерами страдомера, которые составляют страдомеры и страдотела настоящего изобретения. Тогда как доменные связи представляют собой короткие аминокислотные последовательности, которые служат для связывания друг с другом мономеров Fc-домена и мономеров неполного Fc-домена, которые составляют индивидуальные мономеры страдомера биомиметических соединений, интер-мономер страдомерные связи служат для соединения двух или более отдельных мономеров страдомера, которые составляют биомиметические соединения. Интер-мономер страдомерная связь может являться любой связью, способной к стабильному соединению отдельных мономеров страдомера. В некоторых вариантах осуществления интер-мономер страдомерная связь может являться ковалентной связью между мономерами страдомера. В альтернативе, интер-мономер страдомерная связь между мономерами страдомера может являться прямым химическим сшиванием. В предпочтительных вариантах осуществления структуры мономеров страдомера обладают преимуществом возможности природной самоагрегации мономеров Fc-домена, что позволяет создать самоагрегирующие страдомеры. В таких вариантах осуществления между отдельными мономерами страдомера образуются дисульфидные связи, что приводит к формированию страдомеров (см., например, фиг.5A, где интер-мономер страдомерные связи (не показаны) служат для соединения двух отдельных мономеров страдомера, составляющих страдомер). Дисульфидные связи образуются между остатками цистеина мономеров Fc-домена, которые составляют биомиметические молекулы, с использованием остатков цистеина, присутствующих в последовательности природного мономера Fc-домена, либо остатков цистеина, введенных в мономер Fc-домена с помощью сайт-направленного мутагенеза. Такие природные свойства самоагрегации могут также использоваться с целью формирования интер-мономер страдомерной связи между отдельными мономерами страдомера в мультимерах страдомера. Альтернативные варианты осуществления включают интер-мономер страдомерные связи, где дисульфидные связи образуются между остатками цистеина, введенными посредством сайт-направленного мутагенеза в аминокислотную последовательность, составляющую отдельные мономеры страдомера.

[00117] Как описано выше, в предпочтительном варианте осуществления интер-мономер страдомерная связь, с помощью которой формируется страдомер, представляет собой связь, которая образуется в результате самоагрегации мономеров страдомера. В одном варианте осуществления два мономера страдомера, которые составляют страдомер, являются идентичными пептидами, то есть два отдельных мономера страдомера, которые составляют страдомер, имеют идентичные последовательности. Впрочем, квалифицированный специалист сумеет понять, что другие варианты осуществления включают такие страдомеры, в которых мономеры страдомера отличаются друг от друга по аминокислотным последовательностям.

[00118] Два мономера страдомера могут сформировать страдомер, например, выстраиваясь параллельно, таким образом, соединение происходит между идентичными мономерами неполного Fc-домена в мономерах страдомера (см., например, фиг.5A-B). Однако настоящее изобретение также включает варианты осуществления, в которых соединение происходит между неидентичными мономерами неполного Fc-домена, а также варианты осуществления (см. фиг.11C), в которых соединение происходит между идентичными мономерами неполного Fc-домена в мономерах страдомера, но в которых при этом выравнивание двух мономеров страдомера происходит со смещением.

[00119] Для регуляции продукции и самодимеризации мономера страдомера могут использоваться "кэпирующие области". Например, последовательность мономера страдомера может включать следующие неполные Fc-домены: CH2 IgE/шарнирную область IgG1/CH2 IgG1/CH3 IgG1/шарнирную область IgG1/CH2 IgG1/CH4 IgE (см. фиг.13A), где домены IgE служат кэпом, который предотвращает "эффект застегивания". Эффект застегивания может возникнуть, когда мономер страдомера (см. фиг.11A) может автодимеризоваться (см. фиг.11B) или может ориентировать себя не в виде автодимера, а в виде параллельных чередующихся мономеров (см. фиг.11C). Средний специалист в данной области осведомлен, что для того, чтобы вызвать автодимеризацию страдомера и предотвратить эффект застегивания, при необходимости могут использоваться различные неполные Fc-домены, такие как шарнирная область любого иммуноглобулина или CH4 домен IgM, или IgE, отдельно или в комбинации. Другие непоследовательные структуры могут содержать молекулы с разветвленной цепью (см. фиг.12B), два или более страдомеров, расположенных параллельно и соединенных линкерами, например, посредством простой ковалентной связи, пептидных линкеров или непептидных линкеров (см. фиг.14A и 14B).

Кор-страдомер

[00120] "Кор-страдомер" состоит из кор-группы, с которой связаны две или более кор-страдомерных единицы, где каждая кор-страдомерная единица включает по меньшей мере один Fc-домен, формируя, таким образом, биомиметическое соединение, способное связывать два или более Fcγ-рецепторов. Fc-фрагмент, неполный Fc-фрагмент, последовательный страдомер или кластерная страдомерная единица могут независимо служить в качестве одной или обоих (если они включают два Fc-домена) кор-страдомерных единиц в кор-страдомере, поскольку каждая из указанных молекул содержит по меньшей мере один Fc-домен. Таким образом, кор-страдомер может включать кор-группу, с которой связан по меньшей мере один последовательный страдомер.

[00121] Используемая в настоящей заявке кор-группа кор-страдомера является любой физической структурой, с которой могут быть соединены или ковалентно связаны кор-страдомерные единицы. Предпочтительные полипептиды, которые могут служить в качестве кор-группы, включают гемоцианин лимфы улитки, бычий сывороточный альбумин и овальбумин. Химическое перекрестное сшивание между такими кор-группами и кор-страдомерными единицами (например, Fc-фрагментом, неполным Fc-фрагментом, Fc-доменом, последовательным страдомером и кластерной страдомерной единицей) может осуществляться посредством различных химических реагентов с использованием известных методов. Примеры химических реагентов, которые стандартно применяют в перекрестном сшивании, включают глутаральдегид, карбодиимид, сложные эфиры сукцинимиды (например, MBS, SMCC), бензидин, периодат, изотиоцианат; ПЭО (полиэтиленоксид)/ПЭГ (полиэтиленгликоль) спейсеры, такие как бис(NHS)PEO5, DFDNB (1,5-дифтор-2,4-динитробензол); и аминореактивные гомобифункциональные поперечно-сшивающие реагенты, включая альдегид-активированный декстран, бис(сульфосукцинимидил)суберат, бис[2-(сукцинимидооксикарбонил-окси)этил]сульфон, диметиладипимидат·2 HCl, диметилпимелимидат·2 HCl, диметилсуберимидат·2 HCl, дисукцинимидил глутарат, дитиобис(сукцинимидил)пропионат, дисукцинимидилсуберат, дисукцинимидилтартрат, диметил-3,3'-дитиобиспропионимидат·2 HCl, 3,3'-дитиобис(сульфосукцинимидилпропионат), этиленгликоль бис[сукцинимидилсукцинат], этиленгликоль бис[сульфосукцинимидил-сукцинат], β-[трис(гидроксиметил)фосфино]пропионовая кислота и трис-сукцинимидиламинотриацетат. Специалист в данной области сумеет подобрать соответствующий сшивающий реагент и условия на основе конкретной выбранной кор-группы и последовательности Fc-домен-содержащих полипептидов, соединяемых с формированием иммунологически активного биомиметика. См., например, Wong, Shan S. Chemistry of protein conjugation and cross-linking. Boca Raton: CRC Press, c1991 (ISBN 0849358868).

[00122] В другом предпочтительном варианте осуществления в качестве кор-группы может использоваться полипептид соединительной (J) цепи. Когда в качестве кор-группы используется J-цепь, цистеиновые мостики могут использоваться для соединения отдельных кор-страдомерных единиц с образованием кор-страдомера (См. фиг.10A-10D). В одном из вариантов осуществления кор-страдомер, последовательные страдомеры (служащие в качестве кор-страдомерных единиц), содержащие концевой CH4 домен IgM, соединены J-цепью с образованием кор-страдомера. Включение CH4 домена IgM приводит к самоагрегации страдомеров, включающих данный наполный Fc-домен с J-цепью, с формированием биомиметика, способное связывать несколько Fc-гамма рецепторов. Другим примером кор-страдомера является кор-страдомер, включающий Fc-домены (служащие в качестве кор-страдомерных единиц), где Fc-домены имеют следующую структуру: шарнирная область IgG3/CH2 IgG3/CH3 IgG3/CH4 IgM. Fc-домены, составляющие данную молекулу, не могут по отдельности связывать более одного Fc-гамма рецептора, а уже полная структура может связывать пять Fc-гамма рецепторов, когда составляющие Fc-домены соединены J-цепью.

[00123] В другом варианте осуществления кор-группа может являться неполипептидной молекулой. С кор-страдомерными единицами могут быть физически связаны различные подходящие композиции, обеспечивая получение иммунологически активного биомиметика. Могут использоваться нетоксичные гранулы, гиперразветвленные полимеры и дендримеры, наночастицы, а также различные соединения, которые классифицированы FDA как полностью безопасные (например, пропиленгликоль, сорбит, липосомы и силикат кальция). См., например, Nanoparticulates as Drug Carriers (Vladimir P.Torchilin (Редактор)), Imperial College Press (Сент. 2006) ISBN: 1860946305/ISBN-13: 9781860946301.

[00124] Предпочтительные кор-группы настоящего изобретения включают гранулу, альбумин, липосому, пептид и полиэтиленгликоль.

Кластерный страдомер

[00125] "Кластерный страдомер" является биомиметиком, который имеет осьминогоподобную форму с центральной группой, "головкой" и двумя или более "ножками", где каждая ножка включает один или более Fc-доменов, которые способны связывать по меньшей мере один Fc-гамма рецептор, образуя, таким образом, биомиметик, способный связывать два или более Fc-гамма рецептора. Каждый кластерный страдомер состоит больше чем из одного димерного белка, который назвается "кластерной страдомерной единицей". Каждая кластерная страдомерная единица состоит из области, которая мультимеризуется, и области "ножки", которая включает по меньшей мере один функциональный Fc-домен. Мультимеризирующая область образует "головку" кластерного страдомера при мультимеризации с мультимеризирующей областью другой кластерной страдомерной единицы. Область ножки способна связывать столько Fcγ-рецепторов, сколько Fc-доменов содержится в каждой области ножки. Таким образом, кластерный страдомер представляет собой биомиметическое соединение, способное связывать два или более Fcγ-рецепторов.

[00126] Мультимеризирующая область может являться пептидной последовательностью, которая вызывает дальнейшую мультимеризацию димерных белков, или, в альтернативе, мультимеризирующая область может являться гликозилированием, увеличивающим мультимеризацию димерных белков. Примеры пептидных мультимеризирующих областей включают шарнирную область IgG2, CH2 домен IgE, изолейциновую молнию и цинковые пальцы. Влияние гликозилирования на мультимеризацию пептидов хорошо описано в уровне техники (например, Role of Carbohydrate in Multimeric Structure of Factor VIII/V on Willebrand Factor Protein. Harvey R. Gralnick, Sybil B. Williams and Margaret E. Rick. Proceedings of the National Academy of Sciences of the United States of America, Vol. 80, No. 9, [Part 1: Biological Sciences] (May 1, 1983), pp. 2771-2774; Multimerization and collagen binding of vitronectin is modulated by its glycosylation. Kimie Asanuma, Fumio Arisaka and Haruko Ogawa. International Congress Series Volume 1223, December 2001, Pages 97-101).

[00127] Опытный специалист осведомлен, что кластерная страдомерная единица сама может включать последовательный страдомер (содержащий два или более Fc-доменов) наряду с мультимеризирующей областью. Таким образом, "ножки" кластерного страдомера могут состоять из последовательных страдомеров любого из типов, описанных в настоящей заявке, и/или одного или нескольких Fc-фрагментов IgG1, и/или Fc-фрагментов IgG3, и/или одного Fc-домена. Опытный специалист осведомлен, что каждый из Fc-фрагментов IgG1 и каждый Fc-фрагмент IgG3 в таких биомиметиках может быть модифицирован так, что будет включать неполные Fc-фрагменты из любого иммуноглобулина. Мономеры, которые составляют кластерную страдомерную единицу (которая, как указано выше, существует в виде димерного комплекса двух пептидов), являются "мономерами кластерной страдомерной единицы". Примером сконструированного кластерного страдомера, кластерная страдомерная единица которого связывает не более чем один Fc-гамма рецептор низкой аффинности перед мультимеризацией, является CH2 IgE/шарнирная область IgG1/CH2 IgG1/CH3 IgG1.

[00128] Опытный специалист осведомлен, что когда последовательный страдомер используется в качестве "ножки" кластерного страдомера, каждая "ножка" способна связывать больше одного Fc-гамма рецептора (поскольку в последовательном страдомере присутствует по меньшей мере два Fc-домена), то в результате образуется биомиметик, способный связывать больше одного Fc-гамма рецептора. Неполные Fc-домены, другие последовательности иммуноглобулинов и неиммуноглобулиновые последовательности могут быть помещены на концы отдельных мономеров кластерных страдомерных единиц, которые составлят ножки, с получением кластерного страдомера, в котором каждая ножка расположена на необходимом расстоянии, что повышает их доступность при связывании с одним или более чем одним Fc-гамма рецептором.

[00129] Мультимеризирующая область может являться пептидной последовательностью, которая вызывает димеризацию или мультимеризацию пептидов и включает шарнирную область IgG2, CH2 домен IgE, изолейциновую молнию и цинковый палец. Как известно из уровня техники, шарнирная область IgG2 человека может формировать ковалентно связанные димеры (Yoo, E.M. et al. J. Immunol. 170, 3134-3138 (2003); Salfeld Nature Biotech. 25, 1369-1372 (2007)). Формирование димеров IgG2 потенциально опосредуется структурой шарнирной области IgG2 при образовании C-C связей (Yoo et al, 2003), что позволяет предположить, что структура одной лишь шарнирной области может вызывать образование димеров. Таким образом, последовательные страдомеры, содержащие шарнирную область IgG2 (и, таким образом, служащие в качестве кластерных страдомерных единиц), будут формировать кластерный страдомер, который может включать два последовательных страдомера или даже три последовательных страдомера.

[00130] Аминокислотная последовательность мономера шарнирной области IgG2 человека является следующей: ERKCCVECPPCP (SEQ ID NO:36). Ключевой структурой шарнирной области является часть C-X-X-C мономера шарнирной области. Таким образом, мономеры страдомера настоящего изобретения могут включать полную последовательность мономера шарнирной области IgG2 из 12 аминокислот, либо четыре главных аминокислоты, наряду с мономерами Fc-домена. Хотя X-X в ключевой структуре может обозначать любую аминокислоту, в предпочтительном варианте осуществления последовательность X-X представляет собой V-E или P-P. Для квалифицированного специалиста очевидно, что мономерная шарнирная область IgG2 может состоять из любой части последовательности шарнирной области в дополнение к основной структуре из четырех аминокислот, включая полную последовательность шарнирной области IgG2, а также часть или полную последовательность мономеров CH2 и CH3 домена IgG2. Конкретные примеры возможных конструкций последовательных страдомеров на основе шарнирной области IgG2-Fc-домена IgG1 являются следующими:

Таблица 1
N-конец H CH2 CH3 H CH2 CH3 H CH2 CH3 C-конец
СХХС 1 1 1
СХХС 1 1 1 1 1 1
2 2 2 1 1 1
2 2 2 1 1 1 1 1 1
2 1 1 1
2 1 1 1 1 1 1
2 2 1 1 1
2 2 1 1 1 1 1 1
2 2 1 1 1 1 1 1 шарн.IgE
1 1 1
Обозначения: H=шарнирная область, CH2=константный тяжелый домен 2, CH3=константный тяжелый домен 3, 1=IgG1, 2=IgG2, X=любая аминокислота; 2x=две шарнирных области в последовательном порядке

[00131] Это лишь несколько из многих примеров. Любой из Fc-доменов IgG1 может быть заменен, например, Fc-доменом IgG3. Дополнительные белки с димеризационными доменами IgG2 включают химерные белки IgG2-IgG1 с дополнительными N- и/или С-концевыми последовательностями, включающими последовательности мономеров доменов IgM или IgE. Указанные N- и С-концевые последовательности могут являться шарнирными областями, константными областями или и тем, и другим.

[00132] Как указано выше, лейциновые и изолейциновые молнии также могут использоваться в качестве мультимеризирующей области. Лейциновые и изолейциновые молнии (спирально скрученные домены), как известно, способствуют образованию белковых димеров, тримеров и тетрамеров (Harbury et al. Science 262:1401-1407 (1993); O'Shea et al. Science 243:538 (1989)). Кластерные страдомеры, обладающие преимуществом природной тенденции изолейциновой молнии образовывать тример, могут быть получены с использованием последовательных страдомеров, включающих изолейциновую молнию. Ассоциирование трех или более последовательных страдомеров (как кластерных страдомерных единиц), содержащих изолейциновые молнии, приводит к формированию кластерных страдомеров, имеющих по меньшей мере шесть областей, связывающих Fc-гамма рецепторы.

[00133] Хотя для квалифицированного специалиста очевидно, что могут использоваться различные типы лейциновых и изолейциновых молний, в предпочтительном варианте осуществления используется изолейциновая молния из модифицированного регулятора транскрипции GCN4 (описанного в статье Morris et al., MoI. Immunol. 44:3112-3121 (2007); Harbury et al. Science 262:1401-1407 (1993)): YTQKSLSLSPGKELLGGGSIKQIEDKIEEILSKIYHIENEIARIKKLIGE RGHGGGSNSQVSHRYPRFQSIKVQFTEYKKEKGFILTS (SEQ ID NO:37). Приведенная последовательность изолейциновой молнии является лишь одной из нескольких возможных последовательностей, которые могут использоваться для мультимеризации мономеров Fc-домена. Хотя может использоваться вся последовательность, приведенная в SEQ ID NO:37, подчеркнутая часть последовательности представляет ключевую последовательность изолейциновой молнии, которая может использоваться в кластерных страдомерах настоящего изобретения. Таким образом, мономеры страдомера настоящего изобретения могут включать либо полную последовательность из 88 аминокислот изолейциновой молнии (ILZ), либо 28 ключевых аминокислот, наряду с одним или несколькими мономерами Fc-домена. Квалифицированному специалисту также очевидно, что изолейциновая молния может состоять из любой части молнии в дополнение к основной структуре из 28 аминокислот и, таким образом, может состоять больше чем из 28 аминокислот, но менее чем 88 аминокислот изолейциновой молнии. Конкретные примеры возможных конструкций на основе ILZ-Fc-домена IgG1 приведены далее.

Таблица 2
H CH2 CH3 H CH2 CH3
ILZ 1 1 1
ILZ 1 1 1 1 1
ILZ 1 1 1 1 1 1
ILZ 1 1 1 3 3 3
Обозначения: H=шарнирная область, CH2=константный тяжелый домен 2, CH3=константный тяжелый домен 3, 1=IgG1, 3=IgG3, ILZ=домен изолейциновой молнии

[00134] Это лишь несколько из многих примеров. Любой из доменов IgG1 может быть заменен, например, доменами IgG3. Дополнительные белки с ILZ доменами включают химерные белки IgG1 с дополнительными N- и/или С-концевыми последовательностями из других молекул Ig, таких как IgM или IgE. Указанные N- и С-концевые последовательности могут являться шарнирными областями, константными областями или и тем, и другим.

Fc-фрагмент-страдомер

[00135] "Fc-фрагмент-страдомер" состоит более чем из одного Fc-фрагмента. При некоторых обстоятельствах, относящихся к посттрансляционной модификации Fc-фрагмента, Fc-фрагмент с достаточной силой связывается с другим Fc-фрагментом, обеспечивая формирование молекулы, которая связывается более чем с одним Fcγ-рецептором. Посттрансляционная модификация, которая обеспечивает такое связывание, включает гликозилирование и метилирование. Идентичность клеточной линии, в которой получают рекомбинантные Fc-фрагменты, а также условия, при которых их получают, определяют, будут ли Fc-фрагменты формировать Fc-фрагмент-страдомеры. Например, рекомбинантный Fc-фрагмент, полученный в транзиентно трансфицированных CHO клетках FreestyleMax, образует мультимеры, которые визуально регистрируются на вестерн-блотах, связывается согласно бивалентному стандарту в анализе связывания методом плазмонного резонанса, и демонстрирует биологическую активность в анализе на дендритных клетках, сопоставимую с активностью IVIG. Напротив, такой же рекомбинантный Fc-фрагмент, полученный в стабильной линии клеток CHO не образует мультимеров Fc-фрагмента, детектируемых на вестерн-блотах, связывается согласно моновалентному стандарту в анализе связывания методом плазмонного резонанса, и не демонстрирует сопоставимую биологическую активность. Таким образом, Fc-фрагмент-страдомер является биомиметическим соединением, способным связывать два или более Fcγ-рецепторов.

[00136] Также используемый в настоящей заявке термин "Fc-димер" обозначает димер Fc-фрагментов (см. фиг.2A), термин "Fc-тример" обозначает тример Fc-фрагментов и термин "Fc-мультимер" обозначает мультимер Fc-фрагментов (см. фиг.2B).

Страдотело

[00137] Настоящее изобретение также охватывает страдотела. Используемое в настоящей заявке "страдотело" относится к молекуле, включающей два или более Fc-доменов, предпочтительно в контексте страдомера (включая последовательные страдомеры, кор-страдомеры, кластерные страдомеры и Fc-фрагмент-страдомеры), к которому присоединен один или несколько Fab-доменов (см., например, фиг.8A-B и 9 A-B). Таким образом, благодаря присутствию таких Fab-доменов страдотела обладают и антигенсвязывающей способностью, и страдомерной Fcγ-рецептор-связывающей активностью. В некоторых вариантах осуществления Fcγ-рецептор-связывающая активность может быть обусловлена способностью связывать и перекрестно связывать FcγR в равной или большей степени по сравнению с Fc-частью нативной структуры холо-антитела. Предпочтительно Fab-часть страдотела включает и тяжелую и легкую цепи. Вариабельная тяжелая цепь и легкая цепь могут независимо происходить из любого совместимого иммуноглобулина, например, IgA1, IgA2, IgM, IgD, IgE, IgG1, IgG2, IgG3 или IgG4, и могут относиться к тому же или другому изотипу Ig, но предпочтительно они относятся к тому же изотипу Ig. Легкие цепи каппа или лямбда также могут происходить из различных изотипов Ig. Страдотела, как и страдомеры, могут связывать два или более Fc?-рецепторов и модулировать иммунную функцию.

[00138] В одном из вариантов осуществления страдомеры могут содержать Fab иммуноглобулина, связанный с Fc шарнирным (H) доменом страдомера, образуя страдотело (например, фиг.8A и B). В другом варианте осуществления страдотело может состоять из Fc IgG1 - (шарнирной области - CH2) IgG1 (например, фиг.9A). В других вариантах осуществления страдотело может состоять из домена и шарнирной области IgG1, домена и шарнирной области IgG3 и домена и шарнирной области IgGE (например, фиг.9B). Fab включает и тяжелую, и легкую цепь, присутствующие в нативной структуре иммуноглобулинов (фиг.3A-B).

[00139] Страдотела обладают антигенсвязывающими свойствами Fab части и вышеописанными свойствами страдомеров. Такая комбинация служит для связывания, перекрестного связывания и активации Fcγ-рецепторов на эффекторных клетках с более высокой скоростью, чем может быть достигнуто Fc-основой холо-антитела, особенно в среде с низкой экспрессией эпитопов (например, у 90% пациентов с раком молочной железы, опухоли которых не классифицированы, как экспрессирующие her/2-neu с высоким уровнем), индуцируя у пациентов АЗКЦ с более высоким процентом. Как указано выше, один или несколько антигенсвязывающих Fab-фрагментов могут быть введены в страдомеры с формированием страдотел. Предпочтительно, полипептиды (кроме связей, описанных в настоящей заявке), вводимые в страдомеры, не являются целыми неиммуноглобулиновыми полипептидами или их частями.

[00140] Fab может являться химерной структурой, состоящей из константных областей, относящихся к человеку, и не относящихся к человеку вариабельных областей, таких как вариабельная область, происходящая из антитела мыши, крысы, кролика, обезьяны или козы. Средний специалист в данной области способен получить различные Fab-химерные структуры с целью их включения в страдотела с использованием методик, существующих на сегодняшний день и описанных в научной литературе применительно к таким конструкциям. Таким образом, "гуманизированные" страдотела могут быть созданы аналогично "гуманизированным" моноклональным антителам.

Варианты и гомологи

[00141] Квалифицированному специалисту очевидно, что могут быть разработаны страдомеры и другие биомиметики настоящего изобретения, включающие специфические Fc-домены иммуноглобулинов, такие как два Fc-домена из IgG1 (то есть шарнирная область IgG1/CH2 IgG1/CH3 IgG1/шарнирная область IgG1/CH2 IgG1/CH3 IgG1). Такой страдомер может быть сконструирован посредством получения в начале полинуклеотида, кодирующего два мономера Fc-домена IgG1 (то есть мономер шарнирной области IgG1/мономер CH2 IgG1/мономер CH3 IgG1/мономер шарнирной области IgG1/мономер CH2 IgG1/мономер CH3 IgG1), а экспрессии с него мономеров страдомера. Затем при ассоциировании двух таких мономеров страдомера образуется последовательный страдомер, включающий два Fc-домена IgG1.

[00142] Страдомеры и другие биомиметики настоящего изобретения могут быть также созданы на основе идентичности определенных неполных Fc-доменов иммуноглобулина, которые составляют Fc-домены. Например, может быть получен последовательный страдомер, содержащий два Fc-домена, где первый Fc-домен включает шарнирную область IgG1/CH2 IgG3/CH3 IgG1, а второй Fc-домен включает шарнирную область IgG3/CH2 IgG1/CH3 IgG3.

[00143] Следует понимать, что страдомеры и другие биомиметические молекулы, раскрытые в настоящей заявке, могут быть получены из организмов любых различных видов. Фактически Fc-домены или неполные Fc-домены в любых биомиметических молекулах настоящего изобретения могут быть получены из иммуноглобулина, происходящего более чем из одного (например, из двух, трех, четырех, пяти или более) видов. Однако обычно они происходят из одного вида. Кроме того, следует понимать, что любой из способов, раскрытых в настоящей заявке (например, способов лечения), может быть применен к любому виду. В основном все компоненты биомиметиков, применяемых к целевому виду, происходят из того же вида. Впрочем, также могут применяться биомиметики, в которых все компоненты происходят из различных видов или более чем из одного вида (включая или не включая виды, к которым применяется рассматриваемый способ).

[00144] Определенные CH1, CH2, CH3 и CH4 домены и шарнирные области, которые включают Fc-домены и неполные Fc-домены страдомеров и других биомиметиков настоящего изобретения, могут быть независимо выбраны как на основе подкласса иммуноглобулинов, так и на основе организма, из которого они получены. Таким образом, страдомеры и другие биомиметики, раскрытые в настоящей заявке, могут включать Fc-домены и неполные Fc-домены, которые независимо происходят из иммуноглобулинов различных типов, например, IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD, IgE и IgM. Аналогично, каждый Fc-домен и неполный Fc-домен могут быть получены из различных видов, предпочтительно видов млекопитающих, включая всех приматов кроме человека (например, обезьян, бабуинов и шимпанзе), людей, мышей, крыс, крупный рогатый скот, лошадей, кошачих, собачих, свиней, кроликов, коз, оленей, овец, хорьков, песчанок, морских свинок, хомяков, летучих мышей, птиц (например, кур, индеек и уток), рыб и рептилий, используемых для получения видоспецифичных или химерных молекул страдомеров.

[00145] Отдельные Fc-домены и неполные Fc-домены могут быть также гуманизированы. Специалисту в данной области очевидно, что различные Fc-домены и неполные Fc-домены обеспечивают функциональные свойства различных типов. Например, Fcγ-рецепторы специфично связываются с иммуноглобулинами IgG и никакими другими классами иммуноглобулинов. Таким образом, специалист в данной области, намереваясь создать страдомер, обладающий способностью связывания множественных Fcγ-рецепторов, будет создавать Fc-области страдомера, которые включают по меньшей мере хорошо описанные последовательности IgG, связывающие Fcγ-рецептор, включая соответствующие последовательности из шарнирной области IgG и CH2 и CH3 домены IgG. Специалисту в данной области также очевидно, что с применением конкретных доменов Ig могут быть связаны различные нежелательные последствия, например, анафилаксия, связанная с инъекциями IgA. Биомиметики, раскрытые в настоящей заявке, в целом необходимо разрабатывать так, чтобы избегать подобных эффектов, хотя в определенных обстоятельствах такие эффекты могут являться желательными.

[00146] Настоящее изобретение также охватывает страдомеры, включающие Fc-домены и неполные Fc-домены, которые содержат аминокислоты, которые отличаются от природной аминокислотной последовательности Fc-домена или неполного Fc-домена. Предпочтительные Fc-домены, включаемые в биомиметические соединения настоящего изобретения, обладают детектируемой специфичной связывающей аффинностью либо в отношении к холо-Fcγ-рецептору, или к растворимой внеклеточной части домена FcγR. Первичные аминокислотные последовательности и полученные с помощью рентгенокристаллографии структуры различных Fc-доменов и мономеров Fc-домена известны в уровне техники. См., например, Woof JM, Burton DR. Human antibody-Fc receptor interactions illuminated by crystal structures. Nat Rev Immunol. 2004 Feb;4(2):89-99. Типичные Fc-домены с Fcγ-рецепторсвязывающей способностью включают Fc-домены из иммуноглобулина G человека изотипов 1-4 (hIgG1-4) (SEQ ID NOS: 1, 3, 5 и 7 соответственно; см. также фиг.15A-D). (См. фиг.2 в статье Robert L. Shields, et al. High Resolution Mapping of the Binding Site on Human IgG1 for FcγRI, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcγR. J. Biol. Chem., Feb 2001; 276:6591-6604). Указанные нативные последовательности были подвергнуты обширному структурно-функциональному анализу, включая картирование сайт-направленного мутагенеза функциональных последовательностей 14. На основе указанных предшествующих структурно-функциональных исследований и доступных данных кристаллографии специалист в данной области может создать функциональные варианты последовательности Fc-домена (например, SEQ ID NOS: 1, 3, 5 и 7) с сохранением Fcγ-рецепторсвязывающей способности Fc-домена.

[00147] Аминокислотные замены могут быть обнаружены по ходу всей последовательности Fc-домена или локализованы до конкретных неполных Fc-доменов, которые составляют Fc-домен. Функциональные варианты Fc-домена, используемые в страдомерах и других биомиметиках настоящего изобретения, обладают по меньшей мере приблизительно 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности по отношению к нативному Fc-домену. Аналогично, функциональные варианты неполных Fc-доменов, используемые в страдомерах и других биомиметиках настоящего изобретения, обладают по меньшей мере приблизительно 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности по отношению к нативному неполному Fc-домену.

[00148] Квалифицированному специалисту очевидно, что настоящее изобретение также охватывает применение функциональных вариантов мономеров Fc-домена в конструировании мономеров Fc-фрагмента, мономеров неполного Fc-фрагмента, мономеров страдомера и других мономеров настоящего изобретения. Функциональные варианты мономеров Fc-домена обладают по меньшей мере приблизительно 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности по отношению к последовательности нативного мономера Fc-домена.

[00149] Аналогично, настоящее изобретение также охватывает применение функциональных вариантов мономеров неполного Fc-домена в конструировании мономеров Fc-фрагмента, мономеров неполного Fc-фрагмента, мономеров Fc-доменов, мономеров страдомера и других мономеров настоящего изобретения. Функциональные варианты мономеров неполного Fc-домена обладают по меньшей мере приблизительно 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% или 99% идентичности последовательности по отношению к последовательности нативного мономера неполного Fc-домена.

[00150] Аминокислотные замены могут уменьшать, увеличивать или никак не изменять аффинность связывания страдомера с Fcγ-рецептором. Предпочтительно такие аминокислотные замены являются заменами консервативных аминокислот, однако такие замены включают делеции, добавления и другие замены. Замены консервативных аминокислот обычно включают замены в пределах следующих групп: глицин и аланин; валин, изолейцин и лейцин; аспарагиновая кислота и глутаминовая кислота; аспарагин, глутамин, серин и треонин; лизин, гистидин и аргинин; а также фенилаланин и тирозин.

[00151] Термин "функциональный вариант", используемый в настоящей заявке, относится к последовательности, родственной по гомологии с исходной последовательностью, которая способна опосредовать те же биологические эффекты, что и исходная последовательность (в случае полипептида), или которая кодирует полипептид, способный опосредовать те же биологические эффекты, как и полипептид, кодируемый исходной последовательностью (в случае полинуклеотида). Например, функциональный вариант любого из биомиметиков, описанных в настоящей заявке, обладает заданной гомологией или идентичностью и способен к иммунной модуляции дендритных клеток. Функциональные варианты последовательности включают и полинуклеотиды, и полипептиды. Идентичность последовательности обычно оценивают с помощью BLAST 2.0 (Basic Local Alignment Search Tool), работая с параметрами по умолчанию: Filter - On, Scoring Matrix - BLOSUM62, Word Size - 3, E value - 10, Gap Costs - 11,1 и Alignments - 50.

[00152] На основе вышесказанного следует понимать, что страдомеры настоящего изобретения включают страдомеры, содержащие: (a) только природные Fc-домены; (b) смесь природных Fc-доменов и Fc-доменов с измененными аминокислотными последовательностями; и (c) только Fc-домены с измененными аминокислотными последовательностями. Необходимо лишь, чтобы страдомеры, содержащие измененные аминокислотные последовательности, обладали по меньшей мере 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, 99,5% или 100% или даже большей способностью по сравнению со страдомером, включающим Fc-домены с природными последовательностями, связываться с двумя или более Fcγ-рецепторами.

[00153] Последовательности вышеуказанных Fcγ-рецепторсвязывающих сайтов, присутствующих в страдомерах и страдотелах настоящего изобретения, могут быть изменены с помощью генной инженерии в целях прогнозируемого получения связывающих сайтов с измененной связывающей способностью и аффинностью по сравнению с нативной последовательностью. Например, определенные остатки могут быть изменены, что снижает связывание Fc-домена биомиметических соединений с FcγRII, повышая связывание с FcγRIIIa. Пример развернутого структурно-функционального анализа на основе мутагенеза для Fcγ-рецепторсвязывающих последовательностей hIgG можно найти в статье Robert L. Shields, et al. High Resolution Mapping of the Binding Site on Human IgG1 for FcγRI, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcγR. J. Biol. Chem., Feb 2001; 276: 6591-6604. Подобные исследования были выполнены на Fc IgG мыши (mIgG Fc). На основе гомологии структуры и первичной последовательности нативных Fc-доменов IgG различных видов специалист в данной области может перенести обширную информацию по структурно-функциональным свойствам hIgG Fc и mIgG Fc в рациональный мутагенез всех последовательностей нативных Fcγ-рецепторсвязывающих сайтов в биомиметических соединениях настоящего изобретения, создав связывающие сайты с заданной специфичностью и аффинностью связывания к Fcγ-рецептору.

[00154] В дополнение к составу аминокислотной последовательности нативных областей Fc-доменов содержание углеводов в Fc-домене, как известно, оказывает большое влияние на структуру Fc-домена и взаимодействие с FcγR. См., например, Robert L. Shields, et al. Lack of Fucose on Human IgG1 N-Linked Oligosaccharide Improves Binding to Human Fc RIII and Antibody-dependent Cellular Toxicity. J. Biol. Chem., JuI 2002; 277: 26733 - 26740 (doi:10.1074/jbc.M202069200); Ann Wright and Sherie L. Morrison. Effect of C2- Associated Carbohydrate Structure on Ig Effector Function: Studies with Chimeric Mouse-Human IgG1 Antibodies in Glycosylation Mutants of Chinese Hamster Ovary Cells. J. Immunol, Apr 1998; 160: 3393-3402. Содержание углеводов можно регулировать, используя, например, конкретные системы экспрессии белков, включая конкретные клеточные линии или энзиматическую модификацию in vitro. Таким образом, настоящее изобретение включает страдомеры и страдотела, включающие Fc-домены с нативным содержанием углеводов холо-антитела, из которого были получены указанные домены, а также биомиметические соединения, в которых изменено содержание углеводов.

[00155] Введение дополнений в полипептидную цепь неполного Fc-домена, мультимеризационная область или изменения в гликозилировании могут вызвать конформационное изменение в Fc-домене, приводящее к повышению связывания Fc-домена с Fcγ-рецептором. Таким образом, кажущиеся незначительными модификации полипептида могут также привести к получению страдомера, способного связывать несколько Fcγ-рецепторов.

Неполные домены и неполные фрагменты

[00156] Квалифицированному специалисту также очевидно, что Fc-домены и неполные Fc-домены, используемые в вариантах осуществления настоящего изобретения, могут и не быть полноразмерными вариантами. Таким образом, настоящее изобретение охватывает применение мономеров Fc-домена и мономеров неполного Fc-домена, не содержащих N-концевые, C-концевые аминокислоты или аминокислоты из центральной части конкретных мономеров Fc-домена и мономеров неполного Fc-домена, которые составляют страдомеры и другие биомиметики настоящего изобретения.

[00157] Например, был описан сайт связывания Fcγ-рецепторов на иммуноглобулинах IgG человека (например, Radaev, S., Sun, P., 2001. Recognition of Immunoglobulins by Fcγ Receptors. Molecular Immunology 38, 1073-1083; Shields, R.L. et. al., 2001. High Resolution Mapping of the Binding Site on Human IgG1 for FcγRI, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcγR. J. Biol. Chem. 276 (9), 6591-6604). На основе данной информации можно удалить аминокислоты из Fc-домена указанных иммуноглобулинов и определить влияние, оказываемое на взаимодействие между Fc-доменом и рецептором. Таким образом, настоящее изобретение охватывает Fc-домены IgG, содержащие по меньшей мере приблизительно 90% аминокислот, включая положения 233-338 нижней шарнирной области и CH2, как определено в статье Radaev, S., Sun, P., 2001.

[00158] Неполные Fc-домены иммуноглобулинов IgG согласно настоящему изобретению включают всю шарнирную область или ее часть, весь CH2 домен или его часть, а также весь CH3 домен или его часть.

[00159] Неполные Fc-домены IgG, содержащие только часть шарнирной области, часть CH2 домена или часть CH3 домена, сконструированы из мономеров неполного Fc-домена. Таким образом, настоящее изобретение включает мономеры шарнирной области IgG, полученные из N-концевой части шарнирной области или C-концевой части шарнирной области. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 или 62 (до 15 для IgG1, до 12 для IgG2, до 62 для IgG3, до 12 для IgG4) аминокислоты шарнирной области.

[00160] Настоящее изобретение также включает мономеры CH2 домена IgG, полученные из N-концевой части CH2 домена или C-концевой части CH2 домена. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109 или 110 (до 110 для IgG1 и IgG3, до 109 для IgG2 и IgG4) аминокислот CH2 домена.

[00161] Настоящее изобретение дополнительно включает мономеры CH3 домена IgG, полученные из N-концевой части CH3 домена или C-концевой части CH3 домена. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106 или 107 (до 106 для IgG1 и IgG3, до 107 для IgG2 и IgG4) аминокислот CH3 домена.

[00162] Неполные Fc-домены иммуноглобулинов IgA1, IgA2 и IgD настоящего изобретения включают всю шарнирную область или ее часть, весь CH2 домен или его часть, а также весь CH3 домен или его часть. Кроме того, в качестве неполных Fc-доменов может использоваться весь CH1 домен иммуноглобулина IgA1, IgA2 или IgD, или его часть.

[00163] Неполные домены IgA1, IgA2 и IgD, содержащие только часть шарнирной области, часть CH1 домена, часть CH2 домена или часть CH3 домена, сконструированы из мономеров неполного Fc-домена. Таким образом, настоящее изобретение включает мономеры шарнирной области, полученные из N-концевой части шарнирной области или C-концевой части шарнирной области IgA1, IgA2 или IgD. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63 или 64 (до 26 для IgA1, до 13 для IgA2, до 64 для IgD) аминокислоты шарнирной области.

[00164] Настоящее изобретение включает мономеры CH2 домена, полученные из N-концевой части CH2 домена или C-концевой части CH2 доменов IgA1, IgA2 или IgD. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106 или 107 (до 102 для IgA1, до 96 для IgA2, до 107 для IgD) аминокислот CH2 домена.

[00165] Настоящее изобретение включает CH3 домены, полученные из N-концевой части CH3 домена или C-концевой части CH3 доменов IgA1, IgA2 или IgD. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130 или 131 (до 113 для IgA1, до 131 для IgA2, до 110 для IgD) аминокислоту CH3 домена.

[00166] Неполные Fc-домены иммуноглобулинов IgM и IgE настоящего изобретения включают всю шарнирную область/CH2 домен или их часть, весь CH3 домен или его часть, а также весь CH4 домен или его часть, из указанных молекул. Кроме того, в качестве неполных Fc-доменов может использоваться весь CH1 домен, или его часть, из иммуноглобулинов IgM и IgE.

[00167] Неполные домены IgM и IgE, содержащие только часть шарнирной области/CH2 домена, часть CH3 домена или часть CH4 домена, сконструированы из мономеров неполного Fc-домена. Таким образом, настоящее изобретение включает мономеры шарнирной области/CH2 домена, полученные из N-концевой части шарнирной области/CH2 домена или C-концевой части шарнирной области/CH2 домена IgM или IgE. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111 или 112 (до 112 для IgM, до 109 для IgE) аминокислот шарнирной области / CH2 домена.

[00168] Настоящее изобретение включает мономеры CH3 домена IgM и IgE, полученные из N-концевой части CH3 домена или C-концевой части CH3 домена IgM или IgE. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105 или 106 (до 106 для IgM, до 105 для IgE) аминокислот CH3 домена.

[00169] Настоящее изобретение включает мономеры CH4 домена IgM и IgE, полученные из N-концевой части CH4 домена или C-концевой части CH4 домена IgM или IgE. Они, таким образом, могут содержать, например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129 или 130 (до 130 для IgM, до 105 для IgE) аминокислот CH4 домена. Однако размер частей CH4 домена IgM или IgE, которые включают C-конец CH4 домена, предпочтительно превышает 18 аминокислот и более предпочтительно превышает 30 аминокислот, а наиболее предпочтительно превышает 50 аминокислот.

[00170] Из вышеуказанного очевидно, что различные варианты осуществления настоящего изобретения включают страдомеры, содержащие: (a) полноразмерные Fc-домены; (b) комбинацию полноразмерных Fc-доменов и неполных Fc-доменов; и (c) неполные Fc-домены. В каждом из указанных вариантов осуществления страдомеры могут дополнительно включать CH1 домены. Как описано в настоящей заявке, в каждом варианте осуществления страдомеров настоящего изобретения страдомеры обладают способностью связывать два или более Fcγ-рецепторов.

Предпочтительные варианты осуществления страдомеров и мономеров страдомеров

[00171] Ниже приведены примеры мономеров страдомеров настоящего изобретения:

1. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

2. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1- шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

3. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

4. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1

5. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1

6. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3

7. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1

8. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

9. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1

10. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG3 - CH3 IgG3

11. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG3 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

12. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - шарнирная область IgG1 - CH2 IgG3 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

13. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG3 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG2 - CH3 IgG3.

14. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG4 - CH2 IgG4 - CH3 IgG4 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1

[00172] Следует понимать, что в каждом из указанных вариантов осуществления, а также в других вариантах осуществления, представленных в настоящей заявке, доменные связи могут использоваться для связи отдельных мономеров неполных Fc-доменов, которые формируют отдельные мономеры неполных Fc-доменов, которые формируют мономеры страдомеров. В одном из вариантов осуществления мономеры неполного Fc-домена для каждого из мономеров страдомера, перечисленных выше, являются мономерами неполного Fc-домена человека.

[00173] Настоящее изобретение включает страдомеры, включающие два или более мономеров страдомера, перечисленных выше. В предпочтительных вариантах осуществления настоящее изобретение включает последовательные страдомеры, включающие два идентичных мономера страдомера, приведенные выше.

[00174] Как указано выше, функциональные свойства страдомера касательно связывания более чем одного Fcγ-рецептора также могут обеспечиваться введением J цепи в качестве кор-группы в кор-страдомер, аналогичный или молекуле природных IgM, или IgA. В нативных иммуноглобулинах IgA и IgM соединительная (J) цепь представляет собой 15 кДа пептид, который соединяет тяжелую и легкую цепи IgA и IgM с 18 аминокислотами "секреторной концевой части" Fc-частей антител через дисульфидные мостики. Braathen, R., et al., The Carboxyl-terminal Domains of IgA and IgM Direct Isotype-specifϊc Polymerization and Interaction with the Polymeric Immunoglobulin Receptor, J. Bio. Chem. 277(45), 42755- 42762 (2002).

[00175] Такие кор-страдомеры могут состоять из мономеров страдомера, содержащих природные CH4 Fc-домены, предпочтительно из иммуноглобулинов IgM, обеспечивая таким образом ассоциацию подобных мономеров страдомера с J цепью (см. фиг.10A-10D). Ниже приведены примеры мономеров страдомера, которые могут самодимеризоваться, образуя страдомер, а затем соединяться с J цепью, формируя кор-страдомер, состоящий из множества (например, двух, трех, четырех, пяти, шести, семи, восеми, девяти, десяти, одиннадцати, двенадцати, пятнадцати, восемнадцати, двадцати или более) страдомеров:

1. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM (см. фиг.10C-10D)

2. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

3. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM (см. фиг.10A-10B)

4. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

5. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1 - CH4 IgM

6. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

7. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3 - CH4 IgM

8. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

9. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

10. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

11. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - шарнирная область IgG1 - CH2 IgG1 - шарнирная область IgG1 - CH2 IgG3 - CH3 IgG3 - CH4 IgM

[00176] Следует понимать, что в каждом из указанных вариантов осуществления, а также в других вариантах осуществления, представленных в настоящей заявке, доменные связи могут использоваться для связи отдельных мономеров неполных Fc-доменов, которые формируют отдельные мономеры неполных Fc-доменов, которые формируют мономеры страдомеров. В одном из вариантов осуществления мономеры неполного Fc-домена для каждого из мономеров страдомера, перечисленных выше, являются мономерами неполного Fc-домена человека.

[00177] Кор-страдомеры на основе J цепи также могут состоять из Fc-фрагментов, неполных Fc-фрагментов и/или Fc-доменов, которые содержат CH4 Fc-домен. В данном примере, каждый из Fc-фрагментов, неполных Fc-фрагментов и/или Fc-доменов, CH4 Fc-домен которых связан с кор-группой, может содержать только один Fcγ-рецепторсвязывающий сайт, однако в контексте такого кор-страдомера, образует биологически активный биомиметик, содержащий больше одного Fcγ-рецепторсвязывающего сайта. Квалифицированному специалисту очевидно, что неполные Fc-домены из различных нативных иммуноглобулинов могут использоваться для получения функциональных Fc-фрагментов, неполных Fc-фрагментов и Fc-доменов такого кор-страдомера. Ниже приведены примеры мономеров Fc-фрагментов, неполных Fc-фрагментов и Fc-доменов, которые могут самодимеризоваться, а затем ассоциироваться с J цепью, формируя кор-страдомер:

1. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

2. Шарнирная область IgG3 - CH2 IgG1 - CH3 IgG1 - CH4 IgM

3. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG1 - CH4 IgM

4. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG3 - CH4 IgM

5. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG3 - CH4 IgM

6. Шарнирная область IgG3 - CH2 IgG3 - CH3 IgG1 - CH4 IgM

7. Шарнирная область IgG3 - CH2 IgG3 - CH3 IgG1 - CH4 IgM

8. Шарнирная область IgG1 - CH2 IgG3 - CH3 IgG2 - CH4 IgM

9. Шарнирная область IgG1 - шарнирная область IgG3 - CH2 IgG3 - CH3 IgG2 - CH4 IgM

10. Шарнирная область IgG1 - CH2 IgG1 - CH3 IgG1 - CH4 IgE - CH4 IgM

[00178] Следует понимать, что в каждом из указанных вариантов осуществления, а также в других вариантах осуществления, представленных в настоящей заявке, доменные связи могут использоваться для связи отдельных мономеров неполных Fc-доменов, которые формируют отдельные мономеры неполных Fc-доменов, которые формируют мономеры страдомеров. В одном из вариантов осуществления мономеры неполного Fc-домена для каждого из мономеров страдомера, перечисленных выше, являются мономерами неполного Fc-домена человека.

[00179] Как следует из вышеприведенных примеров, мономеры страдомеров могут иметь различную длину и состав, в соответствии с целью, образуя кор-страдомер, содержащий более одного Fcγ-рецепторсвязывающего сайта при соединении посредством самоагрегации или интер-мономер страдомерных связей со вторым мономером страдомера и при соединении с J цепью. Данные примеры никоим образом не ограничивают изобретение, при этом специалисту в данной области очевидно, что страдомеры могут иметь множество других конфигураций.

Fcγ-рецепторы

[00180] Термины "FcγR" и "Fcγ-рецептор", используемые в настоящей заявке, включают каждого представителя семейства Fc гамма рецепторных белков, экспрессируемых на поверхности иммуноноцитов, как описано в Nimmerjahn F and Ravetch JV. Fcgamma receptors: old friends and new family members. Immunity. 2006 Jan; 24(1): 19-28, или которые могут быть описаны позже. Предполагается, что термин "FcγR", описанный в настоящей заявке, охватывает всех представителей Fc гамма семейств RI, RII и RIII. Fcγ-рецептор включает Fcγ-рецепторы низкой аффинности и высокой аффинности, включая, помимо прочих, FcγRI (CD64); FcγRII (CD32) и его изотипы, и аллотипы FcγRIIa LR, FcγRIIa HR, FcγRIIb и FcγRIIc; FcγRIII (CD16) и его изотипы FcγRIIIa и FcγRIIIb. Квалифицированному специалисту очевидно, что настоящее изобретение, которое включает соединения, которые связывают FcγR, относится к будущим FcγR рецепторам и соответствующим изотипам и аллотипам, которые еще неизвестны на сегодняшний день.

[00181] Было описано, что IVIG связывается и полностью насыщает неонатальный Fc-рецептор ("FcRn") и что такое конкурентое ингибирование FcRn может играть важную роль в биологической активности IVIG (например, Mechanisms of Intravenous Immunoglobulin Action in Immune Thrombocytopenic Purpura. F. Jin, J. Balthasar. Human Immunology, 2005, Volume 66, Issue 4, Pages 403-410.) Поскольку иммуноглобулины, которые связываются с Fcγ-рецепторами, также связываются по меньшей мере в некоторой степени, с FcRn, то квалифицированному специалисту очевидно, что страдомеры, которые способны связываться с более чем одним Fcγ-рецептором, также будут связывать и могут полностью насыщать FcRn.

[00182] "Иммунологическая активность нативного агрегированного IgG" относится к свойствам мультимеризованного IgG, которые влияют на функционирование иммунной системы при воздействии на иммунную систему агрегатов IgG. Специфические свойства нативного мультимеризованного IgG включают измененное специфическое связывание с FcγR рецепторами, перекрестное связывание с FcγR рецепторами на поверхности иммуноцитов или эффекторные функциональные свойства мультимеризованного IgG, такие как антителозависимая клеточно-опосредованная цитотоксичность (АЗКЦ), фагоцитоз (ADCP) или связывание комплимента (см., например, Nimmerjahn F, Ravetch JV. The anti-inflammatory activity of IgG: the intravenous IgG paradox. J Exp Med. 2007; 204:11-15; Augener W, Friedman B, Brittinger G. Are aggregates of IgG the effective part of high-dose immunoglobulin therapy in adult idiopathic thrombocytopenic purpura (ITP)? Blut. 1985;50:249-252; Arase N, Arase H, Park SY, Ohno H, Ra C, Saito T. Association with FcRgamma is essential for activation signal through NKR-Pl (CD 161) in natural killer (NK) cells and NKl.1+ T cells. J Exp Med. 1997;186:1957-1963; Teeling JL, Jansen- Hendriks T, Kuijpers TW, et al. Therapeutic efficacy of intravenous immunoglobulin preparations depends on the immunoglobulin G dimers: studies in experimental immune thrombocytopenia. Blood. 2001;98: 1095-1099; Anderson CF, Mosser DM. Cutting edge: biasing immune responses by directing antigen to macrophage Fc gamma receptors. J Immunol. 2002; 168:3697-3701; Jefferis R, Lund J. Interaction sites on human IgG-Fc for Fc[gamma]R: current models. Immunology Letters. 2002;82:57; Banki Z, Kacani L, Mullauer B, et al. Cross-Linking of CD32 Induces Maturation of Human Monocyte - Derived Dendritic Cells Via NF-{kappa} B Signaling Pathway. J Immunol. 2003;170:3963-3970; Siragam V, Brine D, Crow AR, Song S, Freedman J, Lazarus AH. Can antibodies with specificity for soluble antigens mimic the therapeutic effects of intravenous IgG in the treatment of autoimmune disease? J Clin Invest. 2005;115:155-160). Обычно указанные свойства оценивают посредством сравнения со свойствами мономерного IgG.

[00183] "Сопоставимый или превосходящий перекрестное связывание Fcγ рецептора или эффекторные функциональные свойства множества природных, агрегированных иммуноглобулинов IgG", как используется в настоящей заявке, означает, что страдомер показывает в анализе результат порядка 70% или более по сравнению с результатом, получаемым для IVIG. В других вариантах осуществления результат анализа находится по меньшей мере в пределах стандартной среднеквадратической ошибки результатов анализа, получаемых для IVIG. В других вариантах осуществления результат анализа составляет 110% или выше по сравнению с результатом, получаемым для IVIG. Анализы на перекрестное связыванием FcγR известны средним специлистам в данной области (см. например, Falk Nimmerjahn and Jeffrey Ravetch. Fcγ receptors as regulators of immune responses. Nature Reviews Immunology, опубликовано онлайн, 7 декабря 2007 г.).

[00184] "Иммуномодулирующие активности", "модулирующий иммунный ответ", "модулирующий иммунную систему" и "иммуномодуляция" означают воздействие на иммунные системы с измением активностей, функциональных свойств и относительного количества одного или нескольких иммуноцитов, включая созревание клетки какого-либо типа в пределах своего типа клеток или с превращением в другие типы клеток. Например, иммуномодуляция незрелых моноцитов может приводить к увеличению популяции более зрелых моноцитов, дендритных клеток, макрофагов или остеокластов, которые образуются из незрелых моноцитов. Например, рецепторы иммуноцитов могут быть связаны иммунологически активными биомиметиками и могут активировать внутриклеточную передачу сигналов, индуцируя различные изменения иммуноцитов, отдельно упомянутые как "активация иммуномодуляции". Блокирование рецепторов иммуноцитов с целью предотвращения активации рецепторов также включено в рамки "иммуномодуляции" и может отдельно упоминаться как "ингибиторная иммуномодуляция".

[00185] Модуляция созревания моноцита относится к дифференцировке моноцита в зрелую DC, макрофаг или остеокласт. Дифференцировка может модулироваться с целью ускорения созревания и/или увеличиния числа моноцитов, подвергаемых дифференцировке. В альтернативе, дифференцировка может быть снижена в отношении скорости дифференцировки и/или количества клеток, подвергающихся дифференцировке.

[00186] Используемый в настоящей заявке термин "выделенный" полипептид или пептид относится к полипептиду или пептиду, который не имеет какого-либо природного аналога, либо был выделен или получен при очистке от компонентов, которые обычно окружают его, например, в тканях, таких как поджелудочная железа, печень, селезенка, яичник, яичко, мышца, ткань сустава, нервная ткань, гастроинтестинальная ткань, ткань молочной железы или опухолевая ткань (например, ткань рака молочной железы), или в физиолигических жидкостях, таких как кровь, сыворотка или моча. Как правило, полипептид или пептид считаются "выделенными", когда степень их чистоты от белков и других природных органических молекул, с которыми они обычно связаны, составляет по меньшей мере 70% по сухому весу. Предпочтительно, препарат полипептида (или пептида) изобретения содержит по меньшей мере 80%, более предпочтительно по меньшей мере 90% и наиболее предпочтительно по меньшей мере 99% по сухому весу полипептида (пептида) изобретения соответственно. Поскольку полипептид или пептид, синтезированный химически, по свой природе отделен от компонентов, которые сопровождают его в природе, синтетический полипептид или пептид являются "выделенными".

[00187] Выделенный полипептид (или пептид) изобретения может быть получен, например, посредством экстракции из природного источника (например, из тканей или физиологических жидкостей); посредством экспрессии рекомбинантной нуклеиновой кислоты, кодирующей полипептид или пептид; или с помощью химического синтеза. Полипептид или пептид, который получен в клеточной системе, отличной от источника, из которого он происходит в природе, являются "выделенным", так как он в обязательном порядке не будет содержать компоненты, которые сопровождают его в природе. Степень очистки или чистоты может быть определена любым подходящим методом, например, с помощью колоночной хроматографии, электрофореза в полиакриламидном геле или ВЭЖХ анализа.

Фармацевтические композиции

[00188] Введение иммунологически активных биомиметических композиций, описанных в настоящей заявке, осуществляется любым обычным путем - перорально, парентерально или местно. Примеры путей введения включают, помимо прочих, пероральный, назальный, буккальный, ректальный, вагинальный, глазной, подкожный, внутримышечный, внутрибрюшинный, внутривенный, внутриартериальный, внутриопухолевый, спинальный, интратекальный, внутрисуставной, внутриартериальный, субарахноидальный, сублингвальный, на слизистую ротовой полости, бронхиальный, лимфатический, внутриматочный, подкожный, внутриопухолевый, интегрируемый на имплантируемом устройстве, интрадуральный, интракортикальный или кожный. Такие композиции обычно вводят в форме фармацевтически приемлемых композиций, как описано в настоящей заявке. В предпочтительном варианте осуществления выделенный иммунологически активный биомиметик вводят внутривенно.

[00189] Термин "фармацевтически приемлемый носитель", используемй в настоящей заявке, включает все без исключения растворители, диспергирующие среды, покрытия, антибактериальные и противогрибковые агенты, изотонические агенты, замедлители абсорбции и т.п. Применение таких сред и агентов в сочетании с фармацевтически активными веществами известно в уровне техники. За исключением тех случаев, когда какие-либо обычные среды или агенты являются несовместимыми с векторами или клетками настоящего изобретения, их применение в терапевтических композициях предусмотрено. Также в композиции могут быть включены дополнительные активные компоненты.

[00190] Иммунологически активные биомиметические композиции настоящего изобретения могут быть приготовлены в нейтральной форме или в форме соли. Фармацевтически приемлемые соли включают соли присоединения кислот (образованные со свободными аминогруппами белка) и соли, образованные с неорганическими кислотами, такими как, например, хлороводородная или фосфорная кислоты, или такими органическими кислотами как уксусная, щавелевая, винная, миндальная и т.п. Соли, образованные свободными карбоксильными группами, также могут быть получены с неорганическими основаниями, такими как, например, гидроксиды натрия, калия, аммония, кальция или гидрат оксида железа, а также с такими органическими основаниями как изопропиламин, триметиламин, гистидин, прокаин и т.п.

[00191] Стерильные растворы для инъекций получают путем введения в необходимом количестве иммунологически активных биомиметиков в подходящий растворитель, при необходимости вместе с другими различными компонентами, перечисленными выше, с последующей стерилизацией фильтрованием. Обычно дисперсии получают путем введения различных стерилизованных активных компонентов в стерильную среду, которая содержит базовую дисперсионную среду и другие необходимые компоненты из вышеперечисленного. В случае стерильных порошков для приготовления стерильных растворов для инъекций предпочтительные способы приготовления включают методы вакуумной сушки и лиофильной сушки, которые приводят к получению порошка активного компонента, содержащего также какой-либо дополнительный требуемый компонент из соответствующего, ранее простерилизованного фильтрованием раствора.

[00192] Кроме того, один из вариантов осуществления относится к иммунологически активной биомиметической композиции, подходящей для перорального введения, которая приготовлена в фармацевтически приемлемом носителе с или без инертного разбавителя. Носитель должен являться усвояемым или съедобным, и включает жидкие, полутвердые, то есть пастообразные, или твердые носители. За исключением тех случаев, когда какие-либо обычные среды, агенты, разбавители или носители являются нежелательными касательно реципиента или терапевтической эффективности иммунологически активного биомиметического препарата, содержащегося в них, их использование в перорально вводимой иммунологически активной биомиметической композиции, применяемой при осуществлении способов настоящего изобретения, предусмотрено. Примеры носителей или разбавителей включают жиры, масла, воду, соляные растворы, липиды, липосомы, смолы, связующие вещества, наполнители и т.п., или комбинации перечисленного. Термин "пероральное введение", используемый в настоящей заявке, включает пероральное, буккальное, энтеральное или внутрижелудочное введение.

[00193] В одном из вариантов осуществления композицию объединяют с носителем любым удобным и практичным способом, то есть путем растворения, суспендирования, эмульгирования, смешивания, инкапсулирования, микрокапсулирования, абсорбции и т.п. Подобные операции являются стандартными для специалистов в данной области.

[00194] В конкретном варианте осуществления иммунологически активную биомиметическую композицию в порошковой форме объединяют или тщательно смешивают с полутвердым или твердым носителем. Смешивание может быть выполнено любым удобным способом, например, растиранием. В процессе смешивания также могут быть добавлены стабилизаторы для предохранения композиции от потери терапевтической активности в ходе применения, то есть от денатурации в желудке. Примеры стабилизаторов, применяемых в перорально вводимой композиции, включают буферы, антагонисты секреции желудочных кислот, аминокислоты, такие как глицин и лизин, углеводы, такие как декстроза, манноза, галактоза, фруктоза, лактоза, сахароза, мальтоза, сорбит, маннит и т.д., ингибиторы протеолитических ферментов и т.п. Более предпочтительно, стабилизатор для перорально вводимой композиции может также включать антагонисты секреции желудочных кислот.

[00195] Кроме того, иммунологически активная биомиметическая композиция для перорального введения, объединенная с полутвердым или твердым носителем, может быть также приготовлена в форме желатиновых капсул, таблеток или пилюль с твердой или мягкой оболочкой. Более предпочтительно, желатиновые капсулы, таблетки или пилюли имеют кишечнорастворимое покрытие. Кишечнорастворимые покрытия предотвращают денатурацию композиции в желудке или верхней кишке, где pH является кислым. См., например, патент США 5,629,001. При попадании в тонкую кишку с основным pH покрытие растворяется, и композиция высвобождается, взаимодействуя с клетками кишечника, например, М-клетками пейеровых бляшек.

[00196] В другом варианте осуществления иммунологически активная биомиметическая композиция в порошковой форме объединена или тщательно смешана с материалами, которые образуют наночастицы, инкапсулирующие иммунологически активный биомиметик, или к которым присоединен иммунологически активный биомиметик. Каждая наночастица имеет размер меньше или равный 100 микронам. Наночастица может обладать мукоадгезивными свойствами, которые обеспечивают абсорбцию иммунологически активного биомиметика в желудочно-кишечном тракте, который в ином случае не был бы биодоступен при пероральном введении.

[00197] В другом варианте осуществления порошковая композиция объединена с жидким носителем, таким как, например, вода или физиологический раствор, с или без стабилизатора.

[00198] Конкретная лекарственная форма иммунологически активного биомиметика, которая может применяться, является раствором иммунологически активного биомиметического белка в гипотоническом буфере на основе фосфатов, который не содержит калия, где состав буфера является следующим: 6 мМ моногидрат одноосновного фосфата натрия, 9 мМ гептагидрат двухосновного фосфата натрия, 50 мМ хлорид натрия, pH 7,0+/-0,1. Концентрация иммунологически активного биомиметического белка в гипотоническом буфере может изменяться в пределах от 10 микрограммов/мл до 100 миллиграммов/мл. Указанную лекарственную форму можно вводить любым путем введения, например, помимо прочего, внутривенно.

[00199] Кроме того, иммунологически активная биомиметическая композиция для местного применения, объединенная с полутвердым носителем, может быть также приготовлена в форме крема или геля. Предпочтительным носителем для приготовления геля является гель-полимер. Предпочтительные полимеры, используемые для приготовления композиции настоящего изобретения в форме геля, включают, помимо прочих, карбопол, карбоксиметилцеллюлозу и плюрониловый полимеры. В частности, порошковую композицию, содержащую Fc-мультимер, объединяют с гелем на водной основе, содержащим полимеризационный агент, такой как Карбопол 980, в концентрации от 0,5% до 5% вес/об, для нанесения на кожу для лечения заболевания или под кожу. Термин "местное применение", используемый в настоящей заявке, включает нанесение на поверхность кожи, эпидермиса, подкожного слоя или слизистой.

[00200] В процессе приготовления лекарственной формы растворы вводят способом, совместимым с приготовлением дозированной лекарственной формы, и в таком количестве, которое является терапевтически эффективным и приводит к облегчению или устранению симптомов. Лекарственные формы обычно вводят в различных дозированных формах, таких как растворы для внутреннего применения, лекарственные капсулы и т.п. Некоторое изменение дозировки может происходить в зависимости от состояния подвергаемого лечению индивида. Лицо, ответственное за введение, может, в любом случае, определить подходящую дозу для отдельного индивида. Кроме того, для введения человеку препараты должны соответствовать стандартам стерильности, полной безопасности и чистоты, требуемым Департаментом стандартов биопрепаратов FDA.

[00201] Путь введения изменяется, как и следовало ожидать, в соответствии с локализацией и природой заболевания, подвергаемого лечению, и может включать, например, внутрикожный, трансдермальный, парентеральный, внутривенный, внутримышечный, внутриназальный, подкожный, чрескожный, внутритрахеальный, внутрибрюшинный, внутриопухолевый, перфузию, промывку, прямую инъекцию и пероральное введение.

[00202] Термин "парентеральное введение", используемый в настоящей заявке, включает любую форму введения, в которой соединение абсорбируется в организме индивида, исключая абсорбцию через кишечный тракт. Примеры способов парентерального введения, используемых в настоящем изобретении, включают, помимо прочих, внутримышечное, внутривенное, внутрибрюшинное, внутриопухолевое, внутриглазное или внутрисуставное введение.

[00203] Ниже приведены конкретные примеры различных категорий фармацевтических форм и предпочтительных путей введения, как указано, для конкретных примеров заболеваний:

[00204] Буккальная или подъязычная растворимая таблетка: ангина, узелковый полиартериит.

[00205] Внутривенно: идиопатическая тромбоцитопеническая пурпура, миозит с включенными тельцами, парапротеинемическая IgM демиелинизирующая полиневропатия, некротизирующий фасцит, вульгарная пузырчатка, гангрена, дерматомиозит, гранулема, лимфома, сепсис, апластическая анемия, полиорганная недостаточность, множественная миелома и моноклональная гаммапатия неизвестной этиологии, хроническая воспалительная демиелинизирующая полирадикулоневропатия, воспалительные миопатии, тромбическая тромбоцитопеническая пурпура, миозит, анемия, неоплазия, гемолитическая анемия, энцефалит, миелит, миелопатия, особенно связанная с Т-лимфотропным вирусом человека первого типа, лейкоз, рассеянный склероз и неврит зрительного нерва, астма, эпидермальный некролиз, миастенический синдром Ламберта-Итона, миастения гравис, невропатия, увеит, синдром Гийена-Барре, гомологичная болезнь, синдром мышечной скованности, паранеопластическая дегенерация мозжечка, вызванная анти-Yo антителами, паранеопластический энцефаломиелит и сенсорная невропатия, вызванная анти-Hu антителами, системный васкулит, системная красная волчанка, аутоиммунная диабетическая невропатия, острая идиопатическая вегетативная невропатия, синдром Фогта-Коянаги-Харады, многоочаговая двигательная невропатия, боковой амиотрофический склероз, ассоциируемый с антителами против GM1, демиелинизация, мембранозно-пролиферативный гломерулонефрит, кардиомиопатия, болезнь Кавасаки, ревматоидный артрит и синдром Эвана IM-ИТП, CIDP, MS, дерматомиозит, миастения гравис, мышечная дистрофия. Термин "внутривенное введение", используемый в настоящей заявке, включает все способы доставки соединения или композиции настоящего изобретения в системный кровоток посредством внутривенной инъекции или инфузии.

[00206] Кожный гель, лосьон, крем или пластырь: витилиго, опоясывающий герпес, акне, хейлит.

[00207] Ректальный суппозиторий, гель или инфузия: язвенный колит, воспаление геморроидальных узлов.

[00208] Пероральная форма, такая как пилюля, пастилка, инкапсулированная или с кишечнорастворимым покрытием: болезнь Крона, глютеновая энтеропатия, синдром раздраженного кишечника, воспалительная болезнь печени, пищевод Барретта.

[00209] Интракортикальный: эпилепсия, болезнь Альцгеймера, рассеянный склероз, болезнь Паркинсона, хорея Хантингтона.

[00210] Внутрибрюшинная инфузия или имплант: эндометриоз.

[00211] Интравагинальный гель или суппозиторий: бактериальный, трихомонадный или грибковый вагинит.

[00212] Медицинские устройства: введенный на коронарную артерию стент, протезные соединения.

[00213] Иммунологически активные биомиметики, описанные в настоящей заявке, могут вводить в дозировках приблизительно от 0,01 мг в расчете на кг до приблизительно 300 мг в расчете на кг массы тела и особенно от 0,01 мг в расчете на кг массы тела до приблизительно 300 мг в расчете на кг массы тела, и могут вводить по меньшей мере ежедневно, еженедельно, раз в две недели или ежемесячно. Может использоваться двухфазная схема введения, когда первая фаза введения включает приблизительно от 0,1% до приблизительно 10% от второй фазы введения.

Терапевтические применения страдомеров и страдотел

[00214] На основе рационального дизайна и тестов in vitro и in vivo иммунологически активные биомиметики настоящего изобретения могут служить важными биопрепаратами для лечения аутоиммунных заболеваний и для модуляции иммуной функции в других различных контекстах, например, в биоиммунотерапии рака и воспалительных заболеваний. Патологические состояния, подходящие для лечения иммунологически активными биомиметиками, описанными в настоящей заявке, включают заболевания, которые на сегодняшний день обычно подвергают лечению с применением hIVIG, или заболевания, при которых hIVIG, как установлено, являлся клинически эффективным, такие как аутоиммунные цитопении, синдром Гийена-Барре, миастения гравис, аутоиммунные заболевания с аутоиммунитетом против фактора VIII, дерматомиозит, васкулит и увеит (См., F. G. van der Meche, P. I. Schmitz, N. Engl. J. Med. 326, 1123 (1992); P. Gajdos et al, Lancet i, 406 (1984); Y. Sultan, M. D. Kazatchkine, P. Maisonneuve, U. E. Nydegger, Lancet ii, 765 (1984); M. C. Dalakas et al., N. Engl. J. Med. 329, 1993 (1993); D. R. Jayne, M. J. Davies, C. J. Fox, C. M. Black, C. M. Lockwood, Lancet 337, 1137 (1991); P. LeHoang, N. Cassoux, F. George, N. Kullmann, M. D. Kazatchkine, Ocul. Immunol. Inflamm. 8, 49 (2000)), а также те типы онкологических или воспалительных заболеваний, при которых может применяться или уже находится в клиническом применении моноклональное антитело. Также заболевания, которые можно эффективно лечить соединениями, которые являются объектом настоящего изобретения, включают воспалительное заболевание с нарушением баланса путей цитокинов, аутоиммунное нарушение, опосредованное патогенными аутоантителами или аутоагрессивными T-клетками, или острую или хроническую фазу хронического рецидивирующего аутоиммунного, воспалительного или инфекционного заболевания или процесса.

[00215] Кроме того, лечению иммунологически активными биомиметиками могут успешно подвергаться другие патологические состояния с воспалительным фактором, такие как амиотрофический боковой склероз, болезнь Хантингтона, болезнь Альцгеймера, болезнь Паркинсона, инфаркт миокарда, инсульт, гепатит B, гепатит C, воспаление, связанное с вирусом иммуннодефицита человека, адренолейкодистрофия и эпилептические заболевания, в особенности такие, которые считаются связанными с поствирусным энцефалитом, включая синдром Расмуссена, синдром Веста и синдром Леннокса-Гасто.

[00216] Общий подход к терапии с применением выделенных иммунологически активных биомиметиков, описанных в настоящей заявке, включает введение индивиду с заболеванием или патологическим состоянием терапевтически эффективного количества выделенного иммунологически активного биомиметика с целью осуществления лечения. В некоторых вариантах осуществления заболевания или патологические состояния могут быть ориентировочно отнесены к категории воспалительных заболеваний с нарушением баланса путей цитокинов, аутоиммунного нарушения, опосредованного патогенными аутоантителами или аутоагрессивными T-клетками, или острой или хронической фазы хронического рецидивирующего заболевания или процесса.

[00217] Термин "лечение", используемый в настоящей заявке, относится к введению индивиду терапевтически эффективного количества биомиметика настоящего изобретения, в результате чего у индивида наблюдается улучшение течения заболевания или патологического состояния, или симптома заболевания или патологического состояния. Улучшением является любое улучшение или устранение заболевания или патологического состояния, или симптома заболевания или патологического состояния. Улучшение является заметным или поддающимся измерению улучшением, либо может являться улучшением общего самочувствия индивида. Таким образом, специалисту в данной области очевидно, что лечение может улучшить течение заболевания, однако может и не приводить к полному выздоровлению. В частности, улучшения у индивидов могут включать одно или несколько из следующего: уменьшение воспаления; уменьшение воспалительных аналитических маркеров, таких как C-реактивный белок; уменьшение аутоиммунных реакций, о чем свидетельствует одно или несколько из следующего: улучшение картины аутоиммунных маркеров, например, аутоантител или числа тромбоцитов, числа лейкоцитов или эритроцитов, уменьшение сыпи или пурпуры, уменьшение слабости, онемения или покалывания, увеличение уровней глюкозы у пациентов с гипергликемией, уменьшение боли в суставах, воспаления, припухлости или деградации, уменьшение частоты и интенсивности судорог и диареи, уменьшение ангины, уменьшение воспаления ткани или уменьшение частоты пароксизмов; уменьшение тяжести раковой опухоли, замедление прогрессии опухоли, уменьшение болей при раке, увеличение выживаемости или улучшение качества жизни; или задержка прогрессии или улучшение течения остеопороза.

[00218] Термин "терапевтически эффективное количество", используемый в настоящей заявке, относится к количеству, которое приводит к улучшению или устранению симптомов заболевания или патологического состояния.

[00219] Используемая в настоящей заявке "профилактика" может означать полное предотвращение симптомов заболевания, задержку развития симптомов заболевания или уменьшение тяжести симптомов заболевания, развивающегося впоследствии.

[00220] Термин "индивид", используемый в настоящей заявке, используется для обозначения любого пациента-млекопитающего, которому вводят биомиметики настоящего изобретения согласно способам, описанным в настоящей заявке. В конкретном варианте осуществления способы настоящего описания используют для лечения человека. Способы настоящего описания могут также применяться для обработки всех приматов за исключением человека (например, обезьян, бабуинов и шимпанзе), мышей, крыс, крупного рогатого скота, лошадей, кошачих, собачих, свиней, кроликов, коз, оленей, овец, хорьков, песчанок, морских свинок, хомяков, летучих мышей, птиц (например, кур, индеек и уток), рыб и рептилий, с целью получения видоспецифичных или химерных молекул страдомеров.

[00221] В частности, биомиметики настоящего изобретения могут применяться для лечения патологических состояний, включающих, помимо прочих, ишемическую болезнь сердца (ИБС), васкулит, розацеа, акне, экзему, миокардит и другие поражения миокарда, системную красную волчанку, диабет, спондилопатии, синовиальные фибробласты и строму костного мозга; потерю костной массы; болезнь Паджета, остеокластому; множественную миелому; рак молочной железы; дисфункциональную остеопению; недостаточность питания, парадонтоз, синдром Гоше, гистиоцитоз из клеток Лангерганса, поражение спинного мозга, острый септический артрит, остеомаляция, синдром Иценко-Кушинга, монооссальную фиброзную дисплазию, полиоссальную фиброзную дисплазию, реконструкцию периодонта и переломы кости; саркоидоз; остеолитические формы рака, рак легкого, рак почки и ректальный рак; метастазы кости, регуляцию болей в кости, а также гуморальную злокачественную гиперкальцемию, анкилозирующий спондилит и другие спондилоартропатии; отторжение трансплантата, вирусные инфекции, гематологические неоплазии и заболевания наподобие неопластических, например, лимфому Ходжкина; неходжскинские лимфомы (лимфому Беркитта, мелкоклеточную лимфоцитарную лимфому/хронический лимфолейкоз, грибовидную гранулему, лимфому из клеток мантийной зоны, фолликулярную лимфому, диффузную В-крупноклеточную лимфому, лимфому краевой зоны, гистиоцитарный ретикулоэндотелиоз и лимфоплазмацитарный лейкоз), опухоли из клеток-предшественников лимфоцитов, включающие B-клеточный острый лимфобластный лейкоз/лимфому и T-клеточный острый лимфобластный лейкоз/лимфому, тимому, опухоли из зрелых T- и NK-клеток, включающие узловой T-клеточный лейкоз, Т-клеточный лейкоз/Т-клеточные лимфомы взрослых и Т-клеточный лейкоз из крупных гранулярных лимфоцитов, лангергансоклеточный гистиоцитоз (X), миелоидные неоплазии, такие как острый миелобластный лейкоз, включая ОМЛ с созреванием, ОМЛ без дифференцировки, острый промиелоцитарный лейкоз, острый миеломоноцитарный лейкоз и острый моноцитарный лейкоз, миелодиспластические синдромы и хронические миелопролиферативные заболевания, включая хронический миелогенный лейкоз, опухоли центральной нервной системы, например, опухоли головного мозга (глиому, нейробластому, астроцитому, медуллобластому, эпендимому и ретинобластому), солидные опухоли (носоглоточный рак, базально-клеточную карциному, рак поджелудочной железы, рак желчных протоков, саркому Капоши, рак яичка, маточный, вагинальный или цервикальный рак, рак яичников, первичный рак печени или эндометриальный рак, опухоли сосудистой системы (ангиосаркому и гемангиоперицитому)) или другие формы рака.

[00222] В настоящей заявке "злокачественная опухоль" относится к или описывает физиологическое состояние у млекопитающих, которое обычно характеризуется нерегулируемым ростом клеток. Примеры злокачественной опухоли включают, помимо прочего, карциному, лимфому, бластому, саркому (включая липосаркому, остеобластическую саркому, ангиосаркому, эндотелиосаркому, лимфангиосаркому, лимфангиоэндотелиосаркому, лейомиосаркому, рабдомиосаркому, фибросаркому, миксосаркому, хондросаркому), нейроэндокринные опухоли, мезотелиому, хордому, синовиому, шванному, менингиому, аденокарциному, меланому и лейкоз или лимфолейкоз. Более конкретные примеры таких форм злокачественной опухоли включают плоскоклеточный рак (например, эпителиальный плоскоклеточный рак), рак легкого, включая мелкоклеточный рак легкого, немелкоклеточный рак легкого, аденокарциному легкого и плоскоклеточную карциному легкого, мелкоклеточную карциному легкого, рак брюшной полости, гепатоцеллюлярный рак, рак желудка, включая рак желудочно-кишечного тракта, рак поджелудочной железы, глиобластому, цервикальный рак, рак яичников, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак толстой кишки, рак прямой кишки, колоректальный рак, карциному эндометрия или матки, карциному слюнной железы, рак почки, рак простаты, рак вульвы, рак щитовидной железы, карциному печени, анальную карциному, карциному полового члена, рак яичка, рак пищевода, опухоли желчного тракта, опухоль Юинга, базально-клеточную карциному, аденокарциному, карциному потовых желез, карциному сальных желез, папиллярную карциному, папиллярные аденокарциномы, цистаденокарциному, медуллярную карциному, бронхогенную карциному, почечноклеточную карциному, гепатому, карциному желчных протоков, хориокарциному, семиному, таратокарциному, опухоль Вильмса, опухоль яичка, карциному легкого, карциному мочевого пузыря, эпителиальную карциному, глиому, астроцитому, медуллобластому, краниофарингиому, эпендимому, пинеалому, гемангиобластому, неврому слухового нерва, олигодендроглиому, менингиому, меланому, нейробластому, ретинобластому, лейкоз, лимфому, множественную миелому, макроглобулинемию Вальденстрема, миелодиспластическую болезнь, болезнь тяжелых цепей, нейроэндокринные опухоли, Шванному и другие карциномы, а также рак головы и шеи.

[00223] Биомиметики настоящего изобретения могут применяться для лечения аутоиммунных заболеваний. Термин "аутоиммунное заболевание", используемый в настоящей заявке, относится к большой группе, включающей свыше 80 различных заболеваний и патологических состояний. Основная проблема при таких заболеваниях и патологических состояниях состоит в том, что иммунная система атакует собственный организм. Аутоиммунные заболевания затрагивают все основные системы организма, включая соединительную ткань, нервы, мышцы, эндокринную систему, кожу, кровь, дыхательную и желудочно-кишечную системы. Аутоиммунные заболевания включают, например, системную красную волчанку, ревматоидный артрит, рассеянный склероз, миастению гравис и диабет I типа.

[00224] Заболевание и патологическое состояние, поддающееся лечению с применением композиций и способов настоящего изобретения, могут являться гематоиммунологическим процессом, включающим, помимо прочего, идиопатическую тромбоцитопеническую пурпуру, аллоиммунную/аутоиммунную тромбоцитопению, приобретенную иммунную тромбоцитопению, аутоиммунную нейтропению, аутоиммунную гемолитическую анемию, Парвовирус B19-ассоциированную эритроцитарную аплазию, приобретенный аутоиммунитет против фактора VIII, приобретенную болезнь фон Виллебранда, множественную миелому и моноклональную гаммапатию неизвестной этиологии, сепсис, апластическую анемию, истинную эритроцитарную аплазию, анемию Даймонда-Блекфана, гемолитическую болезнь новорожденного, иммуноопосредованную нейтропению, невосприимчивость к переливанию тромбоцитарной массы, неонатальную посттрансфузионную пурпуру, гемолитический уремический синдром, системный васкулит, тромбическую тромбоцитопеническую пурпуру или синдром Эвана.

[00225] Заболевание и патологическое состояние могут также являться нейроиммунологическим процессом, включающим, помимо прочего, синдром Гийена-Барре, хроническую воспалительную демиелинизирующую полирадикулоневропатию, парапротеинемическую IgM демиелинизирующую полиневропатию, миастенический синдром Ламберта-Итона, миастению гравис, многоочаговую двигательную невропатию, боковой амиотрофический склероз, ассоциируемый с антителами против GM1, демиелинизацию, рассеянный склероз и неврит зрительного нерва, синдром мышечной скованности, паранеопластическую дегенерацию мозжечка, вызванную анти-Yo антителами, паранеопластический энцефаломиелит, сенсорную невропатию, вызванную анти-Hu антителами, эпилепсию, энцефалит, миелит, миелопатию, особенно связанную с Т-лимфотропным вирусом человека первого типа, аутоиммунную диабетическую невропатию или острую идиопатическую вегетативную невропатию.

[00226] Заболевание и патологическое состояние могут также являться ревматическим процессом, включающим, помимо прочего, болезнь Кавасаки, ревматоидный артрит, синдром Фелти, АНЦА-положительный васкулит, спонтанный полимиозит, дерматомиозит, антифосфолипидный синдром, повторные самопроизвольные аборты, системную красную волчанку, ювенильный идиопатический артрит, синдром Рейно, CREST-синдром или увеит.

[00227] Заболевание и патологическое состояние могут также являться дерматоиммунологическим процессом, включающим, помимо прочего, токсический эпидермальный некролиз, гангрену, гранулему, аутоиммунное заболевание кожи с развитием нарывов, включая вульгарную пузырчатку, буллезный пемфигоид и эксфолиативную пузырчатку, витилиго, синдром стрептококкового токсического шока, склеродермию, системный склероз, включая диффузный и локальный кожный системный склероз или атопический дерматит (особенно стероидозависимый атопический дерматит).

[00228] Заболевание и патологическое состояние могут также являться скелетно-мышечным иммунологическим заболеванием, включающим, помимо прочего, миозит с включенными тельцами, некротизирующий фасцит, воспалительные миопатии, миозит, анти-декорин (BJ антиген) миопатию, паранеопластическую некротическую миопатию, вакуолизирующую миопатию, сцепленную с X-хромосомой, пеницилламин-индуцированный полимиозит, атеросклероз, ишемическую болезнь сердца или кардиомиопатию.

[00229] Заболевание и патологическое состояние могут также являться желудочно-кишечным иммунологическим процессом, включающим, помимо прочего, пернициозную анемию, аутоиммунный хронический активный гепатит, первичный биллиарный цирроз печени, глютеновую энтеропатию, герпетиформный дерматит, криптогенный цирроз печени, реактивный артрит, болезнь Крона, болезнь Уипла, язвенный колит или склерозирующий холангит.

[00230] Заболевание и патологическое состояние могут также являться гомологичной болезнью (РТПХ), антитело-опосредованным отторжением трансплантата, отторжением трансплантата костного мозга, постинфекционным воспалением, лимфомой, лейкозом, неоплазией, астмой, сахарным диабетом I типа с антителами против бета-клеток, синдромом Шегрена, смешанным поражением соединительной ткани, болезнью Аддисона, синдромом Фогта-Коянаги-Харады, мембранозно-пролиферативным гломерулонефритом, синдромом Гудпасчера, болезнью Грейвса, тиреоидитом Хашимото, гранулематозом Вегенера, микрополиартериитом, синдромом Черджа-Стросс, узелковым полиартериитом или полиорганной недостаточностью.

[00231] В другом варианте осуществления страдомеры, описанные в настоящей заявке, могут применяться в примирующей системе, в которой кровь отбирают у пациента и подвергают короткому контакту со страдомером (страдомерами) в течение промежутка времени продолжительностью приблизительно от получаса до приблизительно трех часов, после чего кровь обратно вводят пациенту. В данной форме клеточной терапии собственные эффекторные клетки пациента подвергаются контакту со страдомером, который иммобилизован на матриксе ex vivo, с целью модуляции эффекторных клеток посредством контакта эффекторных клеток со страдомером. Затем кровь, содержащую модулированные эффекторные клетки, вводят обратно пациенту. Такая примирующая система может найти различные клинические и терапевтические применения.

Терапевтические применения страдотел в онкологии

[00232] В дополнение к наличию клинического применения для лечения иммунологических заболеваний страдотела находят терапевтическое применение в лечении злокачественной опухоли и воспалительных заболеваний. Страдотела могут применяться по существу согласно известным протоколам для любого соответствующего терапевтического антитела. Страдотела обычно создаются с целью усиления эффекта, демонстрируемого эффекторными клетками под воздействием моноклонального антитела, например, АЗКЦ при злокачественной опухоли или уменьшение моноцитов и созревания DC при пониженной секреции цитокинов в аутоиммунном заболевании и, таким образом, потенцирования иммунного ответа против рака, который развивался, например, в результате применения моноклонального антитела, послужившего источником Fab-части страдотела.

[00233] Примеры Fab-доменов моноклональных антител, на основе которых может быть создано страдотело, включают цетуксимаб, ритуксимаб, муромонаб-CD3, абциксимаб, даклизумаб, базиликсимаб, паливизумаб, инфликсимаб, трастузумаб, гемтузумаб озогамицин, алемтузумаб, тиуксетан ибритумомаба, адалимумаб, омализумаб, тозитумомаб, 1-131 тозитумомаб, эфализумаб, бевацизумаб, панитумумаб, пертузумаб, натализумаб, этанерцепт, IGN101, волоциксимаб, анти-CD80 mAb, анти-CD23 mAb, CAT-3888, CDP-791, эпратузумаб, MDX-010, MDX-060, MDX-070, матузумаб, CP-675,206, CAL, SGN-30, занолимумаб, adecatumumab, ореговомаб, нимотузумаб, ABT-874, деносумаб, AM 108, AMC 714, фонтолизумаб, даклизумаб, голимумаб, CNTO 1275, окрелизумаб, HuMax-CD20, белимумаб, эпратузумаб, MLN 1202, визилизумаб, тоцилизумаб, окрелизумаб, цертолизумаб пэгол, экулизумаб, пекселизумаб, абциксимаб, ранибизумаб, меполизумаб и TNX-355, MYO-029.

[00234] Страдомеры и страдотела, в совокупности иммунологически активные биомиметики, раскрытые в настоящей заявке, имеют множество других применений.

Изменение иммунных ответов

[00235] Иммунологически активные биомиметики, раскрытые в настоящей заявке, могут также успешно применяться для изменения ответов иммунной системы в различных ситуациях для специфических изменений профилей иммунного ответа. Изменение или модуляция иммунного ответа у индивида относятся к увеличению, уменьшению или изменению соотношения или компонентов иммунного ответа. Например, уровни выработки или секреции цитокинов при необходимости могут быть увеличены или уменьшены путем направленного воздействия на соответствующую комбинацию Fc-рецепторов страдомера, созданного для взаимодействия с указанными рецепторами. Выработка антител также может быть увеличена или уменьшена; может быть изменено соотношение двух или более цитокинов или рецепторов иммуноцитов; или может быть индуцирована выработка дополнительных типов цитокинов или антител. Иммунный ответ может также являться эффекторной функцией иммуноцита, экспрессирующего FcγR, включая увеличенный или уменьшенный фагоцитный потенциал моноцит макрофаг производных клеток, повышенную или пониженную функцию остеокластов, повышенное или пониженное презентирование антигена антиген-презентирующими клетками (например, дендритными клетками), повышенную или пониженную функцию NK-клеток, повышенную или пониженную функцию B-клеток, по сравнению с иммунным ответом, который не подвергался модулированию с применением иммунологически активных биомиметиков, раскрытых в настоящей заявке.

[00236] В предпочтительном варианте осуществления иммунный ответ индивида со злокачественной опухолью или аутоиммунным или воспалительным заболеванием изменен, что включает стадию введения индивиду терапевтически эффективного количества иммунологически активного биомиметика, описанного в настоящей заявке, где терапевтически эффективное количество иммунологически активного биомиметика изменяет иммунный ответ у индивида. В идеальном случае подобное вмешательство служит лечением заболевания и патологического состояния у индивида. Измененный иммунный ответ может являться увеличенным или уменьшенным ответом и может включать измененные уровни цитокинов, включая уровни любого из IL-6, IL-10, IL-8, IL-23, IL-7, IL-4, IL-12, IL-13, IL-17, TNF-альфа и IFN-альфа. Впрочем, изобретение не ограничивается каким-либо специфическим механизмом действия описанных биомиметиков. Измененный иммунный ответ может являться измененным уровнем аутоантител у индивида. Измененный иммунный ответ может являться измененным уровнем аутоагрессивных T-клеток у индивида.

[00237] Например, снижение количества выработки TNF-альфа при аутоиммунных заболеваниях может оказывать терапевтическое воздействие. Практическим применением данного способа является терапия анти-TNF-альфа антителами (например, REMICADE®), который, как доказано в клинических испытаниях, является эффективным при лечении пятнистого псориаза, ревматоидного артрита, псориатического артрита, болезни Крона, язвенного колита и анкилозирующего спондилита. Перечисленные аутоиммунные заболевания имеют различную этиологию, но при этом включают общие ключевые иммунологические компоненты процессов болезни, связанных с воспалением и активностью иммунных клеток. Страдомер, предназначенный для снижения выработки TNF-альфа, аналогичным образом будет эффективен при указанных и, возможно, при других аутоиммунных заболеваниях. Измененный профиль иммунного ответа может также являться прямой или косвенной модуляцией, вызывающей снижение выработки антител, например аутоантител, атакующих собственные ткани индивида, или изменением уровня аутоагрессивных T-клеток у индивида. Например, рассеянный склероз является аутоиммунным нарушением, вовлекающим аутореактивные T-клетки, которое можно лечить с помощью терапии бета-интерфероном. См., например, Zafranskaya M, et al., Interferon-beta therapy reduces CD4+ and CD8+ T-cell reactivity in multiple sclerosis, Immunology 2007 May;121(l):29-39-Epub 18 декабря 2006 г. Конструкция страдомера, направленная на уменьшение уровня аутореактивных T-клеток аналогичным образом будет эффективна при рассеянном склерозе и, возможно, при других аутоиммунных заболеваниях, вовлекающих аутореактивные T-клетки.

Применения в иммунологическом анализе

[00238] Иммунологически активные биомиметики, раскрытые в настоящей заявке, могут применяться при выполнении иммунологического анализа с целью тестирования функций иммуноцитов, для модуляции которых созданы иммунологически активные биомиметики.

[00239] Передача сигналов через пути Fcγ-рецепторов низкой аффинности требует агрегации рецепторов и перекрестного связывания на поверхности клеток. Указанные параметры агрегации и перекрестного связывания, как предполагают, выполняются при Fab-связывании с антигенспецифичной мишенью с последующим взаимодействием между Fc-областью и Fcγ-рецепторами низкой аффинности на поверхности отреагировавших клеток. В данном случае антитела способны вызывать клеточные ответы двумя различными путями: 1. Fab-взаимодействие/блокирование эпитопспецифичной мишени и 2. Fc-взаимодействия с Fc-рецепторами. Несмотря на приведенные механизмы, существующие средства контроля для большинства терапевтических исследований с использованием моноклональных антител, применяемых in vivo, потенциал взаимодействий Fc:Fcγ-рецептора как участников наблюдаемых функциональных эффектов используют не на должном уровне. Многие стратегии в настоящее время направлены на устранение взаимодействий Fc:FcR как нежелательных переменных. Например, в некоторых исследованиях используются Scv (одноцепочечные вариабельные области) или Fab-фрагменты, которые сохраняют эпитоп-специфичность, но при этом не имеют Fc-домена. Данные подходы ограничены коротким периодом полужизни указанных реагентов и их ограниченным потенциалом при индукции передачи сигналов. В других исследованиях используют слитые белки, состоящие из рецептора или лиганда, слитого с Fc-фрагментом. Хотя указанные методы помогают дифференцировать Fab-специфичные эффекты от эффектов, наблюдаемых при лиганд-рецепторных взаимодействиях, они не позволяют эффективно регулировать Fc-опосредованные эффекты. При оценке терапевтических средств на основе антител в животных моделях также могут использоваться антитела контрольного изотипа с каким-либо другим посторонним связывающим сайтом Fab. Обоснование данного выбора основано на предполагаемом функциональном подобии между антителами одного и того же изотипа, независимо от их Fab специфичности или аффинности. Впрочем, данное применение посторонних контрольных изотипов имеет несколько существенных недостатков:

1. Если Fab-фрагменты указанных антител не могут связывать лиганд или антигенный эпитоп, то, скорее всего, Fc-фрагменты не будут стимулировать передачу сигналов через взаимодействия FcR низкой аффинности из-за отсутствия перекрестного связывания Fcγ-рецептора. Таким образом, наблюдаемые функциональные различия между экспериментальным и контрольным антителами нельзя будет безошибочно отнести к Fab-взаимодействию с эпитоп-специфической мишенью, лишенной способности поперечно связывать FcγR.

2. Если данные изотипы получены в клетках, которые дают различные гликоформы или другой процентное соотношение отдельных гликоформ по сравнению с исходных антителом, то связывание с Fc- рецепторами как низкой, так и высокой аффинности, будет изменено, даже если Fab-аффинность будет идентичной.

[00240] Хотя какого-либо точного способа контроля, чтобы решить данную проблему, не существут, одним из возможных вариантов является применение изотип-специфичных страдомеров, полученных в тех же клетках, что и исходные антитела, и взятых в дозе, пропорциональной уровням экспрессии эпитопа, к которому специфично экспериментальное антитело. Например, соответствующим контролем для эпитоп-специфичного антитела, полученного в крысе, может являться крысиный изотип-специфичный страдомер, способный связывать Fcγ-рецептор на поверхности эффекторных клеток.

[00241] Обычно иммуноцит подвергают контакту с эффективным количеством иммунологически активного биомиметика, модулирующего активность иммуноцита известным способом, при этом указанную иммуномодуляцию сравнивают с тестируемым соединением или молекулой, чтобы определить, обладает ли тестируемое соединение подобной иммуномодулирующей активностью.

[00242] В другом варианте осуществления термоагрегированные страдомеры и агрегированные иммуноглобулины могут применяться в качестве реагентов для лабораторного контроля в различных иммунологических анализах, описанных в настоящей заявке и известных средним специалистам в данной области.

[00243] Иммунологические анализы могут являться анализами in vitro или in vivo и могут включать человеческие или нечеловеческие иммуноциты с использованием видоспецифических или не видоспецифических иммунологически активных биомиметиков. В одном варианте осуществления иммунологический анализ проводят с использованием эффективного количества иммунологически активного биомиметика, модулирующего активность иммуноцита, а затем проводят сравнение данной модуляции с модуляцией иммуноцита под действием тестируемого соединения. Страдомер или страдотело могут выполнять функцию реагента положительного контроля в анализах, включающих испытание других соединений на предмет иммунологического действия. В анализе могут сравнивать эффект, производимый тестируемым моноклональным антителом в сравнении со страдомером при связывании с Fcγ-рецепторами эффекторных клеток, а также функциональный ответ, измеряемый изменениями уровня экспресии рецептора, секреции цитокинов, и функциональные свойства, например, используя реакцию смешанной культуры лимфоцитов. В данном случае, если страдомер (который не содержит Fab) дает ответ, который частично подобен ответу моноклонального антитела, то тогда эффект моноклонального антитела, в некоторой степени, не обусловлен специфичностью его Fab, а является следствием общего эффекта связывания и поперечного связывания более чем одного Fcγ-рецептора на эффекторной клетке. Страдотело, которое содержит и тот же страдомер, и Fab из того же моноклонального антитела, также может помочь отличить специфичность Fab моноклонального антитела от общего эффекта связывания и поперечного связывания более чем одного Fcγ-рецептора на эффекторной клетке.

[00244] Если биологическая активность видоспецифического и изотип-специфического антитела частично или полностью воспроизводится видоспецифичным и изотип-специфичным страдомером, то тогда очевидно, что Fc-Fcγ-рецептор активность составляет часть наблюдаемой биологической активности, относящейся к видоспецифичному и изотип-специфичному страдомеру. Таким образом, видоспецифичные и изотип-специфичные страдомеры могут применяться в оценке потенциальных терапевтических антител для определения, относится ли и в какой степени наблюдаемая биологическая активность к Fab-части тестируемого антитела или же к неспецифичному эффекту Fc-части от молекулярного связывания и поперечного связывания более чем одного Fcγ-рецептора.

[00245] В одном варианте осуществления выделенный иммунологически активный биомиметик настоящего изобретения включает по меньшей мере один страдомер, который включает по меньшей мере два Fc-домена или соответствующие неполные домены, из того же класса Fc иммуноглобулина, где класс Fc иммуноглобулина выбран из группы, состоящей из IgG1, IgG2, IgG3, IgG4 и их комбинаций. Такие биомиметики также способны специфично связываться с первым FcγRx1, где x1 обозначает I, II, III или IV, и со вторым FcγRx2, где x2 обозначает I, II, III или IV. Указанные биомиметики могут дополнительно характеризоваться наличием иммунологической активности, включающей поперечное связывание Fcγ-рецептора или эффекторные функциональные свойства, сопоставимые или превосходящие перекрестное связывание Fcγ-рецептора или эффекторные функциональные свойства множества природных, агрегированных иммуноглобулинов IgG.

[00246] В другом варианте осуществления настоящее изобретение включает выделенный иммунологически активный биомимети, который включает по меньшей мере один страдомер, включающий по меньшей мере два Fc-домена из различных классов иммуноглобулина, или соответствующие неполные домены, где биомиметик специфично связывается с первым FcγRx1, где x1 обозначает I, II, III или IV, и со вторым FcγRx2, где x2 обозначает I, II, III или IV. Указанный биомиметик может дополнительно характеризоваться наличием иммунологической активности, включающей перекрестное связывание Fcγ-рецептора или эффекторные функциональные свойства, сопоставимые или превосходящие перекрестное связывание Fcγ-рецептора или эффекторные функциональные свойства множества природных, агрегированных иммуноглобулинов IgG в отношении Fcγ-рецепторов.

[00247] В следующем варианте осуществления настоящее изобретение включает выделенный иммунологически активный биомиметик, который включает один или более страдомеров, каждый из которых независимо включает три или более Fc-домена, где три или более Fc-домена включают: a) первый Fc-домен, где первый Fc-домен включает Fc-шарнирную область (H) первого иммуноглобулина, b) второй Fc-домен, где второй Fc-домен включает константную область 2 (CH2) второго иммуноглобулина, где второй Fc-домен способен специфично связываться с FcγRx1, где x1 обозначает I, II, III или IV; c) третий Fc-домен, где третий Fc-домен включает константную область 3 (CH3) третьего иммуноглобулина, где третий Fc-домен способен специфично связываться с FcγRx2, где x2 обозначает I, II, III или IV. Указанные биомиметики могут необязательно включать четвертый Fc-домен, где четвертый Fc-домен включает константную область 4 (CH4) четвертого иммуноглобулина IgM. В данной молекуле Fc-шарнирная область может содержать по меньшей мере один цистеин.

[00248] В еще одном варианте осуществления настоящее изобретение включает выделенный иммунологически активный биомиметик, который включает: a) первый Fc-домен или соответствующий неполный Fc-домен, где первый Fc-домен включает Fc-шарнирную область (H) область из первого иммуноглобулина, где Fc-шарнирная область включает по меньшей мере один цистеин, где первый Fc-домен вносит вклад в специфичность связывания с FcγRx, где x обозначает I, II, III или IV; и по меньшей мере один из: i) второго Fc-домена или соответствующего неполного домена, где второй Fc-домен включает константную область 2 (CH2) из второго иммуноглобулина, который может являться, или не являться таким же, как и первый иммуноглобулин, где второй Fc-домен вносит вклад в специфичность связывания с FcγRx, где x обозначает I, II или III, IV; и, необязательно, ii) третьего Fc-домена или соответствующего неполного домена, где третий Fc-домен включает константную область 3 (CH3) из третьего иммуноглобулина, где третий Fc-домен вносит вклад в специфичность связывания с FcγRx, где x обозначает I, II, III или IV; и b) необязательно, четвертый Fc-домен или соответствующий неполный домен, где специфичность четвертого Fc-домена обусловлена константной областью 4 (CH4) из иммуноглобулина IgM.

[00249] В другом варианте осуществления выделенный иммунологически активный биомиметик является страдомером, где иммуноглобулин, послуживший источником Fc-доменов, является одинаковым или разным, и включает изотипы IgA, изотипы IgG, IgD, IgE и IgM. Другим вариантом осуществления страдомера является выделенный иммунологически активный биомиметик, включающий секреторную сигнальную последовательность.

[00250] В одном из предпочтительных вариантов осуществления терапевтически эффективное количество выделеннвх иммунологически активных биомиметиков настоящего изобретения является количеством, достаточным для связывания биомиметиков с двумя или более FcγRx, где x обозначает I, II, III или IV, на поверхности иммуноцита, вызывавая, таким образом, агрегацию FcγRx. Иммуноцит может являться любой эффекторной иммунной клеткой, например, моноцитом, дендритной клеткой, макрофагом, остеокластом или NK-клеткой. Созревание эффекторного иммуноцита может модулироваться иммунологически активным биомиметиком. На иммуноците также может быть изменено отношение FcγRIIa к FcγRIIb. Иммуноцит может быть расположен в плазме, костном мозге, кишечнике, костной ткани, лимфоидной ткани, тимусе, мозге, участке инфекции или опухоли. Функциональная активность макрофага, дендритной клетки, остеокласта или NK-клетки может быть смодулирована.

[00251] Терапевтически эффективное количество выделенного иммунологически активного биомиметика, описанного выше в настоящей заявке, можно вводить ex vivo в иммуноцит с целью получения обработанного иммуноцита, с последующей стадией введения обработанного иммуноцита индивиду. Обработанный иммуноцит может являться дендритной клеткой, макрофагом, остеокластом или моноцитом.

[00252] Дополнительную иммунотерапию можно проводить в сочетании с любым из выделенных иммунологически активных биомиметиков, описанных в настоящей заявке, вводимых в терапевтически эффективном количестве индивиду. Дополнительная иммунотерапия может включать, например, одну или несколько костимулирующих молекул, моноклональное антитело, поликлональное антитело, слитый белок, биоспецифичное антитело, цитокин, иммунологически узнаваемый антиген, низкомолекулярное противоопухолевое средство или антипролиферативное средство. Дополнительную иммунотерапию можно проводить одновременно с, или отдельно от введения иммунологически активного биомиметика.

[00253] Уровни цитокинов (включая вышеуказанные цитокины) могут быть изменены, например, посредством введения одного или нескольких целевых цитокинов, одного или нескольких других цитокинов, которые модулируют уровень одного или нескольких целевых цитокинов, и/или антител (любого из типов и классов, описанных в настоящей заявке), специфичных к одному или нескольким любым цитокинам из двух вышеуказанных категорий.

[00254] Иммунологически активные биомиметики, описанные в настоящей заявке, могут применяться для модуляции экспрессии костимулирующих молекул в иммуноците, включающем дендритную клетку, макрофаг, остеокласт, моноцит или NK-клетку, или ингибировать в тех же иммуноцитах дифференцировку, созревание или секрецию цитокинов, включая интерлейкин-12 (IL-12), или повышать секрецию цитокинов, включая интерлейкин-10 (IL-10) или интерлейкин-6 (IL-6). Квалифицированный специалист может также оценить эффективность иммунологически активного биомиметика, подвергая иммуноцит контакту с иммунологически активным биомиметиком с последующим измерением модуляции функции иммуноцита, где иммуноцит является дендритной клеткой, макрофагом, остеокластом или моноцитом. В одном варианте осуществления иммуноцит подвергают контакту с иммунологически активным биомиметиком in vitro, после чего следует стадия определения количества рецепторов на поверхности клетки или уровня выработки цитокинов, где изменение количества рецепторов на поверхности клетки или уровня выработки цитокина определяет модуляцию функции иммуноцита. В другом варианте осуществления иммуноцит подвергают контакту с иммунологически активным биомиметиком in vivo в животном, служащим моделью аутоиммунного заболевания, с дополнительной стадией оценки степени улучшения при аутоиммунном заболевании.

[00255] "Способный специфично связываться с FcγRx", используемый в настоящей заявке, относится к связыванию с FcγR, таким как FcγRIII. Специфичное связывание обычно определяется как количество меченого лиганда, вытесняемого последующим избытком немеченого лиганда в анализе связывания. Однако это не исключает другие способы оценки специфичного связывания, которые хорошо известны в уровне техники (например, Mendel CM, Mendel DB, 'Non-specific' binding. The problem, and a solution. Biochem J. 1985 May 15;228(1):269-72). Специфичное связывание может быть измерено различными способами, известными в уровне техники, например, с помощью технологии поверхностного плазмонного резонанса (SPR) (доступной посредством BIACORE®), позволяющей характеризовать константы связывания и диссоциации иммунологически активных биомиметиков (Asian K, Lakowicz JR, Geddes C. Plasmon light scattering in biology and medicine: new sensing approaches, visions and perspectives. Current Opinion in Chemical Biology 2005, 9:538-544).

Способы с применением иммобилизованного Fc

[00256] Чтобы понять роль Fc:Fc-гамма-рецепторного (FcγR, Fc-рецептора для Fc IgG) взаимодействия и важность функции IVIG в отношении его Fc, биологически иммобилизованного в молекуле иммуноглобулина, авторы изобретения сравнивали влияние IVIG, а также иммобилизованной формы рекомбинантного Fc-фрагмента IgG1 (rFCF) и растворимой формы рекомбинантного Fc-фрагмента IgG1 (sFc), содержащих шарнирную область-CH2-CH3 домены, на функции моноцитов в процессе дифференцировки из моноцитов в незрелые дендритные клетки (iDC).

[00257] Воздействие на моноциты, выращиваемые в присутствии гранулоцитарно-макрофагального колониестимулирующего фактора (ГМКСФ) и интерлейкина-4 (IL-4), иммобилизованного rFCF и иммобилизованного IVIG, а не растворимого IVIG в малых дозах, повышало экспрессию CD86, замедляло экспрессию CD11c и подавляло экспрессию CD1a на клетках. Кроме того, указанные изменения, вероятно, не являются следствием неспецифичной белковой иммобилизации rFCF на полимере, поскольку растворимый термоагрегированный (sHA) IVIG, sHA rFCF или IVIG в большой дозе (как известно, содержащий мультимерные Fc) вызвали изменения, подобные наблюдаемым для иммобилизованного rFCF.

[00258] В совокупности, полученные данные указывают, что воздействие на iDC IVIG, иммобилизованного на поверхности твердой, полутвердой или гелеобразной подложки, приводит к получению уникальной популяции дендритных клеток (с высоким содержанием CD86 и низким CD1a), способных индуцировать развитие иммунной толерантности, и что иммобилизованные молекулы, которые включают функциональную часть Fc-фрагментов иммуноглобулина G (IgG), могут применяться в качестве миметиков IVIG для лечения местного и системного воспаления, а также широкого ряда других патологических состояний, которые, прямо или косвенно, опосредованы клетками, происходящими из моноцитов (MDC), такими как iDC. Кроме того, иммобилизация функциональной части Fc IgG на устройствах, описанных в настоящей заявке как "устройства с покрытием", которые имплантированы в тела или присоединены к телам животных (например, людей), с молекулами, содержащими функциональную часть Fc-фрагмента IgG, может уменьшать, если не предотвращать, воспалительный ответ на такие устройства.

[00259] Изобретение обеспечивает способ ингибирования активности клетки, происходящей из моноцита (MDC). Способ включает контакт клетки с композицией, включающей основу, с которой связан Fc реагент. Контакт может происходить in vitro, in vivo или ex vivo. В альтернативе, клетка может находиться в организме животного. Животное может являться животным, которое имеет, или подвергается риску развития заболевания, опосредованного клетками, происходящими из моноцитов (MDCMC). MDC может являться, например, дендритной клеткой, макрофагом, моноцитом или остеокластом.

[00260] Изобретение также обеспечивает способ лечения или профилактики. Способ включает введение животному композиции, содержащей основу, с которой связан Fc-реагент, где животное является животным, который имеет, или подвергается риску развития MDCMC.

[00261] Используемый в настоящей заявке термин "заболевание, опосредованное клетками, происходящими из моноцитов (MDCMC)" относится к патологическому состоянию, которое прямо или косвенно, частично или полностью, обусловлено активностью клеток, происходящих из моноцитов, или к факторам, вызванным ими. Клетки, происходящие из моноцитов, включают, помимо прочих, моноциты, макрофаги, интердигитальные дендритные клетки (обычно упоминаемые в настоящей заявке как "дендритные клетки", включая дендритоподобные клетки и фолликулярные дендритныхподобные клетки) (зрелые и незрелые), остеокласты, микроглиоцито-подобные клетки, вырабатывающие инсулин моноцит-производные инсулоцито-подобные клетки, моноцит-производные незрелые тучные клетки и моноцит-производные микрочастицы.

[00262] Касательно применения способов с использованием иммобилизованных Fc, термин "Fc-реагент" относится к любой молекуле или молекулярному комплексу, который включает одну или более (например, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 18, 20 или более) функциональных частей Fc-фрагмента иммуноглобулина G (IgG). Fc-фрагмент IgG состоит из C-концевых частей двух тяжелых цепей IgG, соединенных вместе, которые в свою очередь состоят из шарнирных областей, CH2 доменов и CH3 доменов обеих тяжелых цепей, соединенных вместе. "Функциональная часть Fc-фрагмента IgG" состоит из шарнирных областей, CH2 доменов и, необязательно, всех или некоторых из (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 или 49) первых 50 (начиная с N-конца) аминокислот CH3 доменов обеих соединенных тяжелых цепей. У людей (a) шарнирная область IgG1 содержит 15 аминокислот, CH2 домен содержит 110 аминокислот и CH3 домен содержит 106 аминокислот; (b) шарнирная область IgG2 содержит 12 аминокислот, CH2 домен содержит 109 аминокислот и CH3 домен содержит 107 аминокислот; (c) шарнирная область IgG3 содержит 62 аминокислоты, CH2 домен содержит 104 аминокислоты и CH3 домен содержит 106 аминокислот; и (d) шарнирная область IgG4 содержит 12 аминокислот, CH2 домен содержит 109 аминокислот и CH3 домен содержит 107 аминокислот.

[00263] Как и в молекулах IgG дикого типа, в вышеописанных Fc-реагентах две полипептидных цепи, происходящие из тяжелых цепей IgG, обычно, но не обязательно, являются идентичными. Таким образом, Fc-реагент может являться, без ограничения, полноразмерной молекулой IgG, полноразмерной молекулой IgG, связанной с полипептидом, происходящим не из иммуноглобулина, Fc-фрагментом IgG, Fc-фрагментом IgG, связанным с полипептидом, происходящим не из иммуноглобулина, функциональной частью Fc-фрагмента IgG, функциональной частью Fc-фрагмента IgG, связанной с полипептидом, происходящим не из иммуноглобулина, или мультимерами (например, димерами, тримерами, тетрамерами, пентамерами, гексамерами, гептамерами, октамерами, нонамерами или декамерами) любого из перечисленного. Fc-реагенты могут также являться вышеописанными страдомерами и страдотелами, при условии что они находятся в рамках приведеного выше определения Fc-реагента.

[00264] В иммобилизованном Fcγ компоненты тяжелых цепей иммуноглобулина Fc-реагентов могут иметь аминокислотные последовательности дикого типа, или они могут являться аминокислотными последовательностями дикого типа, содержащими не более 20 (например, не более 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1) аминокислотных замен. Такие замены предпочтительно, но не обязательно, являются консервативными заменами. Консервативные замены обычно включают замены в пределах следующих групп: глицин и аланин; валин, изолейцин и лейцин; аспарагиновая кислота и глутаминовая кислота; аспарагин, глутамин, серин и треонин; лизин, гистидин и аргинин; а также фенилаланин и тирозин.

[00265] "Fc-реагент" изобретения обладает по меньшей мере 25% (например, по меньшей мере: 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99,5% или 100%, или даже больше) способности молекулы IgG, из которой IgG были получены компоненты тяжелых цепей Fc-реагента (исходной молекулы IgG), связываться с целевым Fc-рецептором. В случае, когда "Fc-реагент" содержит компоненты тяжелых цепей, полученные из молекулы более чем одного типа IgG, исходная молекула IgG является молекулой IgG, которая связывается с соответствующим целевым Fc-рецептором с наибольшей авидностью.

[00266] Используемый в настоящей заявке "иммобилизованный Fc", относится к Fc-реагенту, который связан с "подложкой", как определено ниже. Термины "иммобилизованный Fc," "связанный Fc" и "стабилизированный Fc" являются синонимами. Иммобилизованный Fc состоит из функциональной части Fc (включающей, помимо прочего, любой полипептид, который включает функциональную часть Fc), присоединенной к подложке. Иммобилизованный Fc включает, например, как прямое связывание, так и опосредованное связывание Fc через полимеры с подложкой; введение полноразмерных Fc IgG в выделенное; введение только функциональных доменов Fc IgG или введение полноразмерных Fc IgG или функциональных доменов Fc IgG как часть более крупного полипептида, например, антитела, страдомера или страдотела.

[00267] Применительно к иммобилизованному Fc, термин "подложка" относится к твердому, полутвердому или гелеобразному объекту. Подложка может быть имплантирована в или присоединена (или прикреплена) к поверхности тела животного. Подложки могут включать, например, жидкие или газообразные компоненты, однако по меньшей мере часть подложки является твердой, полутвердой, или гелеобразной. Таким образом, подложка может являться веществом, которое по существу нерастворимо в водном растворителе, но растворимо в неводном растворителе. Такие вещества включают липиды (например, фосфолипиды), жирные кислоты и другие жирорастворимые, нерастворимые в водных растворителях соединения. Из нстоящего очевидно, что подложки включают липосомы. Подложка может являться пористой или непористой. В конкретных вариантах осуществления подложка инертна по отношению к поверхности и/или телу, в которое она имплантирована, присоединена или прикреплена.

[00268] Подложка может содержать или быть изготовлена из синтетического полимера, например, нейлона, тефлона, дакрона, поливинилхлорида, ПЭУ (полиэфируретана), ПТФЭ (политетрафторэтилена), ПММА (полиметилметакрилата), ПЭЭК, термоэластопластов, радионепроницаемых полимеров, полиэфирсульфона, силиконов, поликарбонатов, полиуретанов, полиизобутилена и его сополимеров, сложных полиэфиров, полиолефинов, полиизобутилена, сополимеров этилена - альфа-олефинов, акриловых полимеров и сополимеров, винилгалогенидных полимеров и сополимеров, таких как поливинилхлорид, поливиниловых эфиров, поливинилметилового эфира, поливинилиденгалогенидов, поливинилиденфторида, поливинилиден-хлорида, полиакрилонитрила, поливинилкетонов, поливинилароматических соединений, полистирола, сложных поливиниловых эфиров, поливинилацетата, сополимеров виниловых мономеров, сополимеров виниловых мономеров и олефинов, этилен-метил метакрилатных сополимеров, сополимеров акрилонитрила-стирола, АБС-смол, этилен-виниловацетатных сополимеров, полиамидов, Нейлона 66, поликапролактона, алкидных смол, полиоксиэтиленов, полиимидов, полиэфиров, эпоксидных смол, триацетатного искусственного шелка, целлюлозы, ацетата целлюлозы, бутирата целлюлозы, бутирата ацетата целлюлозы, целлофана, нитроцеллюлозы, пропионата целлюлозы, эфиров целлюлозы, карбоксиметилцеллюлозы, коллагенов, хитинов, полимолочной кислоты, полигликолевой кислоты, сополимеров полимолочной кислоты и полиэтиленоксида, полисилоксанов, замещенных полисилоксанов, сополимеры этилена-винилацетата, полиолефиновых эластомеров, а также этилен-пропилен-монодиенового каучука и их комбинаций.

[00269] Подложка может также содержать или быть изготовлена из металла или металлического сплава, например, нержавеющей стали, платины, иридия, титана, тантала, никельтитанового сплава или кобальтохромового сплава. Кроме того, подложка может включать или являться тканью животных или продуктом из ткани животных, например, тканевым или органным трансплантатом. Ткань животных может являться, например, костью (например, остеогенной тканью) или хрящем. Кроме того, подложка может содержать белок, например, коллаген или кератин. Подложка может также являться или содержать тканевый матрикс, например, ацеллюлярный тканевый матрикс. Дисперсные и недисперсные ацеллюлярные матриксы подробно описаны, например, в патентах США 5,336,616 и 6,933,326, описания которых в полном объеме включены в настоящую заявку путем отсылки. Подложка может также являться, или включать клетку животного (например, клетку, восстанавливающую ткани, такую как фибробласты или мезенхимальную стволовую клетку), и может представлять собой, например, комплекс, формирующий поры в мембране. Подложка может содержать или являться полисахаридом, например, агарозой. Она может также содержать или являться солью, предпочтительно относительно нерастворимой солью, например, сульфатом кальция. Подложка может являться гелем или кремом. Кроме того, она может содержать силикон или силастик. Подложки могут также содержать натуральное волокно, например, шелк, хлопок или шерсть.

[00270] Кроме того, подложка может являться имплантируемым медицинским устройством. Она может являться, например, стентом (например, сосудистым стентом, таким как коронарный стент; стентом, размещаемым в дыхательных путях, таким как эндотрахеальный или назальный стент; желудочно-кишечным стентом, таким как билиарный или панкреатический стент; или мочеточниковым стентом, таким как уретральный стент) или хирургической нитью (например, шелковой нитью, хромированным кетгутом, нейлоновой, полимерной или металлической нитью), или хирургическим зажимом (например, зажимом при аневризме). Подложка может являться, например, искусственным бедром, искусственным тазобедренным суставом, искусственным коленом, искусственным коленным суставом, искусственным плечом, искусственным плечевым суставом, искусственным пальцевым суставом (руки или ноги), костной пластинкой, костным штифтом, имплантом при переломе кости, имплантом межпозвоночного диска, костным цементом или прослойкой из костного цемента. Она может являться артериально-венозным шунтом, имплантируемой проволокой, кардиостимулятором, искусственным сердцем, прибором, поддерживающим работу сердца, кохлеарным имплантом, имплантируемым дефибриллятором, стимулятором спинного мозга, стимулятором центральной нервной системы, имплантом перифирического нерва. Другими подложками являются зубные протезы или зубные коронки.

[00271] В других вариантах осуществления подложка может являться устройством или сеткой для защиты больших сосудов от эмболии, подкожным устройством, кожным пластырем или пластырем на подслизистую, или имплантируемым устройством для доставки лекарственного средства. Подложка может также являться трансплантатом большого кровеносного сосуда, где кровеносный сосуд является, например, сонной артерией, бедренной артерией или аортой. Также она может являться подкожным имплантом, корнеальным имплантом, искусственным хрусталиком или контактной линзой.

[00272] Подложка может находиться в форме, например, листа, гранулы, сетки, частицы порошка, нити, гранулы или волокна. Подложка может содержать или являться твердым, полутвердым или гелеобразным веществом.

[00273] Полимеры, применяемые в изобретении, предпочтительно являются такими полимерами, которые являются биостабильными, биосовместимыми, особенно в процессе введения или имплантации устройства в тело, и не вызывают раздражения тканей тела.

[00274] Fc-реагенты могут быть нанесены (то есть иммобилизованы или стабилизированы) на подложку любым доступным способом. Например, они могут быть нанесены непосредственно на поверхности подложек, к которым они прикрепляются, например, посредством гидрофобных взаимодействий. Ниже описаны несколько других методик ((a)-(e)), включающих применение полимеров:

(a) Fc-реагент смешивают с совместимой полимерной смесью, которую затем слоями наносят на поверхность имплантируемого синтетического материала, стабилизируя, таким образом, Fc-реагент. Мономеры, обычно используемые в уровне техники для получения полимерных смесей, включают PLMA [поли(лаурилметакрилат)]; ПЭГ [полиэтиленгликоль], ПЭО [полиэтиленосид]; алкилированные функционализированные метакрилатные полимеры ПММА, ПЭМА, ППМА и ПБМА; итаконаты; фумараты и стироловые полимеры.

(b) Полимерный грунтовочный слой или пленку нанометровой толщины закрепляют на поверхности подложки, а затем на полимерном грунтовочном слое или пленке нанометровой толщины закрепляют Fc-реагент, стабилизируя, таким образом, Fc-реагент.

(c) Тонкий слой мономера полимера наносят на поверхность имплантируемой подложки, после чего мономер полимеризуют. Такие мономеры включают, например, метан, тетрафторэтилен, бензол, метанол, этиленоксид, тетраглим, акриловую кислоту, аллиламин, гидроксиэтилметакрилат, N-винилпирролидон и меркаптоэтанол. Затем Fc-реагент прикрепляют к полученному мономеру.

(d) Подложку покрывают белком, таким как A-белок или альбумин, который прикрепляется к Fc-реагенту, стабилизируя, таким образом, Fc на поверхности подложки.

(e) Fc-реагент может быть помечен цепью гидрофобных аминокислот, которые связываются с имплантируемыми синтетическими материалами и обеспечивают однонаправленную ориентацию Fc.

[00275] Способы изобретения могут быть применены к любым видам животных, а молекулы IgG, из которых получены IgG-производные части Fc-реагентов, могут происходить из любых видов животных. Обычно подходящие виды животных включают те виды, в которых присутствуют IgG или IgG-подобные молекулы. В основном виды, к которым применяются способы, и виды, из которых происходят IgG-производные части Fc-реагентов, применяемых в способах, являются одинаковыми. Однако они не обязательно являются одинаковыми. Подходящими видами животных предпочтительно являются млекопитающие, при этом они включают, без ограничения, людей, всех приматов кроме человека (например, обезьян, бабуинов и шимпанзе), лошадей, крупный рогатый скот (например, быков, коров или волов) свиней, коз, овец, собак, кошек, кроликов, песчанок, хомяков, крыс и мышей. Не относящиеся к млекопитающим виды включают, например, птиц (например, кур, индеек и уток) и рыб.

[00276] Термины "лечение" и "профилактика" имеют одно и то же значение применительно к иммобилизованному Fc, как описано выше для страдомеров и страдотел.

[00277] В случае, когда иммобилизованные Fc являются имплантируемыми устройствами, покрытыми Fc-реагентами, они могут быть имплантированы в, присоединены к или закреплены на соответствующих внутренних органах или тканях, или поверхностях тела соответствующих индивидов, с использованием способов, известных в уровне техники. Когда они приготовлены в такой форме, как, например, суспензии, порошки, они могут быть приготовлены и введены так же, как описано выше для страдомеров и страдотел.

[00278] Иммобилизованные Fc-реагенты настоящего изобретения могут применяться для лечения или профилактики патологических состояний, включающих, помимо прочих, злокачественную опухоль, ишемическую болезнь сердца (ИБС), васкулит, розацеа, акне, экзему, миокардит и другие поражения миокарда, системную красную волчанку, диабет, спондилопатии, синовиальные фибробласты и строму костного мозга; потерю костной массы; болезнь Паджета, гипертрофическую остеопатию; дисфункциональную остеопению; недостаточность питания, парадонтоз, синдром Гоше, гистиоцитоз из клеток Лангерганса, поражение спинного мозга, острый септический артрит, остеомаляцию, синдром Иценко-Кушинга, монооссальную фиброзную дисплазию, полиоссальную фиброзную дисплазию, реконструкцию периодонта и переломы кости, регуляцию болей в кости, а также гуморальную злокачественную гиперкальцемию, анкилозирующий спондилит и другие спондилоартропатии; отторжение трансплантата и вирусные инфекции.

[00279] Все аутоиммунные заболевания, частично или полностью, могут представлять собой MDCMD. Термин "аутоиммунное заболевание", используемый в настоящей заявке, относится к большой группе, включающей свыше 80 различных хронических заболеваний. Основная проблема при таких заболеваниях состоит в том, что иммунная система атакует собственный организм. Аутоиммунные заболевания затрагивают все основные системы организма, включая соединительную ткань, нервы, мышцы, эндокринную систему, кожу, кровь, дыхательную и желудочно-кишечную системы.

[00280] Аутоиммунное заболевание и патологическое состояние могут являться гематоиммунологическим процессом, включающим, помимо прочего, идиопатическую тромбоцитопеническую пурпуру, аллоиммунную/аутоиммунную тромбоцитопению, приобретенную иммунную тромбоцитопению, аутоиммунную нейтропению, аутоиммунную гемолитическую анемию, Парвовирус B19-ассоциированную эритроцитарную аплазию, приобретенный аутоиммунитет против фактора VIII, приобретенную болезнью фон Виллебранда, множественную миелому и моноклональную гаммапатию неизвестной этиологии, сепсис, апластическую анемию, истинную эритроцитарную аплазию, анемию Даймонда-Блекфана, гемолитическую болезнь новорожденного, иммуноопосредованную нейтропению, невосприимчивость к переливанию тромбоцитарной массы, неонатальную посттрансфузионную пурпуру, гемолитический уремический синдром, системный васкулит, тромбическую тромбоцитопеническую пурпуру или синдром Эвана.

[00281] Аутоиммунное заболевание и патологическое состояние могут являться нейроиммунологическим процессом, включающим, помимо прочего, синдром Гийена-Барре, хроническую воспалительную демиелинизирующую полирадикулоневропатию, парапротеинемическую IgM демиелинизирующую полиневропатию, миастенический синдром Ламберта-Итона, миастению гравис, многоочаговую двигательную невропатию, боковой амиотрофический склероз, ассоциируемый с антителами против GM1, демиелинизацию, рассеянный склероз и неврит зрительного нерва, синдром мышечной скованности, паранеопластическую дегенерацию мозжечка, вызванную анти-Yo антителами, паранеопластический энцефаломиелит, сенсорную невропатию, вызванную анти-Hu антителами, эпилепсию, энцефалит, миелит, миелопатию, особенно связанную с Т-лимфотропным вирусом человека первого типа, аутоиммунную диабетическую невропатию или острую идиопатическую вегетативную невропатию.

[00282] Аутоиммунное заболевание и патологическое состояние могут являться ревматическим процессом, включающим, помимо прочего, болезнь Кавасаки, ревматоидный артрит, синдром Фелти, АНЦА-положительный васкулит, спонтанный полимиозит, дерматомиозит, антифосфолипидные синдромы, повторные самопроизвольные аборты, системную красную волчанку, ювенильный идиопатический артрит, синдром Рейно, CREST-синдром или увеит.

[00283] Аутоиммунное заболевание и патологическое состояние могут являться дерматоиммунологическим процессом, включающим, помимо прочего, токсический эпидермальный некролиз, гангрену, гранулему, аутоиммунное заболевание кожи с развитием нарывов, включая вульгарную пузырчатку, буллезный пемфигоид и эксфолиативную пузырчатку, витилиго, синдром стрептококкового токсического шока, склеродермию, системный склероз, включая диффузный и локальный кожный системный склероз или атопический дерматит (особенно стероидозависимый атопический дерматит).

[00284] Аутоиммунное заболевание и патологическое состояние могут являться скелетно-мышечным иммунологическим процессом, включающим, помимо прочего, миозит с включенными тельцами, некротизирующий фасцит, воспалительные миопатии, миозит, анти-декорин (BJ антиген) миопатию, паранеопластическую некротическую миопатию, вакуолизирующую миопатию, сцепленную с X-хромосомой, пеницилламин-индуцированный полимиозит, атеросклероз, ишемическую болезнь сердца или кардиомиопатию.

[00285] Аутоиммунное заболевание и патологическое состояние могут являться желудочно-кишечным иммунологическим процессом, включающим, помимо прочего, пернициозную анемию, аутоиммунный хронический активный гепатит, первичный биллиарный цирроз печени, глютеновую энтеропатию, герпетиформный дерматит, криптогенный цирроз печени, реактивный артрит, болезнь Крона, болезнь Уипла, язвенный колит или склерозирующий холангит.

[00286] Аутоиммунное заболевание и патологическое состояние могут являться гомологичной болезнью (РТПХ), антитело-опосредованным отторжением трансплантата, отторжением трансплантата костного мозга, постинфекционным воспалением, лимфомой, лейкозом, неоплазией, астмой, сахарным диабетом I типа с антителами против бета-клеток, синдромом Шегрена, смешанным поражением соединительной ткани, болезнью Аддисона, синдромом Фогта-Коянаги-Харады, мембранозно-пролиферативным гломерулонефритом, синдромом Гудпасчера, болезнью Грейвса, тиреоидитом Хашимото, гранулематозом Вегенера, микрополиартериитом, синдромом Черджа-Стросс, узелковым полиартериитом или полиорганной недостаточностью.

[00287] В настоящей заявке "злокачественная опухоль" относится к или описывает физиологическое состояние у млекопитающих, которое обычно характеризуется нерегулируемым ростом клеток. Примеры злокачественной опухоли включают, помимо прочего, карциному, лимфому, бластому, саркому (включая липосаркому, остеобластическую саркому, ангиосаркому, эндотелиосаркому, лимфангиосаркому, лимфангиоэндотелиосаркому, лейомиосаркому, рабдомиосаркому, фибросаркому, миксосаркому, хондросаркому), остеокластому, нейроэндокринные опухоли, мезотелиому, хордому, синовиому, шванному, менингиому, аденокарциному, меланому и лейкоз или лимфолейкоз. Более конкретные примеры таких форм злокачественной опухоли включают плоскоклеточный рак (например, эпителиальный плоскоклеточный рак), рак легкого, включая эпителиальный плоскоклеточный рак), рак легкого, включая мелкоклеточный рак легкого, немелкоклеточный рак легкого, аденокарциному легкого и плоскоклеточную карциному легкого, мелкоклеточную карциному легкого, рак брюшной полости, гепатоцеллюлярный рак, рак желудка, включая рак желудочно-кишечного тракта, рак поджелудочной железы, глиобластому, цервикальный рак, рак яичников, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак толстой кишки, рак прямой кишки, колоректальный рак, карциному эндометрия или матки, карциному слюнной железы, рак почки, рак простаты, рак вульвы, рак щитовидной железы, карциному печени, анальную карциному, карциному полового члена, рак яичка, рак пищевода, опухоли желчного тракта, опухоль Юинга, базально-клеточную карциному, аденокарциному, карциному потовых желез, карциному сальных желез, папиллярную карциному, папиллярные аденокарциномы, цистаденокарциному, медуллярную карциному, бронхогенную карциному, почечноклеточную карциному, гепатому, карциному желчных протоков, хориокарциному, семиному, таратокарциному, опухоль Вильмса, опухоль яичка, карциному легкого, карциному мочевого пузыря, эпителиальную карциному, глиому, астроцитому, медуллобластому, краниофарингиому, эпендимому, пинеалому, гемангиобластому, неврому слухового нерва, олигодендроглиому, менингиому, меланому, нейробластому, ретинобластому, лейкоз, лимфому, множественную миелому, макроглобулинемию Вальденстрема, миелодиспластическую болезнь, болезнь тяжелых цепей, нейроэндокринные опухоли, Шванному и другие карциномы, рак головы и шеи, миелоидные неоплазии, такие как острый миелобластный лейкоз, включая ОМЛ с созреванием, ОМЛ без дифференцировки, острый промиелоцитарный лейкоз, острый миеломоноцитарный лейкоз и острый моноцитарный лейкоз, миелодиспластические синдромы и хронические миелопролиферативные заболевания, включая хронический миелогенный лейкоз, опухоли центральной нервной системы, например, опухоли головного мозга (глиому, нейробластому, астроцитому, медуллобластому, эпендимому и ретинобластому), солидные опухоли (носоглоточный рак, базально-клеточную карциному, рак поджелудочной железы, рак желчных протоков, саркому Капоши, рак яичка, маточный, вагинальный или цервикальный рак, рак яичников, первичный рак печени или эндометриальный рак, опухоли сосудистой системы (ангиосаркому и гемангиоперицитому)), гематологические неоплазии и заболевания наподобие неопластических, например, лимфому Ходжкина; не-ходжскинские лимфомы (лимфому Беркитта, мелкоклеточную лимфоцитарную лимфому/хронический лимфолейкоз, грибовидную гранулему, лимфому из клеток мантийной зоны, фолликулярную лимфому, диффузную В-крупноклеточную лимфому, лимфому краевой зоны, гистиоцитарный ретикулоэндотелиоз и лимфоплазмацитарный лейкоз), опухоли из клеток-предшественников лимфоцитов, включающие B-клеточный острый лимфобластный лейкоз/лимфому и T-клеточный острый лимфобластный лейкоз/лимфому, тимому, опухоли из зрелых T- и NK-клеток, включающие узловой T-клеточный лейкоз, Т-клеточный лейкоз/Т-клеточные лимфомы взрослых и Т-клеточный лейкоз из крупных гранулярных лимфоцитов, остеолитические формы рака и костный метастаз.

[00288] Используемый в настоящей заявке индивид "с риском развития заболевания, опосредованного клетками, происходящими из моноцитов (MDCMD)" является индивидом, который имеет предрасположенность к развитию MDCMD, то есть генетическую предрасположенность к развитию MDCMD, или который был подвергнут воздействию условий, которые могут привести к MDCMD. Индивид "подозреваемый на наличие MDCMD" является индивидом, имеющим один или более симптомов MDCMD. Из вышесказанного очевидно, что ни индивиды "с риском развития MDCMD", ни индивиды, "подозреваемые на наличие MDCMD", не являются всеми лицами в рамкам целевого вида.

[00289] В любом из вышеописанных способов MDCMC может являться заболеванием, вызванным подложкой, и Fc-реагент служит для предотвращения MDCMC или улучшения состояния при MDCMC.

Пример 1 - Конструкция иммунологически активных биомиметиков

[00290] Последовательность, кодирующую мономер Fc-фрагмента из IgG1 человека (SEQ ID NO:1), клонировали в экспрессионный вектор (pCDNA 3.1D/V5 His TOPO Invitrogen), включающий отобранные сайты рестрикции, сигнальную последовательность IgK (дополнительно определенную ниже) и эпитоп таги, получив последовательность мономера IgG1 {сайты рестрикции-сигнал IgK-сайты рестрикции-(шарнирная область-CH2-CH3) IgG1-сайты рестрикции-эпитоп таги (V5 и His)-STOP}, показанную на фиг.17 (SEQ ID NO:19). Конструкцию трансфицировали в клетки CHO (CHO-002) с целью продукции белка. Дополнительно, создавали несколько страдомерных конструкций с общими структурами:

a) {сайты рестрикции-сигнал IgK-сайты рестрикции-(шарнирная область-CH2-CH3)IgG1-сайт XbaI (шарнирная область-CH2-CH3)IgG1-STOP} (SEQ ID NO:21) (см. также фиг.4A и фиг.18);

b) {сайты рестрикции-сигнал IgK-сайты рестрикции-(шарнирная область-CH2-CH3)IgG1-сайт XbaI (шарнирная область-CH2-CH3)IgG1-сайты рестрикции-эпитоп таги (V5 и His)-STOP} (SEQ ID NO:23) (см. также фиг.19);

c) {сайты рестрикции-сигнал IgK-сайт EcoRV-(шарнирная область-CH2-CH3)IgG3-(шарнирная область-CH2-CH3)IgG1-сайты рестрикции-эпитоп таги (V5 и His)-STOP} (SEQ ID NO:25) (см. также фиг.21); и

d) {сайты рестрикции-сигнал IgK-сайт EcoRV-(CH2) IgE- (шарнирная область-CH2-CH3)IgG1-(шарнирная область-CH2)IgG1-(CH4) IgE-STOP} (SEQ ID NO:27) (см. также фиг.22).

[00291] Страдомерную конструкцию на основе IgG1 a) (SEQ ID NO:21; фиг.18) создавали с использованием ПЦР. Праймеры, комплементарные последовательности шарнирной области (на 5'-конце) IgGi (SEQ ID NO:29) и C-концу IgG1 (на 3'-конце) (SEQ ID NO:30), использовали для амплификации шарнирной-Fc области IgG. Сайты рестрикции вводили в праймеры, чтобы обеспечить клонирование внутри рамки второго Fc-домена последовательно с первым, который клонировали в pcDNA клонирующий вектор (pCDNA 3.1D/N5 His TOPO, Invitrogen). Стоп-кодон встраивали перед сайтом рестрикции С-концевого праймера, чтобы предотвратить считывание фланкирующих последовательностей данной конструкции.

[00292] Страдомерная конструкция b) (SEQ ID NO:23; фиг.19), полученная аналогичным образом, содержала Fc IgG1 - Fc IgGi, как описано выше, а также два эпитоп тага, добавленные к С-концу конструкции. Данные эпитоп таги использовали для идентификации или очистки белка. В данной второй конструкции два эпитоп тага, V5 и His таг, присутствуют в рамке считывания перед стоп-кодоном.

[00293] Белки, которые обычно секретируются, содержат, как правило, гидрофобную сигнальную последовательность на N-конце белка. Для страдомерных конструкций использовали сигнальную последовательность IgK METDTLLLWVLLLWVPGSTG (SEQ ID NO:35), которая удаляется из белка при секреции клетками млекопитающих, такими как клетки яичников китайских хомячков. Предполагаемый сайт расщепления определяли на основе алгоритмов для предсказания сайта расщепления сигнальной последовательности (SignalP 3.0).

[00294] Сконструировали дополнительные страдомерные конструкции, подобные a) и b) выше, которые содержали структуру Fc IgG1 - Fc IgG1, как описано выше (с и без эпитоп тага), но с использованием шарнирного домена IgG3 в конструкции: Fc IgG1 - шарнирная область IgG3-(СН2-СН3)IgG1.

Пример 2 - Конструкция и тестирование иммунологически активных биомиметиков

IVIG и Fc, наносимые в форме покрытий, вызывают аналогичные фенотипические изменения

[00295] IVIG и Fc, при нанесении на стенки и дно лунок стерильного планшета, вызывают практически идентичные изменения уровней CD1a и CD86 на незрелых DC и замедляют активацию CD11c. Из-за общепризнанной критической роли DC в ИТП указанные данные обеспечивают рациональную модель для оценки функции IVIG-миметиков, таких как страдомеры. Также сделали заключение, что тот факт, что фенотипические изменения, вызываемые IVIG, полностью воспроизводятся рекомбинантным Fc, позволяет предположить, что действие IVIG на DC, вполне вероятно, является Fc-опосредованным.

Получение страдомеров

[00296] Сконструировали страдомеры четырех различных классов, воспроизводящие эффекты IVIG на незрелую DC. Получили все последовательные страдомеры, кластерные страдомерные единицы, составляющие кластерные страдомеры, кор-страдомерные единицы, включающие кор-страдомеры, а также Fc-фрагмент-страдомеры, приведенные ниже в Таблице 3, за исключением обозначенных случаев. Для получения соответствующих последовательностей для каждой из конструкций человека, перечисленных ниже, синтезировали кДНК из суммарной РНК, выделенной из МПК (мононуклеаров периферической крови) человека. Для получения указанных последовательностей из других видов РНК выделяли из ткани соответствующих видов. Для получения кДНК использовали рандомные праймеры. кДНК использовали для амплификации целевых фрагментов, используя ПЦР для синтеза, клонирования, а также для последующего анализа последовательности фрагментов ДНК. Конечные конструкции получали либо соединением перекрывающихся ПЦР фрагментов (Horton RM, Hunt HD, Ho SN, Pullen, JK and Pease LR. Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlap extension. Gene 77:61-68, 1989), либо с использованием подходящих присутствующих сайтов рестрикции, с получением соответствующих слитых фрагментов.

[00297] Например, при клонировании G-007 CH4 домен IgE слили непосредственно с CH2 доменом IgG1 на 3'-конце белка. Это выполняли, получив праймеры, которые содержали перекрывающиеся последовательности IgG1CH2 (C-конец) с N-концевыми аминокислотами IgECH4. В одном случае гибридный праймер использовали для амплификации 5' с последовательностями IgG1, и комплементарный праймер - для амплификации 3' праймерами с C-конца IgECH4. Продукты двух реакций смешивали, и использовали фланкирующие праймеры для амплификации слитого белка. Анализ последовательности подтвердил правильность конструкции.

[00298] Во многих случаях использовали сайты рестрикции, которые удобно располагались на концах соединяемых молекул. Когда сайты рестрикции встроены, на концах связываемых молекул находятся определяемые остаточные рестрикционные последовательности. Такой подход использовали для большинства конструкций, приведенных ниже в Таблице 3. Аминокислотные последовательности страдомеров, показанные в Таблице 3, приведены на фиг.24. Некоторые последовательности показаны с His-тагами, известными в уровне техники, которые применяются при очистке белков.

Таблица 3
Последовательные страдомеры
N-конец Шарн. CH2 CH3 Шарн. CH2 CH3
G-003 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
G-004 IgG1 IgG1 IgG1 IgG1 IgG1 IgG
G-007 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgECh4
G-011 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
G-012 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgECh4
G-012 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgECh4
G-014 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
G-016 IgG3 IgG3 IgG3 IgG1 IgG1 IgG1
(x-b)Ре-естр
G-017 Лин-кер IgG1 IgG1 IgGlx-b IgG1 IgG1 IgG1
G-023 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 Ig3H 32/62
G-024 IgG3 IgG3 IgG3 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
G-025 107аа IgG1 IgG1 IgG1
G-026 107аа IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
Компоненты Fc-фрагмент-страдомера и кор-страдомера
N-конец Шарн. CH2 CH3 Шарн. CH2 CH3
G-002 IgG1 IgG1 IgG1
G-022 IgG1 IgG1 IgG1 шарнирIgG3
Кластерные страдомерные единицы
N-конец Шарн. CH2 CH3 Шарн. CH2 CH3
G-008 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgM
CH3-CH4-TP
G-009 IgG1 IgG1 IgG1 IgMCH3-CH4-TP
G-010 IgECh2 IgG1 IgG1 IgG1
G-018 IgG2 IgG2 IgG2 IgG1 IgG1 IgG1
G-019 шарнIgG2 IgG1 IgG1 IgG
G-020 шарнIgG2 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
G-021 шарнIgG2 IgG1 IgG1 IgG1
G-027 IgECh2-IgECh2 IgG1 IgG1 IgG1
G-028 ILZ IgG1 IgG1 IgG1
G-029 ILZ-IgECh2 IgG1 IgG1 IgG1
G-030 ILZ IgG2 IgG2 IgG2 IgG1 IgG1 IgG1
G-031 ILZ-шарнIgG2 IgG1 IgG1 IgG1
G-032 ILZ-ILZ IgG1 IgG1 IgG1
G-033 шарнIgG2-IgECh2 IgG1 IgG1 IgG
G-034 шарнIgG2-ILZ IgG2 IgG2 IgG2 IgG1 IgG1 IgG1
G-035 шарнIgG2-шарнIgG2 IgG1 IgG1 IgG1
G-036 шарнIgG2-ILZ IgG1 IgG1 IgG1
Предстоит получить
N-конец H CH2 CH3 H CH2 CH3 H CH2 CH3
401 IgG1 IgG1 IgG1 IgG3 IgG3 IgG3
402 IgG3 IgG1 IgG1 IgG3 IgG1 IgG1
403 IgG1 IgG3 IgG1 IgG1 IgG3 IgG1
404 IgG3 IgG3 IgG1 IgG3 IgG3 IgG1
406 IgG1 IgG1 нет IgG3 IgG3 нет
407 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3
408 IgG1 IgG1 IgG1 IgG3 IgG3 IgG3 IgG1 IgG1 IgG1
409 IgG3 IgG3 IgG3 IgG1 IgG1 IgG1 IgG3 IgG3 IgG3
410 IgG3 IgG1 IgG1 IgG3 IgG1 IgG1 IgG3 IgG1 IgG1
411 IgG3 IgG3 IgG1 IgG3 IgG3 IgG1 IgG3 IgG3 IgG1
412 IgG1 IgG1 IgG4CH4 IgG3 IgG3 IgG4CH4 IgG1 IgG1 IgGCH4
413 IgG1 IgG1 IgG3 IgG3 IgG1 IgG1
414 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
415 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3

Экспрессия белка страдомера

[00299] Для экспрессии белка страдомеров плазмидную ДНК, кодирующую страдомеры, описанные выше, трансфицировали в суспензионную культуру клеток CHO (система экспрессии FreestyleTM MAX CHO, Invitrogen СА). После экспрессии белка экспрессированные страдомеры выделяли из среды культивирования с помощью аффинной колоночной хроматографии с использованием аффинных колонок с A-белком или G-белком. Очищенные страдомеры анализировали с помощью электрофореза в ДСН-ПААГ (полиакриламидном геле с додецилсульфатом натрия) с восстановлением, с последующим окрашиванием кумасси голубым, подтверждая присутствие полос мономерных белков ожидаемого размера, как показано: G-002: полоса приблизительно 35KD, G-004 полоса приблизительно 70KD, G-010: полоса приблизительно 45KD, G-011: полоса приблизительно 80KD, G-012: полоса приблизительно 85KD, G-018 полоса приблизительно 70KD, G-019: приблизительно 35KD, G-028: полоса приблизительно 37KD. Плазмидная ДНК, кодирующая описанные страдомеры, также может быть трансфицирована в другие клетки млекопитающих, такие как HEK 293, клетки BHK, мышиные клетки NSO и мышиные клетки SP2/0.

Образование мультимера

[00300] Было замечено, что данные конструкции при трансфекции, культивировании и очистке, могут давать белки ожидаемого размера в неденатурирующем и денатурирующем белковом анализе. Кроме того, наблюдали, что некоторые соединения также показывали полосы большего размера, которые в соответствии с критериями определения размера являются мультимерами белка, ожидаемого в димерной форме.

[00301] Образование соединений более высокого порядка из выбранных страдомеров анализировали электрофорезом в ДСН-ПААГ с последующим вестерн-блоттингом без восстановления (A) и с восстановлением (B). Анализ с помощью электрофореза в ДСН-ПААГ выявил образование высокомолекулярных соединений страдомеров G-002, G-010 и G-019 без восстановления по сравнению с восстановлением:

• G-002: полоса приблизительно 35KD в условиях восстановления - полосы приблизительно 70KD (димер) и 135KD (тетрамер) без восстановления.

• G-010: полоса приблизительно 45KD в условиях восстановления - полосы приблизительно 90KD (димер) и 180KD (тетрамер) без восстановления.

• G-019: полоса приблизительно 35KD в условиях восстановления - полосы приблизительно 70KD (димер), 140 KD (тетрамер) без восстановления.

[00302] Предполагается, что тетрамеры и другие мультимеры более высокого порядка, образуемые из димерного белка, будут существенно повышать биологическую активность соединения при измерении в анализе на незрелых дендритных клетках (см. ниже).

Мономеры страдомеров, страдомеры и мультимеры страдомеров более высокого порядка сохраняют сайты узнавания

[00303] Каждый из белков в Таблице 3 узнавался кроличьим антителом против человеческого IgG (Fc) [Thermo Scientific 31789]. Из этого сделали вывод, что каждый из указанных белков сохраняет сайты узнавания для данного антитела.

Визуализация методом плазмонного резонанса

[00304] Способность страдомеров, показанных в Таблице 3, связывать FcγRIIIa оценивали, используя метод поверхностного плазмонного резонанса (SPR) (доступный в продаже как Biacore®). Человек FcγRIIIa иммобилизовали непосредственно путем связывания амина на чипе CM5 Biacore, разбавив лиганд в ацетате pH 5,0 до концентрации 5 мкг/мл. Лиганды пропускали через определенную проточную ячейку при скорости потока 5 мкл/мл, пока не было достигнуто 250 RU (резонансные единицы Biacore, соотв. ~1 пг белка на мм2 биосенсора). Затем проточные ячейки блокировали этаноламином. Страдомеры и IVIG разбавляли до 1000 нМ в HBS-EP (0,01 M HEPES, pH 7,4; 0,15 M NaCl; 3 мМ ЭДТА; 0,005% поверхностно-активной добавки P20) и получали серийные разведения 500 нМ, 250 нМ, 125 нМ и, наконец, 62,5 нМ. Также включали фоновую пробу, содержащую только буфер (HBS-EP). Скорость потока 20 мкл/мин использовали для всех проб. В общей сложности вводили 60 мкл пробы в течение 3 минут. Восстановление обеспечивали путем пропускания тока буфера через проточные ячейки в течение увеличенного промежутка времени продолжительностью приблизительно 10 минут.

[00305] При 500 нМ измеренное значение Req (равновесное) относительно базовой линии для страдомерной конструкции G-010 составило 24,9 RU при пропускании над FcγRIIIa человека, а KD составила 1,95e-7 с использованием модели связывания 1:1. IVIG при 500 нМ над FcγRIIIa человека показал Req 63,6 RU и KD 1,89e-7 с использованием модели связывания 1:1. Таким образом, определили, что G-010 связывался с FcγRIIIa. Подобную связывающую способность выявили у других биомиметических соединений. Ниже приведены некоторые другие примеры:

1:1 w Массообмен Бивалентное соответствие
Rmax Chi2 KD(M) KA(I/M) Rmax Chi2
Контроль: 2,05 0,451 4,7e-9 2,1e8 5,21 0,39
Отр.(IgG2a мыши) 87,7 6,8 1,9e-7 5,3e6
Пол.(IVIG)
Биомиметики:
002 6,46 1,12 2,2e-8 4,9e7 16,7 0,82
004 30,2 1,74 4,8e-8 2,5e7 88,2 2,47
011 25,9 0,361 5,5e-6 1,8e7 57,4 0,15

[00306] Сделали заключение, что указанные белки различались по способности связываться с рекомбинантным FcγRIIIa в анализе с методом плазмонного резонанса, и что некоторые соединения, такие как G-010, соответствовали бивалентной кривой, подобной кривым для бивалентных антител, что указывает на то, что страдомер может показывать мульти-валентное связывание с FcγRIIIa.

Страдомеры воспроизводят биологический эффект IVIG

[00307] Оценивали биологическую функцию указанных страдомеров. С целью определения способности каждого страдомера из Таблицы 3 воспроизводить функциональные свойства IVIG у лиц с ИТП, проводили in vitro анализ с использованием незрелых дендритных клеток (iDC). Основанием для выбора iDC в качестве целевых клеток послужили опубликованные данные, продемонстрировавшие, что адоптивный перенос DC из мышей, обработанных IVIG, индуцировал развитие защиты от развития ИТП у интактных животных (Siragam, V. et al. Intravenous immunoglobulin ameliorates ITP via activating Fc [gamma] receptors on dendritic cells. Nat Med 12, 688 (2006)). В своих первоначальных исследованиях авторы изобретения оценивали воздействие нанесенных, т.е. иммобилизованных на пластинке, рекомбинантных Fc (rFc) и IVIG на экспрессию различных маркеров активации, созревания и костимулиряции на человеческих CD14+ клетках, культивируемых в присутствии IL-4 и ГМКСФ. При сравнении с клетками, выращенными в присутствии только цитокинов, клетки, контактировавшие с покрытиями IVIG или rFc, демонстриривали заметное повышение экспрессии CD86 и подавление экспрессии CD1a, а также задержку активации CD11c.

[00308] Затем определяли, воспроизводили ли страдомеры, указанные в Таблице 3, описанный эффект иммобилизованных IVIG или Fc в отношении iDC. Указанные соединения при нанесении на стенки и дно лунок планшета действительно воспроизводили указанный эффект: G-002, G-004, G-005, G-014, G-018 и G-019. Следующие соединения при нанесении на стенки и дно лунок планшета не воспроизводили указанный эффект: G-010, G-011 и G-012.

[00309] Указанные соединения в растворе воспроизводили эффект иммобилизованных IVIG или Fc в отношении iDC: G-002, G-010, G-014, G-018 и G-019. Следующие соединения в растворе не воспроизводили указанный эффект: G-004, G-005, G-011 и G-012.

[00310] Можно проверить, действительно ли обработка iDC иммобилизованным IVIG влияет на последующий ответ на провоспалительные стимулы.

[00311] Из полученных данных сделали следующие выводы:

i. выбранные страдомеры, нанесенные на культуральный планшет, воспроизводят функциональную способность иммобилизованного IVIG активировать экспрессию CD86 и подавлять экспрессию CD1a на незрелой DC,

ii. выбранные страдомеры, вводимые при низкой дозе в растворимой форме, воспроизводят функциональную способность иммобилизованного IVIG активировать экспрессию CD86 и подавлять экспрессию CD1a на iDC,

iii. некоторые страдомеры могут индуцировать фенотипическое изменение как в растворимой, так и в иммобилизованной форме, а другие страдомеры, например, G-010, могут индуцировать фенотипическое изменение в растворимой, но не в иммобилизованной форме,

iv. страдомеры разной структуры могут являться биологически активными, что подтверждается на примере Fc-фрагмент-страдомера, образованного из G-002, и кластерного страдомера, образованного из G-010,

v. белковый анализ выявил более крупные структуры, чем ожидалось при димеризации мономеров страдомеров, причем указанные мультимерные структуры могут согласовываться с биологической активностью, сравнимой с активностью IVIG, и

vi. страдомеры, сформированные из димеризованных мономеров страдомеров, могут демонстрировать бивалентное соответствие в условиях плазмонного резонанса, что согласуется со связыванием нескольких Fcγ-рецепторов и предполагает присутствие мультимерных третичных структур страдомеров.

Пример 3 - Термоагрегированные биомиметики более эффективны по сравнению с IVIG

[00312] Страдомер является биологически активным миметиком агрегированного иммуноглобулина и в особенности агрегированных Fc-фрагментов данного иммуноглобулина. В некоторых случаях термоагрегация биомиметиков, описанных в настоящей заявке, может повышать биологическую активность. Можно сделать вывод, что термоагрегированные биомиметики, как описанные в настоящей заявке, могут являться столь же эффективными, что и IVIG.

Пример 4 - Fc-фрагмент проявляет несколько активностей

[00313] Fc-фрагмент использовали в качестве положительного контроля в экспериментах, описанных выше, в которых белок, который наносили и, таким образом, иммобилизовали на полимере, проявлял такие биологические свойства, которые воспроизводили свойства иммобилизованного IVIG. Fc-фрагмент может также применяться в качестве кор-страдомерной единицы, когда его присоединяют к кор-группам, таким как липосомы, частицы или альбумин. Кроме того, авторы изобретения демонстрировали, что Fc-фрагмент при культивировании в некоторых системах экспрессии и некоторых типах клеток, таких как система транзиентной трансфекции Invitrogen FreestyleMax на основе клеток CHO-S, может формировать мультимеры более высокого порядка в белковом анализе, показывать биваленетный профиль связывания при визуализации в условиях плазмонного резонанса и проявлять мощную биологическую активность в растворимой форме, сопоставимой с активностью иммобилизованного IVIG, в анализе на незрелых DC. Таким образом, можно сделать вывод, что при некоторых тщательно контролируемых условиях Fc-фрагмент формирует Fc-фрагмент-страдомер. Данный эффект может происходить в результате посттрансляционных модификаций, таких как изменения в гликозилировании.

Пример 5 - Кор-страдомер, который представляет собой Fc-покрытую частицу, может менять фагоцитный потенциал в сравнении с частицами без покрытия

[00314] МПК выделяли из лейкотромбоцитарного слоя здоровых доноров, используя центрифугирование в градиенте плотности фиколла-гипака. После выделения МПК дважды промывали PBS. Затем CD14+ клетки очищали, используя разделительную колонку MACS (Miltenyi). Очищенные клетки подсчитывали и ресуспендировали до плотности 2x105/мл в полной среде RPMI, содержащей 800 мкг/мл ГМКСФ и 5 нг/мл IL-4. Затем клетки высевали в лунки обычных (не для культур тканей), но стерильных 6-луночных планшетов. После посева CD14+ клеток в планшеты к ним добавляли, в соотношении 1:1, полистирольные ФИТЦ-микрогранулы (0,52 мкм), покрытые насыщающим или ненасыщающим количеством Fc или IVIG, и инкубировали в течение 6 дней при 37°C, 5,0% CO2, а затем анализировали на предмет фагоцитоза микросфер посредством измерения флуоресценции отсортированных клеток.

[00315] Частицы, покрытые как IVIG, так и Fc, функционировали как кор-страдомеры и, таким образом, могли изменять фагоцитный потенциал в сравнении с частицами без покрытия.

Пример 6 - Конструкция иммунологически активных биомиметиков с измененными аффинностями связывания FcγRIII

[00316] Было показано, что общий набор остатков IgG1 вовлечен в связывание со всеми Fcγ-рецепторами. Также демонстрировали, что дополнительные остатки в молекулах IgG1 участвуют в связывании и с FcγRII, и с FcγRIII. Некоторые остатки при изменении ингибировали связывание одного или нескольких рецепторов. Примечательно, что специфическая двойная мутация S298A/K334A усиливала связывание с FcγIIIa и снижала связывание с FcγIIb. Указанные остатки были помечены на конструкции страдомера, показанной на фиг.16 (звездочкой на обеих аминокислотах). Таким образом, можно использовать сайт-направленный мутагенез, чтобы получить страдомерную молекулу со структурой, кодируемой в соответствии с SEQ ID NO:17, но с соответствующими мутациями S298A/K334A.

Пример 7 - Экспрессия рекомбинантных белков

[00317] Существуют многочисленные системы экспрессии, которые подходят для применения при получении композиций, описанных выше. В частности, системы экспрессии на основе эукариотических клеток могут использоваться для получения нуклеотидных последовательностей или соответствующих полипептидов, белков и пептидов. Многие такие системы широко доступны в продаже.

[00318] В предпочтительном варианте осуществления страдомеры, описанные в настоящей заявке, получены с использованием клеток яичников китайских хомячков (CHO), широко применяемых для получения рекомбинантных иммуноглобулинов в соответствии со стандартными методами. В альтернативном варианте для получения человеческих страдомеров, описанных в настоящей заявке, могут применяться, например, трансгенные животные, обычно посредством экспрессии в молоке животного, с использованием общеизвестных методов экспрессии в трансгенных животных (Lonberg N. Human antibodies from transgenic animals. Nat Biotechnol. 2005 Sep;23(9):1117-25; Kipriyanov SM, Le Gall F. Generation and production of engineered antibodies. Mol. Biotechnol. 2004 Jan;26(l):39-60; см. также Ko K, Koprowski H. Plant biopharming of monoclonal antibodies. Virus Res. 2005 Jul;111(1):93-100.

[00319] Система на основе бакуловирусов в клетках насекомых может обеспечивать высокий уровень экспрессии белков с фрагмента гетерологичной нуклеиновой кислоты, как описанного в патентах США 5,871,986 и 4,879,236, включенных в полном объеме в настоящую заявку путем отсылки, и может быть приобретена, например, под маркой MAXBAC® 2.0 у Invitrogen® и BACPACK™ Baculovirus Expression System у Clontech®.

[00320] Другие примеры систем экспрессии включают систему индуцируемой экспрессии в клетках млекопитающих от Stratagene®, в которой используется синтетический экдизон-индуцируемый рецептор. Другим примером индуцируемой системы экспрессии является система T-REX™ от Invitrogen®, тетрациклин-регулируемая индуцируемая система экспрессии в клетках млекопитающих, в которой используется полноразмерный промотор ЦМВ. Invitrogen® также предлагает дрожжевую систему экспрессии, Pichia methanolica, которая разработана для получения с высоким уровнем рекомбинантных белков в метилотрофных дрожжах Pichia methanolica. Специалисту в данной области известно, как осуществлять экспрессию векторов, таких как экспрессионные конструкции, описанные в настоящей заявке, получать их кодирующую нуклеотидную последовательность или соответствующий полипептид, белок или пептид. См. обзоры Recombinant Gene Expression Protocols, Rocky S. Tuan, Humana Press (1997), ISBN 0896033333; Advanced Technologies for Biopharmaceutical Processing, Roshni L. Dutton, Jeno M. Scharer, Blackwell Publishing (2007), ISBN 0813805171; Recombinant Protein Production With Prokaryotic and Eukaryotic Cells By Otto-Wilhelm Merten, Contributor European Federation of Biotechnology, Section on Microbial Physiology Staff, Springer (2001), ISBN 0792371372.

Пример 8 - Экспрессия и очистка иммунологически активных биомиметиков

[00321] Конструкции нуклеиновых кислот, описанные в Примерах 1 и 2, трансфицировали в клеточные линии, которые в естественном состоянии не экспрессируют Ig. Кодируемые полипептиды экспрессировались в виде секретируемых белков благодаря наличию секреторных лидерных последовательностей, которые обычно удаляются эндогенными протеазами в процессе транспорта из клеток или могут быть впоследствии отщеплены и удалены способами, известными в уровне техники. Данные секретируемые, иммунологически активные биомиметики очищали с помощью хроматографических методов на основе A-белка или His-тагов, широко известных в уровне техники, а размер подтверждали с помощью электрофореза в ДСН-ПААГ (полиакриламидном геле с додецилсульфатом натрия) в восстанавливающих и/или не восстанавливающих условиях.

Пример 9 - Экспрессия и очистка иммунологически активных биомиметиков для крупномасштабного производства

[00322] Тогда как для получения больших количеств определенного белка могут использоваться различные системы, включающие бактерии, клетки насекомых или дрожжи, экспрессия в клетках млекопитающих может свести к минимуму проблемы, обусловленные измененным гликозилированием белков. Клетки млекопитающих, такие как клетки CHO, использовали для оверпродукции различных белков, слитых с Ig основой. Fc-домен в конструкции становится тагом, который обеспечивает последующую очистку из клеточного супернатанта с помощью очистки на аффинной колонке (Harris, CL, DM Lublin and BP Morgan Efficient generation of monoclonal antibodies for specific protein domains using recombinant immunoglobulin fusion proteins: pitfalls and solutions., J. Immunol. Methods 268:245-258, 2002). Много слитых белков были непосредственно клонированы в рамке с константной областью Ig, а именно мономерами неполных CH2 и CH3 Fc-доменов. Конкретный пример экспрессии внеклеточного домена рецептора гамма-интерферона, экспрессируемого с Ig, использовали для получения больших количеств функционально активного белка (Fountoulakis, M, C. Mesa, G. Schmid, R. Gentz, M. Manneberg, M. Zulauf, Z. Dembic and G. Garotta, Interferon gamma receptor extracellular domain expressed as IgG fusion protein in Chinese hamster ovary cells: Purification, biochemical, characterization and stoichiometry of binding, J. Biol. Chem. 270:3958-3964, 1995).

Пример 10 - Конструкция иммунологически активных биомиметиков с измененным Fc гликозилированием

[00323] С помощью метода, по существу аналогичного описанному Shields et al. для гомо-антител, дефукозилированные Fc-домены могут быть получены в мутантных CHO клетках с дефицитом ферментативной активности, обеспечивающей добавление фукозы к углеводам белка. Их используют для экспрессии страдомеров, обладающих более высокой аффинностью к FcγRIII, по сравнению с фукозилированной формой той же молекулы. (Robert L. Shields, et al. Lack of Fucose on Human IgG1 N-Linked Oligosaccharide Improves Binding to Human Fc RIR and Antibody-dependent Cellular Toxicity. J. Biol. Chem., Jul 2002; 277:26733-26740 (doi:10.1074/jbc.M202069200)).

[00324] Было показано, что изменения в сиалировании Fc N-гликана может повысить биологическую активность (Kaneko Y, Nimmerjahn F, Ravetch JV. Science. 2006 Aug 4;313(5787):627-8). Таким образом, с использованием подобных методов может быть получена молекула страдомера с измененным сиалированием.

[00325] Альтернативные способы изменения гликозилирования Fc-доменов страдомера включают хемоэнзиматические способы получения полипептидов с определенной структурой гликозилирования. См., Li, B., Song, H., Hauser, S., and Wang, L. X. 2006. A Highly Efficient Chemoenzymatic Approach Toward Glycoprotein Synthesis. Org. Lett. 8:3081-3084; См. также, заявку на международный патент PCT/US07/70818.

Пример 11 - Слитые конструкции с (176 V/F) полиморфизмом FcγIIIa

[00326] Как описано ранее, противовоспалительная активность IVIG зависит от первичных взаимодействий между Fc-доменом и FcγIIIa. Указанные взаимодействия можно эффективно оценить посредством количественного анализа с использованием метода ППР для определения констант связывания и диссоциации иммунологически активных биомиметиков с двумя узнанаваемыми полиморфными вариантами FcγIIIa (176 V/F). Для определения аффинности связывания и диссоциации мономерного контрольного Fc-домена и страдомерных конструкций настоящего изобретния в клетках CHO необходимо получить слитые FcγIIIa-His-таг белки обоих V (SEQ ID NO:33) и F (SEQ ID NO:31), полиморфных по положению 176, вариантов (фиг.20). Данные последовательности могут быть встроены в pCDNA 3.1 и трансфицированы в клетки CHO. Указанные слитые белки FcγIIIa очищали от супернатантов трансфицированных клеток, используя аффинные Nit'-колонки для очистки белков. Все слитые белки FcγIIIa характеризовали секвенированием кДНК и электрофорезом в ДСН-ПААГ.

[00327] Для экспрессии FcγIIIa и описания взаимодействия с иммунологически активным биомиметиком могут использоваться другие методы, известные в уровне техники. См., например, раздел "материалы и методы" в статье Robert L. Shields, et al. High Resolution Mapping of the Binding Site on Human IgG1 for FcγRI, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcγR. J. Biol. Chem., Feb 2001; 276: 6591-6604 (doi:10.1074/jbc.M009483200).

Пример 12 - Скрининг функции иммунологически активных биомиметиков in vitro

[00328] Для проверки функции иммунологически активных биомиметиков, таких как представленные в Примере 1, разработали in vitro анализ для определения возможного механизма, согласно которому нативные Fc-домены уменьшают воспаление in vivo. Недавно было продемонстрировано, что hIVIG ингибирует созревание дендритных клеток и изменяет профиль секреции IL-10, IL-12 и TNF-альфа (Bayry, J, et al., Inhibition of maturation and function of dendritic cells by intravenous immunoglobulin, Blood 101(2):758-765(2003)). Страдомеры настоящего изобретения опосредуют эффекты в отношении DC аналогично hIVIG. Ингибирование созревания DC и изменение секреции цитокина in vitro может служить эффективным способом определения некоторых биологических активностей многих конструкций страдомеров. Конструкции страдомеров, описанные выше, могут быть также проверены с использованием следующих экспериментальных параметров:

Таблица 4
Группа Экспериментальное условие Измерение результата 1 (FAGS) Измерение результата 2 ELISA/Elispot
1 Нет CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
2 Растворимый IVIG CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
3 Иммобилизованный IVIG CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
4 Растворимый Fc CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
5 Иммобилизованный Fc CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
6 Растворимый страдомер CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23
7 Иммобилизованный страдомер CD1a,14,40,80,83,86,HLADR IL-10,IL-12,TNFa,IL-23

[00329] В одном предпочтительном in vitro анализе, показанном в Таблице 4, измеряли воздействие на человеческий фенотип DC растворимых, иммунологически активных биомиметиков, обладающих необходимыми аффинностями связывания. Растворимые не перекрестно-связанные конструкции на основе природной последовательности Fc-домена могут служить в качестве контроля. Оценивали специфичные DC маркеры на поверхности DC, включая маркеры активации (CD80, CD83 и CD86), а также Fcγ-рецепторы. См. Prechtel AT, Turza NM, Theodoridis AA, Steinkasserer A. CD83 knockdown in monocyte-derived DCs by small interfering RNA leads to a diminished T cell stimulation. J Immunol. 2007 May 1;178(9):5454-64. Кроме того, мультиплексный анализ может использоваться для оценки воздействия иммунологически активных биомиметиков настоящего изобретения на выработку цитокинов в DC (Jongbloed, Sarah L., et al. Enumeration and phenotypic analysis of distinct dendritic cell subsets in psoriatic arthritis and rheumatoid arthritis. Arthritis Res Ther. 2006;8(1):R15 (Опубликовано онлайн 16 декабря 2005 г. doi: 10.1186/ar1864)). Наконец, для подтверждения взаимодействия дендритных клеток с моноцитами, как ожидается, контрольные дендритные клетки и дендритные клетки, обработанные иммунологически активными биомиметиками, культивировали с очищенными моноцитами и с помощью поточной цитометрии оценивали изменения уровней активации рецепторов FcγRIIa и других клеточных поверхностных детерминант, связанных с состоянием активации моноцитов.

[00330] В конкретных вариантах осуществления страдомеры могут уменьшать число рецепторов FcγRIIa на иммунной клетке, увеличивая, таким образом, соотношение рецепторов FcγRIIb, ингибиторных в отношении рецепторов FcγRIIa, что приводит к ингибированию функций иммуноцита.

Пример 13 - Скрининг функции иммунологически активных биомиметиков in vivo

[00331] Многочисленные аутоиммунные заболевания, такие как идиопатическая тромбоцитопеническая пурпура, рассеянный склероз, астма и воспалительные болезни кишечника, являются признанными, общеизвестными моделями для испытания на животных in vivo (Wu GF, Laufer TM. The role of dendritic cells in multiple sclerosis. Curr Neural Neurosci Rep. 2007 May;7(3):245-52; Targan SR, Karp LC. Defects in mucosal immunity leading to ulcerative colitis. Immunol Rev. 2005 Aug;206:296-305). Например, в настоящее время доступны многочисленные модели ИТП. См., например, Crow AR, et al. IVIG inhibits reticuloendothelial system function and ameliorates murine passive immune thrombocytopenia independent of anti-idiotype reactivity. Br J Haematol. 2001; 115:679-686. Иммунологически активные биомиметики, предназначенные для модуляции иммунной системы, как подходящие для каждого конкретного аутоиммунного заболевания, могут быть оценены в таких in vivo моделях. Важно то, что во многих из указанных моделей введение hIVIG скорее всего будет приводить к иммунному ответу на чужеродные (например, у мышей) человеческие антитела, который может заглушить или дать ложноположительный результат, связанный с противовоспалительными эффектами.

[00332] Мышиную модель идиопатической тромбоцитопенической пурпуры разрабатывали согласно следующей методике: число тромбоцитов у мышей C57BL6 измеряли, периодически производя надрез хвостовой вены, 10 мкл крови разводили в 15 мкл цитратного буфера. Затем в образцах анализировали абсолютное число тромбоцитов с помощью цитометра HemaVet 950. У мышей в ИТП контрольной группе, начиная со 2-го дня, ежедневно уменьшали число тромбоцитов, делая внутрибрюшинную инъекцию 2 мкг анти-тромбоцитного крысиного антитела против CD41 мышей (MWReg30) (BD Biosciences pharmingen). Мыши в IVIG профилактической контрольной группе каждое утро получали в/б инъекцию 2 г/кг (40 мг/мышь) человеческого IVIG и MWReg30 в той же дозе, как и в ИТП контрольной группе. Определили, что IVIG обеспечивает эффективную защиту числа тромбоцитов в данной модели индуцированной ИТП, и сделали вывод, что данная модель может применяться для тестирования страдомеров в сравнении с IVIG на предмет относительной степени защиты от уменьшения числа тромбоцитов. Страдомер может быть оценен в данной модели при различных концентрациях, чтобы оценить защиту по сравнению с IVIG, следующим образом:

Группы в эксперименте

1) Контроль - нет ИТП, нет IVIG

2) ИТП контрольная группа - 2 мкг MWReg30 каждый вечер, начиная со 2-го дня

3) Группа IVIG профилактики - 40 мг IVIG каждое утро и 2 мкг MWReg30 каждый вечер, начиная со 2-го дня

4) Страдомер, эквивалентный 101\12 Fc-доменам IV каждое утро

5) Страдомер, эквивалентный 101\11 Fc-доменам IV каждое утро

6) Страдомер, эквивалентный 101\10 Fc-доменам IV каждое утро

7) Страдомер, эквивалентный 101\9 Fc-доменам IV каждое утро

8) Страдомер, эквивалентный 101\8 Fc-доменам IV каждое утро

9) Страдомер, эквивалентный 101\7 Fc-доменам IV каждое утро

10) Страдомер, эквивалентный 101\6 Fc-доменам IV каждое утро

Пример 14 - Оценка эффективности иммунологически активных биомиметиков in vivo при лечении ИТП

[00333] В другой мышиной модели ИТП могут использоваться мыши с дефицитом нормальной функции B-клеток. Дефицит нормальной функции B-клеток служит для устранения идиотип- антиидиотипических эффектов мышиных антител против человеческого Fc-фрагмента, которые вырабатываются при введении мыши Fc-фрагмента или неполного Fc-фрагмента человека и приводят к ложноположительным результатам. Дефицит функции B-клеток может быть вызван, например, путем введения антител против B-клеток или получен в генно-инженерных линиях мышей, таких как нокаутные мыши (Jackson Labs, линия B6.129S2-Igh6tmlCgn/J) с дефицитом зрелых B-клеток.

[00334] Иммунную систему иммунодефицитных мышей восстанавливают либо посредством немодифицированных, либо очищенных от B-клеток МПК из иммунокомпетентных животных. Затем указанных животных обрабатывают антителами к тромбоцитам, воспроизводя ИТП с использованием общеизвестных способов из уровня техники. После этого животных обрабатывают иммунологически активными биомиметиками согласно следующей схеме:

Таблица 5
In vivo эффективность иммунологически активных биомиметиков [Fc-домен hIgG1 - Fc-домен hIgGi] (SEQ ID NO: 22) при лечении ИТП
Группа Кол-во животных МПК, используемые для восстановления мыши Лечение Измеряемый параметр
1 5 Нет Fc IgG1 Количество тромбоцитов
2 5 Нет Страдомер Fc IgG1-Fc IgG1 Количество тромбоцитов
3 5 Немодифицированные Fc IgG1 Количество тромбоцитов
4 5 Немодифицированные Страдомер Fc IgG1-Fc IgG1 Количество тромбоцитов
5 5 Без В-клеток Fc IgG1 Количество тромбоцитов
6 5 Без В-клеток Страдомер Fc IgG1-Fc IgG1 Количество тромбоцитов
7 5 Немодифицированные hIVIG Количество тромбоцитов

[00335] Ожидали, что в группах 1 и 2 ИТП не будет развиваться при введении антитела, поскольку в них у мышей нет B-клеток, чтобы вырабатывать антитела против тромбоцитов, необходимые для разрушения тромбоцитов. Ожидали, что в группах 3 и 4 и страдомерный полипептид {Fc hIgG1-Fc hIgG1}, и мономерный полипептид Fc hIgG1 будут эффективно улучшать состояние при ИТП, поскольку эндогенные мышиные антитела, взаимодействуя с эпитопами Fc-домена hIgGi, перекрестно связывают мономерные полипептиды Fc hIgG1. Напротив, в отсутствие эндогенных мышиных антител страдомерный полипептид {Fc hIgG1-Fc hIgG1} (группа 6) являлся более эффективным, чем не перекрестно-связанный мономерный полипептид Fc IgG1 (группа 5) в улучшении ИТП. Группа 7 служила положительным контролем эффекта лечения.

Пример 15 - Лечение пациентов с ИТП с использованием внутривенных форм страдомерных белков (SEQ ID NO: 18 и 22)

[00336] В схемах лечения ИТП с применением примеров страдомерных белков, кодируемых SEQ ID NO.: 17 и 21, использовали методики на основе нормативных руководств для hIVIG терапии ИТП, таких как практическое руководство Исполнительного комитета американского Общества Гематологии для диагностики и терапии первичной иммунной тромбоцитопенической пурпуры. См. George, JN, et al. Idiopathic thrombocytopenic purpura: a practice guideline developed by explicit methods for the American Society of Hematology. Blood. 1996 Jul 1;88(l):3-40; См. также руководства педиатров гематологов Италии (2000), руководства гематологов Великобритании (2003) и руководства педиатров гематологов Японии (2006). В альтернативе, схемы применения страдомера IV при ИТП могут включать фазу начального введения дозировок, составляющих от приблизительно 0,1 до приблизительно 0,001 от вышеуказанных дозировок схемы лечения. Начальная фаза с низкой дозой предназначена для минимизации каких-либо кратковременных провоспалительных эффектов при введении страдомеров, все еще являясь достаточной, чтобы вызывать длительный противовоспалительный эффект, который впоследствии усиливается и поддерживается в ходе второй фазы стандартной дозировки, описанной выше. Обоснованием данного альтернативного подхода является то, что некоторые варианты осуществления страдомеров могут оказывать и кратковременный воспалительный эффект, и длительный противовоспалительный эффект посредством снижения экспрессии FcγRIIa. Начальная низкая доза (или начальные низкие дозы) может использоваться для стимуляции длительного противовоспалительного эффекта, минимизируя кратковременный воспалительный эффект.

[00337] Эффективная доза страдомера обычно составляет от приблизительно 0,01% до приблизительно 15% эффективной дозы hIVIG, более предпочтительно, от приблизительно 0,1% до приблизительно 3% эффективной дозы hIVIG. Эффективная доза hIVIG при ИТП обычно находится в диапазоне от приблизительно 100 мг/кг до приблизительно 2 грамм/кг, вводимых каждые 10-21 дней.

[00338] Лекарственная форма страдомера для внутривенного введения по существу является такой же, как и лекарственные формы hIVIG, одобренные FDA, однако может не содержать стабилизаторы, присутствущие в некоторых лекарственных формах hIVIG. См., например, листок-вкладыш препарата Gammagard S/D, распространяемого корпорацией Baxter Healthcare и одобренного FDA для терапии ИТП.

Пример 16 - Лечение пациентов с ИТП с использованием внутрибрюшинного введения кор-страдомера

[00339] Схемы лечения для ИТП с применением примеров страдомерных белков, которые представляют собой Fc-фрагменты, присоединенные к кор-группе, такой как липосома, включают внутрибрюшинное введение с дозировками, составляющими от приблизительно 1% до приблизительно 0,001% стандартных дозировок в схемах для внутривенного IVIG. Обоснованием для данного альтернативного подхода является то, что кор-страдомеры, состоящие из связанных фрагментов Fc, доставляемых в стабильной лекарственной форме внутрь брюшной полости, делают доступным воздействие множественных Fc-доменов на моноцит-производные эффекторные клетки, подобно IVIG, но в существенно более низких дозах.

Пример 17 - Конструкция иммунологически активных биомиметиков (страдотел)

[00340] Сконструировали и трансфицировали два страдотела. Для каждого страдотела на основе суммарной РНК, полученной из гибридомных клеточных линий, экспрессирущих целевое антитело, синтезировали кодирующую кДНК. Создание гибридомных клеточных линий известно в уровне техники. Амплификацию целевой кДНК, кодирующей тяжелые и легкие вариабельные области антитела, выполняли с помощью набора для амплификации BD SMART™ RACE (Clontech CA). Для получения кДНК, кодирующей тяжелые и легкие цепи вариабельных областей антител, доступны другие многочисленные методы (Sassano, M. et. al., 1994. Nucleic Acids Res. May 11;22(9):1768-9; Jones, S.T., Bendig, M.M., 1991. Biotechnology (NY) Jan:9(1):88-9). Для получения страдотела тяжелые области вариабельной цепи сливают со страдомерными конструкциями либо с помощью ПЦР с удлинением перекрывающихся фрагментов (Hutton и Pease), либо используют присутствующие совместимые сайты рестрикции для сливания соответствующих фрагментов. Страдотела экспрессировали в клетках CHO-S и выделяли из клеточных супернатантов путем аффинной очистки на колонке с А-белком. Связывание очищенного страдотела с целевым антигеном подтверждали путем анализов на связывание с помощью поточной цитометрии, используя клеточные линии, экспрессирующие антиген.

[00341] Стандартный анализ АЗКЦ с использованием NK-клеток в качестве эффекторов, а антиген-экспрессирующих опухолевых клеток в качестве мишени в различных соотношениях эффектор/мишень, применяли для сравнения эффективности страдотела и моноклонального антитела (Mab), имеющих один и тот же Fab-домен, в индукции АЗКЦ против опухолевых клеточных линий, экспрессирующих антиген с высоким и низким уровнем. Для дальнейшего совершенствования выбирали страдотела, которые демонстрировали результаты, сходные с результатами спаренного Mab в NK-анализе против клеточной линии с высоким уровнем экспрессии эпитопов, но превосходные результаты по сравнению со спаренным Mab в NK-анализе против клеточной линии с низким уровнем экспрессии эпитопов.

Пример 18 - Лечение пациентов с раком молочной железы с использованием внутривенных лекарственных форм страдотела, содержащего антигенсвязывающий домен Трастузумаба

[00342] В схемах лечения рака молочной железы с применением примера страдотела, содержащего Fab, аналогичный Fab из коммерческого препарата трастузумаб, который обладает активностью против эпитопа her2/neu, использовали методики на основе нормативных руководств для терапии рака молочной железы. См. Romond, EH et. al. Trastuzumab plus Adjuvant Chemotherapy for Operable HER2-Positive Breast Cancer. NEJM. 2005 Oct. 20; 353:1673-1684; Seidman, AD et. al. Weekly Trastuzumab and Paclitaxel Therapy for Metastatic Breast Cancer With Analysis of Efficacy by HER2 Immunophenotype and Gene Amplification. Journal of Clinical Oncology. Vol 19, Issue 10 (May), 2001: 2587-2595; Vogel, CL et. al. Journal of Clinical Oncology. Vol 20, Issue 3 (February), 2002:719-726

[00343] Ожидается, что эффективная доза страдотела варьирует в пределах от приблизительно 1% до приблизительно 500% эффективной дозы моноклонального антитела, Fab в котором аналогичен Fab страдотела, более предпочтительно, от приблизительно 50% до приблизительно 100% эффективной дозы моноклонального антитела. В клинической терапии рака эффективная доза моноклонального антитела варьирует. Для моноклонального антитела к Her-2 neu доза обычно находится в диапазоне от приблизительно 2 мг/кг до приблизительно 4 мг/кг, вводимых каждые 7-21 дней.

Пример 19 - Лечение пациентов с раком головы и шеи или раком толстой кишки с использованием внутривенных лекарственных форм страдотела, содержащего антигенсвязывающий домен Цетуксимаба

[00344] Ожидается, что схемы лечения рака молочной железы с применением примера страдотела, содержащего Fab, который является или аналогичен Fab из коммерческого препарата цетуксимаб, обладающий активностью против эпитопа РЭФР, включают методики на основе нормативных руководств для терапии рака головы и шеи и рака толстой кишки. См. Robert, F et. al. Phase I Study of Anti-Epidermal Growth Factor Receptor Antibody Cetuximab in Combination With Radiation Therapy in Patients With Advanced Head and Neck Cancer. Journal of Clinical Oncology, Vol 19, Issue 13 (July), 2001:3234-3243; Bonner, JA et. al. Cetuximab prolongs survival in patients with locoregionally advanced squamous cell carcinoma of head and neck: A phase III study of high dose radiation therapy with or without cetuximab. Journal of Clinical Oncology, 2004 ASCO Annual Meeting Proceedings (Post-Meeting Edition).Vol 22, No 14S (July 15 Supplement), 2004:5507; Shin, DM et. al. Epidermal Growth Factor Receptor-targeted Therapy with C225 and Cisplatin in Patients with Head and Neck Cancer. Clinical Cancer Research Vol. 7, 1204-1213, May 2001; Cunningham, D et al. Cetuximab Monotherapy and Cetuximab plus Irinotecan in Irinotecan-Refractory Metastatic Colorectal Cancer. NEJM. Volume 351:337-345, 2004.

[00345] Ожидается, что эффективная доза страдотела к РЭФР/HER1 варьирует в пределах от приблизительно 1% до приблизительно 500% эффективной дозы моноклонального антитела, Fab которого аналогичен Fab страдотела, более предпочтительно, от приблизительно 50% до приблизительно 100% эффективной дозы моноклонального антитела. В клинической терапии рака эффективная доза моноклонального антитела варьирует. Для моноклонального антитела РЭФР доза обычно находится в диапазоне приблизительно 250-400 мг/квадратный метр, что составляет приблизительно 5 мг/кг-25 мг/кг, вводимых каждые 7-21 дней.

Пример 20 - Увеличенная мультимеризация в результате измененного гликозилирования может повысить активность иммунологически активных биомиметиков

[00346] Профили гликозилирования экспрессируемых белков зависят от клеточной линии, в которой экспрессируется белок. Клетка яичника китайского хомячка (клетка CHO), обычно используемая для экспрессии белка и очистки, дает профиль гликозилирования, который отличается, например, от гликозилирования в клетках HEK 293, которые имеют человеческое происхождение и также широко используются для экспрессии эндогенных белков. Поскольку профиль гликозилирования может влиять на свойства связывания Fc-фрагментов и кор-страдомерных единиц, увеличенная мультимеризация и, как следствие, повышенная биологическая активность экспрессируемых пептидов может быть достигнута при экспрессии в иных клеточных линиях, нежели CHO, или в клеточных линиях, включающих генетически модифицированные CHO с измененным профилем гликозилирования на N-гликане, что способствует повышенной агрегации между Fc-фрагментами или пептидами, содержащими Fc-домен. Увеличенная мультимеризация Fc-фрагмента или выбранных кластерных страдомерных единиц путем изменения профилей гликозилирования может повысить способность иммунологически активных биомиметиков к воспроизведению эффектов hIVIG.

Пример 21 - Изменяет ли IVIG или rFcF (рекомбинантные Fc-фрагменты) фенотип зрелых DC (mDC) при их обработке?

[00347] Фрагменты rFCF из человеческого IgG1, используемые в данном эксперименте, были получены с помощью стандартных методов генной инженерии белков. Каждая из двух цепей человеческого rFCF состояла из шарнирной области (15 аминокислот), CH2 домена (110 аминокислот) и CH3 домена (106 аминокислот) тяжелой цепи IgG1 человека.

[00348] CD14+ клетки могут быть выделены из мононуклеаров периферической крови (МПК), полученных из крови здоровых людей-доноров, с использованием разделительной колонки Miltenyi MACS. Клетки культивировали при конечной концентрации 2×105/мл в присутствии ГМКСФ (800 МЕ/мл) и IL-4 (5 нанограмм/мл) в течение 5 дней при 37°C. Среды во всех культурах обновляли на 3-й день культивирования. На 5-й день в подходящие культуры добавляли липополисахарид (ЛПС; 10 мкг/мл), чтобы вызвать созревание в зрелые дендритные клетки. Зрелые дендритные клетки, как известно из уровня техники, не экспрессируют существенные уровни CD16, CD32 или CD64. Затем клетки культивировали в течение еще двух дней и анализировали аликвоты на экспрессию CD11c, CD80, CD83, CD86, CD1a и CD14 посредством двумерной флюоресцентной поточной цитометрии (FFC). Затем оставшиеся клетки, культивировавшиеся с ЛПС, помещали в лунки с растворимым или иммобилизованным IVIG или человеческим rFcF (все в концентрации 10 мкг/мл) на 24 часа при 37°C, после чего собирали и анализировали экспрессию вышеуказанных маркеров с помощью двумерного FFC.

[00349] Экспериментальные группы являлись следующими:

(1) CD14+ клетки; ГМКСФ; IL-4; без ЛПС ("7d-ЛПС")

(2) CD14+ клетки: ГМКСФ; IL-4; ЛПС ("7d+ЛПС")

(3) CD14+ клетки; ГМКСФ; IL-4; ЛПС; иммоблилизованный IVIG ("cIVIG")

(4) CD14+ клетки; ГМКСФ; IL-4; ЛПС; растворимый IVIG ("sIVIG")

(5) CD14+ клетки; ГМКСФ; IL-4; ЛПС; иммоблилизованный rFcF ("cFc")

(6) CD14+ клетки; ГМКСФ; IL-4; ЛПС; растворимый rFcF ("sFc")

(7) CD14+ клетки; ГМКСФ; IL-4; ЛПС ("Контроль")

Пример 22 - Приводит ли обработка iDC иммобилизованным IVIG к ингибированию фагоцитоза опсонизированных эритроцитов?

[00350] CD14+ клетки очищали от человеческих МПК здорового человека-донора, как описано в Примере 21, и культивировали при 37°C в течение 6 дней в присутствии ГМКСФ и IL-4 в концентрациях, указанных в предыдущих примерах, а также в присутствии или отсутствие иммобилизованного или растворимого IVIG. Затем клетки собирали и инкубировали при 37°C, либо при 4°C в течение двух часов с человеческими резус-положительными (Rho+) эритроцитами, непокрытыми или покрытыми антителами против D-фактора (Rho), конъюгированными флуоресцеинизотиоцианатом (ФИТЦ). После инкубирования с эритроцитами CD14+ клетки окрашивали АФЦ-конъюгированным CD1a. Затем фагоцитоз оценивали с помощью двумерного FFC, измеряя боковое рассеяние (SSC-A), прямое рассеяние (FSC-A), флюоресценцию ФИТЦ (FITC-A) и флюоресценцию АФЦ (CDIa).

Пример 23 - Приводит ли обработка иммобилизованным IVIG к уменьшению способности iDC стимулировать реакцию аллогенной смешанной культуры лимфоцитов

[00351] CD14+ клетки выделяли из крови здорового человека-донора, как описано в предыдущих примерах. Затем их культивировали при 37°C в течение 6 дней с ГМКСФ и IL-4 в присутствии или отсутствие растворимого и иммобилизованного IVIG. Концентрации всех указанных реагентов такие же, как описано выше. Затем клетки собирали и высевали в лунки 96-луночных микропланшетов для культур тканей в различной плотности (максимальная доза составляла 2,5×104 клеток в лунке). CD3+ T-клетки очищали от МПК второго человека-донора, который являлся HLA-несовместимым с донором, от которого были получены CD14+ клетки. T-клетки вносили в каждую лунку 96-луночных планшетов для культур тканей (105 T-клеток на лунку). Через пять дней совместного культивирования в каждую лунку добавляли 1 мкКи 3H-тимидина. Затем культуры инкубировали еще в течение 6 часов, после чего измеряли поглощение 3H-тимидина ("имп/мин") как показатель степени пролиферации клеток в культурах. Тестировали три различных iDC стимуляторных популяции: одну, полученную при культивировании только с ГМКСФ и IL-4, одну, полученную при культивировании с ГМКСФ, IL-4 и иммобилизованным IVIG, и одну, полученную при культивировании с ГМКСФ, IL-4 и растворимым IVIG.

Пример 24 - Влияние обработки iDC иммобилизованными и растворимыми rFcF и IVIG на экспрессию цитокинов в iDC и mDC

[00352] Культуры, содержащие CD14+ клетки, ГМКСФ и IL-4, и либо rFcF (иммобилизованный или растворимый), либо IVIG (иммобилизованный или растворимый), выдерживали при условиях, описанных в предыдущих примерах. Вместо тестирования клеток на предмет экспрессии поверхностных клеточных маркеров оценивали фагоцитную способность или способность стимулировать аллогенные СКЛ-реакции, а также выработку цитокинов, продуцируемых клетками. Ожидалось, что иммобилизованный rFcF модулирует продукцию цитокинов в клетках аналогично IVIG, но не аналогично растворимому rFcF. Таким образом, ожидалось, что уровень цитокинов, которые ингибируют воспалительные ответы (например, интерлейкин-4, интерлейкин-6 и интерлейкин-12) повысится при обработке клеток иммобилизованным rFcF. Кроме того, ожидалось, что обработка клеток иммобилизованным rFcF приведет к уменьшению уровня выработки клетками цитокинов, которые усиливают воспалительные ответы (например, интерферон, интерлейкин-23 и фактор некроза опухолей-I).

Пример 25 - Рекомбинантные мышиные Fc-фрагменты

[00353] Рекомбинантные Fc-фрагменты (rFcF) из IgG2a мыши получали, используя стандартные методы клонирования и экспрессии рекомбинантных белков. Каждая из двух цепей мышиных rFcF состояла из шарнирной области (21 аминокислота), CH2 домена (110 аминокислот) и CH3 домена (107 аминокислот) тяжелой цепи мышиного IgG2a. Мышиный IgG2a являлся активным в анализе на iDC человека, когда был нанесен на стенки и дно лунок планшета.

[00354] Хотя настоящее изобретение и его преимущества были подробно описаны, следует понимать, что в настоящее изобретение могут быть внесены различные изменения, замены и модификации без отступления от сущности и объема изобретения, определенных в соответствии с прилагаемой формулой. Кроме того, объем настоящего заявления не должен ограничиваться конкретными вариантами осуществления способов, устройств, способов производства, композиции, средств, способов и стадий, изложенных в описании. Среднему специалисту в данной области техники из описания настоящего изобретения очевидно, что способы, устройства, способы производства, композиции, средства, способы или стадии, которые присутствуют по состоянию на данный момент или могут быть разработаны позже, выполняющие по существу ту же функцию или достигающие по существу того же результата, что и соответствующие варианты осуществления, описанные в настоящей заявке, могут применяться согласно настоящему изобретению. Таким образом, прилагаемая формула изобретения включает в себя такие способы, устройства, способы производства, композиции, средства, способы или стадии. Все патенты США и иностранные патенты, заявки на патент и непатентная литература (включающие, помимо прочего, рефераты, статьи в научных журналах, книги, товаросопроводительную литературу и руководства), упомянутые или процитированные в настоящей заявке, настоящим полностью включены путем отсылки.

СПИСОК ЛИТЕРАТУРЫ

Следующие ссылки полностью включены путем отсылки.

1. Smiley, D. & MG, T. Southwestern internal medicine conference: High dose intravenous gamma globulin therapy: How does it work? Am JMed Sci 309, 295-303 (1995).

2. Nimmerjahn, F. & Ravetch, J.V. The antiinflammatory activity of IgG: the intravenous IgG paradox. J. Exp. Med. 204, 11-15 (2007).

3. Samuelsson, A., Towers, T.L. & Ravetch, J.V. Anti-inflammatory Activity of IVIG Mediated Through the Inhibitory Fc Receptor. Science 291, 484-486 (2001).

4. Follea, G. et al. Intravenous plasmin-treated gammaglobulin therapy in idiopathic thrombocytopenic purpura. Nouv Rev Fr Hematol 27, 5-10 (1985).

5. Solal-Celigny, P., Bernard, J., Herrera, A. & Biovin, P. Treatment of adult autoimmune thrombocytopenic purpura with high-dose intravenous plasmin-cleaved gammaglobulins. Scand J Haematol 31, 39-44 (1983).

6. Debre, M. & Bonnet, M.-C. Infusion of Gcgamma fragments for treatment of children with acute immune thrombocytopenic purpura. Lancet 342, 945-49 (1993).

7. Burdach, S.E., Evers, K. & Geurson, R. Treatment of acute idiopathic thrombocytopenic purpura of childhood with intravenous immunoglobulin G: Comparative efficacy of 7S and 5S preparations. J Pediatr 109, 770-775 (1986).

8. Siragam, V. et al. Intravenous immunoglobulin ameliorates ITP via activating Fe[gamma] receptors on dendritic cells. Nat Med 12, 688 (2006).

9. Clarkson, S. et al. Treatment of refractory immune thrombocytopenic purpura with an anti-Fe gamma-receptor antibody. N Engl JMed 314, 1236-1239 (1986).

10. Bleeker, W.K. et al. Vasoactive side effects of intravenous immunoglobulin preparations in a rat model and their treatment with recombinant platelet-activating factor acetylhydrolase. Blood 95, 1856-1861 (2000).

11. Teeling, J.L. et al. Therapeutic efficacy of intravenous immunoglobulin preparations depends on the immunoglobulin G dimers: studies in experimental immune thrombocytopenia. Blood 98, 1095-1099 (2001).

12. Augener, W., Friedman, B. & Brittinger, G. Are aggregates of IgG the effective part of high-dose immunoglobulin therapy in adult idiopathic thrombocytopenic purpura (ITP)? Blut 50, 249-252 (1985).

13. Tankersley, D.L., Preston, M.S. & Finlayson, J.S. Immunoglobulin G dimer: An idiotypeanti-idiotype complex. Molecular Immunology 25, 41 (1988).

14. Robert L. Shields, Angela K. Namenuk, Kyu Hong, Y. Gloria Meng, Julie Rae, John Briggs, Dong Xie, Jadine Lai, Andrew Stadlen, Betty Li, Judith A. Fox, and Leonard G. Presta. High Resolution Mapping of the Binding Site on Human IgG1 for FcγR1, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FOR J. Biol. Chem., Feb 2001; 276: 6591 - 6604; doi:10.1074/jbc.M009483200

15. Sondermann, P., Huber, R., Oosthuizen, V., and Jacob, U. (2000) Nature 406, 267-273

16. Robert L. Shields, Jadine Lai, Rodney Keck, Lori Y. O'Connell, Kyu Hong, Y. Gloria Meng, Stefanie H. A. Weikert, and Leonard G. Presta Lack of Fucose on Human IgG1 N-Linked Oligosaccharide Improves Binding to Human FcγRIII and Antibody-dependent Cellular Toxicity. J. Biol. Chem., Jul 2002; 277: 26733 - 26740 ; oi:10.1074/jbc.M202069200

17. Ann Wright and Sherie L. Morrison. Effect of C2-Associated Carbohydrate Structure on Ig Effector Function: Studies with Chimeric Mouse-Human IgG1 Antibodies in Glycosylation Mutants of Chinese Hamster Ovary Cells. J. Immunol., Apr 1998; 160: 3393 - 3402.

18. Crow AR, et al. IVIg inhibits reticuloendothelial system function and ameliorates murine passive immune thrombocytopenia independent of antiidiotype reactivity. Br J Haematol. 2001;115:679-686.

19. Inhibition of maturation and function of dendritic cells by intravenous immunoglobulin Jagadeesh Bayry, Sebastien Lacroix-Desmazes, Cedric Carbonneil, Namita Misra, Vladimira Donkova, Anastas Pashov, Alain Chevailler, Luc Mouthon, Bernard Weill, Patrick Bruneval, Michel D. Kazatchkine, and Srini V. Kaveri Blood 2003 101: 758-765. Prepublished online August 29, 2002; DOI 10.1182/blood-2002-05-1447

20. R. Deng and J. P. Balthasar. Comparison of the effects of antibody-coated liposomes, IVIG, and anti-RBC immunotherapy in a murine model of passive chronic immune thrombocytopenia. Blood, March 15, 2007; 109(6): 2470 - 2476. Prepublished online as a Blood First Edition Paper on November 28, 2006; DOI 10.1182/blood-2006-04-018093.

21. Kabat, E. A., Wu, T. T., Perry, H. M., Gottesman, K. S., and Foeller, C. (1991) Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda

22. U.S. Published Patent Application 20060074225.

1. Димерное соединение для образования мультимера, способного к воспроизведению эффекторной функции агрегированного IgG при мультимеризации через мультимеризирующую область, которое содержит идентичные мономеры, где каждый мономер содержит:
а) мономер мультимеризирующей области, который при димеризации формирует мультимеризирующую область, где мономер мультимеризирующей области представляет собой мономер шарнирной области IgG2 или мономер изолейционовой молнии, и
б) по меньшей мере, один мономер Fc-домена, содержащий шарнирную область, домен СН2 и домен СН3 из IgG1, который при димеризации формирует Fc-домен, который способен главным образом к связыванию с Fcγ-рецептором.

2. Димерное соединение по п. 1, в котором мономер мультимеризирующей области является мономером шарнирной области IgG2.

3. Димерное соединение по п. 1, которое при мультимеризации через указанную мультимеризирующую область способно к связыванию с, по меньшей мере, двумя FcR, выбранными из группы, включающей: FcγRI, FcγRII, FcγRIII, FcγRIV, или их нечеловеческими эквивалентами.

4. Мультимерное соединение, способное к воспроизведению эффекторной функции агрегированного IgG, содержащее два или более димерных соединений по п. 1, которое способно к связыванию, по меньшей мере, с двумя FcR, выбранными из группы, включающей: FcγRI, FcγRII, FcγRIII, FcγRIV, или их нечеловеческими эквивалентами.

5. Способ изменения иммунного ответа, при котором субъекту, нуждающемуся в этом, вводят фармацевтическую композицию, содержащую терапевтически эффективное количество димерного соединения по п. 1 или мультимерного соединения по п. 4.

6. Способ лечения воспалительного заболевания, при котором пациенту, нуждающемуся в этом, вводят мультимерное соединение по п. 4.

7. Способ по п. 6, где воспалительное заболевание представляет собой аутоиммунное заболевание.



 

Похожие патенты:

Изобретение относится к биохимии. Описан биспецифический антигенсвязывающий белок, который является гетеродимерным в отношении связывания белка А.

Изобретение относится к области биохимии. Предложен способ очистки антитела, включая антитела, связывающие CD20 и VEGF человека, из композиции, включающей антитело и, по меньшей мере, одно примесное соединение, где указанный способ включает стадии: (a) загрузки композиции на катионообменный материал, где указанная композиция имеет значение первого pH от 4,0 до 6,0; (b) промывки катионообменного материала первым промывочным буфером при pH, значение которого превышает значение pH композиции (а), где pH первого промывочного буфера составляет от 6,8 до 9,0; (c) промывки катионообменного материала вторым промывочным буфером при pH, значение которого меньше значения pH первого промывочного буфера, где второй промывочный буфер имеет проводимость от 0,5 до 3,0 мСм/см и pH от 5,0 до 6,0; и (d) элюирования антитела из катионообменного материала элюирующим буфером при проводимости, по меньшей мере, на 2 мСм/см большей, чем проводимость второго промывочного буфера, где pH второго промывочного буфера и pH элюирующего буфера являются приблизительно одинаковыми и где pH элюирующего буфера составляет от 5,0 до 6,0.
Изобретение относится к области жидкостной хроматографии. .

Изобретение относится к области биотехнологии, конкретно к получению препарата на основе иммуноглобулинов человека, и может быть использовано в медицине. .
Изобретение относится к инактивации вирусов в производстве иммуноглобулинов, в частности фракции G. .
Изобретение относится к медицине, а именно к производству лекарственных препаратов. .
Изобретение относится к медицине и биотехнологии и касается способа получения иммуноглобулиновых препаратов. .

Изобретение относится к медицине, в частности к иммунологии, и может быть использовано для иммунотерапии и иммунопрофилактики бактериальных и вирусных заболеваний.

Изобретение относится к области ветеринарии и предназначено для защиты животных от стресса, стимуляции роста и регуляции обмена веществ у молодняка сельскохозяйственных животных.

Изобретение относится к области фармакологии и медицины, в том числе ветеринарной медицины, а именно к способу получения средства для стимуляции клеток организма.
Изобретение относится к медицине и может быть использовано для лечения радиационно-термического поражения организма. Для этого применяют однократное подкожное введение облученного гамма-лучами в дозе 14,0 Гр бифидумбактерина.

Изобретение относится к области медицины и может быть использовано для профилактики повреждения химическими гемолитическими агентами биологических мембран эритроцитов.

Изобретение относится к новому усилителю противоопухолевого действия, представляющего собой производное урацила общей формулы (I) или его фармацевтически приемлемой соли.

Изобретение относится к медицине, а именно к методам очищения и оздоровления организма. Для этого проводят лечебное голодание не менее 5 дней при 7-дневной программе и не менее 7 дней при 9-дневной программе.

Изобретение относится к области биотехнологии, конкретно к слитым белкам, содержащим вариант родостомина, и может быть использовано в медицине. Получают полипептид, селективный в отношении интегрина αvβ3, состоящий из аминокислотной последовательности SEQ ID NO:1, конъюгированной на N-конце посредством линкерной аминокислотной последовательности, содержащей комбинацию аминокислот глицина и серина, с вариантом человеческого сывороточного альбумина (HSA) с SEQ ID NO:4.
Изобретение относится к медицине и может быть использовано для коррекции функционального состояния и работоспособности человека. Для этого нейропептид семакс вводят по две капли в каждый носовой ход.

Изобретение относится к медицине, конкретно к неврологии, кардиологии, а также хирургии и травматологии, а именно лекарственным средствам, обладающим цитопротекторной активностью в условиях ишемии-реперфузии, хронического окислительного стресса и химической интоксикации.

Изобретение относится к способам защиты клеток и тканей от гипоксического повреждения и может быть использовано для разработки средств защиты от повреждения при гипоксии и ишемии.

Изобретение относится к области иммунологии. Предложены варианты модифицированного антитела к CD20 или его антигенсвязывающего фрагмента.
Наверх