Антитела против bv8 и их применение



Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение
Антитела против bv8 и их применение

 


Владельцы патента RU 2559542:

ДЖЕНЕНТЕК, ИНК. (US)

Настоящее изобретение относится к биотехнологии. Предложены варианты антител против Bv8 человека или макака, каждое из которых характеризуется тем, что содержит 6 CDR. Описана кодирующая нуклеиновая кислота; вектор экспрессии на её основе для получения антитела; клетка-хозяин для экспрессии антитела на основе вектора, а также способ получения антитела с использованием клетки. Раскрыта фармацевтическая композиция, использующая антитело в эффективном количестве, а также применение антитела - для лечения опухоли, рака или нарушения пролиферации клеток. Предложено применение антитела для снижения или ингибирования ангиогенеза у субъекта, а также для ингибирования пролиферации клеток эндотелия. Использование изобретения обеспечивает новые антитела с аффинностью в отношении Bv8 человека или макака (KD) менее 10-11 М, как измерено методом BIACORE 3000, которые могут найти применение в терапии различных раковых заболеваний. 10 н. и 15 з.п. ф-лы, 43 ил., 1 табл., 3 пр.

 

РОДСТВЕННЫЕ ЗАЯВКИ

Эта заявка является непредварительной заявкой, поданной по 37 CFR 1.53(b)(1), согласно 35 USC 119(e), испрашивающей приоритет предварительной заявки № 61/284743, которая подана 23 декабря 2009 года, и предварительной заявки № 61/414052, которая подана 16 ноября 2010 года, содержание которых включено в данный документ путем ссылки.

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение в основном относится к области молекулярной биологии. Более конкретно, изобретение относится к антителам против Bv8, и их применению.

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

В настоящем точно установлено, что ангиогенез, который включает образование новых кровеносных сосудов из предварительно существующего эндотелия, вовлечен в патогенез различных нарушений. Они включают солидные опухоли и метастазирование, атеросклероз, ретролентальную фиброплазию, гемангиомы, хроническое воспаление, интраокулярные неоваскулярные синдромы, такие как пролиферативные ретинопатии, например, диабетическая ретинопатия, возрастная дегенерация желтого пятна (AMD), неоваскулярная глаукома, иммунное отторжение трансплантированной ткани роговицы и других тканей, ревматоидный артрит и псориаз. Folkman et al., J. Biol. Chem., 267: 10931-10934 (1992); Klagsbrun et al, Annu. Rev. Physiol, 53:217-239 (1991); и Garner A., «Vascular diseases», In: Pathobiology of Ocular Disease. A Dynamic Approach, Garner A., Klintworth GK, eds., 2nd Edition (Marcel Dekker, NY, 1994), pp 1625-1710.

В случае опухолевого роста, ангиогенез, по-видимому, является ключевым для перехода гиперплазии в неоплазию и для обеспечения питания для роста и метастазирования опухоли. Folkman et al., Nature, 339:58 (1989). Неоваскуляризация позволяет опухолевым клеткам получать преимущество в росте и пролиферативную автономность по сравнению с нормальными клетками. Опухоль обычно начинается в виде одной аберрантной клетки, которая может пролиферировать только до размера в несколько кубических миллиметров ввиду расстояния до доступного капиллярного ложа, и она может оставаться «дремлющей» без дальнейшего роста и диссеминации в течение длительного периода времени. Затем некоторые опухолевые клетки переключаются на ангиогенный фенотип, чтобы активировать клетки эндотелия, которые пролиферируют и созревают в новые капиллярные кровеносные сосуды. Эти вновь образованные кровеносные сосуды не только делают возможным непрерывный рост первичной опухоли, но также диссеминацию и повторную колонизацию метастатических опухолевых клеток. Соответственно, наблюдали корреляцию между плотностью микрососудов в срезах опухолей и выживаемостью пациентов при раке молочной железы, а также при некоторых других опухолях. Weidner et al, N. Engl. J. Med, 324:1-6 (1991); Horak et al, Lancet, 340: 1120-1124 (1992); Macchiarini et al., Lancet, 340: 145-146 (1992). Точные механизмы, которые управляют ангиогенным переключением, не вполне поняты, но полагают, что неоваскуляризация опухолевой массы является результатом суммы множества стимуляторов и ингибиторов ангиогенеза (Folkman, 1995, Nat Med 1(1):27-31).

Процесс развития сосудов подвергается строгой регуляции. На сегодняшний день показано, что значительное число молекул, главным образом, секретируемых факторов, продуцируемых окружающими клетками, регулируют дифференциацию, пролиферацию, миграцию и срастание клеток эндотелия в структуры, похожие на тяжи. Например, фактор роста эндотелия сосудов (VEGF) идентифицирован в качестве ключевого фактора, вовлеченного в стимуляцию ангиогенеза и в индукцию проницаемости сосудов. Ferrara et al., Endocr. Rev., 18: 4-25 (1997). Обнаружение того, что утрата даже одного аллеля VEGF ведет к эмбриональной смертности, указывает на незаменимую роль, которую играет этот фактор в развитии и дифференциации сосудистой системы. Кроме того, показано, что VEGF является ключевым медиатором неоваскуляризации, ассоциированной с опухолями и интраокулярными нарушениями. Ferrara et al., Endocr. Rev., выше. Большинство исследованных опухолей человека сверхэкспрессируют мРНК VEGF. Berkman et al., J. Clin. Invest., 91: 153-159 (1993); Brown et al., Human Pathol., 26: 86-91 (1995); Brown et al, Cancer Res., 53: 4727-4735 (1993); Mattern et al, Brit. J. Cancer, 73: 931-934 (1996); Dvorak et al, Am. J. Pathol, 146: 1029-1039 (1995).

Показано, что Bv8 индуцирует пролиферацию, выживаемость и миграцию клеток эндотелия сосудов коры надпочечников (LeCouter, J. et al, Proc Natl Acad Sci USA 100, 2685-2690 (2003)). Bv8 и EG-VEGF являются двумя близкородственными секретируемыми белками, также обозначаемыми как прокинетицин-1 и -2, которые структурно принадлежат к более крупному классу белков, определяемых по мотиву из пяти дисульфидных мостиков, называемому укладкой по типу колипазы (DeCouter, J. et al, Nature 420, 860-867 (2002); LeCouter, J. et al, Proc Natl Acad Sci USA 100, 2685-2690 (2003); Li, M. et al, Mol Pharmacol 59, 692-698 (2001)). Изначально Bv8 идентифицировали как секретируемый белок из кожи лягушки Bombina variegate (Mollay, C. et al, Eur J Pharmacol 374, 189-196 (1999)). Клонирование и экспрессия Bv8 описаны в WO 03/020892, опубликованной 13 марта 2003 года. Bv8 и EG-VEGF связывают два близкородственных сопряженных с G-белком рецептора (GPCR), EG-VEGF/PKR-1 (R1) и EG-VEGF/PKR-2 (R2) (Masuda, Y et al, Biochem Biophys Res Commun 293, 496-402 (2002); Lin, D.C. et al, J Biol Chem 277, 19276-19280 (2002)). EG-VEGF и Bv8 охарактеризованы в качестве митогенов, избирательных к конкретным типам клеток эндотелия (LeCouter, J. et al, Nature 412(6850):877-84 (2001) и LeCouter, J. et al, Proc Natl Acad Sci USA 100, 2685-2690 (2003)). Этому семейству приписаны другие активности, включая ноцицепцию (Mollay, C. et al, выше), моторику желудочно-кишечного тракта (Li, M. et al, выше), регуляцию суточного двигательного ритма (Cheng, M.Y., et al., Nature All, 405-410 (2002)) и нейрогенез обонятельной луковицы (Matsumoto, S., et al, Proc Natl Acad Sci USA 103, 4140-4145 (2006)). Кроме того, Bv8 стимулировал получение гранулоцитарных и моноцитарных колоний in vitro (LeCouter, J. et al, (2003), выше; Dorsch, M. et al, J. Leukoc Biol 78(2), 426-34 (2005)). Bv8 охарактеризован в качестве хемоаттрактанта для макрофагов (LeCouter et al, Proc Natl Acad Sci USA 101, 16813-16919 (2004)).

Ввиду определенной роли ангиогенеза во многих заболеваниях и нарушениях, желательно иметь средство для снижения или ингибирования одного или нескольких биологических эффектов, являющихся причиной этих процессов. Все цитируемые в данном документе ссылки, включая патентные заявки и публикации, включены в данный документ в качестве ссылки в полном объеме.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Изобретение отчасти основано на различных антителах к Bv8. Bv8 является важной и выигрышной терапевтической мишенью, и изобретение относится к антителам в качестве терапевтических и диагностических средств для применения в направленном воздействии на патологические состояния, ассоциированные с экспрессией и/или активностью Bv8. Соответственно, изобретение относится к способам, композициям, наборам и промышленным изделиям, связанным с Bv8.

В определенных вариантах осуществления обеспечивается антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен, содержащий по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранные из группы, состоящей из:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой D, F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T;

(iii) HVR-L3, которая содержит QQINEDPFT;

(iv) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(v) HVR-H2, которая содержит YIX1X2YX3GX4TX5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой C, S или T; X3 представляет собой A, L, N, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(vi) HVR-H3, которая содержит DX1NYGEAYAMDY, где X1 представляет собой G или S.

В определенных вариантах осуществления антитело против Bv8 содержит следующие три последовательности HVR:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой D, F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T; и

(iii) HVR-L3, которая содержит QQINEDPFT; и

консенсусную каркасную последовательность IV подгруппы VL κ человека SEQ ID NO: 240.

В определенных вариантах осуществления антитело против Bv8 содержит следующие три последовательности HVR:

(i) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(ii) HVR-H2, которая содержит YIX1X2YX3GX4TX5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой C, S или T; X3 представляет собой A, L, N, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(iii) HVR-H3, которая содержит DX1NYGEAYAMDY, где X1 представляет собой G или S, и консенсусную каркасную последовательность I подгруппы VH человека SEQ ID NO: 241.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен, содержащий следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой D, F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T;

(iii) HVR-L3, которая содержит QQINEDPFT;

(iv) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(v) HVR-H2, которая содержит YIX1X2YX3GX4TX5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой C, S или T; X3 представляет собой A, L, N, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(vi) HVR-H3, которая содержит DX1NYGEAYAMDY, где X1 представляет собой G или S.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 в одном или обоих положениях VL 28 и 29. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 в положении VH 52a. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 в положении VH 54. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 в одном или обоих положениях VH 95 и 96. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 (1) в одном или обоих положениях VL 28 и 29; и/или (2) в положении VH 52a; и/или (3) в положении VH 54; и/или (4) одном или обоих положениях VH 95 и 96. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит мутацию по сравнению с мышиным/химерным антителом против Bv8 в положениях VH 96 и не содержит мутацию в положении VH 95.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где HVR-L1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 49, 55, 61, 67, 73, 79, 85, 91, 97, 103, 109, 115, 121, 127, 133, 139, 145 и 151, HVR-L2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 50, 56, 62, 68, 74, 80, 86, 92, 98, 104, 110, 116, 122, 128, 134, 140, 146 и 152, HVR-L3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 51, 57, 63, 69, 75, 81, 87, 93, 99, 105, 111, 117, 123, 129, 135, 141, 147 и 153, HVR-H1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 52, 58, 64, 70, 76, 82, 88, 94, 100, 106, 112, 118, 124, 130, 136, 142, 148 и 154, HVR-H2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 53, 59, 65, 71, 77, 83, 89, 95, 101, 107, 113, 119, 125, 131, 137, 143, 149 и 155, и HVR-H3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 54, 60, 66, 72, 78, 84, 90, 96, 102, 108, 114, 120, 126, 132, 138, 144, 150 и 156.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека и консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления SEQ ID NO: 240 представляет собой консенсусную каркасную последовательность IV подгруппы VL κ человека минус три последовательности HVR легкой цепи. В определенных вариантах осуществления SEQ ID NO: 241 представляет собой консенсусную каркасную последовательность I подгруппы VH минус три последовательности HVR тяжелой цепи.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен, содержащий по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранные из группы, состоящей из:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T;

(iii) HVR-L3, которая содержит QQINEDPFT;

(iv) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(v) HVR-H2, которая содержит YIX1X2YX3GX4T X5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой S или T; X3 представляет собой A, L, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(vi) HVR-H3, которая содержит DSNYGEAYAMDY.

В определенных вариантах осуществления антитело против Bv8 содержит следующие три последовательности HVR:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T;

(iii) HVR-L3, которая содержит QQINEDPFT; и

консенсусную каркасную последовательность IV подгруппы VL κ человека SEQ ID NO: 240.

В определенных вариантах осуществления антитело против Bv8 содержит следующие три последовательности HVR:

(i) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(ii) HVR-H2, которая содержит YIX1X2YX3GX4TX5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой S или T; X3 представляет собой A, L, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(iii) HVR-H3, которая содержит DSNYGEAYAMDY, и

консенсусную каркасную последовательность I подгруппы VH человека SEQ ID NO: 241.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен, содержащий следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит KASQSX1X2YX3X4X5SYMN, где X1 представляет собой L или V; X2 представляет собой D или I; X3 представляет собой F, G, S, W или Y; X4 представляет собой A, G, H или V; и X5 представляет собой D, E или Y;

(ii) HVR-L2, которая содержит AASX1X2EX3, где X1 представляет собой N или Y; X2 представляет собой L или R; и X3 представляет собой S или T;

(iii) HVR-L3, которая содержит QQINEDPFT;

(iv) HVR-H1, которая содержит GYX1X2X3X4YDMH, где X1 представляет собой S или T; X2 представляет собой F или L; X3 представляет собой F, M, P, T или V; X4 представляет собой D, E, H, I или N;

(v) HVR-H2, которая содержит YIX1X2YX3GX4TX5YNQKFKG, где X1 представляет собой H, S или T; X2 представляет собой S или T; X3 представляет собой A, L, S или T; X4 представляет собой A, E или S; X5 представляет собой I, L, S или T, и

(vi) HVR-H3, которая содержит DSNYGEAYAMDY.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где HVR-L1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 55, 61, 67, 73, 79, 85, 91, 97, 103, 109, 115, 121, 127, 133, 139, 145 и 151, HVR-L2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 56, 62, 68, 74, 80, 86, 92, 98, 104, 110, 116, 122, 128, 134, 140, 146 и 152, HVR-L3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 57, 63, 69, 75, 81, 87, 93, 99, 105, 111, 117, 123, 129, 135, 141, 147 и 153, HVR-H1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 58, 64, 70, 76, 82, 88, 94, 100, 106, 112, 118, 124, 130, 136, 142, 148 и 154, HVR-H2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 59, 65, 71, 77, 83, 89, 95, 101, 107, 113, 119, 125, 131, 137, 143, 149 и 155, и HVR-H3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 60, 66, 72, 78, 84, 90, 96, 102, 108, 114, 120, 126, 132, 138, 144, 150 и 156.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека и консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления SEQ ID NO: 240 представляет собой консенсусную каркасную последовательность IV подгруппы VL κ человека минус три последовательности HVR легкой цепи. В определенных вариантах осуществления SEQ ID NO: 241 представляет собой консенсусную каркасную последовательность I подгруппы VH минус три последовательности HVR тяжелой цепи.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит:

(1) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO: 61;

(2) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO: 62;

(3) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO: 63;

(4) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO: 64;

(5) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO: 65; и

(6) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO: 66.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит:

(1) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO: 85;

(2) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO: 86;

(3) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO: 87;

(4) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO: 88;

(5) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO: 89; и

(6) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO: 90.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит:

(1) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO: 91;

(2) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO: 92;

(3) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO: 93;

(4) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO: 94;

(5) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO: 95; и

(6) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO: 96.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит:

(1) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO: 121;

(2) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO: 122;

(3) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO: 123;

(4) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO: 124;

(5) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO: 125; и

(6) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO: 126.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность IV подгруппы VL κ человека и консенсусную каркасную последовательность I подгруппы VH человека. В определенных вариантах осуществления SEQ ID NO: 240 представляет собой консенсусную каркасную последовательность IV подгруппы VL κ человека минус три последовательности HVR легкой цепи. В определенных вариантах осуществления SEQ ID NO: 241 представляет собой консенсусную каркасную последовательность I подгруппы VH минус три последовательности HVR тяжелой цепи.

В одном из вариантов осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий SEQ ID NO: 7, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO: 8.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий SEQ ID NO: 9, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO: 10.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий SEQ ID NO: 11, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO: 12.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий SEQ ID NO: 13, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO: 14.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, обладающий по меньшей мере 90% идентичностью последовательностей с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO: 3, 5, 7, 9, 11, 13 и 15.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 3, 5, 7, 9, 11, 13 и 15.

В одном из вариантов осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность SEQ ID NO: 7.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность SEQ ID NO: 9.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность SEQ ID NO: 11.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность SEQ ID NO: 13.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, обладающий по меньшей мере 90% идентичностью последовательностей с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO: 4, 6, 8, 10, 12, 14 и 16.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 4, 6, 8, 10, 12, 14 и 16.

В одном из вариантов осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO: 8.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO: 10.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность SEQ ID NO: 14.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, обладающий по меньшей мере 90% идентичностью последовательностей с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO: 3, 5, 7, 9, 11, 13 и 15, и вариабельный домен тяжелой цепи, обладающий по меньшей мере 90% идентичностью последовательностей с аминокислотной последовательностью, выбранной из группы, состоящей из SEQ ID NO: 4, 6, 8, 10, 12, 14 и 16. В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 3, 5, 7, 9, 1 1, 13 и 15, и вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 4, 6, 8, 10, 12, 14 и 16.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело против Bv8 связывается с Bv8 человек со значением Kd менее чем приблизительно 0,02 нМ.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело против Bv8 связывается с Bv8 человека со значением Kd приблизительно 0,01 нМ или менее.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело против Bv8 связывается с Bv8 человека по меньшей мере в два раза сильнее, чем химерное антитело 2G9 против Bv8. В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело против Bv8 связывается с Bv8 человека по меньшей мере в пять раз сильнее, чем химерное антитело 2G9 против Bv8.

В определенных вариантах осуществления значение Kd измеряют с использованием анализа поверхностного плазмонного резонанса. В определенных вариантах осуществления значение Kd измеряют с использованием полноразмерного антитела против Bv8. В определенных вариантах осуществления значение Kd измеряют с использованием Fab версии антитела против Bv8.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранные из группы, состоящей из:

(i) HVR-L1, которая содержит SASSX1VFYMH, где X1 представляет собой P или S;

(ii) HVR-L2, которая содержит DTSX1LAS, где X1 представляет собой K или N;

(iii) HVR-L3, которая содержит QQWSX1X2PX3T, где X1 представляет собой F, S, W или Y; X2 представляет собой D или E; X3 представляет собой I, L или M;

(iv) HVR-H1, которая содержит GFX1X2STX3GMGVS, где X1 представляет собой L или Y; X2 представляет собой I или L; X3 представляет собой P или S;

(v) HVR-H2, которая содержит HIYWDDDTRYNP S LKS, и

(vi) HVR-H3, которая содержит RDHGYYWFX1Y, где X1 представляет собой D или T.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен, содержащий следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит SASS X1VFYMH, где X1 представляет собой P или S;

(ii) HVR-L2, которая содержит DTSX1LAS, где X1 представляет собой K или N;

(iii) HVR-L3, которая содержит QQWS X1X2PX3T, где X1 представляет собой F, S, W или Y; X2 представляет собой D или E; X3 представляет собой I, L или M;

(iv) HVR-H1, которая содержит GFX1X2STX3GMGVS, где X1 представляет собой L или Y; X2 представляет собой I или L; X3 представляет собой P или S;

(v) HVR-H2, которая содержит HIYWDDDTRYNPSLKS, и

(vi) HVR-H3, которая содержит RDHGYYWFX1Y, где X1 представляет собой D или T.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где HVR-L1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 157, 163, 169, 175, 181, 187 и 193, HVR-L2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 158, 164, 170, 176, 182, 188 и 194, HVR-L3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 159, 165, 171, 177, 183, 189 и 195, HVR-H1 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 160, 166, 172, 178, 184, 190 и 196, HVR-H2 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 161, 167, 173, 179, 185, 191 и 197, и HVR-H3 содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 162, 168, 174, 180, 186, 192 и 198.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность III подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека и консенсусную каркасную последовательность III подгруппы VH человека.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранных из группы, состоящей из:

(i) HVR-L1, которая содержит SASSX1VFYMH, где X1 представляет собой P или S;

(ii) HVR-L2, которая содержит DTSX1LAS, где X1 представляет собой K или N;

(iii) HVR-L3, которая содержит QQWSX1X2PX3T, где X1 представляет собой F, S, W или Y; X2 представляет собой D или E; X3 представляет собой I, L или M;

(iv) HVR-H1, которая содержит GFX1X2STX3GMGVS, где X1 представляет собой L или Y; X2 представляет собой I или L; X3 представляет собой P или S;

(v) HVR-H2, которая содержит HIYWDDDTRYNPSLKS, и

(vi) HVR-H3, которая содержит RDHGYYWFDY.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит SASSX1VFYMH, где X1 представляет собой P или S;

(ii) HVR-L2, которая содержит DTSX1LAS, где X1 представляет собой K или N;

(iii) HVR-L3, которая содержит QQWSX1X2PX3T, где X1 представляет собой F, S, W или Y; X2 представляет собой D или E; X3 представляет собой I, L или M;

(iv) HVR-H1, которая содержит GFX1X2STX3GMGVS, где X1 представляет собой L или Y; X2 представляет собой I или L; X3 представляет собой P или S;

(v) HVR-H2, которая содержит HIYWDDDTRYNPSLKS, и

(vi) HVR-H3, которая содержит RDHGYYWFDY.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит HVR-L1, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 157, 163, 169, 175, 181, 187 и 193, HVR-L2, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 158, 164, 170, 176, 182, 188 и 194, HVR-L3, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 159, 165, 171, 177, 183, 189 и 195, HVR-H1, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 160, 166, 172, 178, 184, 190 и 196, HVR-H2, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 161, 167, 173, 179, 185, 191 и 197, и HVR-H3, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 174, 180, 186, 192 и 198.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность III подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека и консенсусную каркасную последовательность III подгруппы VH человека.

В другом варианте осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит вариабельный домен легкой цепи, содержащий SEQ ID NO: 23, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO: 24.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранных из группы, состоящей из:

(i) HVR-L1, которая содержит EASQSVDYDDDSYMN;

(ii) HVR-L2, которая содержит ATSNLAS;

(iii) HVR-L3, которая содержит QQSNEDPFT;

(iv) HVR-H1, которая содержит GYTFTNSWMN;

(v) HVR-H2, которая содержит RIDPSDSETHYNQKFKD; и

(vi) HVR-H3, которая содержит DSSYDGFYAMDY.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит EASQSVDYDDDSYMN;

(ii) HVR-L2, которая содержит ATSNLAS;

(iii) HVR-L3, которая содержит QQSNEDPFT;

(iv) HVR-H1, которая содержит GYTFTNSWMN;

(v) HVR-H2, которая содержит RIDPSDSETHYNQKFKD; и

(vi) HVR-H3, которая содержит DSSYDGFYAMDY.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит HVR-L1, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 199 и 205, HVR-L2, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 200 и 206, HVR-L3, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 201 и 207, HVR-H1, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 202 и 208, HVR-H2, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 203 и 209, и HVR-H3, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 204 и 210.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность III подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека и консенсусную каркасную последовательность III подгруппы VH человека.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит по меньшей мере одну, две, три, четыре, пять или шесть последовательностей гипервариабельной области (HVR), выбранных из группы, состоящей из:

(i) HVR-L1, которая содержит KSSEYVSNALS;

(ii) HVR-L2, которая содержит GTNKLED;

(iii) HVR-L3, которая содержит QQGYDIPT;

(iv) HVR-H1, которая содержит GFTFSDYFMG;

(v) HVR-H2, которая содержит GIDTKSYNYATYYSGSVKG; и

(vi) HVR-H3, которая содержит NYGNYGAFDS.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит следующие шесть последовательностей HVR:

(i) HVR-L1, которая содержит KSSEYVSNALS;

(ii) HVR-L2, которая содержит GTNKLED;

(iii) HVR-L3, которая содержит QQGYDIPT;

(iv) HVR-H1, которая содержит GFTFSDYFMG;

(v) HVR-H2, которая содержит GIDTKSYNYATYYSGSVKG; и

(vi) HVR-H3, которая содержит NYGNYGAFDS.

В определенных вариантах осуществления предусмотрено антитело, которое связывается с Bv8, или его фрагмент, где антитело содержит HVR-L1, содержащую аминокислотную последовательность SEQ ID NO: 211, HVR-L2, содержащую аминокислотную последовательность SEQ ID NO: 212, HVR-L3, содержащую аминокислотную последовательность SEQ ID NO: 213, HVR-H1, содержащую аминокислотную последовательность SEQ ID NO: 214, HVR-H2, содержащую аминокислотную последовательность SEQ ID NO: 215, и HVR-H3, содержащую аминокислотную последовательность SEQ ID NO: 216.

В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность III подгруппы VH человека. В определенных вариантах осуществления антитело против Bv8 дополнительно содержит консенсусную каркасную последовательность I подгруппы VL κ человека и консенсусную каркасную последовательность III подгруппы VH человека.

В определенных вариантах осуществления антитело против Bv8 представляет собой моноклональное антитело. В определенных вариантах осуществления антитело против Bv8 является гуманизированным. В определенных вариантах осуществления антитело против Bv8 принадлежит человеку. В определенных вариантах осуществления по меньшей мере часть каркасной последовательности антитела против Bv8 представляет собой консенсусную каркасную последовательность человека. В одном из вариантов осуществления антитело представляет собой фрагмент антитела, выбранный из фрагмента Fab, Fab'-SH, Fv, scFv или (Fab')2.

В определенных вариантах осуществления предусмотрен полинуклеотид или нуклеиновая кислота, кодирующая любое из антител, описанных в настоящем документе. В одном из вариантов осуществления предусмотрен вектор, содержащий полинуклеотид или нуклеиновую кислоту. В одном из вариантов осуществления вектор представляет собой экспрессирующий вектор. В одном из вариантов осуществления предусмотрена клетка-хозяин, содержащая вектор. В одном из вариантов осуществления клетка-хозяин является эукариотической. В одном из вариантов осуществления клетка-хозяин является прокариотической. В одном из вариантов осуществления клетка-хозяин представляет собой клетку CHO. В одном из вариантов осуществления предусмотрен способ получения антитела против Bv8, где способ включает культивирование клетки-хозяина в условиях, подходящих для экспрессии полинуклеотида, кодирующего антитело, и выделение антитела.

В определенных вариантах осуществления изобретение дополнительно относится к композиции, содержащей любое из антител против Bv8, приведенных выше. В определенных вариантах осуществления изобретение относится к фармацевтической композиции, содержащей любое из антител против Bv8, приведенных выше, в смеси с фармацевтически приемлемым носителем.

В определенных вариантах осуществления изобретение относится к фармацевтической композиции для предотвращения или лечения метастаза опухоли, которая содержит эффективное количество любого из антител против Bv8, описанных в настоящем документе, в смеси с фармацевтически приемлемым носителем.

В определенных вариантах осуществления предусмотрены способы обнаружения присутствия Bv8 в биологическом образце, способ включает контакт биологического образца с антителом против Bv8 по изобретению в условиях, допускающих связывание антитела с Bv8, и обнаружение образования комплекса между антителом и Bv8.

В определенных вариантах осуществления предусмотрены способы лечения опухоли, рака или нарушения пролиферации клеток включают введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе. В определенных вариантах осуществления рак выбирают из группы, состоящей из рака молочной железы, рака толстой кишки, рака легких, рака почки, глиобластомы, рака пищевода, меланомы, рака мочевого пузыря, рака яичников, рака поджелудочной железы и гепатоцеллюлярной карциномы. В определенных вариантах осуществления рак представляет собой рак молочной железы, рак толстой кишки, рак легких, рак почки, рак яичников или глиобластому. Образцовый и неограничивающий список предполагаемых видов рака предусмотрен в настоящем документе в «Определениях».

В определенных вариантах осуществления предусмотрены способы снижения или ингибирования ангиогенеза у субъекта, имеющего патологическое состояние, ассоциированное с ангиогенезом, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе. В определенных вариантах осуществления патологическое состояние представляет собой неопластическое состояние. В определенных вариантах осуществления патологическое состояние в ненеопластическом состоянии. Образцовый и неограничивающий список предполагаемых ненеопластических состояний предусмотрен в настоящем документе в «Определениях». В определенных вариантах осуществления ненеопластическое состояние выбирают из группы, состоящей из диабетической и других пролиферативных ретинопатий, ретинопатии недоношенных, неоваскулярной глаукомы, возрастной дегенерации желтого пятна, диабетического отека желтого пятна, неоваскуляризации роговицы, неоваскуляризации трансплантата роговицы, неоваскуляризации сетчатки/собственно сосудистой оболочки глаза и ревматоидного артрита.

В определенных вариантах осуществления предусмотрены способы ингибирования пролиферации клеток эндотелия, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе. В определенных вариантах осуществления клетки эндотелия представляют собой клетки эндотелия коры надпочечников.

В определенных вариантах осуществления предусмотрены способы ингибирования миграции нейтрофилов, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе.

В определенных вариантах осуществления предусмотрены способы ингибирования метастаза опухоли, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе. В определенных вариантах осуществления метастаз находится в лимфатической системе. В определенных вариантах осуществления метастаз находится в отдаленном органе.

В определенных вариантах осуществления предусмотрены способы лечения, предотвращения или снижения боли, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе. В определенных вариантах осуществления боль представляет собой острую или хроническую боль. В определенных вариантах осуществления боль представляет собой боль при остром или хроническом воспалении. В определенных вариантах осуществления предусмотрены способы лечения ревматоидного артрита, включающие введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе.

В определенных вариантах осуществления способы, описанные в настоящем документе и выше, дополнительно содержат введение субъекту эффективного количества второго лекарственного средства, где антитело против Bv8 является первым лекарственным средством. В определенных вариантах осуществления второе лекарственное средство представляет собой другое антитело, химиотерапевтическое средство, цитотоксическое средство, антиангиогенное средство, иммуносупрессорное средство, пролекарство, цитокин, антагонист цитокина, цитотоксическую лучевую терапию, кортикостероид, противорвотное средство, вакцину против рака, обезболивающее средство или ингибирующее рост средство. В определенных вариантах осуществления второе лекарственное средство представляет собой антиангиогенное средство. В определенных вариантах осуществления второе лекарственное средство или антиангиогенное средство представляет собой антитело против VEGF. В определенных вариантах осуществления антителом против VEGF является бевацизумаб. В определенных вариантах осуществления второе лекарственное средство вводят до или после введения антитела против Bv8. В определенных вариантах осуществления второе лекарственное средство вводят одновременно с антителом против Bv8. В определенных вариантах осуществления способы дополнительно содержат введение субъекту эффективного количества третьего лекарственного средства, где третье лекарственное средство представляет собой химиотерапевтическое средство.

Образцовый и неограничивающий список предполагаемых химиотерапевтических средств предусмотрен в настоящем документе в «Определениях». В определенных вариантах осуществления химиотерапевтическое средство выбирают из группы, состоящей из паклитаксела, карбоплатина, цисплатина, гемцитабина и пеметрекседа.

В определенных вариантах осуществления предусмотрены способы повышения эффективности антиангиогенного средства у субъекта, имеющего патологическое состояние, ассоциированное с ангиогенезом, способы включают введение субъекту эффективного количества любого из антител против Bv8, описанных в настоящем документе, в комбинации с антиангиогенным средством, тем самым увеличивая ингибирующую активность указанного антиангиогенного средства. В определенных вариантах осуществления патологическое состояние, ассоциированное с ангиогенезом, представляет собой опухоль, рак или нарушение пролиферации клеток. В определенных вариантах осуществления патологическое состояние, ассоциированное с ангиогенезом, представляет собой ненеопластическое состояние. В определенных вариантах осуществления ненеопластическое состояние выбирают из группы, состоящей из диабетической и других пролиферативных ретинопати, ретинопатии недоношенных, неоваскулярной глаукомы, возрастной дегенерации желтого пятна, диабетического отека желтого пятна, неоваскуляризации роговицы, неоваскуляризации трансплантата роговицы, неоваскуляризации сетчатки/собственно сосудистой оболочки глаза и ревматоидного артрита. В определенных вариантах осуществления ненеопластическим состоянием является ревматоидный артрит.

В определенных вариантах осуществления субъектом является пациент-человек. В определенных вариантах осуществления субъектом является пациент-человек с раком. В определенных вариантах осуществления субъектом является пациент-человек с раком, у которого диагностирован метастаз или который может иметь риск его развития. В определенных вариантах осуществления субъект переносит рецидив из-за антагониста VEGF или не поддается лечению им. В определенных вариантах осуществления антагонист VEGF представляет собой антитело против VEGF. В определенных вариантах осуществления антителом против VEGF является бевацизумаб.

В определенных вариантах осуществления антиангиогенное средство вводят до или после введения антитела против Bv8. В определенных вариантах осуществления антиангиогенное средство вводят одновременно с антителом против Bv8. В определенных вариантах осуществления антиангиогенным средством является средство против VEGF. В определенных вариантах осуществления средством против VEGF является антитело против VEGF. В определенных вариантах осуществления антителом против VEGF является бевацизумаб.

Любой вариант осуществления, описанный в настоящем документе, или любое их сочетание применимо к любому и всем антителам против Bv8 и способам по изобретению, описанным в настоящем документе.

КРАТКОЕ ОПИСАНИЕ РИСУНКОВ

Фиг. 1A-F: Последовательности петель HVR легкой цепи и тяжелой цепи антител против Bv8. На фиг. представлены последовательности HVR легкой цепи, L1, L2, и L3, и последовательности HVR тяжелой цепи, H1, H2 и H3. Нумерация последовательностей для каждого антитела представляет собой следующее: химерное 2G9 (HVR-H1 представляет собой SEQ ID NO: 49; HVR-H2 представляет собой SEQ ID NO: 50; HVR-H3 представляет собой SEQ ID NO: 51; HVR-L1 представляет собой SEQ ID NO: 52; HVR-L2 представляет собой SEQ ID NO: 53; HVR-L3 представляет собой SEQ ID NO: 54); h2G9.K4G1.Polish (HVR-L1 представляет собой SEQ ID NO: 55; HVR-L2 представляет собой SEQ ID NO: 56; HVR-L3 представляет собой SEQ ID NO: 57; HVR-H1 представляет собой SEQ ID NO: 58; HVR-H2 представляет собой SEQ ID NO: 59; HVR-H3 представляет собой SEQ ID NO: 60); h2G9.K4G1.v19 (HVR-L1 представляет собой SEQ ID NO: 61; HVR-L2 представляет собой SEQ ID NO: 62; HVR-L3 представляет собой SEQ ID NO: 63; HVR-H1 представляет собой SEQ ID NO: 64; HVR-H2 представляет собой SEQ ID NO: 65; HVR-H3 представляет собой SEQ ID NO: 66); h2G9.K4G1.v25 (HVR-L1 представляет собой SEQ ID NO: 67; HVR-L2 представляет собой SEQ ID NO: 68; HVR-L3 представляет собой SEQ ID NO: 69; HVR-H1 представляет собой SEQ ID NO: 70; HVR-H2 представляет собой SEQ ID NO: 71; HVR-H3 представляет собой SEQ ID NO: 72); h2G9.K4G1.v27 (HVR-L1 представляет собой SEQ ID NO: 73; HVR-L2 представляет собой SEQ ID NO: 74; HVR-L3 представляет собой SEQ ID NO: 75; HVR-H1 представляет собой SEQ ID NO: 76; HVR-H2 представляет собой SEQ ID NO: 77; HVR-H3 представляет собой SEQ ID NO: 78); h2G9.K4G1.v37 (HVR-L1 представляет собой SEQ ID NO: 79; HVR-L2 представляет собой SEQ ID NO: 80; HVR-L3 представляет собой SEQ ID NO: 81; HVR-H1 представляет собой SEQ ID NO: 82; HVR-H2 представляет собой SEQ ID NO: 83; HVR-H3 представляет собой SEQ ID NO: 84); h2G9.K4G1.v52 (HVR-L1 представляет собой SEQ ID NO: 85; HVR-L2 представляет собой SEQ ID NO: 86; HVR-L3 представляет собой SEQ ID NO: 87; HVR-H1 представляет собой SEQ ID NO: 88; HVR-H2 представляет собой SEQ ID NO: 89; HVR-H3 представляет собой SEQ ID NO: 90); h2G9.K4G1.v55 (HVR-L1 представляет собой SEQ ID NO: 91; HVR-L2 представляет собой SEQ ID NO: 92; HVR-L3 представляет собой SEQ ID NO: 93; HVR-H1 представляет собой SEQ ID NO: 94; HVR-H2 представляет собой SEQ ID NO: 95; HVR-H3 представляет собой SEQ ID NO: 96); h2G9.K4G1.v63 (HVR-L1 представляет собой SEQ ID NO: 97; HVR-L2 представляет собой SEQ ID NO: 98; HVR-L3 представляет собой SEQ ID NO: 99; HVR-H1 представляет собой SEQ ID NO: 100; HVR-H2 представляет собой SEQ ID NO: 101; HVR-H3 представляет собой SEQ ID NO: 102); h2G9.K4G1.v64 (HVR-L1 представляет собой SEQ ID NO: 103; HVR-L2 представляет собой SEQ ID NO: 104; HVR-L3 представляет собой SEQ ID NO: 105; HVR-H1 представляет собой SEQ ID NO: 106; HVR-H2 представляет собой SEQ ID NO: 107; HVR-H3 представляет собой SEQ ID NO: 108); h2G9.K4G1.v65 (HVR-L1 представляет собой SEQ ID NO: 109; HVR-L2 представляет собой SEQ ID NO: 110; HVR-L3 представляет собой SEQ ID NO: 111; HVR-H1 представляет собой SEQ ID NO: 112; HVR-H2 представляет собой SEQ ID NO: 113; HVR-H3 представляет собой SEQ ID NO: 114); h2G9.K4G1.v67 (HVR-L1 представляет собой SEQ ID NO: 115; HVR-L2 представляет собой SEQ ID NO: 116; HVR-L3 представляет собой SEQ ID NO: 117; HVR-H1 представляет собой SEQ ID NO: 118; HVR-H2 представляет собой SEQ ID NO: 119; HVR-H3 представляет собой SEQ ID NO: 120); h2G9.K4G1.v73 (HVR-L1 представляет собой SEQ ID NO: 121; HVR-L2 представляет собой SEQ ID NO: 122; HVR-L3 представляет собой SEQ ID NO: 123; HVR-H1 представляет собой SEQ ID NO: 124; HVR-H2 представляет собой SEQ ID NO: 125; HVR-H3 представляет собой SEQ ID NO: 126); h2G9.K4G1.v75 (HVR-L1 представляет собой SEQ ID NO: 127; HVR-L2 представляет собой SEQ ID NO: 128; HVR-L3 представляет собой SEQ ID NO: 129; HVR-H1 представляет собой SEQ ID NO: 130; HVR-H2 представляет собой SEQ ID NO: 131; HVR-H3 представляет собой SEQ ID NO: 132); h2G9.K4G1.v77 (HVR-L1 представляет собой SEQ ID NO: 133; HVR-L2 представляет собой SEQ ID NO: 134; HVR-L3 представляет собой SEQ ID NO: 135; HVR-H1 представляет собой SEQ ID NO: 136; HVR-H2 представляет собой SEQ ID NO: 137; HVR-H3 представляет собой SEQ ID NO: 138); h2G9.K4G1.v80 (HVR-L1 представляет собой SEQ ID NO: 139; HVR-L2 представляет собой SEQ ID NO: 140; HVR-L3 представляет собой SEQ ID NO: 141; HVR-H1 представляет собой SEQ ID NO: 142; HVR-H2 представляет собой SEQ ID NO: 143; HVR-H3 представляет собой SEQ ID NO: 144); h2G9.K4G1.v92 (HVR-L1 представляет собой SEQ ID NO: 145; HVR-L2 представляет собой SEQ ID NO: 146; HVR-L3 представляет собой SEQ ID NO: 147; HVR-H1 представляет собой SEQ ID NO: 148; HVR-H2 представляет собой SEQ ID NO: 149; HVR-H3 представляет собой SEQ ID NO: 150); h2G9.K4G1.v19H/v55L (HVR-L1 представляет собой SEQ ID NO: 151; HVR-L2 представляет собой SEQ ID NO: 152; HVR-L3 представляет собой SEQ ID NO: 153; HVR-H1 представляет собой SEQ ID NO: 154; HVR-H2 представляет собой SEQ ID NO: 155; HVR-H3 представляет собой SEQ ID NO: 156); химерное 2B9 (HVR-L1 представляет собой SEQ ID NO: 157; HVR-L2 представляет собой SEQ ID NO: 158; HVR-L3 представляет собой SEQ ID NO: 159; HVR-H1 представляет собой SEQ ID NO: 160; HVR-H2 представляет собой SEQ ID NO: 161; HVR-H3 представляет собой SEQ ID NO: 162); h2B9.v1 (HVR-L1 представляет собой SEQ ID NO: 163; HVR-L2 представляет собой SEQ ID NO: 164; HVR-L3 представляет собой SEQ ID NO: 165; HVR-H1 представляет собой SEQ ID NO: 166; HVR-H2 представляет собой SEQ ID NO: 167; HVR-H3 представляет собой SEQ ID NO: 168); h2B9.v10 (HVR-L1 представляет собой SEQ ID NO: 169; HVR-L2 представляет собой SEQ ID NO: 170; HVR-L3 представляет собой SEQ ID NO: 171; HVR-H1 представляет собой SEQ ID NO: 172; HVR-H2 представляет собой SEQ ID NO: 173; HVR-H3 представляет собой SEQ ID NO: 174); h2B9.v23 (HVR-L1 представляет собой SEQ ID NO: 175; HVR-L2 представляет собой SEQ ID NO: 176; HVR-L3 представляет собой SEQ ID NO: 177; HVR-H1 представляет собой SEQ ID NO: 178; HVR-H2 представляет собой SEQ ID NO: 179; HVR-H3 представляет собой SEQ ID NO: 180); h2B9.v37 (HVR-L1 представляет собой SEQ ID NO: 181; HVR-L2 представляет собой SEQ ID NO: 182; HVR-L3 представляет собой SEQ ID NO: 183; HVR-H1 представляет собой SEQ ID NO: 184; HVR-H2 представляет собой SEQ ID NO: 185; HVR-H3 представляет собой SEQ ID NO: 186); h2B9.v56 (HVR-L1 представляет собой SEQ ID NO: 187; HVR-L2 представляет собой SEQ ID NO: 188; HVR-L3 представляет собой SEQ ID NO: 189; HVR-H1 представляет собой SEQ ID NO: 190; HVR-H2 представляет собой SEQ ID NO: 191; HVR-H3 представляет собой SEQ ID NO: 192); h2B9.v76 (HVR-L1 представляет собой SEQ ID NO: 193; HVR-L2 представляет собой SEQ ID NO: 194; HVR-L3 представляет собой SEQ ID NO: 195; HVR-H1 представляет собой SEQ ID NO: 196; HVR-H2 представляет собой SEQ ID NO: 197; HVR-H3 представляет собой SEQ ID NO: 198); химерное 3F1 (HVR-L1 представляет собой SEQ ID NO: 199; HVR-L2 представляет собой SEQ ID NO: 200; HVR-L3 представляет собой SEQ ID NO: 201; HVR-H1 представляет собой SEQ ID NO: 202; HVR-H2 представляет собой SEQ ID NO: 203; HVR-H3 представляет собой SEQ ID NO: 204); h3F1.v1(HVR-L1 представляет собой SEQ ID NO: 205; HVR-L2 представляет собой SEQ ID NO: 206; HVR-L3 представляет собой SEQ ID NO: 207; HVR-H1 представляет собой SEQ ID NO: 208; HVR-H2 представляет собой SEQ ID NO: 209; HVR-H3 представляет собой SEQ ID NO: 210); и химерное 2D3 (HVR-L1 представляет собой SEQ ID NO: 211; HVR-L2 представляет собой SEQ ID NO: 212; HVR-L3 представляет собой SEQ ID NO: 213; HVR-H1 представляет собой SEQ ID NO: 214; HVR-H2 представляет собой SEQ ID NO: 215; HVR-H3 представляет собой SEQ ID NO: 216).

Положения аминокислот пронумерованы в соответствии с системой нумерации по Kabat, как описано ниже.

Фиг. 1G. Консенсусная каркасная последовательность IV подгруппы VL κ человека минус последовательности HVR легкой цепи по Kabat показана в SEQ ID NO: 240. Консенсусная каркасная последовательность I подгруппы VH человека минус последовательности HVR тяжелой цепи по Kabat показана в SEQ ID NO: 241.

ФИГ. 2A-B. Аминокислотные последовательности (A) вариабельного домена легкой цепи и (B) вариабельного домена тяжелой цепи вариантов антител против Bv8 2G9. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 3A-B. Аминокислотные последовательности (A) вариабельного домена легкой цепи и (B) вариабельного домена тяжелой цепи вариантов антител против Bv8 2B9. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 4A-B. Аминокислотные последовательности (A) вариабельного домена легкой цепи и (B) вариабельного домена тяжелой цепи вариантов антител против Bv8 3F1. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 5A-B. Аминокислотные последовательности (A) вариабельного домена легкой цепи и (B) вариабельного домена тяжелой цепи вариантов антител против Bv8 2D3. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 6A-B. Аминокислотные последовательности (A) вариабельного домена легкой цепи и (B) вариабельного домена тяжелой цепи гуманизированных вариантов антител против Bv8 2B9. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 7. Аминокислотные последовательности вариабельного домена легкой цепи, показывающие разницу между (1) каркасной последовательностью 2G9 мыши (m2G9) и консенсусной каркасной последовательностью I κ человека и (2) каркасной последовательностью m2G9 и консенсусной каркасной последовательностью IV κ человека. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 8. Аминокислотные последовательности вариабельного домена тяжелой цепи, показывающие разницу между (1) каркасной последовательностью 2G9 мыши (m2G9) и консенсусной каркасной последовательностью подгруппы I (G1) человек и (2) каркасной последовательностью m2G9 и консенсусной каркасной последовательностью III подгруппы (G3) человека. Положения пронумерованы согласно Kabat и гипервариабельные области выделены прямоугольниками.

Фиг. 9. Аминокислотные последовательности L1, L2 и L3 для антител против Bv8 h2G9.K4G1.Polish, h2G9.K4G1.v27, h2G9.K4G1.v52, h2G9.K4G1.v55, h2G9.K4G1.v63, h2G9.K4G1.v64, h2G9.K4G1.v67, h2G9.K4G1.v77 и h2G9.K4G1.v80.

Фиг. 10. H1, H2 и H3 аминокислотные последовательности для антител против Bv8 h2G9.K4G1.Polish, h2G9.K4G1.v19, h2G9.K4G1.v25, h2G9.K4G1.v37, h2G9.K4G1.v65, h2G9.K4G1.v73, h2G9.K4G1.v75, h2G9.K4G1.v77, h2G9.K4G1.v92.

На фиг. 11 представлено химерное антитело 2D3, которое может иметь эпитоп(ы), отличающиеся от химерного антитела 2B9, а также химерного антитела 3F1 и химерного антитела 2G9. Конкурентный анализ ELISA показывает, что химерное антитело 3F1 и химерное антитело 2G9 конкурировало с химерным 2B9, связывающимся с Bv8 человека. Химерное 2D3 только частично конкурировало с химерным антителом 2B9, связывающимся с Bv8 человека.

На фиг. 12 показано блокирование индуцированной Bv8 человека клеточной пролиферации КЭКН с помощью 2G9 мыши, химерного 2G9, 2B9 мыши, химерного 2B9 и химерного 3F1. Результаты анализа показывают, что химерное 2G9 способно полностью ингибировать индуцированную Bv8 человека клеточную пролиферацию КЭКН.

На фиг. 13 показано блокирование индуцированной Bv8 человека клеточной пролиферации КЭКН с помощью химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1, h2G9.K4G3, h2G9.K1G1 и h2G9.K1G3. Результаты анализа показывают, что химерное антитело 2G9 против Bv8 обладает самой высокой блокирующей активностью при концентрации антитела 20 мкг/мл.

На фиг. 14A-B показаны результаты из фагового конкурентного анализа, демонстрирующего связывание вариантов h2G9.K4G1 (L1: D28E, D28S, G29A, G29S, H2: C52aA, C52aS, N54A, N54S, H3: D95E, D95S, G96A и G96S) против Bv8 человека.

На фиг. 15 показано блокирование индуцированной Bv8 человека клеточной пролиферации КЭКН с помощью химерного антитела против Bv8 2G9 и антитела против Bv8 h2G9.K4G1.Polish.

На фиг. 16 показаны результаты фагового конкурентного анализа, демонстрирующие связывание с улучшенной аффинностью вариантов против Bv8 человека h2G9.K4G1.Polish (h2G9.K4G1.v27, v52, v55, v63, v64, v67, v77, v80 из мягко рандомизированной библиотеки L1/L2).

На фиг. 17 изображены результаты фагового конкурентного анализа, демонстрирующие связывание вариантов h2G9.K4G1.Polish против Bv8 человека с улучшенной аффинностью (h2G9.K4G1.v19, v25, v37, v65, v73, v75, v77. v92 из мягко рандомизированной библиотеки H1/H2).

На фиг. 18 представлены константы диссоциации следующих антител против Bv8 (Fab) с Bv8 человека: h2G9.K4G1.Polish, h2G9.K4G1.v19, h2G9.K4G1.v52, h2G9.K4G1.v55 и h2G9.K4G1.v73.

На фиг. 19 представлены константы диссоциации гуманизированных антител против Bv8 (Fab и IgG) h2G9.K4G1.v19 и h2G9.K4G1.v55 с Bv8 человека и Bv8 яванского макака.

На фиг. 20 представлены сенсограммы для инъекций 50 нМ Fab антител против Bv8 при 25°C для чипа BIAcore с иммобилизованным Bv8 человека, демонстрирующие улучшения скорости диссоциации.

На фиг. 21 представлены константы диссоциации следующих антител против Bv8 (IgG) с Bv8 человека и Bv8 яванского макака: химерное 2G9, h2G9.K4G1.v19 и h2G9.K4G1.v55. Результаты показывают, что аффинности гуманизированных антител против Bv8, h2G9.K4G1.v19 и h2G9.K4G1.v55, по-видимому, по меньшей мере в два раза сильнее, чем химерное антитело 2G9 против Bv8.

На фиг. 22 показано, что гуманизированные антитела против Bv8 блокируют связывание Bv8 человека с антителом мыши 2G9. Пять аффинно зрелых гуманизированных антител против Bv8 (h2G9.K4G1.v19, h2G9.K4G1.v52, h2G9.K4G1.v55, h2G9.K4G1.v73 и h2G9.K4G1.v19H/v55L) обладают приблизительно в 5-8 раз более сильными блокирующим способностями по сравнению с родительской улучшенной молекулой K4G1.

На фиг. 23 показано блокирование индуцированной Bv8 человека клеточной пролиферации КЭКН с помощью химерного антитела против Bv8 2G9, антител против Bv8 h2G9K4G1.Polish, h2G9K4G1.v19, h2G9K4G1.v52, h2G9K4G1.v55 и h2G9K4G1.v73 в указанных концентрациях (мкг/мл). Гуманизированные антитела против Bv8 h2G9K4G1.v19, h2G9K4G1.v52, h2G9K4G1.v55 и h2G9K4G1.v73 показывали значительное улучшение в блокировании индуцированной Bv8 человека пролиферации КЭКН.

На фиг. 24 показано блокирование индуцированной Bv8 мыши клеточной пролиферации КЭКН с помощью антител против Bv8 h2G9K4G1.Polished, h2G9K4G1.v19, h2G9K4G1.v55 и химерного антитела против Bv8 2D3 в указанных концентрациях (мкг/мл).

Фиг. 25. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антитела против Bv8 в лечении рака ободочной кишки человека HM7.

Фиг. 26. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антитела против Bv8 в лечении рака рабдомиосаркомы человека A673.

Фиг. 27. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антитела против Bv8 в лечении рака ободочной кишки человека HT55.

Фиг. 28. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антитела против Bv8 в лечении рака легких человека Calu-6.

Фиг. 29. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антитела против Bv8 в лечении рака ободочной кишки человека Colo-205.

Фиг. 30. Исследование эффективности химерного 3F1, химерного 2B9, химерного 2D3 и химерного 2G9 антител против Bv8 в лечении рака поджелудочной железы человека HPAC.

Фиг. 31. Исследование эффективности химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака легких человека Calu-6.

Фиг. 32. Исследование эффективности химерного антитела против Bv8 2D3, антител против Bv8 h2G9.K4G1.Polish, h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака ободочной кишки человека HM7.

Фиг. 33. Исследование эффективности химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака рабдомиосаркомы человека A673.

Фиг. 34. Исследование эффективности химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака ободочной кишки человека HT55.

Фиг. 35. Исследование эффективности химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака ободочной кишки человека Colo-205.

Фиг. 36. Исследование эффективности химерного антитела против Bv8 2G9, антител против Bv8 h2G9.K4G1.v19 и h2G9.K4G1.v55 в лечении рака поджелудочной железы человека HPAC.

Фиг. 37. Исследование эффективности антитела мыши против Bv8 (3F1 и 2B9) в лечении клеток немелкоклеточной карциномы легких человека LXFL529 с использованием антитела против VEGF или без него.

На фиг. 38 показано ингибирование роста аллотрансплантатов карциномы легких Льюиса (LLC) в ответ на антитело против Bv8 в качестве единственного средства или в комбинации с антителом против VEGF.

На фиг. 39 показано ингибирование роста ксенотрансплантатов карциномы толстой кишки человека HM7 в ответ на антитело против Bv8 в качестве единственного средства или в комбинации с антителом против VEGF.

На фиг. 40 показано ингибирование роста ксенотрансплантатов немелкоклеточной карциномы легких человека H460 в ответ на антитело против Bv8 в комбинации с антителом против VEGF.

На фиг. 41 показана продолжительная выживаемость мышей, несущих ксенотрансплантаты немелкоклеточной карциномы легких человека H460, в ответ на антитело против Bv8 в комбинации с антителом против VEGF.

На фиг. 42 показано ингибирование роста ксенотрансплантатов карциномы толстой кишки человека HT29 в ответ на антитела против Bv8 отдельно или в комбинации с антителом против VEGF.

На фиг. 43 показана продолжительная выживаемость мышей, несущих ксенотрансплантаты карциномы толстой кишки человека HT29, в ответ на антитело против Bv8 отдельно или в комбинации с антителом против VEGF.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Изобретение относится к способам, композициям, наборам и промышленным изделиям для антител против Bv8. Подробности, касающиеся этих способов, композиций, наборов и промышленных изделий предоставлены в настоящем документе.

Общие способы

Способы и процедуры, описанные или упомянутые в настоящем документе, как правило, широко распространены и обыкновенно специалисты в данной области применяют их с использованием стандартных способов, таких как, например, широко используемые способы, описанные в Sambrook et al, Molecular Cloning: A Laboratory Manual 3rd. edition (2001) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (2003)); серии METHODS IN ENZYMOLOGY (Academic Press, Inc.): PCR 2: A PRACTICAL APPROACH (M. J. MacPherson, B. D. Hames and G. R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL, and ANIMAL CELL CULTURE (R. I. Freshney, ed. (1987)).

Определения

Термины «Bv8», «гомолог Bv8», «прокинетицин-2» (также известный как «PK2», «KAL4» и «MIT1») используют в настоящем документе взаимозаменяемо и они указывают на полноразмерный полипептид и/или активные фрагменты полноразмерного полипептида. Нативная последовательность Bv8 охватывает встречающиеся в природе препро, про и зрелую формы и усеченные формы Bv8, встречающиеся в природе вариантные формы (например, формы после альтернативного сплайсинга и встречающиеся в природе аллельные варианты). В определенных вариантах осуществления нативные аминокислотные последовательности Bv8 приведены в SEQ ID NO: 235 до 239. Также раскрыты последовательности Bv8 человека и мыши, например, в Wechselberger et al. (FEBS Lett. 462: 177-181 (1999)) и Li et al. (Mol. Pharm. 59:692-698 (2001)).

«Рецептор Bv8» представляет собой молекулу, с которой связывается Bv8 и которая опосредует биологические свойства Bv8. Следовательно, значение термина «рецептор Bv8» включает PKR1/GPR73/EG-VEGF рецептор-1/PROKR1 и PKR2/GPR73L1/EG-VEGF рецептор-2/PROKR2 (LeCouter et al., 2003, Proc. Natl. Acad. Sci. USA, 100:2685-2690; Lin et al, 2002, J. Biol. Chem., 277: 19276-19280; Masuda et al, 2002, Biochem. Biophys. Res. Commun., 293:396-402).

Термин «биологическая активность» и «биологически активный» в отношении полипептида относится к способности молекулы специфически связываться и регулировать клеточные реакции, например, пролиферацию, миграцию и т.д. Клеточные реакции также включают те, что опосредованы рецептором, включая в качестве неограничивающих примеров, миграцию и/или пролиферацию.

«Активный» или «активность» в связи с Bv8 для целей настоящего документа относится к форме(ам) Bv8, которая сохраняет биологическую и/или иммунологическую активность нативного или встречающегося в природе Bv8, где «биологическая» активность относится к биологической функции (ингибирующей или стимулирующей), обусловленной нативным или встречающимся в природе Bv8, отличной от способности индуцировать образование антитела против антигенного эпитопа, которой обладает нативный или встречающийся в природе Bv8, и «иммунологическая» активность относится к способности индуцировать образование антитела против антигенного эпитопа, которой обладает нативный или встречающийся в природе Bv8. В определенных вариантах осуществления биологическая активность Bv8 представляет собой способность модулировать мобилизацию миелоидных клеток, способствовать опухолевому ангиогенезу и/или способствовать метастазированию опухоли.

Термин «антитело против Bv8» или «антитело, которое связывается с Bv8» относится к антителу, которое способно связываться с Bv8 с достаточной аффинностью так, что антитело можно использовать в качестве диагностического и/или терапевтического средства в нацеливании на Bv8. В определенных вариантах осуществления антитело, которое связывается с Bv8, имеет константу диссоциации (Kd) < 1 мкМ, < 100 нМ, < 10 нМ, < 1 нМ, < 0,1 нМ, или < 0,01 нМ. В определенных вариантах осуществления антитело против Bv8 связывается с эпитопом Bv8, который консервативен среди Bv8 от различных видов. В определенных вариантах осуществления антитело против Bv8 связывается с тем же эпитопом на Bv8 человека, с каким антитело, выбранное из группы, состоящей из химерного 2G9, h2G9.K4G1.v19, h2G9.K4G1.v52, h2G9.K4G1.v55, h2G9.K4G1.v73 и химерного 2D3. В определенных вариантах осуществления антитело против Bv8 конкурирует за связывание с Bv8 человека с антителом, выбранным из группы, состоящей из химерного 2G9, h2G9.K4G1.v19, h2G9.K4G1.v52, h2G9.K4G1.v55, h2G9.K4G1.v73 и химерного 2D3.

«Аффинность связывания» как правило относится к силе совокупности нековалентных взаимодействий между одним сайтом связывания молекулы (например, антитела) и его партнером по связыванию (например, антигеном). Если не указано иное, как используют в настоящем документе, «аффинность связывания» относится к истинной аффинности связывания, которая отражает взаимодействие 1:1 между членами пары по связыванию (например, антителом и антигеном). Аффинность молекулы X к ее партнеру Y, как правило, можно представить константой диссоциации (Kd). Аффинность можно измерить обыкновенными известными в данной области способами, включая те, что описаны в настоящем документе. Антитела с низкой аффинностью, как правило, связывают антиген медленно и склонны к быстрой диссоциации, тогда как антитела с высокой аффинностью, как правило, связывают антиген быстрее и склонны дольше оставаться связанными. Различные способы измерения аффинности связывания известны в данной области, и любой из них можно использовать для целей настоящего изобретения. Конкретные иллюстративные варианты осуществления описаны в дальнейшем.

В определенных вариантах осуществления «Kd» или «значение Kd» соответственно измеряют с помощью анализа связывания радиоактивно меченного антигена (RIA), осуществляемого с Fab версией антитела против Bv8 и его антигена, как описано в следующем анализе, в котором измеряют аффинность связывания Fab в растворе с антигеном посредством уравновешивания Fab с использованием минимальной концентрации меченного 125I антигена в присутствие серии титров немеченого антигена, с последующим захватом связанного антигена на планшете, покрытом антителом против Fab (Chen, et al, (1999) J. Mol Biol 293:865-881). Чтобы создать условия для анализа, микротитровальные планшеты (Dynex) покрывают в течение ночи с использованием 5 мкг/мл захватывающего антитела против Fab (Cappel Labs) в 50 мМ карбонате натрия (pH 9,6), и впоследствии блокируют 2% (масс./об.) бычьим сывороточным альбумином в PBS в течение от двух до пяти часов при комнатной температуре (приблизительно 23°C). В неадсорбирующем планшете (Nunc #269620) 100 пМ или 26 пМ [125I]-антигена смешивают с серийными разведениями Fab, представляющего интерес (например, в соответствии с оценкой антитела против VEGF, Fab-12, у Presta et al., (1997) Cancer Res. 57:4593-4599). Затем Fab, представляющий интерес, инкубируют в течение ночи; однако, инкубацию можно продолжать в течение более длительного периода (например, 65 часов), чтобы гарантировать, что равновесие достигнуто. После этого, смеси переносят в захватывающий планшет для инкубации при комнатной температуре (например, в течение одного часа). Затем раствор удаляют и планшет промывают восемь раз с использованием 0,1% Tween™-20 в PBS. Когда планшеты высыхают, добавляют сцинтиллятор по 150 мкл/лунка (MicroScint™-20; Packard), и проводят счет в планшетах на гамма-счетчике TopCount (Packard) в течение десяти минут. Концентрации каждого Fab, который дает 20% или менее от максимального связывания выбирают для использования в анализах конкурентного связывания. Согласно другому варианту осуществления, Kd или значение Kd измеряют посредством использования анализа поверхностного плазмонного резонанса с использованием BIAcore™-2000 или BIAcore™-3000 (BIAcore, Inc., Piscataway, NJ) при 25°C с чипами с иммобилизованным антигеном CM5 при ~10 единицах ответа (RU). В кратком изложении, биосенсорные чипы из карбоксиметилированного декстрана (CM5, BIAcore Inc.) активируют N-этил-N'-(3-диметиламинопропил)-карбодиимидгидрохлоридом (EDC) и N-гидроксисукцинимид (NHS) в соответствии с инструкциями поставщика. Антиген разводят 10 мМ ацетатом натрия, pH 4,8, до 5 мкг/мл (~0,2 мкМ) перед инъекцией при скорости потока 5 мкл/мин, чтобы достичь приблизительно 10 единиц ответа (RU) связанного белка. После инъекции антигена, инъецируют 1M этаноламин, чтобы блокировать непрореагировавшие группы. Для измерений кинетики инъецируют двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) в PBS с 0,05% Tween™ 20 (PBST) при 25°C со скоростью потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) вычисляют, используя простую модель связывания Ленгмюра (программное обеспечение BIAcore™ Evaluation версии 3.2) посредством одновременной подгонки сенсограммы ассоциации и диссоциации. Равновесную константу диссоциации (Kd) вычисляют в виде отношения koff/kon. См., например, Chen, Y., et al, (1999) J. Mol. Biol. 293:865-881. Если в приведенном выше анализе поверхностного плазмонного резонанса скорость ассоциации превышает 106 M-1S-1, то скорость ассоциации можно определять с использованием способа гашения флуоресценции, в котором измеряют увеличение или уменьшение интенсивности испускания флуоресценции (возбуждение = 295 нм; испускание = 340 нм, полоса пропускания 16 нм) при 25°C для 20 нМ антител против антигена (в форме Fab) в PBS, pH 7,2, в присутствие увеличивающихся концентраций антигена, как измеряют в спектрометре, таком как оборудованном остановкой потока спектрофотометре (Aviv Instruments) или в спектрофотометре SLM Aminco серии 8000 (ThermoSpectronic) с перемешиваемой кюветой.

«Выделенная» молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты, которую идентифицировали и отделили от по меньшей мере одной загрязняющей молекулы нуклеиновой кислоты, с которой она, как правило, ассоциирована в природном источнике нуклеиновой кислоты антитела. Выделенная молекула нуклеиновой кислоты находится в другой форме или окружении, чем те, в которых ее находят в природе. Следовательно, выделенные молекулы нуклеиновой кислоты отличают от молекулы нуклеиновой кислоты, как она существует в естественных клетках. Однако выделенная молекула нуклеиновой кислоты содержит молекулу нуклеиновой кислоты, содержащуюся в клетках, которые, как правило, экспрессируют антитело, где, например, молекула нуклеиновой кислоты находится в местоположении в хромосоме, которое отличается от такового в естественных клетках.

Термин «вектор», как используют в настоящем документе, предназначен для обозначения молекулы нуклеиновой кислоты, способной транспортировать другую нуклеиновую кислоту, с которой она была связана. Один тип вектора представляет собой «плазмиду», что относится к замкнутой кольцевой двухцепочечной ДНК, в которую можно лигировать дополнительные сегменты ДНК. Другой тип вектора представляет собой фаговый вектор. Другой тип вектора представляет собой вирусный вектор, где дополнительные сегменты ДНК можно лигировать в вирусный геном. Определенные векторы способны к автономной репликации в клетке-хозяине, в которую их вводят (например, бактериальные векторы, содержащий бактериальный участок начала репликации и эписомные векторы млекопитающих). Другие векторы (например, неэписомные векторы млекопитающих) можно встраивать в геном клетки-хозяина после введения в клетку-хозяина, и тем самым реплицировать наряду с геномом организма-хозяина. Кроме того, определенные векторы способны управлять экспрессией генов, с которыми они функционально связаны. Такие векторы обозначают в настоящем документе как «рекомбинантные экспрессирующие векторы» (или просто «рекомбинантные векторы» или «экспрессирующие векторы»). В целом, экспрессирующие векторы, пригодные в способах рекомбинантной ДНК, часто имеют форму плазмид. В настоящем описании «плазмида» и «вектор» могут быть использованы взаимозаменяемо.

«Полинуклеотид» или «нуклеиновая кислота», как взаимозаменяемо используют в настоящем документе, относятся к полимерам нуклеотидов любой длины, и включают ДНК и РНК. Нуклеотиды могут представлять собой дезоксирибонуклеотиды, рибонуклеотиды, модифицированные нуклеотиды или основания и/или их аналоги или любой субстрат, который может быть встроен в полимер с помощью ДНК или РНК полимеразы, или посредством реакции синтеза. Полинуклеотид может содержать модифицированные нуклеотиды, такие как метилированные нуклеотиды и их аналоги. Если присутствует, модификацию структуры нуклеотида можно выполнять до или после сборки полимера. Последовательность нуклеотидов может быть нарушена посредством ненуклеотидных компонентов. Полинуклеотид дополнительно может быть модифицирован после синтеза, например, посредством конъюгации с меткой. Другие типы модификаций включают, например, «кэпы», замены одного или нескольких встречающихся в природе нуклеотидов на аналог, межнуклеотидные модификации, такие как, например, с незаряженными связями (например, метилфосфонаты, сложные фосфотриэфиры, фосфоамидаты, карбаматы и т.д.) и с заряженными связями (например, фосфоротиоаты, фосфородитиоаты и т.д.), содержащие боковые фрагменты, такие как, например, белки (например, нуклеазы, токсины, антитела, сигнальные пептиды, ply-L-лизин и т.д.), с интеркаляторами (например, акридин, псорален и т.д.), содержащие хелаторы (например, металлы, радиоактивные металлы, бор, окислительные металлы и т.д.), содержащие алкилирующие средства, с модифицированными связями (например, α-аномерные нуклеиновые кислоты и т.д.), а также немодифицированные формы полинуклеотида(ов). Кроме того, любые из гидроксильных групп, как правило, присутствующих в сахарах, можно заменить, например, посредством фосфонатными группами, фосфатными группами, защитить посредством стандартных защитных групп, или активировать для получения дополнительных связей с дополнительными нуклеотидами, или их можно конъюгировать с твердыми или полутвердыми носителями. 5'- и 3'-концевые OH можно фосфорилировать или заместить аминами или фрагментами органических блокирующих групп от 1 до 20 углеродных атомов. Из других гидроксилов также можно получать стандартные защитные группы. Полинуклеотиды также могут содержать аналогичные формы сахаров рибозы или дезоксирибозы, которые, как правило, известны в данной области, включая, например, 2'-O-метил-, 2'-O-аллил, 2'-фтор- или 2'-азидо-рибозу, аналоги карбоциклических сахаров, α-аномерные сахара, эпимерные сахара, такие как арабиноза, ксилозы или ликсозы, сахара пиранозы, сахара фуранозы, седогептулозы, ациклические аналоги и основные нуклеозидные аналоги, такие как метилрибозид. Одна или несколько фосфодиэфирных связей могут быть заменены альтернативными связывающими группами. Эти альтернативные связывающие группы включают в качестве неограничивающих примеров варианты осуществления, где фосфат заменяют на P(O)S («тиоат»), P(S)S («дитиоат»), «(O)NR2 («амидат»), P(O)R, P(O)OR', CO или CH2 («формацеталь»), в которых каждый R или R независимо представляет собой H или замещенный или незамещенный алкил (C1-20), необязательно содержащий простую эфирную (-O-) связь, арил, алкенил, циклоалкил, циклоалкенил или аралдил. Не все связи в полинуклеотиде должны быть идентичными. Предшествующее описание применимо ко всем полинуклеотидам, упоминаемым в настоящем документе, включая РНК и ДНК.

«Олигонуклеотид», как используют в настоящем документе, как правило относится к коротким, как правило, одноцепочечным, как правило, синтетическим полинуклеотидам, которые, как правило, но не обязательно, имеют длину менее чем приблизительно 200 нуклеотидов. Термины «олигонуклеотид» и «полинуклеотид» не являются взаимоисключающими. Приведенное выше описание для полинуклеотидов в равной и полной мере применимо к олигонуклеотидам.

Термины «антитело» и «иммуноглобулин» используют взаимозаменяемо в самом широком смысле и они включают моноклональные антитела (например, полноразмерные или интактные моноклональные антитела), поликлональные антитела, поливалентные антитела, полиспецифические антитела (например, биспецифические антитела при условии, что они проявляют желательную биологическую активность), а также они могут включать определенные фрагменты антител (как более подробно описано в настоящем документе). Антитело может быть антителом человека, гуманизированным и/или аффинно зрелым.

«Выделенное» антитело представляет собой антитело, которое идентифицировали и извлекли и/или отделили от компонента его естественной среды. Загрязняющие компоненты его естественной среды представляют собой вещества, которые могут препятствовать диагностического или терапевтическому использованию антитела, и они могут включать ферменты, гормоны и другие белковые или небелковые растворенные вещества. В предпочтительных вариантах осуществления антитело должно быть очищено (1) до более чем 95% по массе антитела, как определяют способом Лоури, и наиболее предпочтительно более чем 99% по массе, (2) до степени, достаточной для получения по меньшей мере 15 остатков N-концевой или внутренней аминокислотной последовательности с использованием секвенатора с вращающимся стаканом, или (3) до однородности на SDS-PAGE в восстановительных или невосстановительных условиях, используя кумаси синий или, предпочтительно, окрашивание серебром. Выделенное антитело включает антитело in situ внутри рекомбинантных клеток, после того, как по меньшей мере один компонент естественной среды антитела не будет присутствовать. Однако, как правило, выделенное антитело следует получать посредством по меньшей мере одной стадии очистки.

Термин «вариабельный» относится к тому факту, что определенные части вариабельных доменов значительно различаются последовательностью среди антител и участвуют в связывании и специфичности каждого конкретного антитела к конкретному антигену. Однако вариабельность распределена не равномерно по всем вариабельным доменам антител. Она сосредоточена в трех сегментах, называемых определяющими комплементарность областями или гипервариабельными областями (CDR или HVR, используются взаимозаменяемо в настоящем документе), в вариабельных доменах как легкой цепи, так и тяжелой цепи. Более высоко консервативные части вариабельных доменов называют каркасными областями (FR). Вариабельные домены каждой из нативных тяжелой и легкой цепей содержат четыре области FR, большей частью принимающие конфигурацию β-листа, которые соединены тремя HVR, которые образуют петли, соединяющие и, в некоторых случаях, формирующие часть структуры β-листа. HVR в каждой цепи удерживаются вместе в непосредственной близости с помощью областей FR и с HVR из другой цепи, внося вклад в формирование участка связывания антигена в антителе (см. Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)). Константные домены не вовлечены непосредственно в связывание антитела с антигеном, но проявляют различные эффекторные функции, такие как участие антитела в антитело-зависимой клеточной токсичности.

При расщеплении антител папаином получают два идентичных антигенсвязывающих фрагмента, называемых «Fab» фрагментами, в каждом по одному участку связывания антигена, и остаточный «Fc» фрагмент, название которого отражает его способность легко кристаллизоваться. Обработка пепсином дает F(ab')2 фрагмент, который имеет два антигенсвязывающих участка и сохраняет способность к перекрестному связыванию антигена.

«Fv» представляет собой минимальный фрагмент антитела, который содержит полный участок распознавания и связывания антигена. В двухцепочечных частицах Fv эта область содержит димер из вариабельного домена одной тяжелой и одной легкой цепи в тесной нековалентной связи. В одноцепочечных частицах Fv вариабельные домены одной тяжелой и одной легкой цепи могут быть ковалентно связаны гибким пептидным линкером, так что может происходить ассоциация легкой и тяжелой цепи в «димерную» структуру, аналогичную таковой в двухцепочечных частицах Fv. В этой конфигурации три HVR каждого вариабельного домена взаимодействуют для того, чтобы определить участок связывания антигена на поверхности димера VH-VL. Совместно шесть HVR придают антителу специфичность связывания с антигеном. Однако, даже один вариабельный домен (или половина Fv, содержащая только три HVR, специфичных к определенному антигену) обладает способностью распознавать и связывать антиген, несмотря на более низкую аффинность, чем целый сайт связывания.

Fab фрагмент также содержит константный домен легкой цепи и первый константный домен (CH1) тяжелой цепи. Фрагменты Fab' отличаются от фрагментов Fab добавлением нескольких остатков на карбоксильном конце домена CH1 тяжелой цепи, включая один или несколько цистеинов из шарнирной области антитела. В настоящем документе Fab'-SH является обозначением для Fab', в котором остаток(ки) цистеина в константных доменах несут свободную тиоловую группу. F(ab')2 фрагменты антител исходно получали в виде пар фрагментов Fab', которые имеют шарнирные цистеины между ними. Также известно другое химическое связывание фрагментов антител.

«Легким цепям» антител (иммуноглобулинов) от любых видов позвоночных может быть присвоен один из двух четко различаемых типов, называемых κ (каппа) и λ (лямбда), основываясь на аминокислотных последовательностях их константных доменов.

В зависимости от аминокислотной последовательности константного домена их тяжелых цепей, иммуноглобулинам могут быть присвоены различные классы. Существует пять основных классов иммуноглобулинов: IgA, IgD, IgE, IgG и IgM, и некоторые из них дополнительно делятся на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, которые соответствуют различным классам иммуноглобулинов, называют α, δ, ε, γ и μ, соответственно. Структуры субъединиц и трехмерные конфигурации различных классов иммуноглобулинов хорошо известны.

«Фрагменты антител» содержат только часть интактного антитела, где часть предпочтительно сохраняет по меньшей мере одну, предпочтительно большинство или все, функции, обычно ассоциированные с этой частью, когда она присутствует в интактном антителе. Примеры фрагментов антител включают фрагменты Fab, Fab', F(ab')2 и Fv; диатела; линейные антитела; одноцепочечные молекулы антител; и полиспецифические антитела, образованные из фрагментов антител. В одном из вариантов осуществления фрагмент антитела содержит антигенсвязывающий участок интактного антитела и, таким образом, сохраняет способность связывать антиген. В другом варианте осуществления фрагмент антитела, например, содержащий Fc-область, сохраняет по меньшей мере одну из биологических функций, обычно ассоциированных с Fc-областью, когда он присутствует в интактном антителе, такую как связывание FcRn, модуляция времени полужизни антитела, функция АЗКЦ и связывание комплемента. В одном из вариантов осуществления фрагмент антитела представляет собой моновалентное антитело, которое имеет время полужизни in vivo по существу схожее с интактным антителом. Например, такой фрагмент антитела может содержать антигенсвязывающее плечо, связанное с Fc последовательностью, способной придавать фрагменту стабильность in vivo.

Термин «гипервариабельная область», «HVR» или «HV», когда используют в настоящем документе, относится к областям вариабельного домена антитела, которые имеют гипервариабельную последовательность и/или формируют структурно выделяющиеся петли. Как правило, антитела содержат шесть HVR; три в VH (H1, H2, H3) и три в VL (L1, L2, L3). В нативных антителах H3 и L3 проявляют наибольшее разнообразие среди шести HVR и, в частности, полагают, что H3 играет уникальную роль в придании точной специфичности антителам. См., например, Xu et al, Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, NJ, 2003). Действительно, встречающиеся в природе антитела верблюдовых, состоящие только из тяжелой цепи, функциональны и стабильны в отсутствие легкой цепи. См., например, Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al, Nature Struct. Biol. 3:733-736 (1996).

Множество вариантов HVR используется и охвачено в настоящем документе. Определяющие комплементарность области по Kabat (CDR) основаны на вариабельности последовательностей и являются наиболее общеупотребительными (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Вместо этого, Chothia использует местоположение структурных петель (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). HVR в AbM представляют собой компромисс compromise между HVR по Kabat'y и структурными петлями по Chothia, и используются в программном обеспечении для моделирования антител Oxford Molecular AbM. «Контактные» HVR основаны на анализе доступных комплексных кристаллических структур. Остатки из каждого из этих HVR указаны ниже.

Петля Kabat AbM Chothia Контакт
L1 L24-L34 L24-L34 L26-L32 L30-L36
L2 L50-L56 L50-L56 L50-L52 L46-L55
L3 L89-L97 L89-L97 L91-L96 L89-L96
H1 H31-H35B H26-H35B H26-H32 H30-H35B

(Нумерация по Kabat'y)

H1 H31-H35 H26-H35 H26-H32 H30-H35

(Нумерация по Chothia)

H2 H50-H65 H50-H58 H53-H55 H47-H58
H3 H95-H102 H95-H102 H96-H101 H93-H101

HVR могут содержать следующие «расширенные HVR»: 24-36 или 24-34 (L1), 46-56 или 50-56 (L2) и 89-97 или 89-96 (L3) в VL и 26-35 (H1), 50-65 или 49-65 (H2) и 93-102, 94-102 или 95-102 (H3) в VH. Остатки вариабельного домена пронумерованы согласно Kabat et al., выше, для каждого из этих определений.

Остатки «каркасной области» или «FR» представляют собой те остатки вариабельного домена, которые отличаются от остатков гипервариабельной области, как определено в настоящем документе.

«Гуманизированные» формы не принадлежащих человеку (например, мышиных) антител представляют собой химерные антитела, которые содержат минимальную последовательность, полученную из не принадлежащего человеку иммуноглобулина. В одном из вариантов осуществления гуманизированное антитело представляет собой иммуноглобулин человека (реципиентное антитело), в котором остатки из HVR реципиента заменяют на остатки из HVR от не являющихся человеком видов (донорное антитело), таких как мышь, крыса, кролик или не являющийся человеком примат, обладающие желаемой специфичностью, аффинностью и/или емкостью. В некоторых случаях остатки FR иммуноглобулина человека заменяют на соответствующие не принадлежащие человеку остатки. Кроме того, гуманизированные антитела могут содержать остатки, которые не находят в реципиентном антителе или донорном антителе. Эти модификации можно создавать, чтобы дополнительно улучшать эффективность антитела. В целом, гуманизированное антитело должно содержать по существу все из по меньшей мере одного, и типично двух вариабельных доменов, в которых все или по существу все гипервариабельные петли соответствуют таковым в не принадлежащем человеку иммуноглобулине, и все или по существу все FR являются таковыми из последовательности иммуноглобулина человека. Гуманизированное антитело необязательно также будет содержать по меньшей мере часть константной области иммуноглобулина (Fc), типично таковой из иммуноглобулина человека. Более подробно см., например, Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); и Presta, Curr. Op. Struct. Biol. 2:593-596 (1992). Также см., например, Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1: 105-115 (1998); Harris, Biochem. Soc. Transactions 23: 1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994); и патенты США №№ 6982321 и 7087409.

«Антитело человека» представляет собой антитело, которое обладает аминокислотной последовательностью, которая соответствует таковой антитела, продуцируемого человеком и/или которая получена с использованием любых способов получения антител человека, как описано в настоящем документе. Это определение антитела человека, в частности, исключает гуманизированное антитело, которое содержит не принадлежащие человеку антигенсвязывающие остатки. Антитела человека можно получать с использованием различных способов, известных в данной области, включая библиотеки фагового дисплея. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Для получения моноклональных антител человека также доступны способы, описанные в Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al, J. Immunol, 147(1):86-95 (1991). См. также van Dijk and van de Winkel, Curr. Opin. Pharmacol, 5: 368-74 (2001). Антитела человека можно получать посредством введения антигена трансгенному животному, которое модифицировано для того, чтобы продуцировать такие антитела в ответ на антигенный стимул, но эндогенные локусы которого выведены из строя, например, иммунизированной Xenomouse (см., например, патенты США №№ 6075181 и 6150584 касательно технологии XENOMOUSE™). Также см., например, Li et al., Proc. Natl Acad. Sci. USA, 103:3557-3562 (2006) касательно антител человека, создаваемых с помощью технологии гибридомных B-клеток человека.

Термин «моноклональное антитело», как используют в настоящем документе, относится к антителу, полученному из популяции по существу гомогенных антител, т.е., отдельные антитела, содержащиеся в популяции, идентичны, за исключением возможных мутаций, например, встречающихся в природе мутаций, которые могут присутствовать в незначительных количествах. Таким образом, модификатор «моноклональное» указывает на характер антитела, которое не является смесью отдельных антител. В определенных вариантах осуществления такое моноклональное антитело типично включает антитело, содержащее полипептидную последовательность, которая связывает мишень, где связывающая мишень полипептидная последовательность получена посредством процесса, который включает отбор одной связывающей мишень полипептидной последовательности из множества полипептидных последовательностей. Например, процесс отбора может представлять собой отбор уникального клона из множества клонов, такого как пул гибридомных клонов, фаговых клонов или клонов рекомбинантной ДНК. Следует понимать, что выбранную связывающую мишень последовательность можно дополнительно изменить, например, для улучшения аффинности к мишени, для гуманизации связывающей мишень последовательности, для улучшения ее получения в клеточной культуре, для снижения ее иммуногенности in vivo, для создания полиспецифического антитела и т.д., и что антитело, содержащее измененную связывающую мишень последовательность, также представляет собой моноклональное антитело по данному изобретению. В отличие от препаратов поликлональных антител, которые типично содержат различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело в препарате моноклонального антитела направлено против одной детерминанты на антигене. В дополнение к их специфичности, препараты моноклональных антител полезны тем, что типично они не загрязнены другими иммуноглобулинами.

Определение «моноклональный» указывает на характер антитела, которое получено из по существу гомогенной популяции антител, и его не следует толковать в качестве требования получать антитело каким-либо конкретным способом. Например, моноклональные антитела, подлежащие использованию в соответствии с настоящим изобретением, можно создавать множеством способов, включая, например, гибридомный способ (например, Kohler and Milstein, Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14 (3): 253-260 (1995), Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al, in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981)), способы рекомбинантной ДНК (см., например, патент США № 4816567), технологии фагового дисплея (см., например, Clackson et al., Nature, 352: 624-628 (1991); Marks et al, J. Mol. Biol. 222: 581-597 (1992); Sidhu et al, J. Mol. Biol. 338(2): 299-310 (2004); Lee et al, J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); и Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004), и технологии получения антител человека или похожих на антитела человека у животных, которые имеют части или все локусы иммуноглобулинов человека или гены, кодирующие последовательности иммуноглобулинов человека (см., например, WO 1998/24893; WO 1996/34096; WO 1996/33735; WO 1991/10741; Jakobovits et al., Proc. Natl. Acad. Sci. USA 90: 2551 (1993); Jakobovits et al, Nature 362: 255-258 (1993); Bruggemann et al, Year in Immunol. 7:33 (1993); патенты США №№ 5545807; 5545806; 5569825; 5625126; 5633425 и 5661016; Marks et al, Bio/Technology 10: 779-783 (1992); Lonberg et al, Nature 368: 856-859 (1994); Morrison, Nature 368: 812-813 (1994); Fishwild et al, Nature Biotechnol. 14: 845-851 (1996); Neuberger, Nature Biotechnol. 14: 826 (1996); и Lonberg and Huszar, Intern. Rev. Immunol. 13: 65-93 (1995).

Моноклональные антитела в настоящем документе в частности включают «химерные» антитела, в которых часть тяжелой и/или легкой цепи идентична или гомологична соответствующим последовательностям в антителах, полученных от конкретного вида или принадлежащих к конкретному классу или подклассу антител, тогда как остальная часть цепи(ей) идентична или гомологична соответствующим последовательностям в антителах, полученных от другого вида или принадлежащих другому классу или подклассу антитела, а также фрагменты таких антител при условии, что они проявляют желательную биологическую активность (см., например, патент США № 4816567; и Morrison et al, Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). Химерные антитела включают антитела PRIMATIZED®, где антигенсвязывающую область антитела получают из антитела, полученного, например, посредством иммунизации обезьян макаков антигеном, представляющим интерес.

Термин «полиспецифическое антитело» используют в самом широком смысле, и в частности он покрывает антитело, которое обладает полиэпитопной специфичностью. Такие полиспецифические антитела включают в качестве неограничивающих примеров антитело, содержащее вариабельный домен тяжелой цепи (VH) и вариабельный домен легкой цепи (VL), где блок VHVL обладает полиэпитопной специфичностью, антитела, обладающие двумя или более доменами VL и VH, причем каждый блок VHVL связывается с отличающимся эпитопом, антитела, обладающие двумя или более отдельными вариабельными доменами, причем каждый отдельный вариабельный домен связывается с отличающимся эпитопом, полноразмерные антитела, фрагменты антител, такие как Fab, Fv, dsFv, scFv, диатела, биспецифические диатела и триатела и фрагменты антител, которые связаны ковалентно или нековалентно. Согласно одному из вариантов осуществления, полиспецифическое антитело представляет собой антитело IgG, которое связывается с каждым эпитопом с аффинностью от 5 мкМ до 0,001 пМ, от 3 мкМ до 0,001 пМ, от 1 мкМ до 0,001 пМ, от 0,5 мкМ до 0,001 пМ или от 0,1 мкМ до 0,001 пМ.

«Полиэпитопная специфичность» относится к способности специфически связываться с двумя или более различными эпитопами на одном и том же или различных антигенах. Например, «биспецифическая», как используют в настоящем документе, относится к способности связывать два различных эпитопа. «Моноспецифический» относится к способности связывать только один эпитоп.

Выражение «однодоменные антитела» (sdAb) или «антитела с одним вариабельным доменом» (SVD) как правило относится к антителам, у которых один вариабельный домен (VH или VL) может обеспечивать связывание антигена. Другими словами, один вариабельный домен не должен взаимодействовать с другим вариабельным доменом для того, чтобы распознать антиген-мишень. Примеры однодоменных антител включают те, что получены от верблюдовых (ламы и верблюды) и хрящевых рыб (например, акул-нянек), и те, что получены рекомбинантными способами из антител человека и мыши (Nature (1989) 341:544-546; Dev Comp Immunol (2006) 30:43-56; Trend Biochem Sci (2001) 26:230-235; Trends Biotechnol (2003):21:484-490; WO 2005/035572; WO 03/035694; Febs Lett (1994) 339:285-290; WO 00/29004; WO 02/051870).

«Одноцепочечные Fv» или «scFv» фрагменты антител содержат домены VH и VL антитела, где эти домены присутствуют в одной полипептидной цепи. Как правило, полипептид scFv дополнительно содержит полипептидный линкер между доменами VH и VL, который позволяет scFv формировать желаемую структуру для связывания антигена. Обзор по scFv см. В Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).

«Антиген» представляет собой предварительно определяемый антиген, с которым антитело может избирательно связываться. Антиген-мишень может представлять собой полипептид, углевод, нуклеиновую кислоту, липид, гаптен или другое встречающееся в природе или синтетическое соединение.

Термин «диатела» относится к небольшим фрагментам антител с двумя участками связывания антигена, эти фрагменты содержат вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) в одной и той же полипептидной цепи (VH-VL). Используя линкер, который слишком короток, чтобы позволить образование пары между двумя доменами одной и той же цепи, домены принуждают к образованию пар с комплементарными доменами другой цепи и созданию двух участков связывания антигена. Диатела описаны более полно, например, в EP 404097; WO 93/11161; и Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993). Триатела и тетратела также описаны в Hudson et al, Nat. Med. 9: 129-134 (2003).

Термины «нумерация остатков вариабельного домена по Kabat'y» или «нумерация положений аминокислот по Kabat'y» и их вариации относятся к системе нумерации, используемой для вариабельных доменов тяжелых цепей или вариабельных доменов легких цепей в обобщенных антителах в Kabat et al., выше. При использовании этой системы нумерации фактическая линейная аминокислотная последовательность может содержать меньше или больше аминокислот, соответствующих укорочению или вставке в FR или HVR вариабельного домена. Например, вариабельный домен тяжелой цепи может содержать вставку из одной аминокислоты (остаток 52a согласно Kabat'y) после остатка 52 в H2 и вставленные остатки (например, остатки 82a, 82b, и 82c и т.д. согласно Kabat'y) после остатка 82 FR тяжелой цепи. Нумерацию остатков по Kabat'y можно определять для заданного антитела посредством выравнивания в областях гомологии последовательности антитела со «стандартной» пронумерованной по Kabat'y последовательностью.

Систему нумерации по Kabat'y, как правило, используют, когда говорят об остатке в вариабельном домене (приблизительно остатки 1-107 легкой цепи и остатки 1-113 тяжелой цепи) (например, Kabat et al, Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). «Система нумерации EU» или «индекс EU», как правило, используют, когда говорят об остатке в константной области тяжелой цепи иммуноглобулина (например, индекс EU приведен в Kabat et al., выше). «Индекс EU по Kabat'y» относится к нумерации остатков антитела EU IgG1 человека. Если в настоящем документе не установлено иное, упоминания номеров остатков в вариабельном домене антитела обозначают нумерацию остатков с помощью системы нумерации по Kabat'y. Если в настоящем документе не установлено иное, упоминания номеров остатков в константном домене антитела обозначает нумерацию остатков с помощью системы нумерации EU (например, см. предварительную заявку США № 60/640323, фиг. про нумерацию по EU).

«Блокирующее» антитело или «антитело-антагонист» представляет собой антитело, которое ингибирует или снижает биологическую активность антигена, который оно связывает. Определенные блокирующие антитела или антитела-антагонисты по существу или полностью ингибируют биологическую активность антигена.

Термин «по существу схожий» или «по существу тот же», как используют в настоящем документе, обозначает достаточно высокую степень сходства между двумя численными значениями (например, одно связано с антителом по изобретению, а другое связано с эталоном/антителом для сравнения), так что специалист в данной области сочтет разницу между этими двумя значениями как обладающую небольшой или нулевой биологической и/или статистической значимостью в рамках контекста биологической характеристики, измеряемой с помощью указанных значений {например, значения Kd). Разница между указанным двумя значениями составляет, например, менее чем приблизительно 50%, менее чем приблизительно 40%, менее чем приблизительно 30%, менее чем приблизительно 20% и/или менее чем приблизительно 10% в качестве функции эталонного значения/значения для сравнения.

Фраза «по существу сниженный» или «по существу отличающийся», как используют в настоящем документе, обозначает достаточно высокую степень различия между двумя численными значениями (как правило, одно связано с молекулой, а другое связано с эталоном/молекулой для сравнения), так что специалист в данной области сочтет различия между двумя значениями как статистически значимые в рамках контекста биологической характеристики, измеряемой посредством указанных значений (например, значений Kd). Разность между указанными двумя значениями, например, больше чем приблизительно 10%, больше чем приблизительно 20%, больше чем приблизительно 30%, больше чем приблизительно 40% и/или больше чем приблизительно 50% в качестве функции значения для эталона/молекулы для сравнения.

«Эффекторные функции» антитела относятся к тем биологическим активностям, которые приписывают Fc-области (Fc-области с нативной последовательностью или Fc-области с вариантной аминокислотной последовательностью) антитела, и меняются с изотипом антитела. Примеры эффекторных функций антитела включают: связывание C1q и комплемент-зависимая цитотоксичность (КЗЦ); связывание рецептора Fc; антителозависимая клеточная цитотоксичность (АЗКЦ); фагоцитоз; понижающая регуляция рецепторов клеточной поверхности (например, B-клеточного рецептора); и активация B-клеток.

Термин «Fc-область» в настоящем документе используют, чтобы определить C-концевую область тяжелой цепи иммуноглобулина, включая нативную последовательность Fc-области и вариантные Fc-области. Несмотря на то, что границы Fc-области тяжелой цепи иммуноглобулина могут варьировать, обычно задают, что Fc-область тяжелой цепи IgG человека расположена от аминокислотного остатка в положении Cys226 или от Pro230 до ее карбоксильного конца. C-концевой лизин (остаток 447 согласно системе нумерации EU) Fc-области может быть удален, например, во время получения или очистки антитела, или с помощью рекомбинантно сконструированной нуклеиновой кислоты, кодирующей тяжелую цепь антитела. Соответственно, композиция интактного антитела может содержать популяции антител, у которых удалены все остатки K447, популяции антител, у которых не удалены остатки K447, и популяции антител, содержащих смесь антител с остатком K447 и без него.

«Функциональная Fc-область» обладает «эффекторной функцией» нативной последовательности Fc-область. Образцовые «эффекторные функции» включают связывание C1q; КЗЦ; связывание рецептора Fc; АЗКЦ; фагоцитоз; понижающую регуляцию рецепторов клеточной поверхности (например, B-клеточного рецептора; BCR) и т.д. Для таких эффекторных функций, как правило, нужно сочетание Fc-области и связывающего домена (например, вариабельного домена антитела), и их можно оценивать с использованием различных анализов, как раскрыто, например, в определениях в настоящем документе.

«Fc-область с нативной последовательностью» содержит аминокислотную последовательность, идентичную аминокислотной последовательности Fc-области, найденной в природе. Fc-области человека с нативной последовательностью включают Fc-область IgG1 человека с нативной последовательностью (аллотипы не A и A); Fc-область IgG2 человека с нативной последовательностью; Fc-область IgG3 человека с нативной последовательностью; и Fc-область IgG4 человека с нативной последовательностью, а также их встречающиеся в природе варианты.

«Вариантная Fc-область» содержит аминокислотную последовательность, которая отличается от таковой у Fc-области с нативной последовательностью по меньшей мере на одну модификацию аминокислоты, предпочтительно на одну или несколько замен аминокислот. Предпочтительно, вариантная Fc-область имеет по меньшей мере одну замена аминокислоты по сравнению с Fc-область с нативной последовательностью или с Fc-областью родительского полипептида, например, приблизительно от одной приблизительно до десяти замен аминокислот, и предпочтительно приблизительно от одной приблизительно до пяти замен аминокислот в Fc-области с нативной последовательностью или в Fc-области родительского полипептида. Вариантная Fc-область в настоящем документе предпочтительно должна обладать по меньшей мере приблизительно 80% гомологией с Fc-областью с нативной последовательностью и/или с Fc-областью родительского полипептида и наиболее предпочтительно по меньшей мере приблизительно 90% гомологией с ними, более предпочтительно по меньшей мере приблизительно 95% гомологией с ними.

«Рецептор Fc» или «FcR» обозначает рецептор, который связывается с Fc-областью антитела. В некоторых вариантах осуществления FcR представляет собой нативный FcR человека. В некоторых вариантах осуществления FcR представляет собой рецептор, который связывает антитело IgG (γ-рецептор) и включает подклассы рецепторов FcγRI, FcγRII и FcγRIII, включая аллельные варианты и формы этих рецепторов после альтернативного сплайсинга. FcγRII рецепторы включают FcγRIIA («активирующий рецептор») и FcγRIIB («ингибирующий рецептор»), которые обладают схожими аминокислотными последовательностями, различающимися в основном своими цитоплазматическими доменами. Активирующий рецептор FcγRIIA содержит иммунорецепторный тирозиновый активирующий мотив (ITAM) в своем цитоплазматическом домене. Ингибирующий рецептор FcγRIIB содержит иммунорецепторный тирозиновый ингибирующий мотив (ITIM) в своем цитоплазматическом домене, (см., например, Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). Обзор FcR см., например, в Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al, Immunomethods 4:25-34 (1994); и de Haas et al, J. Lab. Clin. Med. 126:330-41 (1995). В настоящем документе другие FcR, включая те, что будут идентифицированы в будущем, охвачены термином «FcR».

Термин «рецептор Fc» или «FcR» также включает неонатальный рецептор, FcRn, который отвечает за перенос материнских IgG в плод (Guyer et al, J. Immunol. 117:587 (1976) и Kim et al, J. Immunol. 24:249 (1994)) и регуляцию гомеостаза иммуноглобулинов. Известны способы измерения связывания с FcRn (см., например, Ghetie and Ward., Immunol. Today 18(12):592-598 (1997); Ghetie et al, Nature Biotechnology, 15(7):637-640 (1997); Hinton et al., J. Biol. Chem. 279(8):6213-6216 (2004); WO 2004/92219 (Hinton et al).

Связывание с FcRn человека in vivo и время полужизни в сыворотке для полипептидов, связывающих с высокой аффинностью FcRn человека, можно анализировать, например, на трансгенных мышах или трансфицированных клеточных линиях человека, экспрессирующих FcRn человека, или на приматах, которым вводят полипептиды с вариантной Fc-областью. В публикации PCT WO 2000/42072 (Presta) и заявке США № 12/577967 (Lowman) описаны варианты антител с усиленным или ослабленным связыванием с FcR. Также см., например, Shields et al. J. Biol. Chem. 9(2):6591-6604 (2001).

«Эффекторные клетки человека» представляют собой лейкоциты, которые экспрессируют один или несколько FcR и выполняют эффекторные функции. В определенных вариантах осуществления клетки экспрессируют по меньшей мере FcγRIII и выполняют эффекторную функцию АЗКЦ. Примеры лейкоцитов человека, которые опосредуют АЗКЦ, включают мононуклеарные клетки периферической крови (PBMC), естественные киллерные (NK) клетки, моноциты, цитотоксические T-клетки и нейтрофилы. Эффекторные клетки можно выделять из нативного источника, например, из крови.

«Антителозависимая клеточная цитотоксичность» или «АЗКЦ» относится к форме цитотоксичности, в которой секретируемые Ig, связанные с рецепторами Fc (FcR), присутствующими на определенных цитотоксических клетках (например, NK клетках, нейтрофилах и макрофагах), позволяют этим цитотоксическим эффекторным клеткам специфически связываться с несущей антиген клеткой-мишенью и впоследствии убивать клетку-мишень цитотоксинами. Самые ранние клетки, опосредующие АЗКЦ, NK клетки, экспрессируют только FcγRIII, тогда как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Сводка об экспрессии FcR на гематопоэтических клетках приведена в таблице 3 на странице 464 в Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). Чтобы оценить активность АЗКЦ для молекулы, представляющей интерес, можно осуществлять анализ АЗКЦ in vitro, такой как тот, что описан в патентах США №№ 5500362 или 5821337 или патенте США № 6737056 (Presta). Эффективные эффекторные клетки для таких анализов включают PBMC и NK клетки. Альтернативно, или дополнительно, активность АЗКЦ для молекулы, представляющей интерес, можно оценивать in vivo, например, в модели на животном, такой как та, что раскрыта в Clynes et al. PNAS (USA) 95:652-656 (1998).

«Комплемент-зависимая цитотоксичность» или «КЗЦ» относится к лизису клетки-мишени в присутствие комплемента. Инициация активации классического пути комплемента происходит посредством связывания первого компонента системы комплемента (C1q) с антителами (подходящего подкласса), которые связаны с их когнатным антигеном. Чтобы оценить активацию комплемента, можно осуществлять анализ КЗЦ, например, как описано в Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996). Варианты полипептидов с измененными аминокислотными последовательностями Fc-области (полипептиды с вариантной Fc-областью) и повышенной или пониженной способностью к связыванию с C1q описаны, например, в патенте США № 6194551 B1 и WO 1999/51642. Также см., например, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

Термин «содержащее Fc-область антитело» относится к антителу, которое содержит Fc-область. C-концевой лизин (остаток 447 согласно системе нумерации EU) Fc-области может быть удален, например, во время очистки антитела или посредством рекомбинантного конструирования нуклеиновой кислоты, кодирующей антитело. Соответственно, композиция, содержащая антитело, обладающее Fc-областью, в соответствии с данным изобретением может содержать антитело с K447, со всеми удаленными K447 или смесь антител с остатком K447 и без него.

«Акцепторная каркасная область человека» для целей настоящего документа представляет собой каркасную область, содержащую аминокислотную последовательность каркасной области VL или VH, полученную из каркасной области иммуноглобулина человека или из консенсусной каркасной области человека. Акцепторная каркасная область человека, «полученная из» каркасной области иммуноглобулина человека или консенсусной каркасной области человека, может содержать ту же ее аминокислотную последовательность или может содержать предварительно существующие изменения аминокислотной последовательности. Когда предварительно существующие изменения аминокислот присутствуют, предпочтительно присутствуют не более 5 и предпочтительно 4 или менее или 3 или менее предварительно существующих изменений аминокислот. Когда предварительно существующие изменения аминокислот присутствуют в VH, предпочтительно эти изменения имеют место только в трех, двух или одном из положений 71H, 73H и 78H; например, аминокислотные остатки в этих положениях могут представлять собой 71A, 73T и/или 78A. В одном из вариантов осуществления акцепторная каркасная область VL человека идентична последовательностью каркасной последовательности VL иммуноглобулина человека или консенсусной каркасной последовательности человека.

«Консенсусная каркасная область человека» представляет собой каркасную область, которая представляет чаще всего встречающийся аминокислотный остаток в отборе последовательности каркасной области VL или VH иммуноглобулина человека. Как правило, последовательности VL или VH иммуноглобулина человека выбирают из подгруппы последовательностей вариабельного домена. Как правило, подгруппа последовательностей представляет собой подгруппу, как в Kabat et al. В одном из вариантов осуществления для VL подгруппа представляет собой IV подгруппу κ, как в Kabat et al. В одном из вариантов осуществления для VH подгруппа представляет собой I подгруппу, как в Kabat et al. «Консенсусная каркасная область I подгруппы VH» содержит консенсусную последовательность, полученную из аминокислотных последовательностей в I подгруппе VH как у Kabat et al.

«Консенсусная каркасная область I подгруппы VH» содержит консенсусную последовательность, полученную из аминокислотных последовательностей в I подгруппе VH, как у Kabat et al.

«Консенсусная каркасная область III подгруппы VH» содержит консенсусную последовательность, полученную из аминокислотных последовательностей в III подгруппе VH, как у Kabat et al.

«Консенсусная каркасная область IV подгруппы VL» содержит консенсусную последовательность, полученную из аминокислотных последовательностей в IV подгруппе κ VL, как у Kabat et al.

«Консенсусная каркасная область I подгруппы VL» содержит консенсусную последовательность, полученную из аминокислотных последовательностей в I подгруппе κ VL, как у Kabat et al.

«Лекарственное средство» представляет собой активное лекарственное средство для лечения рассматриваемого нарушения или его симптомов или побочных эффектов.

«Нарушение» или «заболевание» представляет собой любое состояние, которое получает пользу от лечения с использованием вещества/молекулы или способа по изобретению. Оно включает хронические и острые нарушения или заболевания, включая те патологические состояния, которые предрасполагают млекопитающее к рассматриваемому нарушению. Неограничивающие примеры нарушений, подлежащих лечению, в настоящем документе включают злокачественные и доброкачественные опухоли; карциному, бластому и саркому.

«Патология» заболевания включает все феномены, которые угрожают здоровью пациента. Для рака это включает, без ограничения, аномальный или неконтролируемый клеточный рост, метастазирование, препятствие нормальному функционированию соседних клеток, высвобождение цитокинов или других продуктов секреции на аномальных уровнях, супрессию или обострение воспалительного или иммунологического ответа и т.д.

Термины «нарушение пролиферации клеток» и «пролиферативное нарушение» относятся к нарушениям, которые ассоциированы с некоторой степенью аномальной клеточной пролиферации. В одном из вариантов осуществления нарушение пролиферации клеток представляет собой рак.

«Опухоль», как используют в настоящем документе, относится к любому неопластическому клеточному росту и пролиферации, злокачественному или доброкачественному, и предшествующим злокачественной опухоли и злокачественным клеткам и тканям. Термины «рак», «злокачественный», «нарушение пролиферации клеток», «пролиферативное нарушение» и «опухоль» не являются взаимоисключающими как изложено в настоящем документе.

Термины «рак» и «злокачественный» относятся к или описывают физиологическое состояние у млекопитающих, которое типично характеризуется нерегулируемым клеточным ростом/пролиферацией. Примеры рака включают в качестве неограничивающих примеров, карциному, лимфому, бластому, саркому и лейкоз. Более конкретные примеры таких видов рака включают плоскоклеточный рак, мелкоклеточный рак легких, рак гипофиза, рак пищевода, астроцитому, саркому мягких тканей, немелкоклеточный рак легких, аденокарциному легких, плоскоклеточную карциному легких, рак брюшной полости, гепатоцеллюлярный рак, желудочно-кишечный рак, рак поджелудочной железы, глиобластому, рак шейки матки, рак яичников, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак ободочной кишки, рак толстой кишки, карциному эндометрия или матки, карциному слюнной железы, рак почки, рак почки, рак печени, рак предстательной железы, рак женских наружных половых органов, рак щитовидной железы, печеночную карциному, рак головного мозга, рак эндометрия, рак яичка, холангиокарциному, карциному желчного пузыря, рак желудка, меланому и различные типы рака головы и шеи.

Дисрегуляция ангиогенеза может вести ко многим нарушениям, которые можно лечить композициями и способами по изобретению. Эти нарушения включают как ненеопластические, так и неопластические состояния. Неоплазии включают описанное выше, но не ограничены этим.

Ненеопластические состояния, поддающиеся лечению антителами и фрагментами антител по изобретению, включают в качестве неограничивающих примеров, например, нежелательную или аберрантную гипертрофию, доброкачественную гипертрофию предстательной железы, боль (острую и хроническую), включая воспалительную боль, артрит, ревматоидный артрит (РА), псориатический артрит, нейродегенеративные заболевания (например, болезнь Альцгеймера, СПИД-дименцию, болезнь Паркинсона, амиотрофический боковой склероз, пигментную дистрофию сетчатки, спинальную мышечную атрофию и дегенерацию мозжечка), аутоиммунное заболевание, псориаз, псориатические бляшки, саркоидоз, атеросклероз, атеросклеротические бляшки, тиреоидит Хашимото, ангиогенные нарушения, заболевания глаз, такие как синдром предполагаемого гистоплазмоза глаз, почечная васкуляризация, диабетическая и другие пролиферативные ретинопатии, включая ретинопатию недоношенных, диабетическую нефропатию, ретролентальную фиброплазию, неоваскулярную глаукому, возрастную дегенерацию желтого пятна, диабетический отек желтого пятна, неоваскуляризацию роговицы, неоваскуляризацию трансплантата роговицы, отторжение трансплантата роговицы, неоваскуляризацию сетчатки/собственно сосудистой оболочки глаза, неоваскуляризацию угла (рубеоз), неоваскулярное заболевание глаз, сосудистое заболевание, состояния, в которые вовлечена аномальная пролиферация сосудистых эпителиальных клеток, сосудистый рестеноз, синдром Гийена-Барре, полипы, такие как полипы ободочной кишки, семейный аденоматозный полипоз, полипы в носу или полипы желудочно-кишечного тракта, язвы в желудочно-кишечном тракте, детский гипертрофический стеноз привратника желудка, мочевой обструктивный синдром, болезнь Менетрие, секретирующие аденомы или синдром потери белка, фиброаденому, респираторное заболевание, холецистит, нейрофиброматоз, артериовенозные мальформации (АВМ), менингиому, гемангиому, ангиофиброму, гиперплазии щитовидной железы (включая базедову болезнь), трансплантацию роговицы и другой ткани, воспалительные заболевания, хроническое воспаление, воспаление легких, острое повреждение легких/РДСВ, сепсис, хроническое окклюзионное легочное заболевание, первичную легочную гипертензию, злокачественную легочную экссудацию, атерому, отек после ожогов, травму, облучение, инсульт, гипоксию или ишемию, отек от инфаркта миокарда, ишемическое повреждение, повреждение после мозгового ишемического явления, отек мозга (например, ассоциированный с острым инсультом/закрытым повреждением/травмой головы), тромб, обусловленный агрегацией тромбоцитов, фиброзные или отечные заболевания, такие как цирроз печени, фиброз легких, саркоидоз, тиреоидит, системный синдром повышенной вязкости, синовиальное воспаление, образование паннуса при РА, оссификаты при миозите, гипертрофический остеогенез, ассоциированные с костями патологии, такие как остеоартрит, рахит и остеопороз, рефракторный асцит, воспаление костей или суставов, миелодиспластический синдром, апластическая анемия, почки или печень; заболевание опосредованной T-клетками гиперчувствительности, болезнь Педжета, поликистозная болезнь почек, заболевания, при которых жидкость выходит в третье пространство (панкреатит, компартмент-синдром, ожоги, заболевание кишечника), хроническое воспаление, такое как IBD (болезнь Крона и язвенный колит), почечные нарушения, отторжение аллотрансплантата почки, реакция «трансплантат против хозяина» или отторжение трансплантата, воспалительное заболевание кишечника, острые и хронические нефропатии (включая пролиферативный гломерулонефрит и вызванное диабетом заболевание почек), нефротический синдром, нежелательный или аберрантный рост тканевой массы (незлокачественная опухоль), ожирение, рост массы жировой ткани, гемофилическая артропатия, гипертрофические рубцы, ингибирование роста волос, синдром Рандю-Вебера-Ослера, пиогенную гранулему, ретролентальные фиброплазии, склеродермию, трахому, сращения сосудов, синовит, реакцию гиперчувствительности кожи, нарушения кожи, включая псориаз и дерматит, экзему, солнечную геродермию (например, вызванную УФ-облучением кожи человека), образование гипертрофических шрамов, репродуктивные состояния, такие как эндометриоз, синдром гиперстимуляции яичников, поликистозное заболевание яичников, предэклампсию, дисфункциональное маточное кровотечение или менометроррагию, фиброид матки, преждевременные роды, асцит, перикардиальный выпот (например, ассоциированный с перикардитом), плевральный выпот, эндотоксический шок и грибковую инфекцию, определенные микробные инфекции, включая микробных патогенов, выбранных из аденовируса, хантавирусов, Borrelia burgdorferi, Yersinia spp., Bordetella pertussis, и психиатрические нарушения (например, шизофрению, биполярную депрессию, аутизм и синдром дефицита внимания).

Термин «предзлокачественный» относится к состоянию или росту, который типично предшествует или развивается в рак. «Предзлокачественный» рост будут иметь клетки, которые характеризуются аномальной регуляцией клеточного цикла, пролиферацией или дифференциацией, которые можно определять с помощью маркеров регуляции клеточного цикла, клеточной пролиферации или дифференциации.

Под «дисплазией» понимают любой аномальный рост или развитие ткани, органа или клеток. В определенных вариантах осуществления дисплазия имеет высокую степень или является предзлокачественной.

Под «метастазированием» понимают распространение рака из его первичной локализации в другие места в организме. Клетки рака могут отрываться от первичной опухоли, проникать в лимфатические и кровеносные сосуды, циркулировать по кровотоку и расти в отдаленном очаге (метастазировать) в нормальных тканях где-либо еще в организме. Метастазирование может быть локальным или отдаленным. Метастазирование представляет собой последовательный процесс, зависящий от отрыва опухолевых клеток от первичной опухоли, перемещения по кровотоку или лимфатической системе и остановки в отдаленном месте. В новом месте клетки создают кровоснабжение и могут расти для формирования массы, опасной для жизни. В определенных вариантах осуществления термин «метастатическая опухоль» относится к опухоли, которая способна к метастазированию, но еще не метастазировала в ткани или органы в другой части организма. В определенных вариантах осуществления термин «метастатическая опухоль» относится к опухоли, которая метастазировала в ткани или органы в другой части организма.

Как стимулирующие, так и ингибирующие молекулярные пути в опухолевой клетке регулируют ее поведение, и также имеют значение взаимодействия между опухолевыми клетками и клетками организма-хозяина в отдаленном месте.

Под «неметастатической» понимают злокачественную опухоль, которая является доброкачественной или которая остается в первичной локализации и не проникла в систему лимфатических или кровеносных сосудов или в ткани, отличные от первичной локализации. Как правило, неметастатическая злокачественная опухоль представляет собой любой рак, который представляет собой рак 0, I или II стадии и иногда рак III стадии.

«Предметастатический орган» или «предметастатическая ткань», как используют в настоящем документе, относится к органу или ткани, в которой не обнаружены клетки рака из первичной опухоли или из другой части организма. В определенных вариантах осуществления предметастатический орган или предметастатическая ткань, как используют в настоящем документе, относится к органу или ткани, которые находятся в фазе, предшествующей распространению клеток рака из первичной опухоли или из другой части организма в этот орган или ткань. Примеры предметастатического органа или предметастатической ткани включают, но без ограничения, легкие, печень, головной мозг, яичник, кость и костный мозг.

Под «первичной опухолью» или «первичным раком» понимают исходный рак, но не метастатическое повреждение, расположенное в другой ткани, органе или местоположении в организме субъекта.

«Метастатический орган» или «метастатическую ткань» используют в самом широком смысле, и они относятся к органу или ткани, в которые распространились клетки рака из первичной опухоли или клетки рака из другой части организма. Примеры метастатического органа и метастатической ткани включают, но без ограничения, легкие, печень, головной мозг, яичник, кость и костный мозг.

«Рецидив рака» в настоящем документе относится к возвращению рака после лечения и включает возвращение рака в первичный орган, а также отдаленный рецидив, где рак возвращается за пределы первичного органа.

Под «опухолевой массой» понимают число клеток рака, размер опухоли или количество рака в организме. Опухолевую массу также обозначают как опухолевым грузом.

Под «числом опухолей» понимают число опухолей.

Как используют в настоящем документе, «лечение» относится к клиническому вмешательству в попытке изменить естественный курс индивидуума или клетки, подлежащей лечению, и его можно осуществлять или для профилактики или во время течения клинической патологии. Желаемые эффекты лечения включают предотвращение возникновения или рецидивов заболевания, облегчение симптомов, уменьшение любых прямых или опосредованных патологических следствий заболевания, снижение скорости развития заболевания, улучшение или облегчение состояния заболевания и ремиссию или улучшенный прогноз. В некоторых вариантах осуществления антитела по изобретению используют для задержки развития заболевания или нарушения.

Термин «антинеопластическая композиция» относится к композиции, которую можно использовать для лечения рака и которая содержит по меньшей мере одно активное терапевтическое средство, например, «средство против рака». Примеры терапевтических средств (например, средства против рака) включают, но без ограничения, например, химиотерапевтические средства, ингибирующие рост средства, цитотоксические средства, средства, используемые в лучевой терапии, антиангиогенные средства, апоптотические средства, средства против тубулина и другие средства для лечения рака, такие как антитела против HER-2, антитела против CD20, антагонист рецептора эпидермального фактора роста (EGFR) (например, ингибитор тирозинкиназы), ингибитор HER1/EGFR (например, эрлотиниб (ТАРЦЕВА®), ингибиторы тромбоцитарного фактора роста (например, Гливек™ (иматиниба мезилат)), ингибитор ЦОГ-2 (например, целекоксиб), интерфероны, цитокины, антагонисты (например, нейтрализующие антитела), которые связываются с одной или несколькими следующими мишенями рецепторами ErbB2, ErbB3, ErbB4, PDGFR-β, BlyS, APRIL, BCMA или VEGF, TRAIL/Apo2 и другие биологически активные и органические химические средства и т.д. Их сочетания также включены в изобретение.

Термин «терапия против рака» или «терапия рака» относится к терапии, которую можно использовать в лечении рака. Примеры терапевтических средств против рака включают, но без ограничения, например, химиотерапевтические средства, ингибирующие рост средства, цитотоксические средства, средства, используемые в лучевой терапии, антиангиогенные средства, апоптотические средства, средства против тубулина и другие средства для лечения рака, такие как антитела против HER-2, антитела против CD20, антагонист рецептора эпидермального фактора роста (EGFR) (например, ингибитор тирозинкиназы), ингибитор HER1/EGFR (например, эрлотиниб (ТАРЦЕВА®), ингибиторы тромбоцитарного фактора роста (например, Гливек® (иматиниба мезилат)), ингибитор ЦОГ-2 (например, целекоксиб), Эрбитукс® (цетуксимаб, имклон), интерфероны, цитокины, антагонисты (например, нейтрализующие антитела), которые связываются с одной или несколькими следующими мишенями рецепторами ErbB2, ErbB3, ErbB4, PDGFR-β, BlyS, APRIL, BCMA или VEGF, TRAIL/Apo2 и другие биологически активными и органическими химическими средствами и т.д. Их сочетания также включены в изобретение.

Под «лучевой терапией» понимают использование направленных γ-лучей или β-лучей, чтобы вызвать достаточное повреждение клетки с тем, чтобы ограничить ее способность нормально функционировать или чтобы полностью разрушить клетку. Следует принимать во внимание, что существует множество путей, известных в данной области, для определения дозы и длительности лечения. Типичное лечение назначают в виде одноразового введения, и типичный диапазон доз составляет от 10 до 200 единиц (Грэй) в сутки.

Термин «VEGF» или «VEGF-A», как используют в настоящем документе, относится к 165-аминокислотному фактору роста клеток эндотелия сосудов человек и родственным 121-, 189- и 206-аминокислотным факторам роста клеток эндотелия сосудов человека, как описано авторами Leung et al. (1989) Science 246: 1306, и Houck et al. (1991) Mol. Endocrin, 5: 1806, вместе с их встречающимися в природе аллельными и процессированными формами. Термин «VEGF» также относится к VEGF от не являющихся человеком видов, таких как мышь, крыса или примат. Иногда VEGF от конкретных видов обозначают такими терминами, как hVEGF для VEGF человека, mVEGF для VEGF мыши и т.д. Термин «VEGF» также используют для обозначения усеченных форм полипептида, содержащего аминокислоты с 8 по 109 или с 1 по 109 из 165-аминокислотного фактора роста клеток эндотелия сосудов человека. Указание на любую такую форму VEGF можно идентифицировать в настоящей заявке, например, с помощью «VEGF (8-109)», «VEGF (1-109)», «VEGF-A109» или «VEGF 165». Положения аминокислот для «усеченного» нативного VEGF пронумерованы, как указано в нативной последовательности VEGF. Например, 17 положение аминокислоты (метионин) в усеченном нативном VEGF также представляет собой 17 положение (метионин) в нативном VEGF. Усеченный нативный VEGF обладает аффинностью связывания с рецепторами KDR и Fit-1, сравнимой с нативным VEGF.

«Антагонист VEGF» относится к молекуле, способной нейтрализовать, блокировать, ингибировать, устранять, снижать или препятствовать активностям VEGF, включая в качестве неограничивающих примеров его связывание с одним или несколькими рецепторами VEGF. Антагонисты VEGF без ограничения включают антитела против VEGF и их антигенсвязывающие фрагменты, рецепторные молекулы и производны, которые специфически связываются с VEGF, тем самым устраняя его связывание с одним или несколькими рецепторами, антитела против рецепторов VEGF, антагонисты рецепторов VEGF, такие как низкомолекулярные ингибиторы тирозинкиназ VEGFR и иммуноадгезины, которые связываются с VEGF, такие как VEGF Trap. Термин «антагонист VEGF», как используют в настоящем документе, в частности включает молекулы, включая антитела, фрагменты антител, другие связывающие полипептиды, пептиды и непептидные низкомолекулярные соединения, которые связываются с VEGF и способны нейтрализовать, блокировать, ингибировать, устранять, снижать или препятствовать активностям VEGF. Таким образом, термин «активности VEGF», в частности, включает опосредованные VEGF биологические активности VEGF.

Термины «биологическая активность» и «биологически активный» в отношении полипептида VEGF или «активности VEGF» относятся к физическим/химическим свойствам и биологическим функциям, ассоциированным с полноразмерным и/или усеченным VEGF. В определенных вариантах осуществления активность VEGF индуцирует и/или стимулирует и/или способствует ангиогенезу. В определенных вариантах осуществления активность VEGF индуцирует и/или стимулирует и/или способствует неоваскуляризации. В определенных вариантах осуществления активность VEGF индуцирует и/или модулирует проницаемость сосудов. В определенных вариантах осуществления активность VEGF индуцирует и/или стимулирует и/или способствует миграцию клеток эндотелия и/или пролиферацию клеток эндотелия.

Нейтрализующие антитела против VEGF подавляют рост различных линий опухолевых клеток человека у голых мышей (Kim et al., Nature 362:841-844 (1993); Warren et al, J. Clin. Invest. 95: 1789-1797 (1995); Borgstrom et al, Cancer Res. 56:4032-4039 (1996); Melnyk et al, Cancer Res. 56:921-924 (1996)), а также ингибируют интраокулярный ангиогенез в моделях ишемических нарушений сетчатки. Adamis et al, Arch. Ophthalmol. 114:66-71 (1996).

Термин «антитело против VEGF» или «антитело, которое связывается с VEGF» относится к антителу, которое способно связывать VEGF с достаточной аффинностью и специфичностью, чтобы антитело можно было использовать в качестве диагностического и/или терапевтического средства в нацеливании на VEGF. Например, антитело против VEGF по изобретению можно использовать в качестве терапевтического средства в нацеливании и препятствовании заболеваниям или состояниям, в которые вовлечена активность VEGF. См., например, патенты США 6582959, 6703020; W098/45332; WO 96/30046; WO 94/10202, WO 2005/044853; EP 0666868B1; патентные заявки США 20030206899, 20030190317, 20030203409, 20050112126, 20050186208, и 20050112126; Popkov et al, Journal of Immunological Methods 288: 149-164 (2004); и WO 2005012359. Выбранное антитело обычно должно обладать достаточно высокой аффинностью связывания с VEGF. Например, антитело может связывать hVEGF со значением Kd от 100 нМ до 1 пМ. Аффинности антител можно определять, например, посредством анализа, основанного на поверхностном плазмонном резонансе (такого как анализ BIAcore, как описано в публикации заявки PCT № WO 2005/012359); твердофазного иммуноферментного анализа (ELISA); и конкурентных анализов (например, RIA). Антитело можно подвергать другим анализам на биологическую активность, например, для того, чтобы оценить его эффективность в качестве терапевтического средства. Такие анализы известны в данной области и зависят от антигена-мишени и предполагаемого использования антитела. Примеры включают анализ ингибирования HUVEC; анализы ингибирования роста опухолевых клеток (например, как описано в WO 89/06692); анализы на антителозависимую клеточную цитотоксичность (АЗКЦ) и комплемент-зависимую цитотоксичность (КЗЦ) (патент США 5500362); и анализы на агонистическую активность или гемопоэз (см. WO 95/27062). Антитело против VEGF обычно не должно связываться ни с другими гомологами VEGF, такими как VEGF-B, VEGF-C, VEGF-D или VEGF-E, ни с другими факторами роста, такими как P1GF, PDGF или bFGF. В одном из вариантов осуществления антитела против VEGF включают моноклональное антитело, которое связывается с тем же эпитопом, что и моноклональное антитело против VEGF A4.6.1, продуцируемое гибридомой ATCC HB 10709; рекомбинантное гуманизированное моноклональное антитело против VEGF (см. Presta et al. (1997) Cancer Res. 57:4593-4599), включая в качестве неограничивающих примеров антитело, известное как «бевацизумаб (BV)», также известное как «rhuMAb VEGF» или «АВАСТИН®». АВАСТИН® в настоящее время является коммерчески доступным. Бевацизумаб содержит мутировавшие каркасные области IgG1 человека и антигенсвязывающие определяющие комплементарность области из антитела мыши A.4.6.1, которое блокирует связывание VEGF человека с его рецепторами. Приблизительно 93% аминокислотной последовательности бевацизумаба, включая бóльшую часть каркасных областей, получают из IgG1 человека, и приблизительно 7% последовательности получают из A4.6.1. Бевацизумаб имеет молекулярную массу приблизительно 149000 Да и гликозилирован. Бевацизумаб и другие гуманизированные антитела против VEGF дополнительно описаны в патенте США № 6884879, который выдан 26 февраля 2005 года. Дополнительные антитела против VEGF включают серии антитела G6 или B20 (например, G6-23, G6-31, B20-4.1), как описано в публикации заявки PCT № WO 2005/012359. О дополнительных предпочтительных антителах см. в патентах США №№ 7060269, 6582959, 6703020; 6054297; W098/45332; WO 96/30046; WO 94/10202; EP 0666868B1; публикациях патентных заявок США №№ 2006009360, 20050186208, 20030206899, 20030190317, 20030203409 и 20050112126; и Popkov et al, Journal of Immunological Methods 288: 149-164 (2004).

Термин «полипептид серии B20», как используют в настоящем документе, относится к полипептиду, включая антитело, которое связывается с VEGF. Полипептид серии B20 включает, но без ограничения, антитела, полученные из последовательности антитела B20, или полученное из B20 антитело, описанные в публикации США № 20060280747, публикации США № 20070141065 и/или публикации США № 20070020267, содержание этих патентных заявок в явной форме включено в настоящий документ в качестве ссылки. В одном из вариантов осуществления полипептид серии B20 представляет собой B20-4.1, как описано в публикации США № 20060280747, публикации США № 20070141065 и/или публикации США № 20070020267. В другом варианте осуществления полипептид серии B20 представляет собой B20-4.1.1, описанный в публикации PCT № WO 2009/073160, полное раскрытие которых в явной форме включено в настоящий документ в качестве ссылки.

Термин «полипептид серии G6», как используют в настоящем документе, относится к полипептиду, включающему антитело, которое связывается с VEGF. Полипептид серии G6 включает, но без ограничения, антитела, полученные из последовательности антитела G6, или полученное из G6 антитело, описанное в публикации США № 20060280747, публикации США № 20070141065 и/или публикации США № 20070020267. Полипептиды серии G6, как описано в публикации США № 20060280747, публикации США № 20070141065 и/или публикации США № 20070020267, включают, но без ограничения, G6-8, G6-23 и G6-31.

«Ангиогенный фактор или средство» представляет собой фактор роста, которые стимулирует развитие кровеносных сосудов, например, способствует ангиогенезу, росту клеток эндотелия, стабильности кровеносных сосудов, и/или васкулогенезу и т.д. Например, ангиогенные факторы включают в качестве неограничивающих примеров, например, VEGF и членов семейства VEGF (VEGF-B, VEGF-C и VEGF-D), P1GF, семейство PDGF, семейство фактора роста фибробластов (FGF), лиганды TIE (ангиопоэтины), эфрины, дельта-подобный лиганд 4 (DLL4), Del-1, факторы роста фибробластов: кислый (aFGF) и основной (bFGF), фоллистатин, гранулоцитарный колониестимулирующий фактор (G-CSF), фактор роста гепатоцитов (HGF)/рассеивающий фактор (SF), интерлейкин-8 (IL-8), лептин, мидкин, нейропилины, плацентарный фактор роста, тромбоцитарный фактор роста клеток эндотелия (PD-ECGF), тромбоцитарный фактор роста, в частности PDGF-BB или PDGFR-β, плейотрофин (PTN), програнулин, пролиферин, трансформирующий фактор роста α (TGF-α), трансформирующий фактор роста β (TGF-β), фактор некроза опухоли α (TNF-α) и т.д. Они также включают факторы, которые ускоряют заживление ран, такие как гормон роста, инсулиноподобный фактор роста-I (IGF-I), VIGF, эпидермальный фактор роста (EGF), CTGF и члены его семейства и TGF-α и TGF-β. См., например, Klagsbrun and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179; Ferrara & Alitalo (1999) Nature Medicine 5(12): 1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (например, в таблице 1 перечислены известные ангиогенные факторы); и, Sato (2003) Int. J. Clin. Oncol. 8:200-206.

«Антиангиогенное средство» или «ингибитор ангиогенеза» относится к низкомолекулярному веществу, полинуклеотиду, полипептиду, выделенному белку, рекомбинантному белку, антителу или их конъюгатам или слитным белкам, которые ингибируют ангиогенез, васкулогенез или нежелательную проницаемость сосудов, непосредственно или опосредованно. Например, антиангиогенное средство представляет собой антитело или другой антагонист для ангиогенного средства, как определено выше, например, антитела к VEGF, антитела к рецепторам VEGF, низкомолекулярные соединения, которые блокируют передачу сигнала рецептора VEGF (например, PTK787/ZK2284, SU6668, СУТЕНТ®/SU11248 (сунитиниб малат), AMG706). Антиангиогенные средства также включают нативные ингибиторы ангиогенеза, например, ангиостатин, эндостатин и т.д. См., например, Klagsbrun and D'Amore, Annu. Rev. Physiol, 53:217-39 (1991); Streit and Detmar, Oncogene, 22:3172-3179 (2003) (например, в таблице 3 описана антиангиогенная терапия при раке); Ferrara & Alitalo, Nature Medicine 5(12): 1359-1364 (1999); Tonini et al, Oncogene, 22:6549-6556 (2003) (например, в таблице 2 перечислены антиангиогенные факторы); и, Sato Int. J. Clin. Oncol, 8:200-206 (2003) (например, в таблице 1 перечислены антиангиогенные средства, используемые в клинических исследованиях). В определенных вариантах осуществления антиангиогенное средство представляет собой средство против VEGF, такое как антитело против VEGF (например, бевацизумаб).

Термин «цитотоксическое средство», как используют в настоящем документе, относится к веществу, которое ингибирует или предотвращает функцию клеток и/или вызывает разрушение клеток. Термин предназначен включать радиоактивные изотопы (например, At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32 и радиоактивные изотопы Lu), химиотерапевтические средства, например, метотрексат, адриамицин, алкалоиды барвинка (винкристин, винбластин, этопозид), доксорубицин, мелфалан, митомицин C, хлорамбуцил, даунорубицин или другие интеркалирующие средства, ферменты и их фрагменты, такие как нуклеолитические ферменты, антибиотики и токсины, такие как низкомолекулярные токсины или ферментативно активные токсины бактериального, грибкового, растительного или животного происхождения, включая их фрагменты и/или варианты, и различные средства против опухолей или против рака, раскрытые ниже. Другие цитотоксические средства описаны ниже. Туморицидное средство вызывает разрушение опухолевых клеток.

«Токсином» является любое вещество, способное оказывать отрицательный эффект на рост или пролиферацию клетки.

«Химиотерапевтическое средство» представляет собой химическое соединение, которое можно использовать в лечении рака. Примеры химиотерапевтических средств включают алкилирующие средства, такие как тиотепа и циклофосфамид (Цитоксан®); алкилсульфонаты, такие как бусульфан, импросульфан и пипосульфан; азиридины, такие как бензодопа, карбоквон, метуредопа и уредопа; этиленимины и метиламеламины, включая алтретамин, триэтиленмеламин, триэтиленфосфорамид, триэтилентиофосфорамид и триметиломеламин; ацетогенины (в частности, буллатацин и буллатацинон); δ-9-тетрагидроканнабинол (дронабинол, Маринол®); β-лапахон; лапахол; колхицины; бетулиновую кислоту; камптотецин (включая синтетический аналог топотекан (Гикамтин®), CPT-11 (иринотекан, Камптосар®), ацетилкамптотецин, скополектин и 9-аминокамптотецин); бриостатин; каллистатин; CC-1065 (включая его синтетические аналоги адозелезин, карзелезин и бизелезин); подофиллотоксин; подофиллиновую кислоту; тенипозид; криптофицины (в частности криптофицин 1 и криптофицин 8); доластатин; дуокармицин (включая синтетические аналоги, KW-2189 и CB1-TM1); элеутеробин; панкратистатин; саркодиктиин; спонгистатин; азотистые иприты, такие как хлорамбуцил, хлорнафазин, хлорфосфамид, эстрамустин, ифосфамид, мехлорэтамин, гидрохлорид оксида мехлорэтамина, мелфалан, новэмбихин, фенестерин, преднимустин, трофосфамид, урамустин; нитрозомочевины, такие как кармустин, хлорзотоцин, фотемустин, ломустин, нимустин и ранимнустин; антибиотики, такие как энедииновые антибиотики (например, калихимицин, в частности, калихимицин γ1I и калихимицин ωI1 (см., например, Nicolaou et al., Angew. Chem Intl. Ed. Engl., 33: 183-186 (1994)); CDP323, пероральный ингибитор α-4 интегрина; динемицин, включая динемицин A; эсперамицин; а также неокарциностатин хромофор и родственные хромопротеиновые хромофорные антибиотики энедиины), аклациномизины, актиномицин, аутрамицин, азасерин, блеомицины, сактиномицин, карабицин, карминомицин, карцинофилин, хромомицины, дактиномицин, даунорубицин, деторубицин, 6-диазо-5-оксо-L-норлейцин, доксорубицин (включая Адриамицин®, морфолинодоксорубицин, цианоморфолинодоксорубицин, 2-пирролино-доксорубицин, инъекционные липосомы с доксорубицином HCl (Доксил®), липосомный доксорубицин TLC D-99 (Миоцет®), пегилированный липосомный доксорубицин (Келикс®) и дезоксидоксорубицин), эпирубицин, эзорубицин, идарубицин, марцелломицин, митомицины, такие как митомицин C, микофеноловая кислота, ногаламицин, оливомицины, пепломицин, порфиромицин, пуромицин, квеламицин, роторубицин, стрептонигрин, стрептозоцин, туберцидин, убенимекс, зиностатин, зорубицин; антиметаболиты, такие как метотрексат, гемцитабин (Гемзар®), пеметрексед (Алимта®); тегафур (Уфторал®), капецитабин (Кселода®), эпотилон и 5-фторурацил (5-FU); аналоги фолиевой кислоты, такие как деноптерин, метотрексат, птероптерин, триметрексат; аналоги пурина, такие как флударабин, 6-меркаптопурин, тиамиприн, тиогуанин; аналоги пиримидина, такие как анцитабин, азацитидин, 6-азауридин, кармофур, цитарабин, дидезоксиуридин, доксифлуридин, эноцитабин, флоксуридин; андрогены, такие как калустерон, дромостанолон пропионат, эпитиостанол, мепитиостан, тестолактон; противоадреналовые средства, такие как аминоглутетимид, митотан, трилостан; компенсатор фолиевой кислоты, такой как фолиновая кислота; ацеглатон; альдофосфамид гликозид; аминолевулиновую кислоту; энилурацил; амсакрин; бестрабуцил; бисантрен; эдатраксат; дефофамин; демеколцин; диазиквон; эфлорнитин; эллиптиний ацетат; эпотилон; этоглуцид; нитрат галлия; гидроксимочевина; лентинан; лонидаинин; майтанзиноиды, такие как майтанзин и ансамитоцины; митогуазон; митоксантрон; мопиданмол; нитраэрин; пентостатин; фенамет; пирарубицин; лозоксантрон; 2-этилгидразид; прокарбазин; полисахаридный комплекс PSK® (JHS Natural Products, Eugene, OR); разоксан; ризоксин; сизофиран; спирогерманий; тенуазоновую кислоту; триазиквон; 2,2',2'-трихлортриэтиламин; трихотецены (в частности, токсин T-2, верракурин A, роридин A и ангуидин); уретан; виндезин (Элдезин®, Филдезин®); дакарбазин; манномустин; митобронитол; митолактол; пипоброман; гацитозин; арабинозид («Ara-C»); тиотепу; таксоид, например, паклитаксел (ТАКСОЛ®), состав паклитаксела в сконструированных из альбумина наночастицах (Абраксан™) и доцетаксел (Таксотер®); хлоранбуцил; 6-тиогуанин; меркаптопурин; метотрексат; платиновые средства, такие как цисплатин, оксалиплатин (например, Элоксатин®) и карбоплатин; алкалоиды барвинка, которые препятствуют полимеризации тубулина при образовании микротрубочек, включая винбластин (Велбан®), винкристин (Онковин®), виндезин (Элдезин®, Филдезин®) и винорелбин (Навельбин®); этопозид (VP- 16); ифосфамид; митоксантрон; лейковорин; новантрон; эдатрексат; дауномицин; аминоптерин; ибандронат; ингибитор топоизомеразы RFS 2000; дифторметилорнитин (DMFO); ретиноиды, такие как ретиноевая кислота, включая бексаротен (Таргретин®); бисфосфонаты, такие как клодронат (например, Бонефос® или Остак®), этидронат (дидрокал®), NE-58095, золедроновая кислота/золедронат (Зомета®), алендронат (Фосамакс®), памидронат (Аредия®), тилудрона (Скелид®) или ризедронат (Актонел®); троксацитабин (1,3-диоксолановый аналог нуклеозида цитозин); антисмысловые олигонуклеотиды, в частности те, которые ингибируют экспрессию генов в путях передачи сигнала, вовлеченных в аберрантную клеточную пролиферацию, таких как, например, PKC-α, Raf, H-Ras и рецептор эпидермального фактора роста (EGF-R); вакцины, такие как вакцина Тератоп® и генотерапевтические вакцины, например, вакцина Алловектин®, вакцина Лейвектин® и вакцина Ваксид®; ингибитор топоизомеразы 1 (например, Луртотекан®); rmRH (например, Абареликс®); BAY439006 (сорафениб; Bayer); SU-11248 (сунитиниб, Сутент®, Pfizer); перифозин, ингибитор ЦОГ-2 (например, целекоксиб или эторикоксиб), ингибитор протеосом (например, PS341); бортезомиб (Велкад®); CCI-779; типифарниб (R11577); орафениб, ABT510; ингибитор Bcl-2, такой как облимерсен натрия (Генасенс®); пиксантрон; ингибиторы EGFR (см. определение ниже); ингибиторы тирозинкиназы (см. определение ниже); ингибиторы серин-треонин киназы, такие как рапамицин (сиролимус, Рапамун®); ингибиторы фарнезилтрансферазы, такие как лонафарниб (SCH 6636, SARASAR™); и фармацевтически приемлемые соли, кислоты или производные любого указанного выше; а также комбинации двух или более указанных выше, такие как CHOP, сокращение для комбинированной терапии циклофосфамидом, доксорубицином, винкристином и преднизолоном; и FOLFOX, сокращение для схемы лечения оксалиплатинов (Элоксатин™) в комбинации с 5-FU и лейковорином.

Химиотерапевтические средства, как определено в настоящем документе, включают «противогормональные средства» или «эндокринные терапевтические средства», которые регулируют, снижают, блокируют или ингибируют эффекты гормонов, которые могут содействовать росту рака. Они могут представлять собой гормоны, включая в качестве неограничивающих примеров: антиэстрогены со смешанным агонистическим/антагонистическим профилем, включая тамоксифен (Нолвадекс®), 4-гидрокситамоксифен, торемифен (Фарестон®), идоксифен, дролоксифен, ралоксифен (Эвиста®), триоксифен, кеоксифен, и селективные модуляторы рецептора эстрогена (SERM), такие как SERM3; чистые антиэстрогены без агонистических свойств, такие как фулвестрант (Фаслодекс®), и EM800 (такие средства могут блокировать димеризацию рецептора эстрогена (ER), ингибировать связывание ДНК, повышать оборот ER и/или снижать уровни ER); ингибиторы ароматазы, включая стероидные ингибиторы ароматазы, такие как форместан и экземестан (Аромазин®), и нестероидные ингибиторы ароматазы, такие как анастразол (Аримидекс®), летрозол (Фемара®) и аминоглутетимид, и другие ингибиторы ароматазы включая ворозол (Ривизор®), мегестрол ацетат (Мегаза®), фадрозол и 4(5)-имидазолы; агонисты рилизинг-гормона лютеинизирующего гормона, включая лейпролид (Люпрон® и Элигард®), гозерелин, бусерелин и триптерелин; половые стероиды, включая прогестины, такие как мегестрол ацетат и медроксипрогестерон ацетат, эстрогены, такие как диэтилстильбэстрол и премарин, и андрогены/ретиноиды, такие как флуоксиместерон, полностью транс-ретиноевую кислоту и фенретинид; онапристон; антипрогестероны; понижающие регуляторы рецептора эстрогена (ERD); противоандрогенные средства, такие как флутамид, нилутамид и бикалутамид; и фармацевтически приемлемые соли, кислоты или производные любого указанного выше; а также комбинации двух или более указанных выше.

«Ингибирующее рост средство», когда используют в настоящем документе, относится к соединению или композиции, которая ингибирует рост клетки (такой как клетка, экспрессирующая Bv8) или in vitro или in vivo. Таким образом, ингибирующее рост средство может представлять собой средство, которое значительно снижает процентную долю клеток (таких как, клетки, экспрессирующие Bv8) в S-фазе. Примеры ингибирующих рост средств включают средства, которые блокируют прохождение клеточного цикла (в фазе, отличной от S-фазы), такие как средства, которые вызвают задержку G1-фазы и задержку M-фазы. Классические блокаторы M-фазы включают алкалоиды барвинка (винкристин и винбластин), таксаны и ингибиторы топоизомеразы II, такие как доксорубицин, эпирубицин, даунорубицин, этопозид и блеомицин. Те средства, которые задерживают G1, также переходят в задержку S-фазы, например, алкилирующие ДНК средства, такие как тамоксифен, преднизон, дакарбазин, мехлоретамин, цисплатин, метотрексат, 5-фторурацил и ara-C. Дополнительную информацию можно найти в Mendelsohn and Israel, eds., Molecular Basis of Cancer, глава 1, озаглавленная «Cell cycle regulation, oncogenes, and antineoplastic drugs» авторов Murakami et al. (W.B. Saunders, Philadelphia, 1995), например, стр. 13. Таксаны (паклитаксел и доцетаксел) представляют собой лекарственные средства против рака, которые получают из тисового дерева. Доцетаксел (Таксотер®, Rhone-Poulenc Rorer), получаемый из европейского тиса, представляет собой полусинтетический аналог паклитаксела (Таксол®, Bristol-Myers Squibb). Паклитаксел и доцетаксел способствуют сборке микротрубочек из димеров тубулина и стабилизируют микротрубочки посредством предотвращения деполимеризации, результатом чего является ингибирование митоза в клетках.

«Доксорубицин» представляет собой антрациклиновый антибиотик. Полное химическое название доксорубицина (8S-цис)-10-[(3-амино-2,3,6-тридезокси-α-L-ликсо-гексапиранозил)окси]-7,8,9,10-тетрагидро-6,8,11-тригидрокси-8-(гидроксиацетил)-1-метокси-5,12-нафтацендион.

Термин «содержащий Fc-область полипептид» относится к полипептиду, такому как антитело или иммуноадгезин (см. определения ниже), который содержит Fc-область. C-концевой лизин (447 остаток согласно системе нумерации EU) Fc-области может быть удален, например, во время очистки полипептида или посредством рекомбинантно сконструированной нуклеиновой кислоты, кодирующей полипептид. Соответственно, композиция, содержащая полипептид, имеющий Fc-область, в соответствии с данным изобретением может содержать полипептиды с K447, со всеми удаленными K447 или смесь полипептидов с остатком K447 или без него.

«Индивидуум», «субъект» или «пациент» представляет собой позвоночное. В определенных вариантах осуществления позвоночное представляет собой млекопитающее. Млекопитающие включают в качестве неограничивающих примеров сельскохозяйственных животных (таких как коровы), спортивных животных, домашних животных (таких как кошки, собаки и лошади), приматов, мышей и крыс. В определенных вариантах осуществления млекопитающим является человек.

«Эффективное количество» относится к количеству, которое эффективно в дозах и в течение периодов времени, необходимых для того, чтобы достичь желаемого терапевтического или профилактического результата.

«Терапевтически эффективное количество» вещества/молекул по изобретению, агониста или антагониста, может варьировать в соответствии с такими факторами, как состояние заболевания, возраст, пол и масса индивидуума, и способность вещества/молекулы, агониста или антагониста, вызывать желаемый ответ у индивидуума. Терапевтически эффективное количество также представляет собой такое количество, при котором терапевтически положительное воздействие перевешивает какие-либо токсические или отрицательные эффекты вещества/молекулы, агониста или антагониста. «Профилактически эффективное количество» относится к количеству, которое эффективно в дозах и в течение периодов времени, необходимых для того, чтобы достичь желаемого профилактического результата. Типично, но не обязательно, профилактически эффективное количество будет составлять менее чем терапевтически эффективное количество, поскольку профилактическую дозу используют у субъектов перед заболеванием или на ранней его стадии.

«Рефракторный» относится к устойчивости или невосприимчивости заболевания или состояния к лечению (например, число неопластических плазматических клеток увеличивается даже если назначено лечение). В определенных вариантах осуществления термин «рефракторный» относится к устойчивости или невосприимчивости к какому-либо предыдущему лечению, содержащему в качестве неограничивающих примеров антагонист VEGF, антиангиогенные средства и химиотерапевтическое лечение. В определенных вариантах осуществления термин «рефракторный» относится к по существу невосприимчивости заболевания или состояния к какому-либо предыдущему лечению, содержащему антагонист VEGF, антиангиогенные средства и/или химиотерапевтическое лечение. В определенных вариантах осуществления антагонист VEGF представляет собой антитело против VEGF.

«Рецидив» относится к регрессу заболевания пациента обратно к его прежнему состоянию заболевания, в частности, к возвращению симптомов после видимой реконвалесценции или частичной реконвалесценции. В определенных вариантах осуществления состояние рецидива относится к процессу возвращения или возврата к заболеванию до предыдущего лечения, включая в качестве неограничивающих примеров антагонист VEGF, антиангиогенные средства и/или химиотерапевтическое лечение. В определенных вариантах осуществления состояние рецидива относится к процессу возвращения или возврата к заболеванию после начального выраженного ответа на терапию рака, содержащую антагонист VEGF, антиангиогенные средства и/или химиотерапевтическое лечение. В определенных вариантах осуществления антагонистом VEGF является антитело против VEGF.

Термин «эффективность» используют в настоящем документе в самом широком смысле, и он относится к способности иммуноглобулина, антитела или Fc слитного белка вызывать желаемый эффект. В определенных вариантах осуществления эффективность относится к максимальному наблюдаемому эффекту иммуноглобулина, антитела или Fc слитного белка при насыщающих уровнях. В определенных вариантах осуществления эффективность относится к EC50 иммуноглобулина, антитела или Fc слитного белка. В определенных вариантах осуществления эффективность относится к активности иммуноглобулина, антитела или Fc слитного белка. В определенных вариантах осуществления эффективность относится к способности иммуноглобулина, антитела или Fc слитного белка оказывать положительный эффект на течение или длительность заболевания, включая клиническую пользу, как определено в настоящем документе.

Термин «EC50» относится к концентрации иммуноглобулина, антитела или Fc слитного белка, которая вызывает ответ, которая расположена посреди между базовым уровнем и максимумом. В определенных вариантах осуществления EC50 представляет концентрацию иммуноглобулина, антитела или Fc слитного белка, при которой наблюдают 50% его максимального эффекта. В определенных вариантах осуществления EC50 представляет концентрацию в плазме или сыворотке, необходимую для получения 50% максимального эффекта in vivo.

Эффективность в лечении рака можно демонстрировать посредством обнаружения способности антитела, слитного белка, конъюгированной молекулы, или композиции по изобретению ингибировать или снижать рост или метастазирование злокачественных клеток или улучшать или облегчать один или несколько симптомов, ассоциированных с раком. Лечение считают терапевтическим, например, в случае снижения роста или метастазирования злокачественных клеток, улучшения одного или нескольких симптомов, ассоциированных с раком или снижения смертности и/или болезненность после введения антитела, слитного белка, конъюгированной молекулы или композиции по изобретению. Антитела, слитные белки или композиции по изобретению можно тестировать на их способность снижать образование опухоли в анализах in vitro, ex vivo и in vivo. Для терапии рака эффективность in vivo также можно измерять, например, посредством оценки длительности выживания, времени до прогрессирования заболевания (TTP), коэффициентов ответа (RR), длительности ответа и/или качества жизни.

Клиническую пользу можно измерить посредством оценки различных конечных точек, таких как, ингибирование, в определенной степени, прогрессирования заболевания, включая замедление и полную задержку; снижение числа эпизодов заболевания и/или симптомов; уменьшение размера повреждения; ингибирование (т.е., снижение, замедление или полная остановка) инфильтрации больных клеток в смежные периферические органы и/или ткани; ингибирование (т.е. снижение, замедление или полная остановка) распространения заболевания; снижение аутоиммунного ответа, которое может, но не обязано, привести к регрессу или абляции повреждения заболеванием; облегчение, в определенной степени, одного или нескольких симптомов, ассоциированных с нарушением; увеличение длительности существования без заболевания после лечения, например, выживаемость без прогрессирования; увеличенная общая выживаемость; более высокий коэффициент ответа; и/или сниженная смертность в заданный момент времени после лечения.

Под «поддерживающей терапией» понимают терапевтический режим, который назначают для снижения вероятности рецидива или прогрессирования заболевания. Поддерживающую терапию можно предоставлять в течение времени любой длительности, включая расширенные периоды времени вплоть до всей жизни субъекта. Поддерживающую терапию можно предоставлять после начальной терапии или в сочетании с начальной или дополнительной терапией. Дозы, используемые для поддерживающей терапии, могут варьировать, и они могут включать уменьшенные дозы по сравнению с дозами, используемыми для других видов терапии.

«Вспомогательная терапия» в настоящем документе относится к терапии, назначаемой после хирургического вмешательства, когда нельзя обнаружить признаки остаточного заболевания, чтобы снизить рис рецидива заболевания. Цель вспомогательной терапии состоит в предотвращении рецидива рака и, следовательно, в снижении вероятности смерти, связанной с раком.

Введение «в комбинации с» одним или несколькими дополнительными терапевтическими средствами включает одновременное (параллельное) и последовательное введение в любом порядке.

Термин «одновременно» или «параллельно» используют в настоящем документе для обозначения введения двух или более терапевтических средств, где по меньшей мере часть введения перекрывается во времени. Соответственно, параллельное введение включает режим дозирования, когда введение одного или нескольких средств продолжают после окончания введения одного или нескольких других средств.

«Биологический образец» (взаимозаменяемо называемый «образцом» или «образцом ткани или клеток») охватывает образцы различных типов, получаемые от индивидуума, и его можно использовать в диагностическом анализе или анализе для мониторинга. Определение охватывает образы крови и других жидкостей биологического происхождения, образцы солидных тканей, таких как биоптат или культуры тканей или клетки, полученные из них, а также их потомство. Определение также включает образцы, с которыми выполняли какие-либо манипуляции после их получения, например, посредством обработки реактивами, солюбилизации или обогащение определенными компонентами, такими как белки или полинуклеотиды, или встраивание в полутвердую или твердую матрицу с целью получения срезов. Термин «биологический образец» охватывает клинический образец, а также включает клетки в культуре, супернатанты клеток, лизаты клеток, сыворотку, плазму, биологическую жидкость и образцы тканей. Источником биологического образца может быть солидная ткань, как из свежего, замороженного и/или фиксированного органа или образца или биопсии ткани или аспирата; кровь или любые компоненты крови; текучие вещества организма, такие как цереброспинальная жидкость, амниотическая жидкость, перитонеальная жидкость или интерстициальная жидкость; клетки из любого момента времени в беременности или развитии субъекта. В некоторых вариантах осуществления биологический образец получают из первичной или метастатической опухоли. Биологический образец может содержать соединения, которые в естественных условиях не смешаны с тканью, такие как консерванты, антикоагулянты, буферы, фиксаторы, питательные вещества, антибиотики или т.п.

Для целей настоящего документа под «срезом» образца ткани понимают одну часть или кусок образца ткани, например, тонкий срез ткани или клеток, вырезанный из образца ткани. Понятно, что можно получать и подвергнуть анализу множество срезов образцов ткани в соответствии с настоящим изобретением. В некоторых вариантах осуществления один и тот же срез образца ткани анализируют как на морфологическом, так и молекулярном уровнях, или анализируют в отношении как белка, так нуклеиновой кислоты.

Термин «фармацевтический состав», «фармацевтическая композиция» или «терапевтический состав» относится к препарату, который находится в такой форме, чтобы позволить биологической активности активного ингредиента быть эффективной, и который н содержит дополнительные компоненты, которые обладают неприемлемой токсичностью для субъекта, которому будут вводить состав. Такие составы могут быть стерильными.

«Стерильный» состав является асептическим и не содержит никакие живые микроорганизмы и их споры.

Слово «метка», когда используют в настоящем документе, относится к соединению или композиции, которые конъюгированы или слиты непосредственно или опосредованно с реактивом, таким как зонд нуклеиновой кислоты или антитело, и облегчают обнаружение реактива, с которым они конъюгированы или слиты. Сама метка может поддаваться обнаружению (например, радиоизотопные метки или флуоресцентные метки) или, в случае ферментативной метки, может катализировать химическое изменение соединения или композиции субстрата, которое поддается обнаружению.

«Носители», как используют в настоящем документе, включают фармацевтически приемлемые носители, эксципиенты или стабилизаторы, которые не обладают токсичностью для клетки или млекопитающего, на которого они воздействуют, в используемых дозах и концентрациях. Что физиологически приемлемый носитель представляет собой водный pH забуференный раствор. Примеры физиологически приемлемых носителей включают буферы, такие как фосфатный, цитратный и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту; низкомолекулярный полипептид (менее чем приблизительно 10 остатков); белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, аргинин или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие средства, такие как ЭДТА; сахароспирты, такие как маннит или сорбит; солеобразующие противоионы, такие как натрий; и/или неионные поверхностно-активные вещества, такие как TWEEN™, полиэтиленгликоль (PEG) и Плюроники™.

«Липосома» представляет собой небольшую везикулу, состоящую из липидов, фосфолипидов и/или поверхностно-активных веществ различных типов, которые можно использовать для доставки лекарственного средства млекопитающему. Компоненты липосомы обыкновенно расположены в виде двухслойного образования, похожего на расположение липидов в биологических мембранах.

Композиции

Антитела против Bv8 по изобретению предпочтительно являются моноклональными. В объем изобретения также включены Fab, Fab', Fab'-SH и F(ab')2 фрагменты антител против Bv8, предоставленных в настоящем документе. Эти фрагменты антител можно создавать с помощью традиционных средств, таких как ферментативное расщепление, или их можно создавать рекомбинантными способами. Такие фрагменты антител могут быть химерным или гуманизированными. Эти фрагменты можно использовать для диагностических и терапевтических целей, изложенных ниже.

Моноклональные антитела получают из популяции по существу гомогенных антител, т.е., отдельные антитела, содержащиеся в популяции, идентичны, за исключением возможных встречающихся в природе мутаций, которые могут присутствовать в незначительных количествах. Таким образом, определение «моноклональный» указывает на характер антитела, которое не является смесью различающихся антител.

Моноклональные антитела против Bv8 по изобретению можно получать с использованием гибридомного способа, который впервые описан авторами Kohler et al, Nature, 256:495 (1975), или можно создавать способами рекомбинантной ДНК (патент США № 4816567).

В гибридомном способе иммунизируют мышь или другое подходящее животное-хозяин, такое как хомяк, чтобы получить лимфоциты, которые продуцируют или способны продуцировать антитела, которые будут связываться, в частности, с белком, использованным для иммунизации. Антитела к Bv8 могут быть индуцированы у животных посредством множественных подкожных (sc) или интраперитонеальных (ip) инъекций Bv8 и адъюванта. Bv8 можно получать, используя способы, хорошо известные в данной области, некоторые из которых дополнительно описаны в настоящем документе. Например, рекобминантно получение Bv8 человека и мыши описано ниже. В одном из вариантов осуществления животных иммунизируют с использованием Bv8, слитого с Fc частью тяжелой цепи иммуноглобулина. В предпочтительном варианте осуществления животных иммунизируют слитным белком Bv8-IgG1. Животных, как правило, иммунизируют против иммуногенных конъюгатов или производных Bv8 с монофосфориллипидом A (MPL)/дикриномиколатом трегалозы (TDM) (Ribi Immunochem. Research, Inc., Hamilton, MT) и раствор инъецируют внутрикожно в несколько мест. Двумя неделями позже животных подвергают повторной иммунизации. Через 7-14 суток у животных берут кровь и в сыворотке анализируют титры антител против Bv8. Животных подвергают повторной иммунизации до тех пор, пока титр не достигнет плато.

Альтернативно, лимфоциты можно иммунизировать in vitro. Затем лимфоциты сливают с миеломными клетками с использованием подходящего средства, вызывающего слияние клеток, такого как полиэтиленгликоль, чтобы создать гибридомную клетку (Goding, Monoclonal Antibodies: Principles and Practice, стр.59-103 (Academic Press, 1986)).

Полученные таким образом гибридомные клетки высевают и растят в подходящей среде для культивирования, которая предпочтительно содержит одно или несколько веществ, которые ингибируют рост или выживаемость неслитых родительских миеломных клеток. Например, если у родительских миеломных клеток отсутствует фермент гипоксантингуанинфосфорибозилтрансфераза (HGPRT или HPRT), среда для культивирования гибридом типично будет содержать гипоксантин, аминоптерин и тимидин (среда HAT), эти вещества препятствуют росту клеток с дефицитом HGPRT.

Предпочтительными миеломными клетками являются те, которые эффективно сливаются, поддерживают стабильную продукцию антитела на высоком уровне выбранными антителопродуцирующими клетками, и чувствительны к среде, такой как среда HAT. Среди них предпочтительными линиями миеломных клеток являются линии миеломы мыши, такие как те, что получены из опухолей мыши MOPC-21 и MPC-11, доступные в Salk Institute Cell Distribution Center, San Diego, California USA, и клетки SP-2 или X63-Ag8-653, доступные в American Type Culture Collection, Rockville, Maryland USA. Линии клеток миеломы человека и гетеромиеломы мыши-человека также описаны для получения моноклональных антител человека (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Methods and Applications, стр. 51-63 (Marcel Dekker, Inc., New York, 1987)).

Среду для культивирования, в которой растут гибридомные клетки, анализируют на продуцирование моноклональных антител, направленных против Bv8. Предпочтительно, специфичность связывания моноклональных антител, продуцируемых гибридомными клетками, определяют с помощью иммунопреципитации или с помощью анализа связывания in vitro, такого как радиоиммунный анализ (RIA) или твердофазный иммуноферментный анализ (ELISA).

Аффинность связывания моноклонального антитела можно определять, например, с помощью анализа Скетчарда по Munson et al., Anal. Biochem., 107:220 (1980).

После идентификации гибридомных клеток, которые продуцируют антитела с желаемой специфичностью, аффинностью и/или активностью, клоны можно субклонировать посредством серийных разведений и растить стандартными способами (Goding, Monoclonal Antibodies: Principles and Practice, стр. 59-103 (Academic Press, 1986)). Подходящие среды для культивирования с этой целью включают, например, среду D-MEM или RPMI-1640. Вдобавок, гибридомные клетки можно растить в виде асцитных опухолей у животного in vivo.

Моноклональные антитела, секретируемые субклонами, надлежаще отделяют от среды для культивирования, асцитной жидкости или сыворотки с помощью стандартных процедур очистки иммуноглобулинов, таких как, например, белок A-сефароза, хроматография на гидроксиапатите, электрофорез в геле, диализ или аффинная хроматография.

Антитела против Bv8 по изобретению можно получать, используя комбинаторные библиотеки для скрининга желаемой активности или активностей клонов синтетических антител. В принципе, клоны синтетических антител отбирают с помощью скрининга фаговых библиотек, содержащих фаг, на котором представлены различные фрагменты вариабельной области (Fv) антитела, слитые с белком оболочки фага. Посредством аффинной хроматографии проводят пэннинг таких фагов с использованием библиотек против желаемого антигена. На антигене происходит адсорбция клонов, экспрессирующих Fv фрагменты, способные к связыванию с желаемым антигеном, и, таким образом, отделение от несвязывающих клонов в библиотеке. Затем связывающие клоны элюируют с антигена, и их можно дополнительно обогащать посредством дополнительных циклов адсорбции на антигене/элюирования. Любые из антител против Bv8 по изобретению можно получать посредством разработки подходящей процедуры скрининга на антигене, чтобы отобрать фаговый клон, представляющий интерес, с последующим конструированием клона полноразмерного антитела против Bv8 с использованием последовательностей Fv из фагового клона, представляющего интерес, и подходящей последовательности константной области (Fc), описанной в Kabat et al, Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), тома 1-3.

Антигенсвязывающий домен антитела сформирован из двух вариабельных (V) областей приблизительно по 110 аминокислот, по одной из легкой (VL) и тяжелой (VH) цепей, и обе они представляют по три гипервариабельные петли или определяющих комплементарность области (CDR). Вариабельные домены могут быть функционально представлены на фаге, или в виде одноцепочечных Fv (scFv) фрагментов, в которых VH и VL ковалентно связаны коротким гибким пептидом, или в виде Fab фрагментов, в которых они слиты с константным доменом и взаимодействуют нековалентно, как описано в Winter et al., Ann. Rev. Immunol, 12: 433-455 (1994). Как используют в настоящем документе, кодирующие scFv фаговые клоны и кодирующие Fab фаговые клоны вместе обозначают «Fv фаговые клоны» или «Fv клоны».

Репертуары генов VH и VL можно клонировать отдельно с помощью полимеразной цепной реакции (ПЦР) и случайным образом рекомбинировать в фаговых библиотеках, в которые затем проводят поиск антигенсвязывающих клонов, как описано в Winter et al., Ann. Rev. Immunol, 12: 433-455 (1994). Библиотеки из иммунизированных источников предоставляют антитела с высокой аффинностью к иммуногену, не требуя конструировать гибридомы. Альтернативно, наивный репертуар можно клонировать для того, чтобы предоставить один источник антител человека к широкому диапазону не своих и также своих антигенов без какой-либо иммунизации, как описано авторами Griffiths et al., ΕΜΒΟ J 12: 725-734 (1993). Наконец, наивные библиотеки также можно получать синтетически посредством клонирования нереарранжированных сегментов V-генов из стволовых клеток и с использованием ПЦР праймеров, содержащих случайную последовательность для того, чтобы кодировать высоко вариабельные области CDR3 и чтобы выполнить реарранжировку in vitro, как описано авторами Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).

Нитчатый фаг используют для представления фрагментов антител посредством слияния с минорным белком оболочки pIII. Фрагменты антител могут быть представлены в виде одноцепочечных Fv фрагментов, в которых домены VH и VL соединены в одну полипептидную цепь посредством гибкого полипептидного спейсера, например, как описано авторами Marks et al., J. Mol. Biol., 222: 581-597 (1991), или в виде Fab фрагментов, в которых одна цепь слита с pIII, а другая секретируется в периплазму бактериальной клетки-хозяина, где происходит сборка структуры Fab-белок оболочки, который будет представлен на поверхности фага посредством вытеснения некоторых белков оболочки дикого типа, например, как описано в Hoogenboom et al, Nucl. Acids Res., 19: 4133-4137 (1991).

В целом, нуклеиновые кислоты, кодирующие фрагменты генов антител, получают из иммунных клеток, которые получают от человека или животных. Если желательно получить библиотеку, смещенную в сторону клонов против Bv8, индивидуума иммунизируют с использованием Bv8, чтобы вызвать образование антител, и собирают клетки селезенки и/или циркулирующие B-клетки другие лимфоциты периферической крови (PBL) для конструирования библиотеки. В предпочтительном варианте осуществления библиотеку фрагментов генов антител человека, смещенную в сторону клонов против Bv8, получают, вызывая образование антител против Bv8 у трансгенных мышей, несущих массив генов функциональных иммуноглобулинов человека (и не обладающих системой продуцирования функциональных эндогенных антител), так что иммунизация Bv8 вызывает образование B клеток, продуцирующих антитела человека против Bv8. Создание трансгенных мышей, продуцирующих антитела человека, описано ниже.

Дополнительное обогащение популяций реактивных клеток против Bv8 можно получать посредством использования подходящей процедуры скрининга, чтобы выделить B клетки, экспрессирующие специфическое мембраносвязанное антитело к Bv8, например, посредством разделения клеток аффинной хроматографией на Bv8 или адсорбции клеток на меченном флуорохромом Bv8 с последующей сортировкой флуоресцентно-активированных клеток (FACS).

Альтернативно, использование клеток селезенки и/или B клеток или других PBL от неиммунизированного донора обеспечивает улучшенное представление возможного репертуара антител, и также делает возможным конструирование библиотеки антител с использованием любых видов животных (человека или не принадлежащих к человеку), в которых Bv8 не является антигеном. Для библиотек, содержащих генную конструкцию антитела in vitro, стволовые клетки берут у индивидуума, чтобы предоставить нуклеиновые кислоты, кодирующие нереарранжированные сегменты генов антител. Иммунные клетки, представляющие интерес, можно получать из различных видов животных, таких как человек, мышь, крыса, зайцеобразные, волк, собака, кошка, свинья, корова, лошадь и виды птиц и т.д.

Нуклеиновую кислоту, кодирующую сегменты вариабельных генов антител (включая сегменты VH и VL) извлекают из клеток, представляющих интерес, и амплифицируют. В случае библиотек реарранжированных генов VH и VL, желаемую ДНК можно получать выделением геномной ДНК или мРНК из лимфоцитов с последующей полимеразной цепной реакцией (ПЦР) с праймерами, соответствующими 5' и 3'-концам реарранжированных генов VH и VL, как описано в Orlandi et al, Proc. Natl. Acad. Sci. (USA), 86: 3833-3837 (1989), тем самым создавая разнообразные репертуары V-генов для экспрессии. V-гены можно амплифицировать из кДНК и геномной ДНК, с обратными праймерами на 5'-конце экзона, кодирующего зрелый V-домен, и прямыми праймерами, расположенными в J-сегменте, как описано в Orlandi et al. (1989) и в Ward et al, Nature, 341: 544-546 (1989). Однако для амплификации из кДНК обратные праймеры также могут быть расположены в лидерном экзоне, как описано в Jones et al, Biotechnol, 9: 88-89 (1991), а прямые праймеры в константной области, как описано в Sastry et al, Proc. Natl. Acad. Sci. (USA), 86: 5728-5732 (1989). Чтобы сделать комплементарность максимальной, вырожденность можно встраивать в праймеры, как описано в Orlandi et al. (1989) или Sastry et al. (1989). Предпочтительно, разнообразие библиотеки максимизируют, используя ПЦР праймеры, нацеленные на каждое семейство V-генов для того, чтобы амплифицировать все доступные расположения VH и VL, присутствующие в образце нуклеиновой кислоты иммунной клетки, например, как описано в способах в Marks et al, J. Mol. Biol, 222: 581-597 (1991) или как описано в способах в Orum et al, Nucleic Acids Res., 21: 4491-4498 (1993). Для клонирования амплифицированной ДНК в экспрессирующих векторах, редкие участки рестрикции можно вводить в ПЦР праймер в качестве метке на одном конце, как описано в Orlandi et al. (1989), или посредством дополнительной ПЦР амплификации с меченным праймером, как описано в Clackson et al, Nature, 352: 624-628 (1991).

Репертуары синтетически реарранжированных V-генов можно получать in vitro из сегментов V-генов. Большинство сегментов VH-генов человека клонированы и секвенированы (сообщалось в Tomlinson et al, J. Mol. Biol, 227: 776-798 (1992)), и картированы (сообщалось в Matsuda et al, Nature Genet., 3: 88-94 (1993); эти клонированные сегменты (включая все основные конформации петли H1 и H2) можно использовать для создания разнообразных репертуаров VH-генов с использованием ПЦР праймеров, кодирующих петли H3 с различной последовательностью и длиной, как описано в Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992). Также можно получать репертуары VH со сфокусированным разнообразием всех последовательностей в длинной петле H3 одной длины, как описано в Barbas et al., Proc. Natl. Acad. Sci. USA, 89: 4457-4461 (1992). Сегменты Vk и Vλ человека клонированы и секвенированы (сообщалось в Williams and Winter, Eur. J. Immunol, 23: 1456-1461 (1993)) и их можно использовать для создания репертуаров синтетических легких цепей. Репертуары синтетических V-генов на основе спектра укладок VH и VL и длин L3 и H3 будут кодировать антитела с существенным структурным разнообразием. После амплификации ДНК, кодирующей V-ген, сегменты V-генов зародышевой линии можно реарранжировать in vitro в соответствии со способами по Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).

Репертуары фрагментов антител можно конструировать посредством комбинирования репертуаров генов VH и VL несколькими путями. Каждый репертуар можно создавать в различных векторах, и векторы рекомбинировать in vitro, например, как описано в Hogrefe et al, Gene, 128: 119-126 (1993), или in vivo посредством комбинаторной инфекции, например, система loxP, описанная в Waterhouse et al., Nucl. Acids Res., 21:2265-2266 (1993). В рекобминаторном подходе in vivo используют двухцепную природу Fab фрагментов, чтобы преодолеть предел размера библиотеки, налагаемый эффективностью трансформации E. coli. Наивные репертуары VH и VL клонируют отдельно, один в фагемиду и другой в фаговый вектор. Затем две библиотеки комбинируют посредством фаговой инфекции бактерий, содержащих фагемиды, чтобы каждая клетка содержала различные комбинации, а размер библиотеки ограничен только числом присутствующих клеток (приблизительно 1012 клонов). Оба вектора содержат рекомбинационные сигналы in vivo с тем, чтобы происходила рекомбинация генов VH и VL на одном репликоне и совместная упаковка в фаговые вирионы. Эти большие библиотеки обеспечивают большое число разнообразных антител с хорошей аффинностью (Kd-1 приблизительно 10-8 M).

Альтернативно, репертуары можно клонировать последовательно в один и тот же вектор, например, как описано в Barbas et al, Proc. Natl. Acad. Sci. USA, 88:7978-7982 (1991), или собирать вместе посредством ПЦР и затем клонировать, например, как описано в Clackson et al, Nature, 352: 624-628 (1991). ПЦР сборку также можно использовать для соединения ДНК VH и VL с ДНК, кодирующей гибкий пептидный спейсер, чтобы сформировать репертуары одноцепочечных Fv (scFv). В еще одном другом способе, «ПЦР сборку в клетке» используют для того, чтобы комбинировать гены VH и VL внутри лимфоцитов посредством ПЦР и затем клонировать репертуары сцепленных генов, как описано в Embleton et al, Nucl. Acids Res., 20:3831-3837 (1992).

Антитела, получаемые посредством наивных библиотек (естественных или синтетических), могут иметь умеренную аффинность (Kd-1 приблизительно от 106 до 107 M-1), но созревание аффинности также можно имитировать in vitro посредством конструирования и повторного отбора из вторичных библиотек, как описано в Winter et al. (1994), выше. Например, мутации можно вводить случайно in vitro с использованием допускающей ошибки полимеразы (сообщалось в Leung et al., Technique, 1: 11-15 (1989)) в способе в Hawkins et al, J. Mol. Biol, 226: 889-896 (1992) или в способе в Gram et al, Proc. Natl. Acad. Sci USA, 89: 3576-3580 (1992). Дополнительно, созревание аффинности можно осуществлять посредством введения случайных мутаций в один или несколько CDR, например, с использованием ПЦР с праймерами, несущими случайную последовательность, перекрывающую CDR, представляющую интерес, в отобранные индивидуальные клоны Fv, и скрининга клонов с повышенной аффинностью. В WO 96/07754 (публикация от 14 марта 1996 года) описан способ индукции мутагенеза в определяющей комплементарность области легкой цепи иммуноглобулина для создания библиотеки генов легкой цепи. Другой эффективный подход состоит в рекомбинации доменов VH или VL, отобранных с помощью фагового дисплея с репертуарами встречающихся в природе вариантов V-домена, полученными от неиммунизированных доноров, и скрининге на повышенную аффинность в нескольких раундах повторного шаффлинга цепей, как описано в Marks et al., Biotechnol., 10:779-783 (1992). Этот способ позволяет получать антитела и фрагменты антител с аффинностями в диапазоне 10-9 M.

Нуклеиновая кислота и аминокислотные последовательности Bv8 известны в данной области, например, в Wechselberger et al. (FEBS Lett. 462: 177-181 (1999)) и Li et al. (Mol. Pharm. 59:692-698 (2001)). Нуклеиновые кислоты, кодирующие Bv8, можно получать различными известными в данной области способами. Эти способы включают в качестве неограничивающих примеров химический синтез посредством любого из способов, описанных в Engels et al., Agnew. Chem. Int. Ed. Engl., 28: 716-734 (1989), таких как способы со сложным триэфиром, фосфитом, фосфорамидитом и H-фосфонатом. В одном из вариантов осуществления кодоны, предпочитаемые экспрессирующей клеткой-хозяином, используют при конструировании ДНК, кодирующей Bv8. Альтернативно, ДНК, кодирующую Bv8, можно выделять из геномной библиотеки или библиотеки кДНК.

После конструирования молекулы ДНК, кодирующей Bv8, молекулу ДНК функционально связывают с последовательностью, управляющей экспрессией, в экспрессирующем векторе, таком как плазмида, где управляющую последовательность распознает клетка-хозяин, трансформированная вектором. В целом, плазмидные векторы содержат репликационные и управляющие последовательности, которые получены от видов, совместимых с клеткой-хозяином. Вектор, как правило, несет участок репликации, также последовательности, которые кодируют белки, которые способны обеспечивать фенотипический отбор в трансформированных клетках. Подходящие векторы для экспрессии в прокариотических и эукариотических клетках-хозяевах известны в данной области и некоторые дополнительно описаны в настоящем документе. Можно использовать эукариотические организмы, такие как дрожжи или клетки, полученные из многоклеточных организмов, таких как млекопитающие.

Необязательно, ДНК, кодирующая Bv8, функционально связана с секреторной лидерной последовательностью, что ведет к секреции продукта экспрессии клеткой-хозяином в среду для культивирования. Примеры секреторных лидерных последовательностей включают stII, ecotin, lamB, herpes GD, lpp, щелочную фосфатазу, инвертазу и α-фактор. Также для применения по настоящему документу подходит 36-аминокислотная лидерная последовательность белка A (Abrahmsen et al., EMBO J., 4: 3901 (1985)).

Клетки-хозяева трансфицируют и предпочтительно трансформируют описанными выше экспрессионными или клонирующими векторами по данному изобретению и культивируют в стандартных питательных средах, модифицированных соответствующим образом, чтобы индуцировать промоторы, отбирать трансформанты или амплифицировать гены, кодирующие желаемые последовательности.

Трансфекция относится к захвату экспрессирующего вектора клеткой-хозяином независимо от того, фактически происходит экспрессия каких-либо кодирующих последовательностей или нет. Множество способов трансфекции известно специалистам в данной области, например, преципитация с CaPO4 и электропорация. Трансфекцию признают в целом успешной, когда в клетке-хозяине возникает какой-либо признак работы этого вектора. Способы трансфекции хорошо известны в данной области, и некоторые дополнительно описаны в настоящем документе.

Трансформация обозначает введение ДНК в организм с тем, чтобы реплицировать ДНК, или в виде внехромосомного элемента или посредством встраивания в хромосому. В зависимости от используемой клетки-хозяина, трансформацию выполняют с использованием стандартных способов, подходящих для таких клеток. Способы трансформации хорошо известны в данной области, и некоторые дополнительно описаны в настоящем документе.

Прокариотические клетки-хозяева, используемые для получения Bv8, можно культивировать, как в целом описано в Sambrook et al, выше.

Клетки-хозяева млекопитающих, используемые для получения Bv8, можно культивировать в различных средах, которые хорошо известны в данной области и некоторые из которых описаны в настоящем документе.

Клетки-хозяева, указанные в этом раскрытии охватывают клетки в культуре in vitro, а также клетки, которые находятся внутри животного-хозяина.

Очистку Bv8 можно выполнять, используя принятые в данной области способы, некоторые из которых описаны в настоящем документе.

Очищенный Bv8 можно прикреплять к подходящей матрице, такой как агарозные бусы, акриламидные бусы, стеклянные бусы, целлюлоза, различные акриловые сополимеры, гидроксиметакрилатные гели, полиакриловые и полиметакриловые сополимеры, нейлон, нейтральные и ионные носители и т.п., для использования в разделении клонов фагового дисплея аффинной хроматографией. Прикрепление белка Bv8 к матрице можно выполнять способами, описанными в Methods in Enzymology, том 44 (1976). Обыкновенно используемый способ прикрепления белковых лигандов к полисахаридным матрицам, например, агарозе, декстрану или целлюлозе, включает активацию носителя цианогенгалогенидами и последующее образование связи первичных алифатических или ароматических аминов пептидного лиганда с активированной матрицей.

Альтернативно, Bv8 можно использовать для того, чтобы покрывать лунки адсорбционных планшетов, экспрессировать на клетках-хозяевах, прикрепленных к адсорбционным планшетам или использовать в сортировке клеток или конъюгировать с биотином для захвата покрытыми стрептавидином бусами, или использовать в любом другом известном в данной области способе для пэннинга библиотек фагового дисплея.

Образцы фаговой библиотеки приводят в контакт с иммобилизованным Bv8 в условиях, подходящих для связывания по меньшей мере части фаговых частиц с адсорбентом. Обычно, условия, включая pH, ионную силу, температуру и т.п., выбирают для того, чтобы имитировать физиологические условия. Фаги, связанные с твердой фазой, промывают и затем элюируют кислотой, например, как описано в Barbas et al., Proc. Natl. Acad. Sci USA, 88: 7978-7982 (1991), или щелочью, например, как описано в Marks et al, J. Mol. Biol, 222: 581-597 (1991), или посредством конкуренции с антигеном Bv8, например, в процедуре, похожей на способ конкуренции антигенов по Clackson et al, Nature, 352: 624-628 (1991). Фаги можно обогащать в 20-1000 раз за один раунд отбора. Кроме того, обогащенные фаги можно выращивать в бактериальной культуре и подвергают дополнительным раундам отбора.

Эффективность отбора зависит от многих факторов, включая кинетику диссоциации во время промывания и того, могут ли несколько фрагментов антител на одном фаге одновременно связываться с антигеном. Антитела с быстрой кинетикой диссоциации (и слабой аффинностью связывания) можно удерживать, используя короткие промывания, поливалентный фаговый дисплей и высокую плотность покрытия антигеном на твердой фазе. Высокая плотность не только стабилизирует фаг посредством поливалентных взаимодействий, но способствует повторному связыванию диссоциировавших фагов. Отбору антител с медленной кинетикой диссоциации (и хорошей аффинностью связывания) может способствовать использование длительного промывания и моновалентного фагового дисплея, как описано в Bass et al, Proteins, 8: 309-314 (1990) и в WO 92/09690, и низкой плотности покрытия антигеном, как описано в Marks et al, Biotechnol, 10: 779-783 (1992).

Можно проводить отбор фаговых антител с различными аффинностями к Bv8, даже с аффинностями, которые различаются незначительно. Однако, случайная мутация отобранного антитела (например, как выполняют в некоторых способах созревания аффинности, описанных выше) вероятно дает начало многим мутантам, в большинстве связывающимся с антигеном, и в меньшинстве с более высокой аффинностью. При ограничении Bv8, можно выявить редкий фаг с высокой аффинностью. Чтобы удержать все мутанты с более высокой аффинностью, можно инкубировать фаги с избытком биотинилированного Bv8, но с биотинилированным Bv8 в концентрации с более низкой молярностью, чем молярная константа сродства мишени к Bv8. Затем фаги с высокой аффинностью связывания можно захватывать с помощью покрытых стрептавидином парамагнитных бус. Такой «равновесный захват» позволяет отбирать антитела в соответствии с их аффинностями связывания, с чувствительностью, которая позволяет выделять мутантные клоны со всего лишь в два раза превосходящей аффинностью из значительного избытка фагов с более низкой аффинностью. Условиями, используемыми при промывании фагов, связанных с твердой фазой, также можно манипулировать для того, чтобы проводить различия на основе кинетики диссоциации.

Bv8 клоны можно отбирать по активности. В одном из вариантов осуществления изобретение относится к антителам к Bv8, которые блокируют связывание между Bv8 и его лигандом (например, рецепторами Bv8 PKR1 и PKR2). Fv клоны, соответствующие таким антителам к Bv8, можно выбирать посредством (1) выделения Bv8 клонов из фаговой библиотеки, как описано выше, и необязательно амплификации выделенной популяции фаговых клонов посредством выращивания популяции в подходящем бактериальном организме-хозяине; (2) отбора Bv8 и второго белка, против которого блокирующая и неблокирующая активности, соответственно, желательны; (3) адсорбции фаговых клонов против Bv8 на иммобилизованном Bv8; (4) использования избытка второго белка, чтобы элюировать любые нежелательные клоны, которые распознают детерминанты связывания Bv8, которые перекрываются и являются общими с детерминантами связывания второго белка; и (5) элюирования клонов, которые остаются адсорбированными после стадии (4). Необязательно, клоны с желаемыми блокирующими/неблокирующими свойствами можно дополнительно можно обогащать посредством повторения процедур отбора, описанных в настоящем документе, один или несколько раз.

ДНК, кодирующую полученные из гибридомы моноклональные антитела или Fv клоны фагового дисплея по изобретению легко выделать и секвенировать с использованием стандартных процедур (например, с использованием олигонуклеотидных праймеров, разработанных для того, чтобы специфически амплифицировать кодирующие области тяжелой и легкой цепи, представляющие интерес, из ДНК матрицы гибридомы или фага). После выделения, ДНК можно помещать в экспрессирующие векторы, которые затем трансфицируют в клетки-хозяева, такие как клетки E. coli, клетки COS обезьяны, клетки яичника китайского хомяка (CHO) или миеломные клетки, которые иным образом не продуцируют белок иммуноглобулина, чтобы добиться синтеза желаемых моноклональных антител в рекомбинантных клетках-хозяевах. Обзорные статьи по рекомбинантной экспрессии ДНК, кодирующей антитело, в бактериях включают Skerra et al, Curr. Opinion in Immunol, 5: 256 (1993) и Pluckthun, Immunol. Revs, 130: 151 (1992).

ДНК, кодирующие Fv клоны по изобретению, можно комбинировать с известными последовательностями ДНК, кодирующим константные области тяжелой цепи и/или легкой цепи (например, подходящие последовательности ДНК можно получать из Kabat et al., выше), чтобы сформировать клоны, кодирующие полноразмерные тяжелые и/или легкие цепи или их части. Следует принимать во внимание, что с этой целью можно использовать константные области любого изотипа, включая константные области IgG, IgM, IgA, IgD и IgE, и что такие константные области можно получать от человека или любых видов животных. Fv клон, полученный из ДНК вариабельного домена одного вида животных (такого как человек) и затем слитый с ДНК константной области другого вида животных, чтобы сформировать кодирующую последовательность(и) для «гибридной», полноразмерной тяжелой цепи и/или легкой цепи, включены в определение «химерного» и «гибридного» антитела, как используют в настоящем документе. В предпочтительном варианте осуществления Fv клон, полученный из ДНК вариабельного домена человека, сливают с ДНК константной области человека, чтобы сформировать кодирующую последовательность(и) для полностью человеческих полноразмерных тяжелых и/или легких цепей или их частей.

ДНК, кодирующую антитело против Bv8, полученную из гибридомы по изобретению, также можно модифицировать, например, посредством замены кодирующей последовательности константными доменами тяжелой и легкой цепи человека гомологичных последовательностей мыши, полученных из гибридомного клона (например, как в способе по Morrison et al, Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). ДНК, кодирующую полученное из гибридомы или Fv клона антитело или фрагмент, дополнительно можно модифицировать посредством ковалентного связывания с кодирующей последовательностью иммуноглобулина всей или части кодирующей последовательности для неиммуноглобулинового полипептида. Таким образом, получают «химерные» или «гибридные» антитела, которые обладают специфичностью связывания антитела по изобретению, полученного из Fv клона или гибридомного клона.

Фрагменты антител

Настоящее изобретение относится к фрагментам антител. Фрагменты антител можно создавать традиционными средствами, такими как ферментативное расщепление, или рекомбинантными способами. В определенных случаях полезно использовать фрагменты антител, вместо целых антител. Меньший размер фрагментов делает возможным быстрый клиренс и может вести к улучшенному доступу к солидным опухолям. Обзор по определенным фрагментам антител см. в Hudson et al. (2003) Nat. Med. 9: 129-134.

Разработаны различные способы получения фрагментов антител. Традиционно, эти фрагменты получали протеолитическим расщеплением интактных антител (см., например, Morimoto et al., Journal of Biochemical and Biophysical Methods 24: 107-117 (1992); и Brennan et al, Science, 229:81 (1985)). Однако теперь эти фрагменты можно получать непосредственно посредством рекомбинантных клеток-хозяев. Fab, Fv и ScFv фрагменты антител может экспрессировать и секретировать E. coli, таким образом, делая возможным гибкое получение больших количеств этих фрагментов. Фрагменты антител можно выделять из фаговых библиотек антител, рассмотренных выше. Альтернативно, Fab'-SH фрагменты можно извлекать непосредственно из E. coli и химически сопрягать для того, чтобы формировать F(ab')2 фрагменты (Carter et al, Bio/Technology 10: 163-167 (1992)). Согласно другому подходу, F(ab')2 фрагменты можно выделять непосредственно из культуры рекомбинантных клеток-хозяев. Fab и F(ab')2 фрагмент с увеличенным временем полужизни in vivo, содержащий остатки эпитопа связывания рецептора спасения, описаны в патенте США № 5869046. Другие способы получения фрагментов антител очевидны практикующим специалистам. В определенных вариантах осуществления антитело представляет собой одноцепочечный Fv фрагмент (scFv). См. WO 93/16185; патенты США №№ 5571894 и 5587458. Fv и scFv представляют собой лишь частицы с интактными антигенсвязывающими участками, которые лишены константных областей; таким образом, они могут подходить для ослабленного неспецифического связывания во время использования in vivo. scFv слитные белки можно конструировать для получения слияния эффекторного белка на амино- или карбоксиконце scFv. См. Antibody Engineering, ed. Borrebaeck, выше. Фрагмент антитела также может представлять собой «линейное антитело», например, как описано в патенте США № 5641870. Такие линейные антитела могут быть моноспецифическими или биспецифическими.

Гуманизированные антитела

Данное изобретение относится к гуманизированным антителам. Различные способы гуманизации не принадлежащих человеку антител известны в данной области. Например, гуманизированное антитело может иметь один или несколько аминокислотных остатков, введенных в него из источника, который не относится к человеку. Эти не принадлежащие человеку аминокислотные остатки часто обозначают как «импортные» остатки, которые типично берут из «импортного» вариабельного домена. Гуманизацию можно по существу выполнять, придерживаясь способа согласно Winter'y и его коллегам (Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239: 1534-1536), посредством замены последовательностями гипервариабельной области соответствующих последовательностей антитела человека. Соответственно, такие «гуманизированные» антитела представляют собой химерные антитела (патент США № 4816567), где по существу менее чем интактный вариабельный домен человека заменен на соответствующую последовательность из видов, не являющихся человеком. На практике, гуманизированные антитела типично представляют собой антитела человека, в которых некоторые остатки гипервариабельной области и, возможно, некоторые остатки FR заменяют на остатки из аналогичных участков в антителах грызунов.

Выбор вариабельных доменов человека, как легких, так и тяжелых, подлежащих использованию в создании гуманизированных антител, может быть важен для снижения антигенности. Согласно так называемому способу «наилучшего соответствия», проводят скрининг последовательности вариабельного домена антитела грызуна против целой библиотеки известных последовательностей вариабельного домена человека. Последовательность человека, которая ближе всего к таковой грызуна, затем принимают в качестве каркасной области человека для гуманизированного антитела. См., например, Sims et al. (1993) J. Immunol. 151:2296; Chothia et al. (1987) J. Mol. Biol. 196:901. В другом способе используют конкретную каркасную область, полученную из консенсусной последовательности всех антител человека конкретной подгруппы легких или тяжелых цепей. Одну и ту же каркасную область можно использовать для нескольких различных гуманизированных антител. См., например, Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol, 151:2623.

Кроме того, как правило, желательно, чтобы антитела гуманизировали с сохранением высокой аффинности к антигену и других благоприятных биологических свойств. Чтобы достичь этой цели, согласно одному способу, гуманизированные антитела получают посредством процесса анализа родительских последовательностей и различных предполагаемых гуманизированных продуктов с использованием трехмерных моделей родительских и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов обычно доступны и знакомы специалистам в данной области. Доступны компьютерные программы, которые иллюстрируют и отображают возможные трехмерные конформационные структуры отобранных рассматриваемых последовательностей иммуноглобулинов. Исследование такого представления делает возможным анализ вероятной роли остатков в функционировании рассматриваемой последовательности иммуноглобулина, т.е., анализ остатков, которые влияют на способность рассматриваемого иммуноглобулина связывать свой антиген. Таким образом, остатки FR можно выбирать и комбинировать из реципиентной и импортной последовательностей с тем, чтобы достичь желаемой характеристики антитела, такой как увеличенная аффинность к антигену(ам)-мишени(ям). В целом, остатки гипервариабельной области непосредственно и в наибольшей степени участвуют во влиянии на связывание антигена.

Антитела человека

Антитела человека по изобретению можно сконструировать посредством комбинирования последовательности(ей) вариабельного домена Fv клона, выбранного из библиотек фагового дисплея, полученных от человека, с известными последовательностями константного домена человека, как описано выше. Альтернативно, моноклональные антитела человека по изобретению можно получать гибридомным способом. Описаны линии миеломных клеток человека и гетеромиеломных клеток мыши-человека для получения моноклональных антител человека, например, авторами Kozbor J. Immunol, 133: 3001 (1984); Brodeur et al, Monoclonal Antibody Production Methods and Applications, стр. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al, J. Immunol, 147: 86 (1991).

Теперь можно получать трансгенных животных (например, мышей), которые после иммунизации способны продуцировать полный репертуар антител человека в отсутствие продукции эндогенных иммуноглобулинов. Например, описано, что гомозиготная делеция гена соединительной области (JH) тяжелой цепи антитела в химерных мутантных мышах и мутантных мышах зародышевой линии ведет к полному ингибированию продукции эндогенных антител. Перенос массива генов иммуноглобулинов зародышевой линии человека в таких мутантных мышей зародышевой линии приведет к продукции антител человека после антигенной стимуляции. См., например, Jakobovits et al, Proc. Natl. Acad. Sci USA, 90: 2551 (1993); Jakobovits et al, Nature, 362: 255 (1993); Bruggermann et al, Year in Immunol, 7:33 (1993).

Шаффлинг генов также можно использовать для получения антител человека из антител, не принадлежащих человеку, например, антител грызуна, где антитело человека обладает схожими аффинностями и специфичностями относительно начального не принадлежащего человеку антитела. Согласно этому способу, который также называют «эпитопным импринтингом», вариабельную область тяжелой или легкой цепи фрагмента не принадлежащего человеку антитела, полученного способами фагового дисплея, как описано в настоящем документе, заменяют на репертуар генов V-домена человека, создавая популяцию химер scFv или Fab с не принадлежащими человеку цепями/цепями человека. Отбор с антигеном ведет к выделению химерных scFv или Fab с не принадлежащими человеку цепями/цепями человека, где цепь человека восстанавливает антигенсвязывающий участок, разрушенный при удалении соответствующей не принадлежащей человеку цепи в первичном клоне фагового дисплея, т.е. эпитоп определяет (закрепляет) выбор партнера цепи человека. Когда процесс повторяют для того, чтобы заменить оставшуюся принадлежащую человеку цепь, получают антитело человека (см. PCT WO 93/06213, публикация от 1 апреля 1993 г.). В отличие от традиционной гуманизации не принадлежащих человеку антител посредством пересадки HVR, этот способ предоставляет полностью человеческие антитела, которые не содержат остатки FR или HVR не относящегося к человеку происхождения.

Полиспецифические антитела

Один из примеров полиспецифического антитела по данному изобретению включает антитело, которое связывается с Bv8 и другой антиген. В других вариантах осуществления полиспецифические антитела могут связываться с двумя различными эпитопами Bv8. Полиспецифические антитела также можно использовать, чтобы локализовать цитотоксические средства в клетках, которые экспрессируют Bv8. Эти антитела обладают Bv8-связывающим плечом и плечом, которое связывает цитотоксическое средство, такое как, например, сапорин, антиинтерферон-α, алкалоид барвинка, цепь A рицина, метотрексат или гаптен с радиоактивным изотопом. Полиспецифические антитела можно получать в виде полноразмерных антител или фрагментов антител {например, F(ab')2 биспецифических антител).

В данной области описаны различные способы создания биспецифических антитела. В одном из первых подходов используют совместную экспрессию двух пар из тяжелой цепи и легкой цепи иммуноглобулина, где две тяжелые цепи имеют различные специфичности (Milstein and Cuello, Nature, 305: 537 (1983)). Вследствие случайного выбора тяжелой и легкой цепей иммуноглобулина, эти гибридомы (квадромы) продуцируют потенциальную смесь из 10 различных молекул антител, среди которых только одна имеет правильную биспецифическую структуру. Очистка правильной молекулы, которую обычно осуществляют посредством стадий аффинной хроматографии, является достаточно тяжелой, и имеет низкий выход продукта. Схожие процедуры раскрыты в WO 93/08829, опубликованной 13 мая 1993 года, и в Traunecker et al, EMBO J., 10: 3655 (1991).

Согласно другому подходу, вариабельные домены антитела сливают с последовательностями константного домена иммуноглобулина. Слияние происходит, например, с константным доменом тяжелой цепи иммуноглобулина, содержащим, по меньшей мере, часть шарнирной, CH2, и CH3 областей. В определенных вариантах осуществления первая константная область тяжелой цепи (CH1) присутствует по меньшей мере в одном из слитых белков. ДНК, кодирующие слитые белки тяжелой цепи иммуноглобулина и, при желании, легкую цепь иммуноглобулина, встраивают в отдельные экспрессирующие векторы, и совместно трансфицируют в подходящий организм-хозяин. Это предусматривает значительную гибкость в коррекции взаимных количественных отношений трех полипептидных фрагментов в вариантах осуществления, когда неравные соотношения трех полипептидных цепей, используемых в конструкции, обеспечивают оптимальный выход. Однако, можно встраивать кодирующие последовательности для двух или всех трех полипептидных цепей в один экспрессирующий вектор, когда экспрессия по меньшей мере двух полипептидных цепей в равных соотношениях ведет к высокому выходу или когда соотношения не имеют конкретного значения.

В одном из вариантов осуществления этого подхода биспецифические антитела состоят из гибридной тяжелой цепи иммуноглобулина с первой специфичностью связывания в одном плече и пары гибридной тяжелой цепи и легкой цепи иммуноглобулина (обеспечивающей вторую специфичность связывания) в другом плече. Обнаружено, что эта асимметричная структура облегчает отделение желаемого биспецифического соединения от нежелательных комбинаций цепей иммуноглобулина, поскольку присутствие легкой цепи иммуноглобулина только в половине биспецифической молекулы предусматривает гибкий путь для разделения. Этот подход раскрыт в WO 94/04690. Более подробно о создании биспецифических антител см., например, в Suresh et al, Methods in Enzymology, 121:210 (1986).

Согласно другому подходу, технология «выступ во впадину» или «KnH» относится к технологии, которая управляет образованием пар двух полипептидов in vitro или in vivo посредством введения выпячивания (выступа) в один полипептид и полости (впадины) в другой полипептид на область контакта, на которой они взаимодействуют. Например, KnH вводили в области связывания Fc:Fc, области контакта CL:CH1 или области контакта VH/VL антител (например, US20007/0178552, WO 96/027011, WO 98/050431 и Zhu et al. (1997) Protein Science 6:781-788). Это особенно эффективно в управлении образованием пар двух различных тяжелых цеп во время производства полиспецифических антител. Например, полиспецифические антитела, содержащие KnH в своих Fc-областях, могут дополнительно содержать одни вариабельные домены, связанные с каждой Fc-областью, или дополнительно содержать различные вариабельные домены тяжелой цепи, которые образуют пары со схожими или различными вариабельными доменами легких цепей. Согласно одному из вариантов осуществления одну или несколько аминокислот с небольшими боковыми цепями из области контакта первой молекулы антитела заменяют на более крупные боковые цепи (например, тирозин или триптофан). Компенсирующие «полости» идентичного или схожего размера для большой боковой цепи(ей) создают на поверхности области контакта второй молекулы антитело посредством замены аминокислот с большими боковыми цепями на меньшие (например, аланин или треонин). Это предоставляет механизм для повышения выхода гетеродимера относительно других нежелательных конечных продуктов, таких как гомодимеры.

Полиспецифические антитела включают сшитые или «гетероконъюгированные» антитела. Например, одно из антител в гетероконъюгате может быть связано с авидином, другое с биотином. Такие антитела предложены, например, для нацеливания клеток иммунной системы на нежелательные клетки (патент США № 4676980), и для лечения ВИЧ-инфекции (WO 91/00360, WO 92/00373 и EP 03089). Гетероконъюгированные антитела можно создавать с использованием любого удобного способа введения перекрестных сшивок. Известны подходящие сшивающие средства и способы (например, патент США № 4676980).

Способы создания полиспецифических антител из фрагментов антител также описаны в литературе. Например, биспецифические антитела можно получать с использованием химической связи. Brennan et al, Science, 229: 81 (1985) описывают процедуру, где интактные антитела протеолитически расщепляют для создания F(ab')2 фрагментов. Эти фрагменты восстанавливают в присутствие дитиолового комплексообразующего средства арсенит натрия для стабилизации винициальных дитиолов и предотвращения образования межмолекулярных дисульфидов. Затем созданные фрагменты Fab' превращают в производные тионитробензоата (TNB). Затем одно из производных Fab'-TNB повторно превращают в Fab'-тиол восстановлением с меркаптоэтиламином и смешивают с эквимолярным количеством другого производного Fab'-TNB, чтобы сформировать биспецифическое антитело. Получаемые биспецифические антитела можно использовать в качестве средств для избирательной иммобилизации ферментов.

Fab'-SH фрагменты можно извлекать из E. coli и химически сопрягать для формирования биспецифических антител. Shalaby et al, J. Exp. Med., 175: 217-225 (1992) описывают получение молекулы F(ab')2 полностью гуманизированного биспецифического антитела. Каждый фрагмент Fab' отдельно секретировали из E. coli и подвергали направленному химическому связыванию in vitro для формирования биспецифического антитела. Таким образом сформированное биспецифическое антитело способно связываться с клетками, осуществляющими сверхэкспрессию HER2 рецептора, и нормальными T-клетками человека, а также запускать литическую активность цитотоксических лимфоцитов человека против мишеней опухоли молочной железы человека.

Также описаны различные способы создания и выделения фрагментов биспецифических антител непосредственно из культуры рекомбинантных клеток. Например, получали биспецифические антитела с использованием лейциновых молний. Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992). Пептиды лейциновой молнии из белков Fos и Jun связывали с Fab' частями двух различных антител посредством слияния генов. Гомодимеры антител восстанавливали в шарнирной области, чтобы сформировать мономеры, и затем повторно окисляли, чтобы сформировать гетеродимеры антител. Этот способ также можно использовать для получения гомодимеров антител. Технология «диател», описанная авторами Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993), предоставляет альтернативный механизм для создания фрагментов биспецифических антител. Фрагменты содержат вариабельный домен тяжелой цепи (VH), соединенный с вариабельным доменом легкой цепи (VL) линкером, который слишком короток, чтобы сделать возможным образование пар между двумя доменами в одной и той же цепи. Соответственно, домены VH и VL одного фрагмента заставляют образовывать пары с комплементарными доменами VL и VH другого фрагмента, тем самым формируя два участка связывания антигена. Также сообщалось о другой стратегии создания фрагментов биспецифических антител с помощью димеров одноцепочечных Fv (sFv). См. Gruber et al, J. Immunol, 152:5368 (1994).

Предусмотрены антитела с более чем двумя валентностями. Например, можно получать триспецифические антитела. Tutt et al. J. Immunol. 147: 60 (1991).

Поливалентные антитела

Поливалентное антитело может быть интернализировано (и/или катаболизировано) быстрее, чем бивалентное антитело, клеткой, экспрессирующей антиген, с которым связываются антитела. Антитела по настоящему изобретению могут представлять собой поливалентные антитела (другого класса, чем IgM) с тремя или более антигенсвязывающими участками (например, тетравалентные антитела), которые можно легко получать с помощью рекомбинантной экспрессии нуклеиновой кислоты, кодирующей полипептидные цепи антитела. Поливалентное антитело может содержать домен димеризации и три или более антигенсвязывающих участка. В определенных вариантах осуществления домен димеризации содержит (или состоит из) Fc-области или шарнирной области. В этом сценарии антитело будет содержать Fc-область и три или более антигенсвязывающих участка на аминоконце Fc-области. В определенных вариантах осуществления поливалентное антитело содержит (или состоит из) от трех приблизительно до восьми антигенсвязывающих участков. В одном из таких вариантов осуществления поливалентное антитело содержит (или состоит из) четырех антигенсвязывающих участков. Поливалентное антитело содержит по меньшей мере одну полипептидную цепь (например, две полипептидные цепи), где полипептидная цепь(и) содержит два или более вариабельных домена. Например, полипептидная цепь(и) может содержать VD1-(X1)n-VD2-(X2)n-Fc, где VD1 представляет собой первый вариабельный домен, VD2 представляет собой второй вариабельный домен, Fc представляет собой одну полипептидную цепь Fc-области, X1 и X2 представляют аминокислоту или полипептид, и n равен 0 или 1. Например, полипептидная цепь(и) может содержать: цепь VH-CH1-гибкий линкер-VH-CH1-Fc-область; или цепь VH-CH1-VH-CH1-Fc-область. Поливалентное антитело в настоящем документе дополнительно может содержать по меньшей мере два (например, четыре) полипептида вариабельного домена легкой цепи. Поливалентное антитело в настоящем документе может, например, содержать приблизительно от двух приблизительно до восьми полипептидов вариабельного домена легкой цепи. Предполагаемые здесь полипептиды вариабельного домена легкой цепи содержат вариабельный домен легкой цепи и, необязательно, дополнительно содержат домен CL.

Однодоменные антитела

В определенных вариантах осуществления антитело против Bv8 по изобретению представляет собой однодоменное антитело. Однодоменное антитело представляет собой одну полипептидную цепь, содержащую весь вариабельный домен тяжелой цепи антитела или его часть или весь вариабельный домен легкой цепи антитела или его часть. В определенных вариантах осуществления однодоменное антитело представляет собой однодоменное антитело человека (Domantis, Inc., Waltham, MA; см., например, патент США № 6248516 B1). В одном из вариантов осуществления однодоменное антитело состоит из всего вариабельного домена тяжелой цепи антитела или его части.

Варианты антител

В некоторых вариантах осуществления предусмотрена модификация(и) аминокислотных последовательностей антител против Bv8, описанных в настоящем документе. Например, может быть желательно улучшить аффинность связывания и/или другие биологические свойства антитела. Варианты аминокислотной последовательности антитела можно получать посредством введения подходящих изменений в нуклеотидную последовательность, кодирующую антитело, или посредством синтеза пептидов. Такие модификации включают, например, делеции и/или инсерции и/или замены остатков в аминокислотных последовательностях антитела. Можно создавать любые комбинации делеций, инсерций и замен для того, чтобы прийти к конечной конструкции, при условии, что конечная конструкция обладает желаемыми характеристиками. Изменения аминокислот можно вводить в аминокислотную последовательность антитела субъекта во время создания этой последовательности.

Эффективный способ идентификации определенных остатков или областей антитела, которые являются предпочтительными местоположениями для мутагенеза, называют «сканирующим аланиновым мутагенезом», как описано авторами Cunningham and Wells (1989) Science, 244: 1081-1085. Здесь остаток или группу остатков-мишеней идентифицируют (например, заряженные остатки, такие как arg, asp, his, lys и glu) и заменяют нейтральной или отрицательно заряженной аминокислотой (например, аланином или полиаланином), чтобы повлиять на взаимодействие аминокислот с антигеном. Затем те аминокислотные положения, которые демонстрируют функциональную чувствительность к заменам, уточняют посредством введения дополнительных или других вариантов в участки замены. Таким образом, несмотря на то, что участок для введения вариации аминокислотной последовательности определяют предварительно, свойства мутации per se не нужно определять предварительно. Например, чтобы анализировать характеристики мутации в заданном участке, в кодоне- или области-мишени проводят сканирующий аланиновый или случайный мутагенез и проводят скрининг экспрессируемых иммуноглобулинов на желаемую активность.

Инсерции аминокислотной последовательности включают амино- и/или карбоксиконцевые слияния, длина которых варьирует от одного остатка до полипептидов, содержащий сотню остатков или более, а также инсерции одного или нескольких аминокислотных остатков внутри последовательности. Примеры концевых инсерций включают антитело с N-концевым остатком метионила. Другие варианты инсерций в молекулу антитела включают слияние с N- или C-конца антитела с ферментом (например, для ADEPT) или полипептидом, который увеличивает время полужизни в сыворотке антитела.

В определенных вариантах осуществления антитело по изобретению изменяют для увеличения или уменьшения степени гликозилирования антитела. Гликозилирование полипептидов типично является N-связанным или O-связанным. «N-связанный» относится к прикреплению молекулы углевода к боковой цепи остатка аспарагина. Трипептидные последовательности аспарагин-X-серин и аспарагин-X-треонин, где X представляет собой любую аминокислоту, за исключением пролина, являются последовательностями распознавания для ферментативного прикрепления молекулы углевода к боковой цепи аспарагина. Таким образом, присутствие любой из этих трипептидных последовательностей в полипептиде создает потенциальный участок гликозилирования. «O-связанное гликозилирование» относится к прикреплению одного из сахаров N-ацетилгалактозамина, галактозы или ксилозы к гидроксиаминокислоте, чаще всего, к серину или треонину, несмотря на то, что также можно использовать 5-гидроксипролин или 5-гидроксилизин.

Вставка или делеция участков гликозилирования в антитело удобно осуществлять посредством измерения аминокислотной последовательности так, чтобы создавать или удалять один или несколько из описанных выше последовательностей трипептидов (для участков N-связанного гликозилирования). Изменение также можно выполнять посредством вставки, делеции или замены одного или нескольких остатков серина или треонина в последовательности исходного антитела (для участков O-связанного гликозилирования).

Когда антитело содержит Fc-область, прикрепленный к ней углевод может быть изменен. Нативные антитела, продуцируемые клетками млекопитающих, типично содержат разветвленный, биантеннарный олигосахарид, который, как правило, прикрепляют посредством N-связи с Asn297 домена CH2 Fc-области. См., например, Wright et al. (1997) TIBTECH 15:26-32. Олигосахарид может содержать различные углеводы, например, маннозу, N-ацетилглюкозамин (GlcNAc), галактозу и сиаловую кислота, а также фукозу, прикрепленную к GlcNAc в «стволе» биантеннарной олигосахаридной структуры. В некоторых вариантах осуществления модификации олигосахарида в антителе по изобретению можно создавать для того, чтобы создавать варианты антител с определенными улучшенными свойствами.

Например, предусмотрены варианты антител, обладающие углеводной структурой, в которой отсутствует фукоза, прикрепленная (непосредственно или опосредованно) к Fc-области. Такие варианты могут обладать улучшенной функцией АЗКЦ. См., например, публикации патентов США №№ US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Примеры публикаций, связанных с «дефукозилированными» или «фукозодефицитными» вариантами антител включают: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Примеры клеточных линий, способных продуцировать дефукозилированные антитела, включают клетки Lec13 CHO с дефицитом фукозилирования белка (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); патентая заявка США № US 2003/0157108 A1, Presta, L; и WO 2004/056312 A1, Adams et al., в частности, в примере 11), и клеточные линии с нокаутом, такие как клетки CHO с нокаутом гена α-1,6-фукозилтрансферазы, FUT8 (см., например, Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al, Biotechnol. Bioeng., 94(4):680-688 (2006); и WO 2003/085107).

Кроме того, предусмотрены варианты антител с разделенными надвое олигосахаридами, например, в которых биантеннарный олигосахарид, прикрепленный к Fc-области антитела, разделен надвое посредством GlcNAc. Такие варианты антител могут иметь сниженное фукозилирование и/или улучшенную функцию АЗКЦ. Примеры таких вариантов антител описаны, например, в WO 2003/011878 (Jean-Mairet et al); патенте США № 6602684 (Umana et al); и US 2005/0123546 (Umana et al). Также предусмотрены варианты антител с по меньшей мере одним остатком галактозы в олигосахариде, прикрепленном к Fc-области. Такие варианты антител могут обладать улучшенной функцией КЗЦ. Такие варианты антител описаны, например, в WO 1997/30087 (Patel et al); WO 1998/58964 (Raju, S.); и WO 1999/22764 (Raju, S.).

В определенных вариантах осуществления вариант антитела содержит Fc-область с одной или несколькими заменами аминокислот, которые дополнительно улучшают АЗКЦ, например, заменами в положениях 298, 333 и/или 334 Fc-области (нумерация остатков по Eu). Такие замены могут возникать в комбинации с любой из вариаций, описанных выше.

В определенных вариантах осуществления изобретение относится к варианту антитела, который обладает некоторыми, но не всеми эффекторными функциями, которые делают его желательным кандидатом для многих применений, в которых время полужизни антитела in vivo имеет значение, тогда как определенные эффекторные функции (такие как комплемент и АЗКЦ) являются необязательными или вредоносными. В определенных вариантах осуществления Fc активности антитела измеряют для того, чтобы гарантировать, что сохранены только желаемые свойства. Анализы цитотоксичности in vitro и/или in vivo можно проводить для того, чтобы подтвердить снижение/ослабление КЗЦ и/или АЗКЦ активностей. Например, анализы связывания Fc рецептора (FcR) можно проводить для того, чтобы гарантировать, что у антитела отсутствует связывание FcγR (таким образом, вероятно, отсутствует АЗКЦ активность), но сохраняется способность связывать FcRn. Основные клетки, опосредующие АЗКЦ, NK клетки, экспрессируют только FcγRIII, тогда как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. экспрессия FcR на гематопоэтических клетках резюмирована в таблице 3 на странице 464 в Ravetch and Kinet, Annu. Rev. Immunol. 9:457-92 (1991). Неограничивающие примеры анализов in vitro для оценки АЗКЦ активности молекулы, представляющей интерес, описаны в патенте США № 5500362 (см., например, Hellstrom, I., et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) и Hellstrom, I et al, Proc. Nat'l Acad. Sci. USA 82: 1499-1502 (1985); 5821337 (см. Bruggemann, M. et al, J. Exp. Med. 166: 1351-1361 (1987)). Альтернативно, можно использовать способы нерадиоактивного анализа (см., например, нерадиоактивный анализ цитотоксичности ACTI™ для проточной цитометрии (CellTechnology, Inc. Mountain View, CA; и CytoTox 96® нерадиоактивный анализ цитотоксичности (Promega, Madison, WI). Эффективные эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (PBMC) и клетки естественные киллеры (NK). Альтернативно или дополнительно, АЗКЦ активность молекулы, представляющей интерес, можно оценивать in vivo, например, в модели на животном, такой как та, что раскрыта в Clynes et al. roc. Nat Acad. Sci. USA 95:652-656 (1998). Также можно осуществлять анализы связывания C1q, чтобы подтвердить, что антитело неспособно связывать C1q и, таким образом, не обладает КЗЦ активностью. Для оценки активации комплемента, можно осуществлять анализ КЗЦ (см., например, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al, Blood 101: 1045-1052 (2003); и Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)). Связывание FcRn и определение клиренса/времени полужизни in vivo также можно осуществлять с использованием известных в данной области способов (см., например, Petkova, S.B. et al, Int'l. Immunol. 18(12): 1759-1769 (2006)).

Предусмотрены другие варианты антител, содержащих одну или несколько замен аминокислот. Участки, представляющие интерес, для заменяющего мутагенеза включают гипервариабельные области, но изменения FR также предусмотрены. Консервативные замены представлены в таблице 1 под заголовком «предпочтительные замены». Более существенные изменения, обозначенные «образцовые замены» представлены в таблице 1, или как дополнительно описано ниже в отношении классов аминокислот. Замены аминокислот можно вводить в антитело, представляющее интерес, и проводить скрининг продуктов, например, по желаемой активности, такой как улучшенное связывание антигена, сниженная иммуногенность, улучшенная АЗКЦ или КЗЦ и т.д.

Таблица 1
Исходный остаток Образцовые замены Предпочтительные замены
Ala (A) Val; Leu; Ile Val
Arg (R) Lys; Gln; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly (G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; норлейцин Leu
Leu (L) Норлейцин; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; Ile Leu
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; Норлейцин Leu

Модификации биологических свойств антитела можно выполнять посредством выбора замен, которые оказывают влияние на (a) структуру полипептидного остова в области замены, например, такую как конформацию листа или спирали, (b) заряд или гидрофобность молекулы в участке-мишени или (c) величину боковой цепи. Аминокислоты можно сгруппировать в соответствии со сходством в свойствах их боковых цепей (в A. L. Lehninger, in Biochemistry, второе издание, стр. 73-75, Worth Publishers, New York (1975)):

(1) неполярные: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M)

(2) незаряженные полярные: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q)

(3) кислые: Asp (D), Glu (E)

(4) основные: Lys (K), Arg (R), His(H)

Альтернативно, встречающиеся в природе остатки можно разделить на группы, основываясь на общих свойствах боковой цепи:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

(3) кислые: Asp, Glu;

(4) основные: His, Lys, Arg;

(5) остатки, которые влияют на ориентацию цепи: Gly, Pro;

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены повлекут замену члена одного из этих классов на другой класс. Такие замененные остатки также можно вводить в участки консервативных замен или в остальные (неконсервативные) участки.

Один тип варианта с заменами включает замену одного или нескольких остатков гипервариабельной области родительского антитела (например, гуманизированного антитела или антитела человека). Как правило, получаемый вариант(ы), отобранный для дальнейшей разработки, будет иметь модифицированные (например, улучшенные) биологические свойства по отношению к родительскому антителу, из которого его создают. Образцовый вариант с заменами представляет собой аффинно зрелое антитело, которое можно удобно создавать с использованием способов созревания аффинности на основе фагового дисплея. В кратком изложении, проводят созревание в нескольких сайтах гипервариабельной области (например, в 6-7 сайтах), чтобы создать все возможные замены аминокислот в каждом сайте. Созданные таким образом антитела представляют на частицах нитчатого фага в виде слитых белков по меньшей мере с частью белка оболочки фага (например, продукт гена III из M13), упакованных в каждую частицу. Затем проводят скрининг представленных на фаге вариантов по их биологической активности (например, аффинности связывания). Для того чтобы идентифицировать сайты-кандидаты гипервариабельной области для модификации, можно осуществлять сканирующий мутагенез (например, сканирование аланином), чтобы идентифицировать остатки гипервариабельной области, которые вносят значительный вклад в связывание антигена. Альтернативно или дополнительно, может быть полезным анализ кристаллической структуры комплекса антиген-антитело, чтобы идентифицировать точки контакта между антителом и антигеном. Такие контактные остатки и соседние остатки являются кандидатами на замену в соответствии со способами, известными в данной области, включая те, что выработаны в настоящем документе. После создания таких вариантов, панель вариантов подвергают скринингу с применением известных в данной области способов, включая те, что описаны в настоящем документе, и варианты с лучшими свойствами в одном или нескольких релевантных анализах можно выбрать для дальнейшей разработки.

Молекулы нуклеиновой кислоты, кодирующие варианты аминокислотных последовательностей антитела получают посредством различных известных в данной области способов. Эти способы включают в качестве неограничивающих примеров, выделение из природного источника (в случае встречающихся в природе вариантов аминокислотных последовательностей) или получение опосредованным олигонуклеотидами (или сайт-специфическим) мутагенезом, ПЦР мутагенезом и кассетным мутагенезом ранее полученного варианта или невариантной версии антитела.

Может быть желательным ввести одну или несколько модификаций аминокислот в Fc-область антител по изобретению, тем самым создавая вариант Fc-области. Вариант Fc-области может содержать последовательность Fc-область человека (например, Fc-область IgG1, IgG2, IgG3 или IgG4 человека), содержащую модификацию аминокислоты (например, замену) в одном или нескольких аминокислотных положениях, включая положения цистеина шарнирной области.

В соответствии с этим описанием и положениями в данной области, предусмотрено, что в некоторых вариантах осуществления антитело по изобретению может содержать одно или несколько изменений по сравнению с аналогичным антителом дикого типа, например, в Fc-области. Тем не менее, эти антитела будут сохранять по существу аналогичные характеристики, необходимые для терапевтической полезности по сравнению с их аналогом дикого типа. Например, полагают, что определенные изменения можно создавать в Fc-области, которые приведут к измененным (т.е., улучшенным или ухудшенным) связыванию C1q и/или комплемент-зависимой цитотоксичности (КЗЦ), например, как описано в W099/51642. См. также Duncan & Winter, Nature 322:738-40 (1988); патент США № 5648260; патент США № 5624821; и WO 94/29351 в отношении других примеров вариантов Fc-области. В WO 00/42072 (Presta) и WO 2004/056312 (Lowman) описаны варианты антител с улучшенным или ухудшенным связыванием с FcR. Также см. Shields et al. J. Biol. Chem. 9(2): 6591-6604 (2001). Антитела с увеличенным временем полужизни и улучшенным связыванием с неонатальным рецептором Fc (FcRn), который отвечает за перенос материнских IgG в плод (Guyer et al., J. Immunol. 117:587 (1976) и Kim et al, J. Immunol. 24:249 (1994)), описаны в US2005/0014934A1 (Hinton et al.). Эти антитела содержат Fc-область с одной или несколькими заменами в ней, которые улучшают связывание Fc-области с FcRn. Варианты полипептидов с измененными аминокислотными последовательностями Fc-области и повышенной или пониженной способностью к связыванию C1q описаны в патенте США № 6194551B1, WO 99/51642. Также см. Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

В другом аспекте изобретение относится к антителам, содержащим модификации в области контакта Fc полипептидов, содержащих Fc-область, где модификации облегчают гетеродимеризацию и/или содействуют ей. Эти модификации содержат введение выступа в первый полипептид Fc и полости во второй полипептид Fc, где выступ может расположиться в полости с тем, чтобы содействовать образованию комплекса первого и второго полипептидов Fc. Способы создания антител с этими модификациями известны в данной области, например, как описано в патенте США № 5731168.

В еще одном аспекте может быть желательным создать антитела, сконструированные с использованием цистеина, например, «тиоМАт», в которых один или несколько остатков антитела заменяют остатками цистеина. В конкретных вариантах осуществления замененные остатки встречаются в доступных участках антитела. Заменяя эти остатки на цистеин, тем самым размещают реакционноспособные тиоловые группы в доступных участках антитела и их можно использовать, чтобы конъюгировать антитело с другими фрагментами, такими как фрагменты лекарственных средств или фрагменты линкер-лекарственное средство, как описано дальше в настоящем документе. В определенных вариантах осуществления любой один или несколько следующих остатков могут быть заменены на цистеин: V205 (нумерация по Kabat'y) легкой цепи; A118 (нумерация по EU) тяжелой цепи; и S400 (нумерация по EU) Fc-области тяжелой цепи.

Производные антител

Антитела против Bv8 по настоящему изобретению дополнительно можно модифицировать, чтобы они содержали дополнительные небелковые фрагменты, которые известны в данной области и легко доступны. Предпочтительно, фрагментами, подходящими для получения производных антитела, являются водорастворимые полимеры. Неограничивающие примеры водорастворимых полимеров включают в качестве неограничивающих примеров полиэтиленгликоль (PEG), сополимеры этиленгликоля/пропиленгликоля, карбоксиметилцеллюлозу, декстран, поливиниловый спирт, поливинилпирролидон, поли-1,3-диоксолан, поли-1,3,6-триоксан, сополимер этилена/малеинового ангидрида, полиаминокислоты (или гомополимеры или статистические сополимеры) и декстран или поли(н-винилпирролидон)полиэтиленгликоль, гомополимеры пропиленгликоля, сополимеры полипропиленоксида/этиленоксида, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт и их смеси. Полиэтиленгликольпропиональдегид может обладать преимуществами в производстве вследствие его стабильности в воде. Полимер может иметь любую молекулярную массу и может быть разветвленным или неразветвленным. Число полимеров, прикрепленных к антителу, может варьировать, и если прикреплен более чем один полимер, они могут представлять собой одинаковые или различающиеся молекулы. В целом, число и/или тип полимеров, используемых для получения производных, можно определять, основываясь на соображениях, которые включают в качестве неограничивающих примеров конкретные свойства или функции антитела, подлежащие улучшению, будет ли производное антитела использовано в терапии при определенных условиях и т.д.

В другом варианте осуществления предусмотрены конъюгаты антитела и небелкового фрагмента, которые можно избирательно нагревать посредством воздействия излучения. В одном из вариантов осуществления небелковый фрагмент представляет собой углеродную нанотрубку (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). Излучение может иметь любую длину волны, и она включает в качестве неограничивающих примеров длины волны, которые не повреждают обычные клетки, но которые нагревают небелковый фрагмент до температуры, при которой гибнут клетки, расположенные близко к антителу-небелковому фрагменту.

Анализ активности

Антитела по настоящему изобретению можно охарактеризовать по их физическим/химическим свойствам и биологическим функциям с помощью различных анализов, известных в данной области.

В одном из аспектов предусмотрены анализы для идентификации антител против Bv8, обладающих биологической активностью. Биологическая активность может включать, например, модуляцию одного или нескольких аспектов эффектов, ассоциированных с Bv8, включая в качестве неограничивающих примеров связывание Bv8, опосредованную Bv8 пролиферацию клеток эндотелия, метастазирование опухоли.

В определенных вариантах осуществления иммуноглобулины, получаемые в настоящем документе, анализируют на их биологическую активность. В некоторых вариантах осуществления иммуноглобулины по настоящему изобретению тестируют на их активность связывания антигена. Анализы связывания антигена, которые известны в данной области и можно использовать в настоящем документе, включают без ограничения любые прямые анализы или анализы конкурентного связывания с использованием таких способов, как вестерн-блоттинг, радиоиммунный анализ, ELISA (твердофазный иммуноферментный анализ), иммунологический «сэндвич-анализ», анализ иммунопреципитации, флуоресцентный иммуноанализ и иммунологический анализ с белком A. Иллюстративный анализ связывания антигена предоставлен ниже в разделе с примерами.

Очищенные антитела дополнительно можно охарактеризовать с помощью серии анализов, включая в качестве неограничивающих примеров N-концевое секвенирование, анализ аминокислот, неденатурирующую эксклюзионную жидкостную хроматографию высокого давления (ВЭЖХ), масс-спектрометрию, ионообменную хроматографию и расщепление папаином.

В некоторых вариантах осуществления настоящее изобретение рассматривает измененные антитела, которые обладают некоторыми, но не всеми эффекторными функциями, которые делают его желательным кандидатом для многих применений, в которых время полужизни антитела in vivo имеет значение, тогда как определенные эффекторные функции (такие как комплемент и АЗКЦ) необязательны или вредоносны. В определенных вариантах осуществления Fc активности получаемого иммуноглобулина измеряют для того, чтобы гарантировать, что сохранены только желаемые свойства. Анализы цитотоксичности in vitro и/или in vivo можно проводить для подтверждения снижения/уменьшения КЗЦ и/или АЗКЦ активностей. Например, анализы связывания Fc рецептора (FcR) можно проводить для того, чтобы гарантировать, что у антитела отсутствует связывание FcγR (таким образом, вероятно, отсутствует АЗКЦ активность), но сохранена способность связывать FcRn. Основные клетки, опосредующие АЗКЦ, NK клетки, экспрессируют только FcγRIII, тогда как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Экспрессия FcR на гематопоэтических клетках резюмирована в таблице 3 на странице 464 в Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). Пример анализа in vitro для оценки АЗКЦ активности молекулы, представляющей интерес, описан в патентах США №№ 5500362 или 5821337. Эффективные эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (PBMC) и клетки естественные киллеры (NK). Альтернативно или дополнительно, АЗКЦ активность молекулы, представляющей интерес, можно оценивать in vivo, например, в модели на животном, такой как та, что раскрыта в Clynes et al. PNAS (USA) 95:652-656 (1998). Анализы связывания C1q также можно осуществлять для подтверждения того, что антитело не способно связывать C1q и, таким образом, не обладает КЗЦ активностью. Чтобы оценить активацию комплемента, можно осуществлять анализ КЗЦ, например, как описано в Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996). Также можно осуществлять определение связывания FcRn и клиренс/время полужизни in vivo с использованием известных в данной области способов.

В некоторых вариантах осуществления изобретение относится к измененным антителам, которые обладают повышенными эффекторными функциями и/или увеличенным временем полужизни. См. например, заявку США № 12/577967.

Векторы, клетки-хозяева и способы рекомбинации

Для рекомбинантного получения антитела по изобретению, нуклеиновую кислоту, кодирующую его, выделяют и встраивают в реплицируемый вектор для дальнейшего клонирования (амплификации ДНК) или для экспрессии. ДНК, кодирующую антитело, легко выделить и секвенировать с использованием стандартных процедур (например, используя олигонуклеотидные зонды, которые способны связываться специфически с генами, кодирующим тяжелые и легкие цепи антитела). Доступно множество векторов. Выбор вектора частично зависит от клетки-хозяина, подлежащей использованию. Как правило, предпочтительные клетки-хозяева имеют прокариотическое или эукариотическое (как правило, от млекопитающего) происхождение. Следует принимать во внимание, что константные области любого изотипа можно использовать с этой целью, включая константные области IgG, IgM, IgA, IgD и IgE, и что такие константные области можно получать от человека или из любых видов животных.

a. Создание антител с использованием прокариотических клеток-хозяев:

i. Конструкция вектора

Полинуклеотидные последовательности, кодирующие полипептидные компоненты антитела по изобретению, можно получать с использованием стандартных рекомбинантных способов. Желаемые полинуклеотидные последовательности можно выделять и секвенировать из антителопродуцирующих клеток, таких как гибридомные клетки. Альтернативно, полинуклеотиды можно синтезировать с использованием нуклеотидного синтезатора или способов ПЦР. После получения, последовательности, кодирующие полипептиды, встраивают в рекомбинантный вектор, способный к репликации и экспрессии гетерологичных полинуклеотидов в прокариотических организмах-хозяевах. Многие векторы, которые доступны и известны в данной области, можно использовать для цели настоящего изобретения. Выбор подходящего вектора зависит преимущественно от размера нуклеиновых кислот, встраиваемых в вектор, и конкретной клетки-хозяина, подлежащей трансформации вектором. Каждый вектор содержит различные компоненты, в зависимости от его функции (амплификация или экспрессия гетерологичного полинуклеотида, или обе) и его совместимости с конкретной клеткой-хозяином, в которой он расположен. Компоненты вектора, как правило, включают в качестве неограничивающих примеров: участок начала репликации, ген маркера отбора, промотор, участок связывания рибосомы (RBS), сигнальная последовательность, вставка гетерологичной нуклеиновой кислоты и последовательность терминации транскрипции.

В целом, плазмидные векторы, содержащие репликон и управляющие последовательности, которые получают от видов, совместимых с клеткой-хозяином, используют применительно к этим организмам-хозяевам. Вектор, как правило, несет участок репликации, а также маркерные последовательности, которые способны обеспечивать фенотипический отбор в трансформированных клетках. Например, E. coli типично трансформируют с использованием плазмиды pBR322, полученной от вида E. coli. pBR322 содержит гены, кодирующие устойчивость к ампициллину (Amp) и тетрациклину (Tet) и, таким образом, предоставляет простое средство для идентификации трансформированных клеток. pBR322, ее производные или другие микробные плазмиды или бактериофаг также могут содержать, или могут быть модифицированы, чтобы содержать, промоторы, которые может использовать микробный организм для экспрессии эндогенных белков. Примеры производных pBR322, используемых для экспрессии конкретных антител, подробно описаны в Carter et al, патент США № 5648237.

Вдобавок, фаговые векторы, содержащие репликон и управляющие последовательности, которые совместимы с микроорганизмом-хозяином, можно использовать в качестве трансформирующих векторов применительно к этим организмам-хозяевам. Например, бактериофаг, такой как λGΕΜ.ΤΜ.-11, можно использовать в создании рекомбинантного вектора, который можно использовать для трансформации восприимчивых клеток-хозяев, таких как E. coli LE392.

Экспрессирующий вектор по изобретению может содержать две или более пары промотор-цистрон, кодирующие каждый из полипептидных компонентов. Промотор представляет собой нетранслируемую регуляторную последовательность, расположенную выше по направлению транскрипции (5') относительно цистрона, которая модулирует его экспрессию. Прокариотические промоторы типично попадают в два класса, индуцибельные и конститутивные. Индуцибельный промотор представляет собой промотор, который инициирует повышенные уровни транскрипции цистрона под его управлением в ответ на изменения в условиях культивирования, например, присутствие или отсутствие питательного вещества или изменение температуры.

Хорошо известно большое число промоторов, распознаваемых различными потенциальными клетками-хозяевами. Выбранный промотор может быть функционально связан с ДНК цистрона, кодирующей легкую или тяжелую цепь, посредством удаления промотора из исходной ДНК путем расщепления рестрикционными ферментами и встраивания выделенной последовательности промотор в вектор по изобретению. Как последовательность нативного промотора, так и многие гетерологичные промоторы можно использовать для управления амплификацией и/или экспрессией целевых генов. В некоторых вариантах осуществления используют гетерологичные промоторы, поскольку они, как правило, допускают более интенсивную транскрипцию и более высокий выход экспрессируемого гена-мишени по сравнению с нативным промотором полипептида-мишени.

Промоторы, пригодные для использования с прокариотическими организмами-хозяевами, включают промотор PhoA, промоторные системы β-галактамазы и лактозы, триптофановую (trp) промоторную систему и гибридные промоторы, такие как промоторы tac или trc. Однако также подходят другие промоторы, которые функциональны в бактериях (такие как другие известные промоторы бактерий или фагов). Их нуклеотидные последовательности опубликованы, тем самым, позволяя квалифицированному рабочему оперативно лигировать их с цистронами, кодирующими целевые легкие и тяжелые цепи (Siebenlist et al. (1980) Cell 20: 269) с использованием линкеров или адапторов, чтобы обеспечить любые необходимые участки рестрикции.

В одном из аспектов изобретения каждый цистрон в рекомбинантном векторе содержит компонент сигнальной последовательности секреции, который направляет транслокацию экспрессируемых полипептидов через мембрану. В целом, сигнальная последовательность может быть компонентом вектора, или она может быть частью ДНК полипептида-мишени, которая встроена в вектор. Сигнальная последовательность, выбранная для цели данного изобретения, должна быть одной из тех, которые распознает и процессирует (т.е. расщепляет сигнальной пептидазой) клетка-хозяин. Для прокариотических клеток-хозяев, которые не распознают и не процессируют сигнальные последовательности, нативные для гетерологичных полипептидов, сигнальную последовательность заменяют прокариотической сигнальной последовательностью, выбранной, например, из группы, состоящей из лидерных последовательностей щелочной фосфатазы, пенициллиназы, Ipp или термостабильного энтеротоксина II (STII), LamB, PhoE, PelB, OmpA и MBP. В одном из вариантов осуществления изобретения сигнальные последовательности, используемые в обоих цистронах экспрессирующей системы, представляют собой сигнальные последовательности STII или их варианты.

В другом аспекте продуцирование иммуноглобулинов в соответствии с изобретением может происходить в цитоплазме клетки-хозяина и, следовательно, не требует присутствия сигнальных последовательностей секреции в каждом цистроне. При этом, экспрессия, укладка и сборка легких и тяжелых цепей иммуноглобулина для формирования функциональных иммуноглобулинов происходит в цитоплазме. Определенные штаммы организмов-хозяев (например, штаммы E. coli trxB-) обеспечивают условия в цитоплазме, которые подходят для образования дисульфидной связи, тем самым давая возможность правильной укладки и сборки экспрессированных субъединиц белка. Proba and Pluckthun Gene, 159:203 (1995).

Прокариотические клетки-хозяева, подходящие для экспрессии антител по изобретению, включают Archaebacteria и Eubacteria, такие как грамотрицательные или грамположительные организмы. Примеры эффективных бактерий включают виды Escherichia (например, E. coli), Bacilli (например, B. subtilis), Enterobacteria, Pseudomonas (например, P. aeruginosa), Salmonella typhimurium, Serratia marcescans, Klebsiella, Proteus, Shigella, Rhizobia, Vitreoscilla или Paracoccus. В одном из вариантов осуществления используют грамотрицательные клетки. В одном из вариантов осуществления клетки E. coli используют в качестве организма-хозяина по изобретению. Примеры штаммов E. coli включают штамм W3110 (Bachmann, Cellular and Molecular Biology, том 2 (Washington, D.C.: American Society for Microbiology, 1987), стр. 1190-1219; депозит ATCC № 27325) и их производные, включая штамм 33D3, обладающий генотипов W3110 ΔfhuA (ΔtonΑ) ptr3 lac Iq lacL8 ΔompTΔ(nmpc-fepE) degP41 kanR (патент США № 5639635). Также подходят другие штаммы и их производные, такие как E. coli 294 (ATCC 31446), E. coli B, E. coli λ1776 (ATCC 31537) и E. coli RV308(ATCC 31608). Эти примеры являются иллюстративными, но не ограничивающими. Способы конструирования производных любой указанной выше бактерии, обладающей определенным генотипом, известны в данной области и описаны, например, в Bass et al, Proteins, 8:309-314 (1990). Как правило, необходимо выбирать подходящих бактерий, принимая во внимание способность к репликации репликона в клетках бактерии. Например, E. coli, виды Serratia или Salmonella можно надлежаще использовать в качестве организма-хозяина, когда хорошо известные плазмиды, такие как pBR322, pBR325, pACYC177 или pKN410, используют для обеспечения репликона. Типично клетка-хозяин должна секретировать минимальные количества протеолитических ферментов и дополнительные ингибиторы протеаз можно по желанию вводить в клеточную культуру.

ii. Получение антител

Клетки-хозяева трансформируют описанными выше экспрессирующими векторами и культивируют в стандартных питательных средах, модифицированных соответствующим образом, чтобы индуцировать промоторы, отбирать трансформанты или амплифицировать гены, кодирующие желаемые последовательности.

Трансформация обозначает введение ДНК в прокариотический организм-хозяин с тем, чтобы можно было реплицировать ДНК, или в виде внехромосомного элемента или посредством встраивания в хромосому. В зависимости от используемой клетки-хозяина, трансформацию выполняют стандартными способами, подходящими для таких клеток. Обработку кальцием с использованием хлорида кальция, как правило, используют для бактериальных клеток, которые содержат значительные барьеры клеточной стенки. В другом способе трансформации используют полиэтиленгликоль/DMSO. Еще один другой используемый способ представляет собой электропорацию.

Прокариотические клетки, используемые для получения полипептидов по изобретению, растут в средах, известных в данной области, и подходящих для культуры выбранных клеток-хозяев. Примеры подходящих сред включают бульон Лурия (LB) плюс добавки необходимых питательных веществ. В некоторых вариантах осуществления среды также содержат селекционное средство, выбранное на основе конструкции экспрессирующего вектора, чтобы избирательно делать возможным рост прокариотических клеток, содержащих экспрессирующий вектор. Например, ампициллин добавляют в среды для роста клеток, экспрессирующих ген устойчивости к ампициллину.

Любые необходимые добавки, помимо углерода, азота и неорганических источников фосфата, также могут быть включены в подходящих концентрациях, которые вводят отдельно или в виде смеси с другой добавкой или средой, такой как комплексный источник азота. Необязательно среда для культивирования может содержать одно или несколько восстанавливающих средств, выбранных из группы, состоящей из глутатиона, цистеина, цистамина, тиогликолята, дитиоэритрита и дитиотреитола.

Прокариотические клетки-хозяева культивируют при подходящих температурах. Например, для роста E. coli предпочтительная температура варьирует приблизительно от 20°C приблизительно до 39°C, более предпочтительно приблизительно от 25°C приблизительно до 37°C, даже более предпочтительно приблизительно равна 30°C. pH среды может иметь любое значение pH в диапазоне от приблизительно 5 приблизительно до 9, преимущественно, в зависимости от организма-хозяина. Для E. coli pH предпочтительно составляет приблизительно от 6,8 приблизительно до 7,4 и более предпочтительно приблизительно 7,0.

Если индуцибельный промотор используют в экспрессирующем векторе по изобретению, экспрессию белка индуцируют в условиях, подходящих для активации промотора. В одном из аспектов изобретения промоторы PhoA используют для управления транскрипции полипептидов. Соответственно, трансформированные клетки-хозяева культивируют в фосфат-лимитированную среду для индукции. Предпочтительно, фосфат-лимитированной средой является среда C.R.A.P. (см., например, Simmons et al, J. Immunol. Methods (2002), 263: 133-147). Можно использовать множество других индукторов в соответствии с используемой векторной конструкцией, как известно в данной области.

В одном из вариантов осуществления экспрессируемые полипептиды по настоящему изобретению секретируют в и извлекают из периплазмы клеток-хозяев. Извлечение белка типично включает разрушение микроорганизма, как правило, такими средствами, как осмотический шок, обработка ультразвуком или лизис. После разрушения клеток, обломки клеток или целые клетки могут быть удалены посредством центрифугирования или фильтрования. Белки можно дополнительно очищать, например, посредством аффинной хроматографии на смолах. Альтернативно, белки можно транспортировать в среды для культивирования и выделять из них. Клетки можно удалить из культуры, а культуральный супернатант фильтровать и концентрировать для дальнейшей очистки получаемых белков. Экспрессируемые полипептиды дополнительно можно выделять и идентифицировать с использованием общеизвестных способов, таких как электрофорез в полиакриламидном геле (PAGE) и анализ вестерн-блоттинга.

В одном из аспектов изобретения, получение антитела проводят в большом количестве посредством процесса ферментации. Различные крупномасштабные порционные процедуры ферментации с подпиткой доступны для получения рекомбинантных белков. Крупномасштабная ферментация имеет объем по меньшей мере 1000 литров, предпочтительно приблизительно от 1000 до 100000 литров. В этих ферментаторах используют перемешивающие импеллеры для распределения кислорода и питательных веществ, в частности, глюкозы (предпочтительного источника углерода/энергии). Мелкомасштабная ферментация, как правило, относится к ферментации в ферментаторе, который имеет объемную вместительность не более приблизительно 100 литров и может варьировать приблизительно от 1 литра приблизительно до 100 литров.

В процессе ферментации индукцию экспрессии белка типично инициируют после выращивания клеток в подходящих условиях до желаемой плотности, например, OD550 приблизительно 180-220, и на этой стадии клетки находятся в ранней стационарной фазе. Можно использовать различные индукторы, соответствующие используемой векторной конструкции, как известно в данной области и описано выше. Клетки можно растить в течение более коротких периодов перед индукцией. Клетки обычно подвергают индукции в течение приблизительно 12-50 часов, несмотря на то, что можно использовать более длительное или более короткое время индукции.

Чтобы улучшить выход продукта и качество полипептидов по изобретению, можно модифицировать различные условия ферментации. Например, чтобы улучшить правильную сборку и укладку секретируемых полипептидов антител, дополнительные векторы, сверхэкспрессирующие шапероны, такие как белки Dsb (DsbA, DsbB, DsbC, DsbD и или DsbG) или FkpA (пептидилпролил-цис-транс-изомераза с активностью шаперона) можно использовать для совместной трансформации прокариотических клеток-хозяев. Показано, что шапероны облегчают правильную укладку и растворимость гетерологичных белков, продуцируемых в бактериальных клетках-хозяевах. Chen et al. (1999) J Bio Chem 274: 19601-19605; Georgiou et al, патент США № 6083715; Georgiou et al, патент США № 6027888; Bothmann and Pluckthun (2000) J. Biol. Chem. 275: 17100-17105; Ramm and Pluckthun (2000) J. Biol. Chem. 275: 17106-17113; Arie et al. (2001) Mol. Microbiol. 39: 199-210.

Чтобы минимизировать протеолиз экспрессируемых гетерологичных белков (в частности, тех, которые чувствительны к протеолизу), определенные штаммы организмов-хозяев с дефицитом протеолитических ферментов можно использовать для настоящего изобретения. Например, штаммы клеток-хозяев можно модифицировать, чтобы вызвать генетическую мутацию(и) в генах, кодирующих известные бактериальные протеазы, такие как протеаза III, OmpT, DegP, Tsp, протеаза I, протеаза Mi, протеаза V, протеаза VI и их сочетания. Некоторые штаммы E. coli с дефицитом протеаз доступны и описаны, например, в Joly et al. (1998), выше; Georgiou et al., патент США № 5264365; Georgiou et al, патент США № 5508192; Hara et al., Microbial Drug Resistance, 2:63-72 (1996).

В одном из вариантов осуществления штаммы E. coli с дефицитом протеолитических ферментов и трансформированные плазмидами, сверхэкспрессирующими один или несколько шаперонов, используют в качестве клеток-хозяев в экспрессирующей системе по изобретению.

iii. Очистка антител

Можно использовать стандартные способы очистки белка, известные в данной области. Следующие процедуры являются образцами подходящих процедур очистки: фракционирование на иммуноаффинных или ионообменных колонках, преципитация этанол, ВЭЖХ с обращенной фазой, хроматография на диоксиде кремния или на катионообменной смоле, такой как DEAE, хроматофокусирование, SDS-PAGE, преципитация с сульфатом аммония и гель-фильтрация с использованием, например, Sephadex® G-75.

В одном из аспектов, используют белок A, иммобилизованный на твердой фазе, для иммуноаффинной очистки продуктов полноразмерных антител по изобретению. Белок A представляет собой белок клеточной стенки 41 кДа из Staphylococcus aureas, который связывается с высокой аффинностью с Fc-областью антитела. Lindmark et al (1983) J. Immunol. Meth. 62: 1-13. Твердая фаза, на которой иммобилизуют белок A, предпочтительно представляет собой колонку, содержащую поверхность из стекла или диоксида кремния, более предпочтительно, колонку с стеклом с контролируемым размером пор или колонку с кремниевой кислотой. В некоторых применениях, колонка покрыта реактивом, таким как глицерин, в попытке предотвратить неспецифическое связывание загрязнителей.

В качестве первой стадии очистки, препарат, полученный из клеточной культуры, как описано выше, наносят на твердую фазу с иммобилизованным белком A, чтобы сделать возможным специфическое связывание антитела, представляющего интерес, с белком A. Затем твердую фазу промывают для того, чтобы удалить загрязнители, неспецифически связанные с твердой фазой. Наконец, антитело, представляющее интерес, извлекают из твердой фазы посредством элюирования.

b. Создание антител с использованием эукариотических клеток-хозяев:

Компоненты вектора, как правило, включают в качестве неограничивающих примеров одно или несколько из следующего: сигнальная последовательность, участок начала репликации, один или несколько маркерных генов, энхансерный элемент, промотор и последовательность терминации транскрипции.

(i) Компонент сигнальной последовательности

Вектор для использования в эукариотической клетке-хозяине также может содержать сигнальную последовательность или другой полипептид, содержащий специфический сайт расщепления на N-конце зрелого белка или полипептида, представляющего интерес. Выбранная гетерологичная сигнальная последовательность предпочтительно представляет собой одну из тех, что распознает и процессирует (т.е., расщепляет сигнальной пептидазой) клетка-хозяин. При экспрессии в клетке млекопитающего доступны сигнальные последовательности млекопитающих, а также вирусные секреторные лидерные последовательности, например, сигнал gD простого герпеса.

ДНК для такой прекурсорной области лигируют с сохранением рамки считывания с ДНК, кодирующей антитело.

(ii) Участок начала репликации

Как правило, компонент участка начала репликации не нужен для экспрессирующих векторов млекопитающих. Например, точку начала репликации SV40 типично можно использовать только потому, что она содержит ранний промотор.

(iii) Компонент селективного гена

Экспрессионные и клонирующие векторы могут содержать селективный ген, также называемый селективным маркером. Типичные селективные гены кодируют белки, которые (a) придают устойчивость к антибиотикам или другим токсинам, например, ампициллину, неомицину, метотрексату или тетрациклину, (b) восполняют ауксотрофный дефицит, в соответствующих случаях, или (c) восполняют критические питательные вещества, не доступные из комплексных сред

В одном из примеров схемы отбора используют лекарственное средство для задержки роста клетки-хозяина. Те клетки, которые успешно трансформированы гетерологичным геном, продуцируют белок, придающий устойчивость к лекарственному средству, и, таким образом, переживают режим отбора. В примерах такого доминантного отбора используют лекарственные средства неомицин, микофеноловая кислота и гигромицин.

Другие примеры подходящих селективных маркеров для клеток млекопитающих представляют собой те, что позволяют идентифицировать клетки, компетентные для захвата нуклеиновой кислоты антитела, такие как DHFR, тимидинкиназа, металлотионеин-I и -II, предпочтительно гены металлотионеинов приматов, аденозиндезаминаза, орнитиндекарбоксилаза и т.д.

Например, клетки, трансформированные селективным геном DHFR, сначала идентифицируют посредством культивирования всех трансформантов в среде для культивирования, которая содержит метотрексат (Mtx), конкурентный антагонист DHFR. Подходящими клетками-хозяевами, когда используют DHFR дикого типа, является клеточная линия яичника китайского хомяка (CHO) с дефицитом активности DHFR (например, ATCC® CRL-9096).

Альтернативно, клетки-хозяева (в частности организмы-хозяева дикого типа, которые содержат эндогенный DHFR), трансформированные или совместно трансформированные последовательностями ДНК, кодирующими антитело, белок DHFR дикого типа и другой селективный маркер, такой как аминогликозид 3'-фосфотрансфераза (APH), можно выбирать по клеточному росту в среде, содержащей селекционное средство для селективного маркера, такое как аминогликозидный антибиотик, например, канамицин, неомицин или G418. См. патент США № 4965199.

(iv) Компонент промотора

Экспрессирующие и клонирующие векторы обычно содержат промотор, который распознает организм-хозяин и который функционально связан с нуклеиновой кислотой полипептида антитела. Промоторные последовательности известны для эукариот. Практически все эукариотические гены имеют AT-богатую область, расположенную приблизительно в 25-30 основаниях выше по направлению транскрипции от сайта, где происходит инициация транскрипции. Другая последовательность, найденная в 70-80 основаниях выше по направлению транскрипции от начала транскрипции многих генов представляет собой область CNCAAT (SEQ ID NO: 206), где N может представлять собой любой нуклеотид. На 3'-конце большинства эукариотических генов расположена последовательность AATAAA (SEQ ID NO: 207), которая может служить сигналом для добавления поли-A последовательности на 3'-конец кодирующей последовательность. Все эти последовательности надлежаще встраивают в эукариотические экспрессирующие векторы.

Транскрипцией полипептидов антител с векторов в клетках-хозяевах млекопитающих управляют, например, посредством промоторов, полученных из геномов вирусов, таких как вирус полиомы, вирус куриной оспы, аденовирус (такой как аденовирус 2), вирус папилломы крупного рогатого скота, вирус саркомы птиц, цитомегаловирус, ретровирус, вирус гепатита B и вирус обезьян 40 (SV40), из гетерологичных промоторов млекопитающих, например, актинового промотора или иммуноглобулинового промотора, из промоторов теплового шока, при условии, что такие промоторы совместимы с системами клеток-хозяев.

Ранние и поздние промоторы вируса SV40 удобно получать в виде рестрикционного фрагмента SV40, который также содержит участок начала репликации вируса SV40. Предранний промотор цитомегаловируса человека удобно получать в виде рестрикционного фрагмента HindIII E. Система для экспрессии ДНК в организмах-хозяевах млекопитающих с использованием вируса папилломы крупного рогатого скота в качестве вектора раскрыта в патенте США № 4419446. Модификация это системы описана в патенте США № 4601978. Альтернативно, в качестве промотора можно использовать длинный концевой повтор вируса саркомы Рауса.

(v) Компонент энхансерного элемента

Транскрипцию ДНК, кодирующей полипептид антитела по данному изобретению, с помощью высших эукариот часто усиливают посредством встраивания энхансерной последовательности в вектор. Сейчас известно множество энхансерных последовательностей из генов млекопитающих (глобин, эластаза, альбумин, α-фетопротеин и инсулин). Однако типично следует использовать энхансер из вируса эукариотических клеток. Примеры включают энхансер SV40 на поздней стороне от точки начала репликации (100-270 п.о.), энхансер раннего промотора цитомегаловируса, энхансер полиомы на поздней стороне от точки начала репликации и энхансеры аденовируса. См. также в Yaniv, Nature 297: 17-18 (1982) энхарсерные элементы для активации эукариотических промоторов. Энхансер может быть встроен в вектор в положении выше или ниже по направлению транскрипции относительно последовательности, кодирующей полипептид антитела, но предпочтительно расположен выше по направлению транскрипции относительно промотора.

(vi) Компонент терминации транскрипции

Экспрессирующие векторы, используемые в эукариотических клетках-хозяевах, типично также будут содержать последовательности, необходимые для терминации транскрипции и для стабилизации мРНК. Такие последовательности обыкновенно доступны из 5', и иногда из 3', нетранслируемых областей эукариотической или вирусной ДНК или кДНК. Эти области содержат нуклеотидные сегменты, транскрибируемые в виде полиаденилированных фрагментов, в нетранслируемой части мРНК, кодирующей антитело. Одним из эффективных компонентов терминации транскрипции является область полиаденилирования бычьего гормона роста. См. W094/11026 и экспрессирующий вектор, раскрытый в ней.

(vii) Отбор и трансформация клеток-хозяев

Подходящие клетки-хозяева для клонирования или экспрессии ДНК в векторах в настоящем документе включают клетки высших эукариот, описанные в настоящем документе, включая клетки-хозяева позвоночных. Размножение клеток позвоночных в культуре (культуре ткани) стало обычной процедурой. Примерами эффективных линий клеток-хозяев млекопитающих являются линия почки обезьяны CV1, трансформированная с использованием SV40 (COS-7, ATCC® CRL 1651); эмбриональная линия почки человека (клетки 293 или 293, субклонированные для роста в суспензионной культуре, Graham et al, J. Gen Virol. 36:59 (1977)); клетки почки детеныша хомяка (BHK, ATCC® CCL 10); клетки яичника китайского хомяка/-DHFR (CHO, Urlaub et al, Proc. Natl. Acad. Sci. USA 77:4216 (1980)); клетки Сертоли мыши (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); клетки почки обезьяны (CV1 ATCC® CCL 70); клетки почки африканской зеленой мартышки (VERO-76, ATCC® CRL-1587); клетки карциномы шейки матки человека (HELA, ATCC® CCL 2); клетки почки собаки (MDCK, ATCC® CCL 34); клетки печени крысы Buffalo (BRL 3A, ATCC® CRL 1442); клетки легкого человека (W138, ATCC® CCL 75); клетки печени человека (Hep G2, HB 8065); опухоль молочной железы мыши (MMT 060562, ATCC® CCL51); клетки TRI (Mather et al, Annals N.Y. Acad. Sci. 383:44-68 (1982)); клетки MRC 5; клетки FS4; и линия гепатомы человека (Hep G2).

Клетки-хозяева трансформируют с использованием описанных выше экспрессионных или клонирующих векторов для получения антител и культивируют в стандартных питательных средах, модифицированных соответствующим образом, чтобы индуцировать промоторы, отбирать трансформанты или амплифицировать гены, кодирующие желаемые последовательности.

(viii) Культивирование клеток-хозяев

Клетки-хозяева, используемые для получения антитела по данному изобретению, можно культивировать в различных средах. Коммерчески доступные среды, такие как Хэма F10 (Sigma), минимальная поддерживающая среда ((MEM), (Sigma), RPMI-1640 (Sigma) и модифицированная по способу Дульбекко среда Игла ((DMEM), Sigma) подходят для культивирования клеток-хозяев. Вдобавок, любые из сред, описанных в Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), патентах США №№ 4767704; 4657866; 4927762; 4560655 или 5122469; WO 90/03430; WO 87/00195; или патент США № 30985, можно использовать в качестве среды для культивирования клеток-хозяев. В любую из этих сред можно добавлять по мере необходимости гормоны и/или другие факторы роста (такие как инсулин, трансферрин или эпидермальный фактор роста), соли (такие как хлорид и фосфат натрия, кальция, магния), буферы (такие как HEPES), нуклеотиды (такие как аденозин и тимидин), антибиотики (такие как лекарственное средство Гентамицин™), микроэлементы (определены как неорганические соединения, обычно присутствующие в конечных концентрациях в микромолярном диапазоне) и глюкозу или эквивалентный источник энергии. Любые другие необходимые добавки также могут быть включены в подходящих концентрациях, которые известны специалистам в данной области. Условия культивирования, такие как температура, pH и т.п., представляют собой те, что ранее использовали с клетками-хозяевами, отобранными для экспрессии, и они известны специалисту в данной области.

(ix) Очистка антитела

Когда используют рекомбинантные способы, антитело можно получать внутриклеточно или непосредственно секретировать в среду. Если антитело получают внутриклеточно, в качестве первой стадии, дебрис из макрочастиц, или из клеток-хозяев или из лизированных фрагментов, удаляют, например, посредством центрифугирования или ультрафильтрования. Когда происходит секреция антитела в среду, супернатанты из таких экспрессирующих систем в целом сначала концентрируют с использованием коммерчески доступного фильтра для концентрирования белка, например, блока ультрафильтрования Amicon или Millipore Pellicon. Чтобы ингибировать протеолиз, на любой из указанных выше стадий может быть введен ингибитор протеазы, такой как PMSF, и могут быть введены антибиотики для предотвращения роста случайных загрязнителей.

Композицию антитела, получаемую из клеток, можно очищать с использованием, например, хроматографии на гидроксиапатите, электрофореза в геле, диализа и аффинной хроматографии, причем предпочтительным способом очистки является аффинная хроматография. Пригодность белка A в качестве аффинного лиганда зависит от вида и изотипа любого Fc домена иммуноглобулина, который присутствует в антителе. Белок A можно использовать для очистки антител, которые основаны на тяжелых цепях γ1, γ2 или γ4 человека (Lindmark et al., J. Immunol. Meth. 62: 1-13 (1983)). Белок G рекомендован для всех изотипов мыши и γ3 человека (Guss et al, EMBO J. 5: 15671575 (1986)). Матрицей, к которой прикрепляют аффинный лиганд, чаще всего является агароза, но доступны другие матрицы. Механически стабильные матрицы, такие как стекло с контролируемым размером пор или поли(стиролдивинил)бензол, делают возможными более высокие скорости потока и более короткие времена обработки, чем те, что можно достичь с использованием агарозы. Когда антитело содержит домен CH3, для очистки можно использовать смолу Bakerbond ABX™ (J. T. Baker, Phillipsburg, NJ). Другие способы очистки белка, такие как фракционирование на ионообменной колонке, преципитация этанолом, ВЭЖХ с обращенной фазой, хроматография на диоксиде кремния, хроматография на гепариновой сефарозе™, хроматография на анионо- или катионообменной смоле (такой как колонка с полиаспарагиновой кислотой), хроматофокусирование, SDS-PAGE и преципитация с сульфатом аммония, также доступны в зависимости от антитела, подлежащего извлечению.

После какой-либо предварительной стадии(й) очистки, смесь, содержащую антитело, представляющее интерес, и контаминанты, можно подвергать хроматографии гидрофобного взаимодействия с низким pH с использованием буфера для элюирования с pH между приблизительно 2,5-4,5, которую предпочтительно осуществляют при низких концентрациях солей (например, приблизительно 0-0,25 M соли).

Иммуноконъюгаты

Изобретение также относится к иммуноконъюгатам (взаимозаменяемо обозначаемым как «конъюгаты антитело-лекарственное средство», или «ADC»), содержащим антитело, конъюгированное с одним или несколькими цитотоксическими средствами, такими как химиотерапевтическое средство, лекарственное средство, ингибирующее рост средство, токсин (например, белковый токсин, ферментативно активный токсин бактериального, грибкового, растительного или животного происхождения или их фрагменты), или радиоактивный изотоп (т.е., радиоконъюгат).

Иммуноконъюгаты использовали для локальной доставки цитотоксических средств, т.е., лекарственных средств, которые убивают или ингибируют рост или пролиферацию клеток, в лечении рака (Lambert, J. (2005) Curr. Opinion in Pharmacology 5:543-549; Wu et al (2005) Nature Biotechnology 23(9): 1137-1146; Payne, G. (2003) 13:207-212; Syrigos and Epenetos (1999) Anticancer Research 19:605-614; Niculescu-Duvaz and Springer (1997) Adv. Drug Deliv. Rev. 26: 151-172; патент США № 4975278). Иммуноконъюгаты делают возможной направленную доставку лекарственной молекулы в опухоль и внутриклеточное накопление в ней, где системное введение неконъюгированных лекарственных средств может привести к неприемлемым уровням токсичности для нормальных клеток, а также опухолевых клеток, подлежащих устранению (Baldwin et al, Lancet (Mar. 15, 1986) стр. 603-05; Thorpe (1985) «Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review», in Monoclonal Antibodies'84: Biological And Clinical Applications (A. Pinchera et al., eds) стр. 475-506. Сообщалось, что как поликлональные антитела, так и моноклональные антитела можно использовать в этих стратегиях (Rowland et al, (1986) Cancer Immunol. Immunother. 21: 183-87). Лекарственные средства, используемые в этих способах, включают дауномицин, доксорубицин, метотрексат и виндезин (Rowland et al, (1986) выше). Токсины, используемые в конъюгатах антитело-токсин, включают бактериальные токсины, такие как дифтерийный токсин, растительные токсины, такие как рицин, низкомолекулярные токсины, такие как гелданамицин (Mandler et al (2000) J. Nat. Cancer Inst. 92(19): 1573-1581; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10: 1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791), майтанзиноиды (EP 1391213; Liu et al, (1996) Proc. Natl. Acad. Sci. USA 93:8618-8623), и калихимицин (Lode et al (1998) Cancer Res. 58:2928; Hinman et al (1993) Cancer Res. 53:3336-3342). Токсины могут проявлять свои цитотоксические эффекты посредством механизмов, включающих связывание тубулина, связывание ДНК или ингибирование топоизомеразы. Некоторые цитотоксические лекарственные средства склонны быть неактивными или менее активными, когда они конъюгированы с большими антителами или лигандами белковых рецепторов.

Зевалин® (ибритумомаб тиуксетан, Biogen/Idec) представляет собой конъюгат антитело-радиоизотоп, состоящий из IgG1 мыши κ моноклональному антителу, направленному против антигена CD20, найденного на поверхности нормальных и злокачественных B-лимфоцитов, и радиоизотопа 111In или 90Y, связанного линкером-хелатором из тиомочевины (Wiseman et al (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al (2002) Blood 99(12):4336-42; Witzig et al (2002) J. Clin. Oncol. 20(10):2453-63; Witzig et al (2002) J. Clin. Oncol. 20(15):3262-69). Несмотря на то, что Зевалин обладает активностью против B-клеточной неходжкинской лимфомы (NHL), введение ведет к тяжелым и длительным цитопениям у большинства пациентов. Милотарг™ (гемтузумаб озогамицин, Wyeth Pharmaceuticals), конъюгат антитело-лекарственное средство, состоящий из антитела huCD33, связанного с калихимицином, одобрено в 2000 для лечения острого миелолейкоза посредством инъекций (Drugs of the Future (2000) 25(7):686; патенты США №№ 4970198; 5079233; 5585089; 5606040; 5693762; 5739116; 5767285; 5773001). Кантузумаб мертанзин (Immunogen, Inc.), конъюгат антитело-лекарственное средство, состоящий из антитела huC242, связанного через дисульфидный линкер SPP с фрагментом лекарственного средства майтанзиноид, DM1, перешло во II фазу исследований для лечения различных видов рака, которые экспрессируют CanAg, таких как рак ободочной кишки, поджелудочной железы, желудка и других. MLN-2704 (Millennium Pharm., BZL Biologies, Immunogen Inc.), конъюгат антитело-лекарственное средство, состоящий из моноклонального антитела против специфического мембранного антигена предстательной железы (PSMA), связанного с фрагментом лекарственного средства майтанзиноид, DM1, находится в разработке для возможного лечения опухолей предстательной железы. Пептиды ауристатина, ауристатин E (AE) и монометилауристатин (MMAE), синтетические аналоги доластатина, конъюгированы с химерными моноклональными антителами cBR96 (специфично к Lewis Y на карциномах) и cAC10 (специфично к CD30 на гематологических злокачественных опухолях) (Doronina et al (2003) Nature Biotechnol. 21(7):778-784) и находятся в терапевтической разработке.

В определенных вариантах осуществления иммуноконъюгат содержит антитело и химиотерапевтическое средство или другой токсин. Химиотерапевтические средства, которые можно использовать в создании иммуноконъюгатов, описаны в настоящем документе (например, выше). Ферментативно активные токсины и их фрагменты, которые можно использовать, включают цепь A дифтерийного токсина, несвязывающие активные фрагменты дифтерийного токсина, цепь A экзотоксин (из Pseudomonas aeruginosa), цепь A рицина, цепь A абрина, цепь A модессин, α-сарцин, белки Aleurites fordii, диантиновые белки, белки Phytolaca americana (PAPI, PAPII и PAP-S), ингибитор Momordica charantia, курцин, кротин, ингибитор Sapaonaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, еномицин и трихотецены. См., например, WO 93/21232, опубликованную 28 октября 1993 года. Различные радионуклиды доступны для получения радиоконъюгированных антител. Примеры включают 212Bi, 131I, 131In, 90Y, и 186Re. Конъюгаты антитела и цитотоксического средства создают с использованием различных бифункциональных соединяющих белок средств, таких как N-сукцинимидил-3-(2-пиридилдитиол)пропионат (SPDP), иминотиолан (IT), бифункциональные производные имидоэфиров (таких как диметиладипимидат HCl), активные сложные эфиры (такие как дисукцинимидилсуберат), альдегиды (такие как глутаральдегид), бис-азидосоединения (такие как бис-(п-азидобензоил)гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)этилендиамин), диизоцианаты (такие как толуол-2,6-диизоцианат), и бис-активные соединения фтора (такие как 1,5-дифтор-2,4-динитробензол). Например, иммунотоксин рицин можно получать, как описано в Vitetta et al., Science, 238: 1098 (1987). Меченная углеродом-14 1-изотиоцианатбензил-3-метилдиэтилентриаминпентауксусная кислота (MX-DTPA) представляет собой образцовое хелатирующее средство для конъюгации радионуклеотида с антителом. См. WO 94/11026.

Конъюгаты антитела и одного или нескольких низкомолекулярных токсинов, таких как калихимицин, майтанзиноиды, доластатины, ауристатины, трихотецен и CC1065 и производные этих токсинов, которые обладают активностью токсина, также предусмотрены в настоящем документе.

Майтанзин и майтанзиноиды

В некоторых вариантах осуществления иммуноконъюгат содержит антитело (полноразмерное или фрагменты), конъюгированное с одной или несколькими молекулами майтанзиноида.

Майтанзиноиды представляют собой ингибиторы митоза, которые действуют посредством ингибирования полимеризации тубулина. Майтанзин впервые был выделен из восточно-африканского кустарника Maytenus serrata (патент США № 3896111). Впоследствии, было обнаружено, что определенные микробы также продуцируют майтанзиноиды, такие как майтанзинол и C-3 сложные эфиры майтанзинола (патент США № 4151042). Синтетический майтанзинол и его производные и аналоги раскрыты, например, в патентах США №№ 4137230; 4248870; 4256746; 4260608; 4265814; 4294757; 4307016; 4308268; 4308269; 4309428; 4313946; 4315929; 4317821; 4322348; 4331598; 4361650; 4364866; 4424219; 4450254; 4362663 и 4371533.

Фрагменты лекарственного средства майтанзиноид являются привлекательными фрагментами лекарственных средств в конъюгатах антитело-лекарственное средство, поскольку они: (i) относительно доступны для получения посредством ферментации или химической модификации, получения производных продуктов ферментации, (ii) допускают получение производных с функциональными группами, подходящими для конъюгации посредством недисульфидных линкеров с антителами, (iii) стабильны в плазме, и (iv) эффективны против различных линий опухолевых клеток.

Иммуноконъюгаты, содержащие майтанзиноиды, способы их получения и их терапевтическое использование раскрыты, например, в патентах США №№ 5208020, 5416064 и европейском патенте EP 0 425 235 B1. Liu et al, Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996) описывают иммуноконъюгаты, содержащие майтанзиноид, обозначаемый DM1, связанный с моноклональным антителом C242, направленным против рака толстой кишки человека. Обнаружено, что конъюгат высоко цитотоксичен в отношении культивируемых клеток рака ободочной кишки и проявляет противоопухолевую активность в анализе опухолевого роста in vivo. Chari et al., Cancer Research 52: 127-131 (1992) описывают иммуноконъюгаты, в которых майтанзиноид конъюгирован через дисульфидный линкер с мышиным антителом A7, связывающимся с антигеном на клетках линии рака ободочной кишки человека, или с другим моноклональным антителом мыши TA.1, которое связывает онкоген HER-2/neu. Цитотоксичность конъюгата TA.1-майтанзиноид тестировали in vitro на клеточной линии рака молочной железы человека SK-BR-3, которая экспрессирует 3×105 поверхностных антигенов HER-2 на клетку. Конъюгат лекарственного средства достигал степени цитотоксичности, схожей со свободным лекарственным средством майтанзиноид, которая может быть увеличена посредством увеличения числа молекул майтанзиноида на молекулу антитела. Конъюгат A7-майтанзиноид показывал низкую системную цитотоксичность у мышей.

Конъюгаты антитело-майтанзиноид получают посредством химического соединения антитела с молекулой майтанзиноида без значительного снижения биологической активности антитела или молекулы майтанзиноида. См., например, патент США № 5208020. В среднем 3-4 молекулы майтанзиноида, конъюгированные с одной молекулой антитела, показали эффективность в усилении цитотоксичности клеток-мишеней без отрицательного влияния на функцию или растворимость антитела, хотя даже от одной молекулы токсин/антитело ожидается усиление цитотоксичности по сравнению с использованием голого антитела. Майтанзиноиды хорошо известны в данной области и их можно синтезировать известными способами или выделять из природных источников. Подходящие майтанзиноиды раскрыты, например, в патенте США № 5208020 и в других патентах и непатентных публикациях, упоминаемых выше в настоящем документе. Предпочтительными майтанзиноидами являются майтанзинол и аналоги майтанзинола, модифицированные по ароматическому кольцу или в других положениях молекулы майтанзинола, такие как различные сложные эфиры майтанзинола.

В данной области известно множество связывающих групп для создания конъюгатов антитело-майтанзиноид, включая, например, те, что раскрыты в патенте США № 5208020 или патенте EP 0 425 235 B1, Chari et al., Cancer Research 52: 127-131 (1992) и патентной заявке США № 10/960602, которая подана 8 октября 2004 года. Конъюгаты антитело-майтанзиноид, содержащие линкерный компонент SMCC, можно получать, как раскрыто в патентной заявке США № 10/960602, которая подана 8 октября 2004 года. Связывающие группы включают дисульфидные группы, простые тиоэфирные группы, кислотнонеустойчивые группы, фотонеустойчивые группы, не устойчивые к пептидазам группы или не устойчивые к эстеразам группы, как раскрыто в указанных выше патентах, дисульфидные и простые тиоэфирные группы являются предпочтительными. Дополнительные связывающие группы описаны и проиллюстрированы в настоящем документе.

Конъюгаты антитела и майтанзиноида можно создавать с использованием различных бифункциональных связывающих белок средств, таких как N-сукцинимидил-3-(2-пиридилдитио)пропионат (SPDP), сукцинимидил-4-(N-малеимидометил)циклогексан-1-карбоксилат (SMCC), иминотиолан (IT), бифункциональные производные имидоэфиров (такие как диметил адипимидат HCl), активные сложные эфиры (такие как дисукцинимидилсуберат), альдегиды (такие как глутаральдегид), бис-азидосоединения (такие как бис-(п-азидобензоил)гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)этилендиамин), диизоцианаты (такие как толуол-2,6-диизоцианат) и бис-активные соединения фтора (такие как 1,5-дифтор-2,4-динитробензол). Особенно предпочтительные связывающие средства включают N-сукцинимидил-3-(2-пиридилдитио)пропионат (SPDP) (Carlsson et al, Biochem. J. 173:723-737 (1978)) и N-сукцинимидил-4-(2-пиридилтио)пентаноат (SPP), чтобы предоставить дисульфидную связь.

Линкер можно прикреплять к молекуле майтанзиноида в различных положениях, в зависимости от типа связи. Например, сложную эфирную связь можно сформировать с помощью реакции с гидроксильной группой, используя стандартные способы связывания. Реакция может произойти в положении C-3, содержащем гидроксильную группу, положении C-14, модифицированном гидроксиметилом, положении C-15, модифицированном гидроксильной группой, и положении C-20, содержащем гидроксильную группу. В предпочтительном варианте осуществления связь формируют в положении C-3 майтанзинола или аналога майтанзинола.

Ауристатины и доластатины

В некоторых вариантах осуществления иммуноконъюгат содержит антитело, конъюгированное с доластатином или пептидными аналогами и производными доластатина, ауристатинами (патенты США №№ 5635483; 5780588). Показано, что доластатины и ауристатины препятствуют движению микротрубочек, гидролизу GTP и делению ядер и клеток (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) и обладают активностью против рака (US 5663149) и против грибков (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965). Фрагмент лекарственных средств доластатин или ауристатин можно прикрепить к антителу по N (амино) концу или the C (карбоксильному) концу фрагмента пептидного лекарственного средства (WO 02/088172).

Образцовые варианты осуществления с ауристатином включают связанные с N-концом фрагменты лекарственного средства монометилауристатина DE и DF, раскрытые в «Monomethylvaline Compounds Capable of Conjugation to Ligands», США сер. № 10/983340, дата подачи 5 ноября 2004 года.

Типично, фрагменты лекарственных средств на пептидной основе можно получать посредством формирования пептидной связи между двумя или более аминокислотами и/или пептидными фрагментами. Такие пептидные связи можно создавать, например, в соответствии со способом синтеза в жидкой фазе (см. E. Schroder and K. Lubke, «The Peptides», том 1, стр. 76-136, 1965, Academic Press), который хорошо известен в области химии пептидов. Фрагменты лекарственного средства ауристатин/доластатин можно получать в соответствии со способами по: US 5635483; US 5780588; Pettit et al (1989) J. Am. Chem. Soc. 111:5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G.R., et al. Synthesis, 1996, 719-725; и Pettit et al (1996) J. Chem. Soc. Perkin Trans. 15:859-863. См. также Doronina (2003) Nat Biotechnol 21(7):778-784; «Monomethylvaline Compounds Capable of Conjugation to Ligands», США сер. № 10/983340, дата подачи 5 ноября 2004 года (раскрыты, например, линкеры и способы получения соединений монометилвалина, таких как MMAE и MMAF, конъюгированных с линкерами).

Калихимицин

В других вариантах осуществления иммуноконъюгат содержит антитело, конъюгированное с одним или несколькими молекулами калихимицина. Семейство калихимициновых антибиотиков способно создавать разрывы двухцепочечной ДНК в субпикомолярных концентрациях. О получении конъюгатов калихимицинового семейства см. патенты США 5712374, 5714586, 5739116, 5767285, 5770701, 5770710, 5773001, 5877296 (все выданы American Cyanamid Company). Структурные аналоги калихимицина, которые можно использовать, включают в качестве неограничивающих примеров, γ1I, α2Ι, α3I, N-ацетил-γ1Ι, PSAG и θΙ1 (Hinman et al, Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998) и указанные выше патенты США, выданные American Cyanamid). Другим противоопухолевым лекарственным средством, с которым можно конъюгировать антитело, является QFA, которое представляет собой антифолат. Как калихимицин, так и QFA имеют внутриклеточные места приложения действия и не без труда проходят через плазматическую мембрану. Следовательно, накопление этих средств в клетках с помощью опосредованной антителами интернализации значительно усиливает их цитотоксические эффекты.

Другие цитотоксические средства

Другие противоопухолевые средства, которые можно конъюгировать с антителами, включают BCNU, стрептозоицин, винкристин и 5-фторурацил, семейство средств, вместе известных как комплекс LL-E33288, которое описано в патентах США 5053394, 5770710, а также эсперамицины (патент США 5877296).

Ферментативно активные токсины и их фрагменты, которые можно использовать, включают цепь A дифтерийного токсина, несвязывающие активные фрагменты дифтерийного токсина, цепь A экзотоксина (из Pseudomonas aeruginosa), цепь A рицина, цепь A абрина, цепь A модессина, α-сарцин, белки Aleurites fordii, диантиновые белки, белки Phytolaca americana (PAPI, PAPII и PAP-S), ингибитор Momordica charantia, курцин, кротин, ингибитор Sapaonaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, еномицин и трихотецены. См., например, WO 93/21232, публикация от 28 октября 1993 года.

В настоящем изобретении дополнительно рассмотрены иммуноконъюгаты, сформированные между антителом и соединением с нуклеолитической активностью (например, рибонуклеазой или ДНК эндонуклеазой, такой как дезоксирибонуклеаза; ДНКаза).

Для избирательного разрушения опухоли, антитело может содержать высоко радиоактивный атом. Различные радиоактивные изотопы доступны для получения радиоконъюгированных антител. Примеры включают At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. Когда конъюгат используют для обнаружения, он может содержать радиоактивный атом для сцинтиграфического исследования, например, Tc99m или I123, или спиновую метку для визуализации ядерного магнитного резонанса (ЯМР) (также известной как магнитно-резонансная визуализация, МРТ), такую как снова йод-123, йод-31, индий-111, фтор-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо.

Радиоактивные или другие метки можно встраивать в конъюгаты известными способами. Например, пептид можно получать биосинтезом или синтезировать посредством химического синтеза аминокислот с использованием подходящих предшественников аминокислот, включая, например, фтор-19 вместо водорода. Метки, такие как Tc99m или I123, Re186, Re188 и In111 можно присоединять через остаток цистеина в пептиде. Иттрий-90 можно присоединять через остаток лизина. Способ IODOGEN (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57) можно использовать для встраивания йода-123. В «Monoclonal Antibodies in Immunoscintigraphy» (Chatal, CRC Press 1989) подробно описаны другие способы.

Конъюгаты антитела и цитотоксического средства можно создавать с использованием различных бифункциональных средств для связывания с протеином, таких как N-сукцинимидил-3-(2-пиридилдитио)пропионат (SPDP), сукцинимидил-4-(N-малеимидометил)циклогексан-1-карбоксилат (SMCC), иминотиолан (IT), бифункциональные производные имидоэфиров (такие как диметиладипимидат HCl), активные сложные эфиры (такие как дисукцинимидилсуберат), альдегиды (такие как глутаральдегид), бис-азидосоединения (такие как бис-(п-азидобензоил)гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)этилендиамин), диизоцианаты (такие как толуол 2,6-диизоцианат) и бис-активные соединения фтора (такие как 1,5-дифтор-2,4-динитробензол). Например, иммунотоксин рицин можно получать, как описано в Vitetta et al., Science 238: 1098 (1987). Меченая углеродом-14 1-изотиоцианатобензил-3-метилдиэтилентриаминпентауксусная кислота (MX-DTPA) является образцовым хелатирующим средством для конъюгирования радионуклеотида с антителом. См. WO 94/11026. Линкер может представлять собой «расщепляемый линкер», облегчающий высвобождение цитотоксического лекарственного средства в клетке. Например, можно использовать кислотно-неустойчивый линкер, чувствительный к пептидазе линкер, фотонеустойчивый линкер, диметиловый линкер или дисульфидсодержащий линкер (Chari et al, Cancer Research 52: 127-131 (1992); патент США № 5208020).

Соединения в явной форме предполагают, но без ограничения, ADC, полученные с использованием кросс-линкерные реактивы: BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC и сульфо-SMPB и SVSB (сукцинимидил-(4-винилсульфон)бензоат), которые коммерчески доступны (например, в Pierce Biotechnology, Inc., Rockford, IL., U.S.A). См. страницы 467-498, 2003-2004 Applications Handbook and Catalog.

Получение конъюгатов антител и лекарственных средств

В конъюгатах антител и лекарственных средств (ADC), антитело (Ab) конъюгируют с одним или несколькими фрагментами лекарственного средства (D), например, приблизительно от 1 приблизительно до 20 фрагментов лекарственного средства на антитело, с помощью линкера (L). ADC формулы I можно получать несколькими путями, используя реакции органической химии, условия и реактивы, известные специалистам в данной области, включая: (1) реакцию нуклеофильной группы антитела с бивалентным линкерным реактивом, чтобы сформировать Ab-L, через ковалентную связь, с последующей реакцией с фрагментом лекарственного средства D; и (2) реакцию нуклеофильной группы фрагмента лекарственного средства с бивалентным линкерным реактивом, чтобы сформировать D-L, через ковалентную связь, с последующей реакцией с нуклеофильной группой антитела. Дополнительные способы получения ADC описаны в настоящем документе.

Ab-(L-D)p I

линкер может состоять из одного или нескольких линкерных компонентов. Образцовые линкерные компоненты включают 6-малеимидокапроил («MC»), малеимидопропаноил («MP»), валин-цитруллин («val-cit»), аланин-фенилаланин («ala-phe»), п-аминобензилоксикарбонил («PAB»), N-сукцинимидил-4-(2-пиридилтио)пентаноат («SPP»), N-сукцинимидил 4-(N-малеимидометил)циклогексан-1-карбоксилат («SMCC) и N-сукцинимидил (4-йодацетил)аминобензоат («SIAB»). Дополнительные линкерные компоненты известны в данной области и некоторые из них описаны в настоящем документе. См. также «Monomethylvaline Compounds Capable of Conjugation to Ligands», США сер. № 10/983340, подана 5 ноября 2004 года.

В некоторых вариантах осуществления линкер может содержать аминокислотные остатки. Образцовые аминокислотные линкерные компоненты включают дипептид, трипептид, тетрапептид или пентапептид. Образцовые дипептиды включают: валин-цитруллин (vc или val-cit), аланин-фенилаланин (af или ala-phe). Образцовые трипептиды включают: глицин-валин-цитруллин (gly-val-cit) и глицин-глицин-глицин (gly-gly-gly). Аминокислотные остатки, которые содержат аминокислотный линкерный компонент, содержат те, что встречаются в природе, а также минорные аминокислоты и не встречающиеся в природе аналоги аминокислот, такие как цитруллин. Аминокислотные линкерные компоненты можно конструировать и оптимизировать по их избирательности для ферментативного расщепления конкретными ферментами, например, опухоль-ассоциированной протеазой, катепсин B, C и D, или протеаза плазмина.

Нуклеофильные группы на антителах включают в качестве неограничивающих примеров: (i) N-концевые аминогруппы, (ii) аминогруппы боковой цепи, например, лизин, (iii) тиоловые группы боковой цепи, например, цистеин, и (iv) гидрокси- или аминогруппы сахаров, где антитело гликозилировано. Амино-, тиоловые и гидроксильные группы являются нуклеофильными и способны вступать в реакцию с образованием ковалентных связей с электрофильными группами на линкерных фрагментах и линкерных реактивах, включая: (i) активные сложные эфиры, такие как NHS сложные эфиры, HOBt сложные эфиры, галогенформиаты и галогенангидриды; (ii) алкил- и бензилгалогениды, такие как галогенацетамиды; (iii) альдегиды, кетоны, карбоксильные и малеимидные группы. Определенные антитела имеют восстанавливаемые межцепные дисульфиды, т.е. цистеиновые мостики. Антитела можно создавать способными вступать в реакцию конъюгации с линкерными реактивами посредством обработки восстанавливающим средством, таким как DTT (дитиотреитол). Каждый цистеиновый мостик, таким образом, образует, теоретически, два реакционноспособных тиоловых нуклеофила. Дополнительные нуклеофильные группы можно вводить в антитела посредством реакции лизинов с 2-иминотиоланом (реактив Трота), что ведет к превращению амина в тиол. Реакционноспособные тиоловые группы можно вводить в антитело (или его фрагмент) посредством введения одного, двух, трех, четырех или более остатков цистеина (например, получая мутантные антитела, содержащие один или несколько ненативных аминокислотных остатков цистеина).

Конъюгаты антител и лекарственных средств также можно получать посредством модификации антитела для введения электрофильных фрагментов, которые могут вступать в реакции с нуклеофильными заместителями на линкерном реактиве или лекарственном средстве. Сахара гликозилированных антител могут быть окислены, например, с использованием окисляющих реактивов перйодатов, чтобы сформировать альдегидные или кетоновые группы, которые могут реагировать с аминогруппой линкерных реактивов или фрагментов лекарственных средств. Получаемые группы иминовых оснований Шиффа могут формировать стабильную связь, или их можно восстанавливать, например, посредством боргидридных реактивов, чтобы формировать стабильные аминовые связи. В одном из вариантов осуществления реакция углеводной части гликозилированного антитела с галактозооксидазой или метапериодатом натрия может дать карбонильные (альдегидные и кетоновые) группы в белке, которые могут реагировать с подходящими группами на лекарственном средстве (Hermanson, Bioconjugate Methods). В другом варианте осуществления белки, содержащие N-концевые остатки серина или треонина, могут вступать в реакцию с метапериодатом натрия, что ведет к получению альдегида вместо первой аминокислоты (Geoghegan & Stroh, (1992) Bioconjugate Chem. 3: 138-146; US 5362852). Такой альдегид может вступать в реакцию с фрагментом лекарственного средства или линкерным нуклеофилом.

Аналогичным образом, нуклеофильные группы на фрагменте лекарственного средства включают в качестве неограничивающих примеров: амино-, тиоловые, гидроксильные, гидразидные, оксимовые, гидразиновые, тиосемикарбазоновые, гидразинкарбоксилатные и арилгидразидные группы, способные вступать в реакцию с образованием ковалентных связей с электрофильными группами на линкерных фрагментах и линкерных реактивах, включая: (i) активные сложные эфиры, такие как NHS сложные эфиры, HOBt сложные эфиры, галогенформиаты и галогенангидриды; (ii) алкил- и бензилгалогениды, такие как гелогенацетамиды; (iii) альдегидные, кетоновые, карбоксильные и малеимидные группы.

Альтернативно, слитный белок, содержащий антитело и цитотоксическое средство, можно создавать, например, рекомбинантными способами или с помощью синтеза пептидов. Фрагмент ДНК может содержать соответствующие области, кодирующие две части конъюгата или смежно друг к другу или разделенные областью, кодирующей линкерный пептид, который не разрушает желаемые свойства конъюгата.

В еще одном другом варианте осуществления антитело можно конъюгировать с «рецептором» (таким как стрептавидин) для использования в предварительном нацеливании на опухоль, где конъюгат антитело-рецептор вводят пациенту с последующим удалением несвязанного конъюгата из циркуляции с использованием очищающего средства, за чем следует введение «лиганда» (например, авидина), который конъюгирован с цитотоксическим средством (например, радионуклеотидом).

Композиции по изобретению

Это изобретение также охватывает композиции, включая фармацевтические композиции, которые содержат антитело против Bv8, и полинуклеотиды, содержащие последовательности, которые кодируют антитело против Bv8. Как используют в настоящем документе, композиции содержат одно или несколько антител, которые связываются с Bv8, и/или один или несколько полинуклеотидов, содержащие последовательности, которые кодируют одно или несколько антител, которые связываются с Bv8. Эти композиции дополнительно могут содержать подходящие носители, такие как фармацевтически приемлемые эксципиенты, включая буферы, которые хорошо известны в данной области.

Терапевтические составы, содержащие антитела против Bv8 по изобретению, получают для хранения посредством смешивания антитела, обладающего желаемой степенью чистоты, с необязательными физиологически приемлемыми носителями, эксципиентами или стабилизаторами (Remington: The Science and Practice of Pharmacy 20th edition (2000)), в форме водных растворов, лиофилизированных или других высушенных составов. Приемлемые носители, эксципиенты или стабилизаторы не токсичны для реципиентов в используемых дозах и концентрациях и включают буферы, такие как фосфатный, цитратный, гистидиновый и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как октадецилдиметилбензиламмонийхлорид; гексаметонийхлорид; хлорид бензалкония, хлорид бензетония; феноловый, бутиловый или бензиловый спирт; алкилпарабены, такие как метил- или пропилпарабен; катехол; резорцин; циклогексанол; 3-пентанол; и м-крезол); низкомолекулярные (приблизительно менее 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин, или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие средства, такие как ЭДТА; сахара, такие как сахароза, маннит, трегалоза или сорбит; солеобразующие противоионы, такие как натрий; комплексные соединения с металлами (например, комплексы Zn-белок); и/или неионные поверхностно-активные средства, такие как TWEEN™, PLURONICS™ или полиэтиленгликоль (PEG).

Для лечения конкретного показания состав в настоящем документе, по мере необходимости, также может содержать более чем одно активное соединение, предпочтительно с комплементными активностями, которые не оказывают нежелательного влияния друг на друга. Такие молекулы надлежаще представлены в комбинации в количествах, которые эффективны для предполагаемой цели.

Активные ингредиенты также можно заключить в микрокапсулы, полученные, например, способом коацервации или интерфазной полимеризацией, например, в гидроксиметилцеллюлозные или желатиновые микрокапсулы и поли-(метилметакрилатные) микрокапсулы, соответственно, в коллоидных системах доставки лекарственных средств (например, липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсиях. Такие способы раскрыты в Remington: The Science and Practice of Pharmacy 20th edition (2000).

Составы, подлежащие использованию для введения in vivo, должны быть стерильными. Это легко выполнить с помощью фильтрования через стерилизующие фильтрующие мембраны.

Можно получать препараты с замедленным высвобождением. Подходящие примеры препаратов с замедленным высвобождением включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащие иммуноглобулин по изобретению, эти матрицы имеют форму профилированных изделий, например, пленок или микрокапсул. Примеры матриц с замедленным высвобождением включают полиэстеры, гидрогели (например, поли(2-гидроксиэтилметакрилат), или поливиниловый сприт), полилактиды (патент США № 3773919), сополимеры L-глутаминовой кислоты и γ-этил-L-глутамата, неразлагающийся этиленвинилацетат, разлагающиеся сополимеры молочной кислоты-гликолевой кислоты, такие как LUPRON DEPOT™ (инъецируемые микросферы, состоящие из сополимера молочной кислоты-гликолевой кислоты и лейпролидацетата) и поли-D-(-)-3-гидроксимасляную кислоту. Тогда как полимеры, такие как этиленвинилацетат и сополимер молочной кислоты-гликолевой кислоты, делают возможным высвобождение молекул в течение более чем 100 суток, определенные гидрогели высвобождают белки в течение более коротких периодов времени. Когда инкапсулированные иммуноглобулины остаются в организме в течение длительного времени, они могут денатурировать или агрегировать в результате воздействия влаги при 37°C, что ведет к утрате биологической активности и возможным изменениям в иммуногенности. Можно разработать рациональные стратегии для стабилизации в зависимости от затрагиваемого механизма. Например, если обнаружено, что механизм агрегации сводится к образованию межмолекулярных S-S связей посредством тио-дисульфидного обмена, стабилизации можно добиться посредством модификации сульфгидрильных остатков, лиофилизации из кислых растворов, управления содержанием влаги, использования подходящих добавок и разработки специальных композиций полимерных матриц.

Использование

Антитело по настоящему изобретению, например, можно использовать в терапевтических способах in vitro, ex vivo и in vivo.

Изобретение относится к способам и композициям, которые можно использовать для модуляции состояний заболевания, ассоциированных с экспрессией и/или активностью Bv8, такой как повышенная экспрессия и/или активность или нежелательная экспрессия и/или активность, указанные способы включают введение эффективной дозы антитела против Bv8 индивидууму, нуждающемуся в таком лечении.

В одном из аспектов изобретение относится к способам лечения или предотвращения опухоли, рака и/или нарушения пролиферации клеток, способы включают введение эффективного количества антитела против Bv8 индивидууму, нуждающемуся в таком лечении.

В одном из аспектов изобретение относится к способам ингибирования ангиогенеза, способы включают введение эффективного количества антитела против Bv8 индивидууму, нуждающемуся в таком лечении.

В одном из аспектов изобретение относится к способам ингибирования метастазирования опухоли, способы включают введение эффективного количества антитела против Bv8 индивидууму, нуждающемуся в таком лечении.

В одном из аспектов изобретение относится к способам ингибирования пролиферации клеток эндотелия, способы включают введение эффективного количества антитела против Bv8 индивидууму, нуждающемуся в таком лечении.

В одном из аспектов изобретение относится к способам усиления повышения эффективности другого антиангиогенного средства, способы включают введение эффективного количества антитела против Bv8 индивидууму, нуждающемуся в таком лечении. В некоторых вариантах осуществления индивидуум имеет опухоль, рак и/или нарушение пролиферации клеток. В некоторых вариантах осуществления другое антиангиогенное средство нацелено на VEGF, например, антитело против VEGF.

Понятно, что любое подходящее антитело против Bv8 можно использовать в способах лечения, включая моноклональные и/или поликлональные антитела, антитело человека, химерное антитело, аффинно зрелое антитело, гуманизированное антитело и/или фрагмент антитела. В некоторых вариантах осуществления для лечения используют любое антитело против Bv8, описанное в настоящем документе.

В любом из способов в настоящем документе можно вводить субъекту или пациенту наряду с антителом против Bv8 в настоящем документе эффективное количество второго лекарственного средства (где антитело против Bv8 в настоящем документе представляет собой первое лекарственное средство), которое является другим активным средством, которое может лечить состояние субъекта, которое требует лечения. Например, антитело по изобретению можно совместно вводить с другим антителом, химиотерапевтическим средством(ами) (включая коктейли химиотерапевтических средств), антиангиогенным средством(ами), иммуносупрессорным средством(ами), цитокином(ами), антагонистом(ами) цитокина, и/или ингибирующим рост средством(ами). Тип такого второго лекарственного средства зависит от различных факторов, включая тип нарушения, тяжесть заболевания, состояние и возраст пациента, тип и дозу используемого первого лекарственного средства и т.д.

Когда антитело по изобретению ингибирует опухолевый рост, например, в частности, может быть желательно комбинировать его с одним или несколькими другими терапевтическими средствами, которые также ингибируют опухолевый рост. Например, антитело по изобретению можно комбинировать с антиангиогенным средством, таким как антитело против VEGF (например, Авастин®), и/или антитела против ErbB (например, антитело против HER2 трастузумаб Герцептин® или ингибитор EGFR (например, эрлотиниб (Тарцева®)) или антитело против HER2, которое связывается со II доменом HER2, такое как антитело против HER2 пертузумаб Омнитарг™) в схеме лечения, например, при лечении любого заболевания, описанного в настоящем документе, включая рак толстой кишки, рак легких, гепатоцеллюлярную карциному, рак молочной железы и/или рак поджелудочной железы. Альтернативно, или дополнительно, пациент может получать комбинированную лучевую терапию (например, облучение внешним пучком или терапию радиоактивно меченным средством, таким как антитело). Такая указанная выше комбинированная терапия включает комбинированное введение (где два или более средства входят в один или раздельные составы) и раздельное введение, в случае которого введение антитела по изобретению может происходить до и/или после введения вспомогательной терапии или терапий. Вдобавок ожидают, что комбинирование антитела по данному изобретению с относительно нецитотоксическим средством, таким как другая биологическая молекула, например, другое антитело, снизит цитотоксичность по сравнению с комбинированием антитела с химиотерапевтическим средством другого средства, которое высоко токсично для клеток.

Лечение комбинацией антитела в настоящем документе с одним или несколькими вторыми лекарственными средствами предпочтительно ведет к улучшению признаков или симптомов рака. Например, такая терапия может привести к повышению выживаемости (общая выживаемость и/или выживаемость без прогрессирования) по сравнению с пациентом, которого лечили только вторым лекарственным средством (например, только химиотерапевтическим средством) и/или может вести к объективному ответу (частичному или полному). Кроме того, лечение комбинацией антитела в настоящем документе и одного или нескольких вторых лекарственных средств предпочтительно ведет к аддитивной и более предпочтительно к синергической (или более чем аддитивной) терапевтической пользе для пациента. В определенных вариантах осуществления промежуток времени между по меньшей мере одним введением второго лекарственного средства и по меньшей мере одним введением антитела в настоящем документе составляет приблизительно один месяц или менее. В определенных вариантах осуществления промежуток времени между по меньшей мере одним введением второго лекарственного средства и по меньшей мере одним введением антитела в настоящем документе приблизительно составляет две недели или менее. В определенных вариантах осуществления антитело в настоящем документе и второе лекарственное средство вводят параллельно.

Для лечения рака второе лекарственное средство предпочтительно представляет собой другое антитело, химиотерапевтическое средство (включая коктейли химиотерапевтических средств), антиангиогенное средство, иммуносупрессорное средство, пролекарство, цитокин, антагонист цитокина, цитотоксическую лучевую терапию, кортикостероид, противорвотное, вакцину против рака, обезболивающе, противососудистое средство и/или ингибирующее рост средство. Цитотоксическое средство включает средство, взаимодействующее с ДНК, антиметаболиты, ингибиторы топоизомеразы I или II или ингибитор веретена деления или стабилизирующие средства (например, предпочтительно алкалоид барвинка, более предпочтительно выбранный из винбластина, дезоксивинбластина, винкристина, виндезина, винорелбина, винепидина, винфосилтина, винзолидина и винфунина), или любое средство, используемое в химиотерапии, такое как 5-FU, таксан, доксорубицин или дексаметезон.

В некоторых вариантах осуществления второе лекарственное средство представляет собой другое антитело, используемое для лечения рака, такое как направленное против внеклеточного домена рецептора HER2/neu, например, трастузумаб, или один из его функциональных фрагментов, ингибитор pan-HER, ингибитор Src, ингибитор MEK или ингибитор EGFR (например, антитело против EGFR (такое как антитело, ингибирующее тирозинкиназную активность EGFR), такое как цетуксимаб (Эрбитукс®), дианилинофталимиды, пиразоло- или пирролопиридопиримидины, хиназилины, гефинитиб, эрлотиниб, цетуксимаб, ABX-EFG, канертиниб, EKB-569 и PKI-166), или двойной ингибитор EGFR/HER-2, такой как лапатаниб. Дополнительные вторые лекарственные средства включают алемтузумаб (Кэмпас™), FavID (IDKLH), антитела к CD20 с измененным гликозилированием, такие как GA-101/Гликарт™, облимерсен (Генасенс™), талидомид и их аналоги, такие как леналидомид (Ревлимид™), иматиниб, сорафениб, офатумумаб (HUMAX-CD20™), антитело против CD40, например, SGN-40, и антитело против CD-80, например, галиксимаб.

Противорвотным средством предпочтительно является ондансетрон гидрохлорид, гранисетрон гидрохлорид, метроклопрамид, домперидон, галоперидол, циклизин, лоразепам, прохлорпемазин, дексаметезон, левомепромазин или трописетрон. Вакциной предпочтительно являются ДНК GM-CSF и клеточные вакцины, дендритная вакцина, рекомбинантные вирусные вакцины, вакцины белков теплового шока (HSP), аллогенные или аутологические опухолевые вакцины. Аналгезирующим средством предпочтительно является ибупрофен, напроксен, холин магний трисалицилат или оксикодон гидрохлорид. Противососудистым средством предпочтительно является бевацизумаб или rhuMAb-VEGF. Дополнительные вторые лекарственные средства включают антипролиферативные средства, такие как ингибиторы фарнезилпротеинтрансферазы, ингибиторы VEGF, ингибиторы p53 или ингибиторы PDGFR. Второе лекарственное средство в настоящем документе также включает биологически-направленную терапию, такую как лечение антителами, а также направленную терапию малыми молекулами, например, против определенных рецепторов.

Многие антиангиогенные средства идентифицированы и известны в данной области, включая те, что перечислены в настоящем документе, например, в Определениях, и, например, авторами Carmeliet and Jain, Nature 407:249-257 (2000); Ferrara et al, Nature Reviews: Drug Discovery, 3:391-400 (2004); и Sato Int. J. Clin. Oncol, 8:200-206 (2003). Также см., патентную заявку США US 20030055006. В одном из вариантов осуществления антитело против Bv8 используют в комбинации с нейтрализующим антителом против VEGF (или фрагментом) и/или другим антагонистом VEGF или антагонистом рецептора VEGF, включая в качестве неограничивающих примеров, например, фрагменты растворимого рецептора VEGF (например, VEGFR-1, VEGFR-2, VEGFR-3, нейропилины (например, NRP1, NRP2)), аптамеры, способные блокировать VEGF или VEGFR, нейтрализующие антитела против VEGFR, низкомолекулярные ингибиторы тирозинкиназ VEGFR (RTK), антисмысловые стратегии для VEGF, рибозимы против VEGF или рецепторов VEGF, варианты антагонистов VEGF; и любые их сочетания. Альтернативно или дополнительно, два или более ингибитора ангиогенеза необязательно можно совместно вводить пациенту в дополнение к антагонисту VEGF и другому средству. В определенном варианте осуществления одно или несколько дополнительных терапевтических средств, например, средств против рака, можно вводить в комбинации с антителом против Bv8, антагонистом VEGF и антиангиогенным средством.

Химиотерапевтические средства, которые можно использовать в настоящем документе, описаны выше, например, в определении «химиотерапевтического средства».

Такие вторые лекарственные средства можно вводить в течение 48 часов после введения антител в настоящем документе или в течение 24 часов или в течение 12 часов или в течение 3-12 часов после указанного средства или их можно вводить через предварительно выбранный период времени, который предпочтительно составляет приблизительно от 1 до 2 суток. Кроме того, доза такого средства может быть субтерапевтической.

Антитела в настоящем документе можно вводить параллельно, последовательно или поочередно со вторым лекарственным средством или на основании невосприимчивости другой терапии. Таким образом, комбинированное введение второго лекарственного средства включает совместное введение (параллельное введение) с использованием раздельных составов или одного фармацевтического состава и последовательное введение в любом порядке, где предпочтительно имеет место период времени, в течение которого оба (или все) лекарственных средства одновременно проявляют свои биологические активности. Все эти вторые лекарственные средства можно использовать в комбинации друг с другом или самостоятельно с первым лекарственным средством, чтобы выражение «второе лекарственное средство», как используют в настоящем документе, не обозначало, что это единственное лекарственное средство, помимо первого лекарственного средства, соответственно. Таким образом, второе лекарственное средство не обязательно представляет собой одно лекарственное средство, но может составлять или содержать более чем одно такое лекарственное средство.

Эти вторые лекарственные средства, как указано в настоящем документе, как правило, используют в тех же дозах и через пути введения, что и первые лекарственные средства, или приблизительно от 1 до 99% доз первых лекарственных средств. Если такие вторые лекарственные средства вообще используют, предпочтительно, их используют в меньших количествах, чем если бы первое лекарственное средство не присутствовало, в частности, в последующих дозированиях после начального дозирования первого лекарственного средства, с тем, чтобы устранить или снизить побочные эффекты, вызванные ими.

Изобретение также относится к способам и композициям для ингибирования или предотвращения рефракторной опухоли, рецидива опухолевого роста или рецидива роста злокачественных клеток. В определенных вариантах осуществления рецидив опухолевого роста или рецидив роста злокачественных клеток используют для описания состояния, в котором пациенты, которых подвергали или лечили одной или несколькими доступными в настоящее время терапиями (например, терапия рака, такая как химиотерапия, лучевая терапия, хирургическое вмешательство, гормональная терапия и/или биологическая терапия/иммунотерапия, терапия антителом против VEGF, в частности, стандартный терапевтический режим для конкретного рака), клинически не адекватно для лечения пациентов или пациенты более не получают какого-либо положительного воздействия от терапии, так что этим пациентам нужна дополнительная эффективная терапия. В определенных вариантах осуществления рак представляет собой рецидив опухолевого роста или рецидив роста злокачественных клеток, где число клеток рака не было значительно уменьшено или увеличилось или размер опухоли не был значительно уменьшен или увеличился или не удается какое-либо дальнейшее уменьшение размера или числа клеток рака. В определенных вариантах осуществления пациенты с рецидивом опухолевого роста или рецидивом роста злокачественных клеток развили устойчивость к одной или нескольким доступным в настоящее время терапиям. В определенных вариантах осуществления термин рефракторный используют для описания состояния, в котором пациенты, подвергаются или их лечили с использованием одной или нескольких доступных в настоящее время терапий (например, терапии рака, такие как химиотерапия, лучевая терапия, хирургическое вмешательство, гормональная терапия и/или биологическая терапия/иммунотерапия, терапия антителами против VEGF, в частности, стандартный терапевтический режим для конкретного рака), клинически не адекватно для лечения пациента. В определенных вариантах осуществления невосприимчивые/рефракторные пациенты представляют собой пациентов, которые отвечают на терапию, но при этом страдают от побочных эффектов, не отвечают на терапию или не отвечают на терапию удовлетворительно и т.д. В определенных вариантах осуществления рак представляет собой невосприимчивую/рефракторную опухоль, где опухоль по существу невосприимчива или устойчива к предыдущему лечению. В определенных вариантах осуществления рефракторный относится к по существу невосприимчивости заболевания или состоянии к терапии, содержащей антагонист VEGF. При определении того, являются ли клетки рака рефракторными, рецидив опухолевого роста или рецидив роста злокачественных клеток можно получать или in vivo или in vitro любым известным в данной области способом для оценки эффективности воздействия на клетки рака, используя принятые в данной области значения «рецидив» или «рефракторный» или «невосприимчивый» в таком контексте.

Изобретение относится к способам блокирования или снижения рецидивирующего опухолевого роста или рецидивирующего роста злокачественных клеток у субъекта посредством введения эффективного количества антитела против Bv8, чтобы блокировать или снизить рецидивирующий опухолевый рост или рецидивирующий рост злокачественных клеток у субъекта. Изобретение относится к способам лечения пациентов, рефракторных к терапии, содержащей антагонист VEGF, посредством введения эффективного количества антитела против Bv8 пациенту. В определенных вариантах осуществления антитело против Bv8 можно вводить после другого терапевтического средства против рака. В определенных вариантах осуществления антитело против Bv8 вводят одновременно с терапией рака. Альтернативно, или дополнительно, терапию антителом против Bv8 чередуют с другой терапией рака, которую можно осуществлять в любом порядке. Изобретение также относится к способам введения одного или нескольких ингибирующих антител для предотвращения начала или рецидива рака у пациентов, предрасположенных иметь рак. Как правило, субъект проходил или параллельно подвергается терапии рака. В одном из вариантов осуществления терапия рака представляет собой лечение с использованием антиангиогенного средства, например, антагониста VEGF. Антиангиогенное средство включает те, что известны в данной области, и те, что можно найти в определениях в настоящем документе. В одном из вариантов осуществления антиангиогенное средство представляет собой нейтрализующее антитело против VEGF или его фрагмент (например, гуманизированное A4.6.1, Авастин® (Genentech, South San Francisco, CA), Y0317, M4, G6, B20, 2C3, и т.д.). См., например, патенты США 6582959, 6884879, 6703020; WO 98/45332; WO 96/30046; WO 94/10202; ЕР 0666868В1; патентные заявки США 20030206899, 20030190317, 20030203409 и 20050112126; Popkov et al, Journal of Immunological Methods 288:149-164 (2004); и WO 2005012359. Дополнительные средства можно вводить в комбинации с антагонистом VEGF и антителом против Bv8 для лечения рефракторной опухоли, блокирования или уменьшения рецидива опухолевого роста или рецидива роста злокачественных клеток.

Антитела против Bv8 по изобретению (и вспомогательное терапевтическое средство) вводят с помощью любых подходящих средств, включая парентеральное, подкожное, интраперитонеальное, внутрилегочное и интраназальное введение и, при желании, для локального лечения, введение внутрь поражений. Парентеральные инфузии включают внутримышечное, внутривенное, внутриартериальное, интраперитонеальное или подкожное введение. Вдобавок, антитела против Bv8 надлежаще вводят импульсными инфузиями, в частности, с использованием снижающихся доз антитела. Дозирование можно осуществлять через любой подходящий путь, например, посредством инъекций, таких как внутривенные или подкожные инъекции, частично в зависимости от того, является ли введение коротким или хроническим.

Положение мишени связывания антитела по изобретению можно принимать во внимание при получении и введении антитела. Когда мишень связывания представляет собой внутриклеточную молекулу, определенные варианты осуществления изобретения предусматривают антитело или антигенсвязывающий его фрагмент, подлежащий введению в клетку, где расположена мишень связывания. В одном из вариантов осуществления антитело против Bv8 по изобретению можно экспрессировать внутриклеточно в виде интраантитела. Термин «интраантитело», как используют в настоящем документе, относится к антителу или его антигенсвязывающей части, которое экспрессируют внутриклеточно и которое способно избирательно связываться с молекулой-мишенью, как описано, например, в Marasco, Gene Therapy 4: 11-15 (1997); Kontermann, Methods 34: 163-170 (2004); патенты США №№ 6004940 и 6329173; публикации патентной заявки США № 2003/0104402 и публикации PCT № WO 2003/077945. Также см., например, WO 96/07321, дата публикации 14 марта 1996 года, относительно использования генной терапии для создания внутриклеточных антител.

Внутриклеточную экспрессию интраантитела можно осуществлять посредством введения нуклеиновой кислоты, кодирующей желаемое антитело или его антигенсвязывающую часть (не содержит лидерную последовательность дикого типа и секреторные сигналы, обычно ассоциированные с геном, кодирующим это антитело или антигенсвязывающий фрагмент) в клетку-мишень. Одну или несколько нуклеиновых кислот, кодирующих все антитело по изобретению или его часть, можно доставлять в клетку-мишень так, что экспрессируется одно или несколько интраантител, которые способны связываться с внутриклеточным полипептидом-мишенью и модулировать активность полипептида-мишени. Можно использовать любой стандартный способ введения нуклеиновых кислот в клетку, включая в качестве неограничивающих примеров, микроинъекцию, баллистическую инъекцию, электропорацию, преципитацию с фосфатом кальция, липосомы и трансфекцию с использованием ретровирусного, аденовирусного, аденоассоциированного вирусного вектора и вектора из вируса осповакцины, несущего нуклеиновую кислоту, представляющую интерес.

В определенных вариантах осуществления нуклеиновую кислоту (необязательно содержится в векторе) можно вводить в клетки пациента способами in vivo и ex vivo. В одном из примеров доставки in vivo, нуклеиновую кислоту инъецируют непосредственно пациенту, например, в месте, где требуется терапевтическое вмешательство. В дополнительном примере доставки in vivo, нуклеиновую кислоту вводят в клетку с использованием трансфекции вирусными векторами (такими как аденовирус, вирус простого герпеса I или аденоассоциированный вирус) и систем на липидной основе (эффективными липидами для опосредованного липидами переноса гена являются, например, DOTMA, DOPE и DC-Choi). Обзор определенных протоколов мечения генов и генной терапии см. в Anderson et al., Science 256:808-813 (1992), и WO 93/25673 и цитируемых в них ссылках. В примере лечения ex vivo удаляют клетки пациента, вводят нуклеиновую кислоту в эти выделенные клетки и модифицированные клетки вводят пациенту или напрямую или, например, инкапсулированными в пористых мембранах, которые имплантируют пациенту (см., например, патенты США №№ 4892538 и 5283187). Общеупотребительный вектор для доставки нуклеиновой кислоты ex vivo представляет собой ретровирусный вектор.

В другом варианте осуществления предусмотрены интернализирующие антитела. Антитела могут обладать определенными характеристиками, которые увеличивают доставку антител в клетки, или их можно модифицировать, чтобы они обладали такими характеристиками. Способы достижения этого известны в данной области. Например, известно, что катионизация антитела облегчает его накопление в клетках (см., например, патент США № 6703019). Липофекцию или липосомы также можно использовать для доставки антитела в клетки. Когда используют фрагменты антител, полезным может быть наименьший ингибирующий фрагмент, который специфически связывается с белком-мишенью. Например, на основе последовательностей вариабельных областей антитела, можно конструировать пептидные молекулы, которые сохраняют способность к связыванию последовательности белка-мишени. Такие пептиды можно синтезировать химически и/или получают с помощью технологии рекомбинантных ДНК. См., например, Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993).

Вхождение антител в клетки-мишени можно увеличить другими известными в данной области способами. Например, определенные последовательности, такие как те, что получены из Tat ВИЧ или гомеодоменного белка Antennapedia Are, способны направлять эффективное накопление гетерологичных белков через клеточные мембраны. См., например, Chen et al, Proc. Natl. Acad. Sci. USA (1999), 96:4325-4329.

Когда мишень связывания антитела расположена в головном мозге, определенные варианты осуществления изобретения предусматривают антитело для пересечения гематоэнцефалического барьера. Существует несколько известных в данной области подходов для транспортировки молекул через гематоэнцефалический барьер, включая в качестве неограничивающих примеров, физические способы, способы на основе липидов, способы на основе стволовых клеток и способы на основе рецепторов и каналов.

Физические способы транспортировки антитела через гематоэнцефалический барьер включают в качестве неограничивающих примеров обхождение гематоэнцефалического барьера полностью, или посредством создания отверстий в гематоэнцефалическом барьере. Способы обхождения включают в качестве неограничивающих примеров прямую инъекцию в головной мозг (см., например, Papanastassiou et al., Gene Therapy 9: 398-406 (2002)), интерстициальную инфузию/доставку, усиленную конвекцией (см., например, Bobo et al., Proc. Natl. Acad. Sci. USA 91: 2076-2080 (1994)) и имплантацию устройства доставки в головной мозг (см., например, Gill et al, Nature Med. 9: 589-595 (2003); и Gliadel Wafers™, Guildford Pharmaceutical). Способы создания отверстий в барьере включают в качестве неограничивающих примеров ультразвук (см., например, публикацию патента США № 2002/0038086), осмотическое давление (например, посредством введения гипертонического маннита (Neuwelt, E. A., Implication of the Brain-Blood Barrier and its Manipulation, тома 1 и 2, Plenum Press, N.Y. (1989)), пермеабилизацию, например, брадикинином или пермеабилизатором A-7 (см., например, патенты США №№ 5112596, 5268164, 5506206 и 5686416) и трансфекцию нейронов, которые проходят через гематоэнцефалический барьер, векторами, содержащими гены, которые кодируют антитело (см., например, публикацию патента США № 2003/0083299).

Основанные на липидах способы транспортировки антитела через гематоэнцефалический барьер включают в качестве неограничивающих примеров инкапсуляцию антитела в липосомы, которые соединены со связывающими фрагментами антитела, которые связываются с рецепторами на эндотелии сосудов в гематоэнцефалическом барьере (см., например, публикацию патентной заявки США № 20020025313), и покрытие антитела в частицах из липопротеинов низкой плотности (см., например, публикацию патентной заявки США № 20040204354) или аполипопротеин E (см., например, публикацию патентной заявки США № 20040131692).

Основанные на стволовых клетках способы транспортировки антитела через гематоэнцефалический барьер включают экспрессию антитела, представляющего интерес, генетически сконструированных нервных клетках-предшественниках (NPC) и затем имплантацию стволовых клеток в головной мозг индивидуума, подлежащего лечению. См. расширенную публикацию он-лайн Behrstock et al. (2005) Gene Ther. 15 Dec. 2005 (сообщается о том, что генетически сконструированные NPC для экспрессии нейротрофического фактора GDNF уменьшали симптомы болезни Паркинсона, когда их имплантировали в головной мозг в моделях на грызунах и приматах).

Основанные на рецепторах и каналах способы транспортировки антитела через гематоэнцефалический барьер включают в качестве неограничивающих примеров использование глюкокортикоидных блокаторов для повышения проницаемости гематоэнцефалического барьера (см., например, публикации патентных заявок США №№ 2002/0065259, 2003/0162695 и 2005/0124533); активацию калиевых каналов (см., например, публикацию патентной заявки США № 2005/0089473), ингибирование переносчиков лекарственных средств ABC (см., например, публикацию патентной заявки США № 2003/0073713); покрытие антител трансферрином и модуляцию активности одного или нескольких рецепторов трансферрина (см., например, публикацию патентной заявки США № 2003/0129186), и катионизацию антител (см., например, патент США № 5004697).

Антитела против Bv8 по изобретению следует формулировать, дозировать и вводить таким образом, который соответствует добросовестной медицинской практике. Факторы, рассматриваемые в этом контексте, включают конкретное нарушение, подлежащее лечению, конкретное млекопитающее, подлежащее лечению, клиническое состояние отдельного пациента, причину нарушения, место доставки средства, способ введения, режим введения и другие факторы, известные медицинским практикам. Антитело против Bv8 не обязательно, но необязательно формулируют с одним или несколькими средствами, используемыми в настоящее время для предотвращения или лечения рассматриваемого нарушения. Эффективное количество таких других средств зависит от количества антитела, присутствующего в составе, типа нарушения или лечения и других факторов, рассмотренных выше. Как правило, их используют в тех же дозах и с использованием путей введения, как описано в настоящем документе, или приблизительно от 1 до 99% от доз, описанных в настоящем документе, или в любой дозе и через любой путь, который эмпирически/клинически определен как подходящий.

Для предотвращения или лечения заболевания, подходящая доза антитела по изобретению (когда используют отдельно или в комбинации с одним или несколькими другими дополнительными терапевтическими средствами) будет зависеть от типа заболевания, подлежащего лечению, типа антитела, тяжести и течения заболевания, профилактической или терапевтической цели введения антитела, предыдущей терапии, клинической истории пациента и ответа на антитела, и усмотрения лечащего врача. Антитело надлежаще вводят пациенту за один раз или в течение серии воздействий. В зависимости от типа и тяжести заболевания, приблизительно от 1 мг/кг до 15 мг/кг (например, 0,1-10мг/кг) антитела может составлять минимальную рассматриваемую дозу для введения пациенту, например, одним или несколькими раздельным введениями или непрерывной инфузией. Одна типичная суточная доза может варьировать приблизительно от 1 мг/кг до 100 мг/кг или более, в зависимости от указанных выше факторов. Для повторных введений в течение нескольких суток или дольше, в зависимости от состояния, лечение как правило следует обеспечивать, пока не наступит желаемое подавление симптомов заболевания. Одна образцовая доза антитела будет в диапазоне приблизительно от 0,05 мг/кг приблизительно до 50 мг/кг. Таким образом, пациенту можно вводить одну или несколько доз приблизительно по 0,5 мг/кг, 2,0 мг/кг, 4,0 мг/кг, 10 мг/кг, 15 мг/кг, 20 мг/кг или 25 мг/кг (или любое их сочетание). Такие дозы можно вводить периодически, например, каждую неделю или каждые три недели (например, чтобы пациент получил приблизительно от двух приблизительно до двенадцати или, например, приблизительно шесть доз антитела). Можно вводить начальную более высокую загрузочную дозу, за которой следует одна или несколько более низких доз. Образцовый режим дозирования включает введение начальной загрузочной дозы приблизительно 4 мг/кг с последующей еженедельной поддерживающей дозой антитела приблизительно 2 мг/кг. Однако, можно использовать другие схемы дозирования. Мониторинг прогресса этой терапии легко осуществлять с помощью общепринятых способов и анализов.

Диагностические способы и способы обнаружения

Антитела против Bv8 по изобретению можно использовать в анализах для обнаружения экспрессии Bv8 (таких как диагностические или прогностические анализы) в конкретных клетках или тканях, где антитела метят, как описано ниже и/или иммобилизуют на нерастворимой матрице.

В другом аспекте изобретение относится к способам обнаружения Bv8, способы включают обнаружение комплекса Bv8-антитело против Bv8 в образце. Термин «обнаружение», как используют в настоящем документе, включает качественное и/или количественное обнаружение (измерение уровней) со ссылкой на контроль или без нее.

В другом аспекте изобретение относится к любому из антител против Bv8, описанных в настоящем документе, где антитело против Bv8 содержит обнаружимую метку.

В другом аспекте изобретение относится к комплексу любого из антител против Bv8, описанных в настоящем документе, и Bv8. В некоторых вариантах осуществления комплекс находится in vivo или in vitro. В некоторых вариантах осуществления комплекс содержит клетку рака. В некоторых вариантах осуществления антитело против Bv8 содержит обнаружимую метку.

Антитела против Bv8 (например, любое из антитела к Bv8, описанных в настоящем документе) можно использовать для обнаружения Bv8 в одном из многих хорошо известных аналитических способов обнаружения.

Например, биологический образец можно анализировать на Bv8 посредством получения образца из желаемого источника, смешивания образца с антителом против Bv8, чтобы позволить антителу сформировать комплекс антитело/Bv8 с любым Bv8, присутствующим в смеси, и обнаружения какого-либо комплекса антитело/Bv8, присутствующего в смеси. Биологический образец можно получать для анализа известными в данной области способами, которые подходят для конкретного образца. Способы смешивания образца с антителами и способы обнаружения комплекса антитело/Bv8 выбирают в соответствии с типом используемого анализа. Такие анализы включают иммуногистохимию, конкурентный и сэндвич-анализ, и анализы стерического ингибирования. Для получения образца можно использовать образец ткани или клеток из млекопитающего (типично пациента-человека). Примеры образцов включают в качестве неограничивающих примеров клетки рака, такие как клетки рака ободочной кишки, молочной железы, предстательной железы, яичника, легкого, желудка, поджелудочной железы, лимфомы и лейкоза. Bv8 также можно измерять в сыворотке. Образец можно получать с помощью различных процедур, известных в данной области, включая в качестве неограничивающих примеров хирургическое иссечение, аспирацию или биопсию. Ткань может быть свежей или замороженной. В одном из вариантов осуществления образец фиксируют и заливают в парафин или т.п. Образец ткани можно фиксировать (т.е. консервировать) стандартным способом (См. например, «Manual of Histological Staining Method of the Armed Forces Institute of Pathology», 3rd edition (1960) Lee G. Luna, HT (ASCP) Editor, The Blakston Division McGraw-Hill Book Company, New York; The Armed Forces Institute of Pathology Advanced Laboratory Methods in Histology and Pathology (1994) Ulreka V. Mikel, Editor, Armed Forces Institute of Pathology, American Registry of Pathology, Washington, D.C.). Специалист в данной области примет во внимание, что выбор фиксатора определяют по цели, для которой образец подлежит гистологическому окрашиванию или иному анализу. Специалист в данной области также примет во внимание, что длительность фиксации зависит от размера образца ткани и используемого фиксатора. В качестве примера, нейтрально забуференный формалин, смесь Буэна или параформальдегид, можно использовать для фиксации образца. Как правило, образец сначала фиксируют и затем дегидратируют посредством возрастающего ряда спиртов, инфильтрируют и заливают парафином или другими средами для срезов с тем, чтобы можно было делать срезы образца ткани. Альтернативно, можно сделать срезы ткани и фиксировать полученные срезы. В качестве примера, образец ткани можно залить и обработать в парафине стандартным способом (См. например, «Manual of Histological Staining Method of the Armed Forces Institute of Pathology», выше). Примеры парафина, который можно использовать, включают в качестве неограничивающих примеров Paraplast, Broloid и Tissuemay. После заливки образца ткани, можно делать срезы образца с помощью микротома или т.п. (См. например, «Manual of Histological Staining Method of the Armed Forces Institute of Pathology», выше). В качестве примера этой процедуры толщина срезов может варьировать приблизительно от трех мкм приблизительно до пяти мкм. После нарезания срезы можно прикреплять к предметным стеклам несколькими стандартными способами. Примеры адгезивов для предметных стекол включают в качестве неограничивающих примеров силан, желатин, поли-L-лизин и т.п. В качестве примера, погруженные в парафин срезы можно прикреплять к положительно заряженным предметным стеклам и/или предметным стеклам, покрытым поли-L-лизином. Если парафин использовали в качестве материала для заливки, тканевые срезы, как правило, депарафинизируют и регидратируют до воды. Тканевые срезы можно депарафинизировать несколькими стандартными способами. Например, можно использовать ксилолы и постепенно убывающий ряд спиртов (См. например, «Manual of Histological Staining Method of the Armed Forces Institute of Pathology», выше). Альтернативно, можно использовать коммерчески доступные депарафинизирующие неорганические средства, такие как Hemo-De7 (CMS, Houston, Texas).

Во всех аналитических способах для Bv8 используют один или несколько из следующих реактивов: меченый аналог Bv8, иммобилизованный аналог Bv8, меченое антитело против Bv8, иммобилизованное антитело против Bv8, и стерические конъюгаты. Меченые реактивы также известны как «меченые вещества».

Используемая метка представляет собой любую обнаружимую функциональность, которая не препятствует связыванию Bv8 и антитела против Bv8. Множество меток известно для использования в иммунологическом анализе, примеры включают фрагменты, которые можно обнаружить непосредственно, такие как флуорохромовые, хемилюминесцентные и радиоактивные метки, а также фрагменты, такие как ферменты, для обнаружения которых должна произойти реакция или нужно получить производные.

Используемая метка представляет собой любую обнаружимую функциональность, которая не препятствует связыванию Bv8 и антитела против Bv8. Множество меток известно для использования в иммунологическом анализе, примеры включают фрагменты, которые могут быть обнаружены непосредственно, такие как флуорохромовые, хемилюминесцентные и радиоактивные метки, а также фрагменты, такие как ферменты, для обнаружения которых должна произойти реакция или нужно получить производные. Примеры таких меток включают радиоизотопы 32P, 14C, 125I, 3H, и 131I, флуорофоры, такие как редкоземельные хелаты или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люциферазу светлячка и бактериальную люциферазу (патент США № 4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидазу хрена (HRP), щелочную фосфатазу, P-галактозидазу, глюкоамилазу, лизоцим, сахаридоксидазы, например, глюкозоксидазу, галактозооксидазу, и глюкозо-6-фосфатдегидрогеназу, гетероциклические оксидазы, такие как уриказа и ксантиноксидаза, соединенные с ферментом, который использует пероксид водорода для окисления предшественника красителя, таким как HRP, лактопероксидаза или микропероксидаза, биотином/авидином, спиновыми метками, бактериофаговыми метками, стабильными свободными радикалами и т.п.

Стандартные способы доступны для связывания этих меток ковалентно с белками или полипептидами. Например, связывающие средства, такие как диальдегиды, карбодиимиды, дималеимиды, бис-имидаты, бис-диазотированный бензидин, и т.п. можно использовать для мечения антител с использованием описанных выше флуоресцентных, хемилюминесцентных и ферментативных меток. См., например, патенты США №№ 3940475 (флуорометрия) и 3645090 (ферменты); Hunter et al., Nature, 144: 945 (1962); David et al., Biochemistry, 13: 1014-1021 (1974); Pain et al., J. Immunol. Methods, 40: 219-230 (1981); и Nygren, J. Histochem. and Cytochem., 30: 407-412 (1982). Предпочтительные метки в настоящем документе представляют собой ферменты, такие как пероксидаза хрена и щелочная фосфатаза. Конъюгация такой метки, содержащей ферменты, с антителом, представляет собой стандартную подручную процедуру для среднего специалиста в способа иммунологического анализа. См., например, O'Sullivan et al., «Methods for the Preparation of Enzyme-antibody Conjugates for Use in Enzyme Immunoassay», в Methods in Enzymology, ed. J.J. Langone and H. Van Vunakis, том 73 (Academic Press, New York, New York, 1981), стр. 147-166.

Иммобилизация реактивов необходима для определенных способов анализа. Иммобилизация включает отделение антитела против Bv8 от каких-либо Bv8, которые остаются свободными в растворе. Стандартно это выполняют или посредством понижения растворимости антитела против Bv8 или аналога Bv8 перед процедурой анализа, например, посредством адсорбции на водонерастворимой матрице или поверхности (Bennich et al., U.S. 3720760), посредством ковалентного связывания (например, с использованием перекрестной сшивки глутаральдегидом), или посредством понижения растворимости антитела против Bv8 или аналога Bv8 после, например, посредством иммунопреципитации.

Экспрессию белков в образце можно исследовать с использованием протоколов иммуногистохимии и окрашивания. Показано, что иммуногистохимическое окрашивание тканевых срезов является надежным способом оценки или обнаружения присутствия белков в образце. В способах иммуногистохимии («ИГХ») используют антитело для исследования и визуализации клеточных антигенов in situ, как правило, хромогенными или флуоресцентными способами. Для получения образца можно использовать образец ткани или клеток от млекопитающего (типично пациента-человека). Образец можно получать с помощью различных процедур, известных в данной области, включая в качестве неограничивающих примеров, хирургическое иссечение, аспирацию или биопсию. Ткань может быть свежей или замороженной. В одном из вариантов осуществления образец фиксируют и заливают парафином или т.п. Образец ткани можно фиксировать (т.е. консервировать) стандартным способом. Специалист в данной области примет во внимание, что выбор фиксатора определяется целью, с которой образец подвергают гистологическому окрашиванию или анализируют иным образом. Специалист в данной области также примет во внимание, что длительность фиксации зависит от размера образца ткани и используемого фиксатора.

ИГХ можно осуществлять в комбинации с дополнительными способами, такими как морфологическое окрашивание и/или флуоресцентная гибридизация in situ. Доступны два основных способа ИГХ; прямой и непрямой анализ. Согласно первому анализу, связывание антитела с антигеном-мишенью (например, Bv8) определяют непосредственно. В этом прямом анализе используют меченый реактив, такой как флуоресцентная метка или меченое ферментом первичное антитело, который можно визуализировать без дополнительного взаимодействия антитела. В типичном непрямом анализе неконъюгированное первичное антитело связывается с антигеном, а затем меченое вторичное антитело связывается с первичным антителом. Когда вторичное антитело конъюгировано с ферментативной меткой, добавляют хромогенный или флуорогенный субстрат, чтобы обеспечить визуализацию антигена. Усиление сигнала происходит в связи с тем, что несколько вторичных антитела могут реагировать с различными эпитопами на первичном антителе.

Первичное и/или вторичное антитело, используемое для иммуногистохимии, типично следует метить обнаружимым фрагментом. Доступно множество меток.

Помимо рассмотренных выше процедур получения образца, может быть желательная дополнительная обработка тканевого среза до, во время или после ИГХ. Например, можно осуществлять способы извлечения эпитопов, такие как нагревание образца ткани в цитратном буфере (см., например, Leong et al. Appl. Immunohistochem. 4(3):201 (1996)).

После необязательной стадии блокирования, тканевой срез подвергают воздействию первичного антитела в течение достаточного периода времени и в подходящих условиях так, что первичное антитело связывается с антигенным белком-мишенью в образце ткани. Подходящие условия для достижения этого можно определять с помощью повседневных экспериментов. Степень связывания антитела с образцом определяют с использованием любой одной из обнаружимых меток, рассмотренных выше. Предпочтительно, метка представляет собой ферментативную метку (например, HRPO), которая катализирует химическое изменение хромогенного субстрата, такого как хромоген 3,3'-диаминобензидин. Предпочтительно ферментативную метку конъюгируют с антителом, которое связывается специфически с первичным антителом (например, первичное антитело представляет собой поликлональное антитело кролика, а вторичное антитело представляет собой антитело козы против кролика).

Полученные таким образом образцы можно закреплять и приклеивать покровное стекло. Затем определяют оценку препарата, например, используя микроскоп, и можно использовать критерии интенсивности окрашивание, обычно используемые в данной области.

Другие способы анализа, известные как конкурентные или сэндвич-анализы, хорошо отлажены и широко используются в отрасли коммерческой диагностики.

Конкурентные анализы основаны на способности меченного аналога Bv8 конкурировать с тестируемым образцом Bv8 за ограниченное число участков связывания антигена антител против Bv8. Как правило, растворимость антитела против Bv8 понижают до или после конкуренции и затем меченое вещество и Bv8, связанные с антителом против Bv8, отделяют от несвязанного меченного вещества и Bv8. Это разделение выполняют декантированием (когда предварительно понизили растворимость партнера по связыванию) или центрифугированием (когда предварительно преципитировали партнера по связыванию после конкурентной реакции). Количество тестируемого образца Bv8 обратно пропорционально количеству связанного меченного вещества, как измеряют по количеству вещества маркера. Получают кривые «доза-эффект» с известными количествами Bv8 и сравнивают их с результатами теста, чтобы количественно определить количество Bv8, присутствующего в тестовом образце. Эти анализы называют система ELISA, когда ферменты используют в качестве обнаружимых маркеров.

Другой вид конкурентного анализа, называемый «гомогенным» анализом, не требует разделения фаз. Здесь получают конъюгат фермента с Bv8 и используют так, что когда антитело против Bv8 связывается с Bv8, присутствие антитела против Bv8 модифицирует активность фермента. В этом случае, Bv8 или его иммунологически активные фрагменты конъюгируют с бифункциональным органическим мостиком к ферменту, такому как пероксидаза. Конъюгаты выбирают для использования с антителом против Bv8 с тем, чтобы связывание антитела против Bv8 ингибировало или потенцировало активность фермента в метке. Этот способ широко используется на практике per se под названием EMIT.

Стерические конъюгаты используют в способах стерического несоответствия для гомогенного анализа. Эти конъюгаты синтезируют посредством ковалентного связывания низкомолекулярного гаптена с небольшим фрагментом Bv8 с тем, чтобы антитело к гаптену было по существу не способно связывать конъюгат одновременно с антителом против Bv8. В этой процедуре анализа Bv8, присутствующий в тестируемом образце, будет связывать антитело против Bv8, тем самым позволяя антителу против гаптена связываться с конъюгатом, что ведет к изменению в свойствах гаптена в конъюгате, например, к изменению флуоресценции, когда гаптен представляет собой флуорофор.

Сэндвич-анализы в частности можно использовать для определения Bv8 или антитела против Bv8. В последовательных сэндвич-анализах иммобилизованное антитело против Bv8 используют, чтобы адсорбировать Bv8 тестируемого образца, тестируемый образец удаляют, например, посредством промывания, связанный Bv8 используют, чтобы адсорбировать второе меченое антитело против Bv8, а затем связанное вещество отделяют от остаточного меченного вещества. Количество связанного меченного вещества прямо пропорционально тестируемому образцу Bv8. В «одновременных» сэндвич-анализах тестируемый образец не отделяют перед добавлением меченного антитела против Bv8. Последовательный сэндвич-анализ, в котором используют моноклональное антитело против Bv8 в качестве одного антитела и поликлональное антитело против Bv8 в качестве другого, можно использовать в тестировании образцов на Bv8.

Указанное выше представляет собой лишь образцовые анализы для обнаружения Bv8. Другие способы, разработанные на сегодняшний день или в будущем, в которых используют антитела против Bv8 для определения Bv8, включены в их объем, включая биологические анализы, описанные в настоящем документе.

В одном из аспектов, изобретение относится к способам обнаружения (например, присутствия или отсутствия или количества) полинуклеотида(ов) (например, полинуклеотидов Bv8) в биологическом образце от индивидуума, такого как субъект-человек. Можно использовать различные способы обнаружения полинуклеотидов, которые включают, например, RT-PCR, Taqman, способы амплификации, полинуклеотидный микрочип и т.п.

Способы обнаружения полинуклеотидов (таких как мРНК) хорошо известны и они включают, например, анализы гибридизации с использованием комплементарных ДНК зондах (таких как гибридизация in situ с использованием меченных рибонуклеотидных зондов Bv8), Нозерн-блоттинг и родственные способы, и различные анализы амплификации нуклеиновых кислот (таких как RT-PCR с использованием комплементарных праймеров, специфичных к Bv8, и другие амплификационные способы обнаружения, такие как, например, разветвленная ДНК, SPIA, Ribo-SPIA, SISBA, TMA и т.п.).

Биологические образцы от млекопитающих можно удобно анализировать, например, на мРНК Bv8, используя Нозерн-блоттинг, дот-блоттинг или анализ ПЦР. Например, анализы RT-PCR, такие как количественные анализы ПЦР, хорошо известны в данной области. В иллюстративном варианте осуществления изобретения способ обнаружения Bv8 мРНК в биологическом образце содержит получение кДНК из образца посредством обратной транскрипции с использованием по меньшей мере одного праймера; амплификацию полученной таким образом кДНК с использованием полинуклеотида Bv8 в качестве смыслового и антисмыслового праймеров для амплификации кДНК Bv8 в нем; и обнаружение присутствия или отсутствия амплифицированной кДНК Bv8. Вдобавок, такие способы могут включать одну или несколько стадий, которые позволяют определять количество (уровни) мРНК Bv8 в биологическом образце (например, посредством одновременного исследования уровней сравнительной контрольной последовательности мРНК конститутивного гена, такого как член семейства актина). Необязательно, можно определять последовательность амплифицированной кДНК Bv8.

Зонды и/или праймеры могут быть меченными обнаружимым маркером, таким как, например, радиоизотоп, флуоресцентное соединение, биолюминесцентное соединение, хемилюминесцентное соединение, хелатор металла или фермент. Такие зонды и праймеры можно использовать для обнаружения присутствия полинуклеотидов Bv8 в образце и в качестве средства для обнаружения клеток, экспрессирующих белки Bv8. Специалисту в данной области будет ясно, что можно получать огромное количество различных праймеров и зондов (например, основываясь на последовательностях, предоставленных в настоящем документе) и эффективно использовать их для амплификации, клонирования и/или определения присутствия или отсутствия и/или количества мРНК Bv8.

Необязательные способы по изобретению включают протоколы, включающие обнаружение полинуклеотидов, таких как полинуклеотид Bv8, в образце ткани или клеток с использованием технологии микрочипов. Например, используя микрочипы нуклеиновых кислот, осуществляют обратную транскрипцию и мечение тестируемых и контрольных образцов мРНК из тестируемых и контрольных образцов ткани для создания кДНК зондов. Затем зонды затем гибридизуют с чипом нуклеиновых кислот, иммобилизованных на твердом носителе. Чип выполняют так, что известна последовательность и положение каждого элемента чипа. Например, набор генов, которые обладают потенциалом экспрессии в определенных состояниях заболевания, могут быть расположены на твердом носителе. Гибридизация меченного зонда с конкретным элементом чипа указывает на то, что образец, из которого получен зонд, экспрессирует этот ген. Дифференциальный анализ экспрессии гена в пораженной ткани может предоставлять полезную информацию. В технологии микрочипов используют способы гибридизация нуклеиновых кислот и вычислительные технологии для оценки профиля экспрессии мРНК тысяч генов в одном эксперименте, (см., например, WO 01/75166, опубликованную 11 октября 2001 года; (Обсуждение изготовления чипов см., например, в США 5700637, патент США 5445934 и патент США 5807522, Lockart, Nature Biotechnology, 14:1675-1680 (1996); Cheung, V.G. et al, Nature Genetics 21(Suppl): 15-19 (1999)). ДНК микрочипы представляют собой миниатюрные чипы, содержащие фрагменты генов, которые синтезируют или непосредственно на или точечно на стеклянных или других подложках. На одном чипе обычно представлены тысячи генов. Типичный микрочиповый эксперимент включает следующие стадии: 1. получение флуоресцентно меченной мишени из РНК, выделенной из образца, 2. гибридизация меченной мишени с микрочипом, 3. Промывание, окрашивание и сканирование чип, 4. анализ сканированного изображения и 5. Создание профилей экспрессии генов. В настоящее время используют два основных типа ДНК микрочипов: олигонуклеотидные (обычно 25 до 70 нуклеотидов) чипы и чипы экспрессии генов, содержащие продукты ПЦР, полученные из кДНК. При создании чипа олигонуклеотиды можно или предварительно изготавливать и точечно наносить на поверхность или непосредственно синтезировать на поверхности (in situ).

Система Affymetrix GeneChip® представляет собой коммерчески доступную микрочиповую систему, которая содержит чипы, изготовленные прямым синтезом олигонуклеотидов на стеклянной поверхности. Чипы с зондами/генами: олигонуклеотиды, обычно по 25 нуклеотидов, непосредственно синтезированные на стеклянной пластине посредством комбинации технологий полупроводниковой фотолитографии и твердофазного химического синтеза. Каждый чип содержит до 400000 различных олигонуклеотидов, и каждый олигонуклеотид представлен миллионами копий. Поскольку олигонуклеотидные зонды синтезируют в известных положениях на чипе, паттерны гибридизации и интенсивности сигналов можно интерпретировать в отношении идентичности генов и относительных уровней экспрессии с помощью программного обеспечения Affymetrix Microarray Suite. Каждый ген представлен на чипе рядом различных олигонуклеотидных зондов. Каждая пара зондов состоит из идеально совпадающего олигонуклеотида и несовпадающего олигонуклеотида. Идеально совпадающий зонд имеет последовательность, точно комплементарную конкретному гену, и, таким образом, измеряет экспрессию гена. Несовпадающий зонд отличается от идеально совпадающего зонда заменой одного основания в центральном положении основания, нарушая связывание транскрипта гена-мишени. Это позволяет определить фоновую и неспецифическую гибридизацию, которая вносит вклад в сигнал, измеряемый для идеально совпадающего олигонуклеотида. Программное обеспечение Microarray Suite вычитает интенсивности гибридизации несовпадающих зондов из интенсивностей гибридизации идеально совпадающих зондов, чтобы определить абсолютное или удельное значение интенсивности для каждого набора зондов. Зонды выбирают, основываясь на текущей информации из GenBank® и других хранилищ данных о нуклеотидах. Полагают, что последовательности распознают уникальные области 3'-конца гена. Печь для гибридизации GeneChip® («вращающуюся» печь) используют для осуществления гибридизации вплоть до 64 чипов одновременно. Станция со струйной автоматикой выполняет промывание и окрашивание чипов с зондами. Она полностью автоматизирована и содержит четыре модуля, где каждый модуль вмещает один чип с зондами. Каждым модулем управляют независимо с помощью программного обеспечения Microarray Suite, используя предварительно запрограммированные протоколы струйной автоматики. Сканер представляет собой конфокальный лазерный флуоресцентный сканер, который измеряет интенсивность флуоресценции, испускаемой меченной кРНК, связанной с чипами с зондами. Компьютерная рабочая станция с программным обеспечением Microarray Suite управляет станцией со струйной автоматикой и сканером. Программное обеспечение Microarray Suite может управлять не более чем 8 станциями со струйной автоматикой, используя предварительно запрограммированные протоколы гибридизации, промывания и окрашивания для чипа с зондами. Также программное обеспечение получает и преобразует данные об интенсивности гибридизации в сигнал присутствия/отсутствия для каждого гена с использованием подходящих алгоритмов. Наконец, программное обеспечение обнаруживает изменения в экспрессии гена между экспериментами посредством сравнительного анализа и форматирует выходные данные в файлы в формате.txt, которые может использовать другое программное обеспечение для дальнейшего анализа данных.

В некоторых вариантах осуществления лечение предназначено для рака, выбранного из группы, состоящей из рака толстой кишки, рака легких, рака яичников, рака гипофиза, рака поджелудочной железы, фиброаденомы молочной железы, рака предстательной железы, плоскоклеточной карциномы головы и шеи, саркомы мягких тканей, рака молочной железы, нейробластом, меланомы, карциномы груди, рака желудка, рака толстой кишки (CRC), эпителиальных карцином, рака головного мозга, рака эндометрия, рака яичка, холангиокарциномы, карциномы желчного пузыря и гепатоцеллюлярной карциномы.

Биологические образцы описаны в настоящем документе, например, в определении биологического образца.

Промышленные изделия

В другом аспекте по изобретению предусмотрено промышленное изделие, содержащее вещества, которые можно использовать для лечения, предотвращения и/или диагностики нарушений, описанных выше. Промышленное изделие содержит контейнер и ярлык или вкладыш в упаковку на или связанный с контейнером. Подходящие контейнеры включают, например, бутылки, сосуды, шприцы и т.д. Контейнеры можно создавать из различных веществ, таких как стекло или пластмасса. Контейнер содержит композицию, которая сама по себе или в комбинации с другой композицией(ями) эффективна для лечения, предотвращения и/или диагностики состояния и может иметь стерильный порт доступа (например, контейнер может представлять собой мешок или сосуд для внутривенного раствора, имеющий пробку, прокалываемую иглой для подкожных инъекций). По меньшей мере одно активное средство в композиции представляет собой антитело по изобретению. Ярлык или вкладыш в упаковку указывает на то, что композицию используют для лечения предпочтительного состояния, такого как рак. Кроме того, промышленное изделие может содержать (a) первый контейнер с композицией, содержащейся в нем, где композиция содержит антитело по изобретению; и (b) второй контейнер с композицией, содержащейся в нем. Промышленное изделие в этом варианте осуществления изобретения может дополнительно содержать вкладыш в упаковку, указывающий на то, что первую и вторую композиции антител можно использовать для лечения конкретного состояния, например, рака. Альтернативно или дополнительно, промышленное изделие может дополнительно содержать второй (или третий) контейнер, содержащий фармацевтически приемлемый буфер, такой как бактериостатическая вода для инъекций (BWFI), фосфатно-солевой буфер, раствор Рингера и раствор декстрозы. Оно может дополнительно содержать другие вещества, желательные с коммерческой и пользовательской точки зрения, включая другие буферы, разбавители, наполнители, иглы и шприцы.

Далее приведены примеры способов и композиций по изобретению. Понятно, что на практике можно осуществлять различные другие варианты осуществления, принимая во внимание предоставленное выше общее описание.

ПРИМЕРЫ

Коммерчески доступные реактивы, упоминаемые в примерах, использовали по инструкциям производителя, если не указано иное.

Пример 1: Создание антител против Bv8

В этом примере продемонстрирована гуманизация антител мыши против Bv8, направленных против Bv8. Номера остатков приведены согласно Kabat'y (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)). Использованы однобуквенные сокращения для аминокислот.

Создание полученных из гибридомы антител против Bv8

Антитела против Bv8 создавали посредством иммунизации мыши или хомяка полипептидами внеклеточного домена рекомбинантного Bv8 человека (PeproTech, Rock Hill, NJ). Отобрали клоны 2G9, 2B9, 3F1, полученные из гибридомы мыши, которые содержат последовательности вариабельной области легкой цепи (VL) и вариабельной области тяжелой цепи (VH), приведенные на фиг. 2A, 2B, 3А, 3B, 4A и 4B. Также отобрали клон 2D3, полученный из гибридомы хомяка, который содержит последовательности VH и VL, приведенные на фиг. 5A и 5B.

Клонирование вариабельных доменов полученных из гибридомы антител против Bv8 и создание химерных антител

Общую РНК экстрагировали из гибридомных клеток, продуцирующих моноклональное антитело мыши против Bv8, 2B9, 3F1 и 2G9, а моноклональное антитело также хомяка против Bv8 2D3, соответственно, с использованием RNeasy Mini Kit (Catalog 74104; QIAGEN; Valencia, CA). Вариабельный легкий (VL) и вариабельный тяжелый (VH) домены амплифицировали с использованием RT-PCR со следующим вырожденными праймерами:

Прямой праймер легкой цепи (LC) 2B9:

5'GTCAGATATCGTKCTSACMCARTCTCCAGCAATMA3' (SEQ ID NO: 225)

Прямой праймер тяжелой цепи (HC) 2B9:

5'GATCGACGTACGCTCAGGTGACKCTGAARGAGTCWGG3' (SEQ ID NO: 226)

Прямой праймер легкой цепи (LC) 3F1:

5'GTACGATATCGTKCTSACCCARTCTCC3' (SEQ ID NO: 227)

Прямой праймер тяжелой цепи (HC) 3F1:

5'GATCGACGTACGCTCAGGTGACKCTGAARGAGTCWGG3' (SEQ ID NO: 228)

Прямой праймер легкой цепи (LC) 2G9:

5'GTACGATATCGTKCTSACCCARTCTCC3' (SEQ ID NO: 229)

Прямой праймер тяжелой цепи (HC) 2G9:

'GATCGACGTACGCTGAGGTYCAGCTSCAGCAGTCTGG3' (SEQ ID NO: 230)

Прямой праймер легкой цепи (LC) 2D3:

5'GATCGATATCCARATGACNCARACNCC3' (SEQ ID NO: 231)

Прямой праймер тяжелой цепи (HC) 2D3:

5'GATCGACGTACGCTGARGTGCARYTGGTGGARTCTGG3' (SEQ ID NO: 232)

Обратный праймер легкой цепи: 5'GCTGTAGGTGCTGTCTTTGCT3' (SEQ ID NO: 233)

Обратный праймер тяжелой цепи: 5'CTGGWCAGGGMTCCAGAGTTCCA3' (SEQ ID NO: 234)

Последовательности праймеров, как показано, соответствуют следующему коду IUB:

Код IUB

G Гуанин

A Аденин

T Тимин

С Цитозин

R (A или G)

Y (С или T)

M (A или С)

К (G или T)

S (С или G)

W (A или T)

Н (A или С или T)

В (С или G или T)

V (A или С или G)

D (A или G или T)

N (A или С или G или T)

Прямые праймеры специфичны к N-концевой аминокислотной последовательности области VL и VH. Соответственно, обратные праймеры легкой цепи (LC) и тяжелой цепи (HC) разработаны для гибридизации с областью в константном домене легкой цепи (CL) и константном домене 1 тяжелой цепи (CH1), который высоко консервативен среди видов.

Амплифицированные продукты ПЦР впоследствии лигировали в клонирующий вектор ТА (Invitrogen, Carlsbad, CA) и секвенировали. Затем идентифицированную последовательность ДНК VL субклонировали в экспрессирующий вектор для клеток млекопитающих pRK (Carter et al., Proc. Natl. Acad. Sci. USA, 89, 4285-4289 (1992)), содержащий константный домен κ человека. Последовательность ДНК VH встраивали в векторы pRK, кодирующие полноразмерные константные домены γ1 человека.

Экспрессирующие LC и HC векторы совместно трансфицировали в трансформированную аденовирусом линию эмбриональных клеток почки человека 293 с использованием реактивов для трансфекции Fugene (Roche, Mannheim, Germany). Антитело продуцировали в не содержащих сыворотку средах и очищали хроматографией на белке A.

Прямая пересадка гипервариабельной области в акцепторную консенсусную каркасную область человека

Фагемида, использованная для этой работы, представляет собой моновалентный вектор дисплея Fab-g3 и состоит из 2 открытых рамок считывания под управлением одного промотора phoA. Первая открытая рамка считывания состоит из сигнальной последовательности stII, слитой с доменами VL и CL акцепторной легкой цеп, а вторая состоит из сигнальной последовательности stII, слитой с доменами VH и CH1 акцепторной тяжелой цепи, за которыми следует минорный белок оболочки фага P3.

Перед созданием вариантов антител против Bv8 с пересаженными CDR, выравнивали последовательности вариабельного домена легкой цепи (VL) и вариабельного домена тяжелой цепи (VH) антитела мыши с консенсусными последовательностями человека.

Для клонов 2B9 и 3F1, консенсусная легкая цепь человека κ 1 (huKI) и консенсусная тяжелая цепь человека III подгруппы (huGIII) были ближайшими каркасными областями человека, и гипервариабельные области последовательностей легкой цепи и тяжелой цепи 2B9 мыши (m2B9) и 3F1 мыши (m3F1) пересаживали в консенсусные акцепторные каркасные области huKI и huGIII, соответственно, чтобы создать варианты с напрямую пересаженными CDR, которые назвали h2B9.v1 (фиг. 6A и 6B) и h3F1.v1 (фиг. 4A и 4B).

Что интересно, для клона 2G9 каркасными областями человека, ближайшими к 2G9 мыши, были консенсусная легкая цепь человека κ IV (huKIV) и консенсусная тяжелая цепь человека I подгруппы (huGI). Следовательно, первоначально, гипервариабельные области легкой цепи и тяжелой цепи 2G9 мыши (m2G9) пересаживали не только в huKI и huGIII, но также в консенсусные акцепторные каркасные области huKIV и huGI, соответственно, чтобы создать четыре различных варианта с пересаженными CDR, идентифицируемые как h2G9.K1G1, h2G9.K1G3, h2G9.K4G1 и h2G9.K4G3 (фиг. 14 и 15). Консенсусная каркасная последовательность IV подгруппы VL κ человека минус последовательности HVR легкой цепи по Kabat показана в SEQ ID NO: 240. Консенсусная каркасная последовательность I подгруппы VH человека минус последовательности HVR тяжелой цепи показана в SEQ ID NO: 241. См. фиг. 1G. В домен VL следующие области пересаживали в консенсусную акцепторную последовательность человека: положения 24-34 в L1, 50-56 в L2 и 89-97 в L3. В домен VH пересаживали положения 26-35 в H1, 49-65, 71 и 73 в H2 и 95-102 в H3.

Варианты с напрямую пересаженными CDR (h2B9.v1, h3F1.v1, h2G9.K1G1, h2G9.K1G3, h2G9.K4G1, h2G9.K4G3) создавали посредством мутагенеза по Кункелю в виде как Fab на фаговом дисплее, так и IgG с использованием отдельных олигонуклеотидов для каждой гипервариабельной области. Правильные клоны идентифицировали посредством секвенирования ДНК.

Отбор и улучшение гуманизированного 2G9.K4G1

Аффинности связывания четырех вариантов антител против Bv8 с пересаженными CDR, h2G9.K1G1, h2G9.K1G3, h2G9.K4G1 и h2G9.K4G3, измеряли посредством Biacore с использованием прибора BIAcore™-3000, как описано в настоящем документе. Вдобавок, осуществляли анализ пролиферации клеток эндотелия коры надпочечников (КЭКН), как описано в настоящем документе, чтобы исследовать нейтрализующую Bv8 активность четырех вариантов.

Результаты анализа BIAcore показали, что варианты h2G9.K1G1 и h2G9.K1G3 обладали значительно более высокой скоростью диссоциации в анализе при высокой концентрации по сравнению с h2G9.K4G1 и h2G9.K4G3. Кроме того, анализ пролиферации КЭКН показал, что среди четырех вариантов, вариант h2G9.K4G1 обладал наилучшей активностью, поскольку он почти полностью блокировали связывание Bv8 с клетками КЭКН. Однако, анализ BIAcore и анализ пролиферации КЭКН показывали, что аффинность связывания и нейтрализующая активность антитела h2G9.K4G1 против Bv8 все же были ниже, чем таковые у химерного антитела 2G9 против Bv8. Следовательно, антитело h2G9.K4G1 против Bv8 отобрали для созревания аффинности, чтобы дополнительно улучшить его аффинность связывания.

Перед инициацией созревания аффинности антитела против Bv8 h2G9.K4G1, последовательности HVR анализировали на предмет возможных проблем со стабильностью, включая изомеризацию, неспаренный цистеин и дезамидирование во время процесса производства. Возможные проблемы идентифицировали в следующих участках: (i) смежные остатки в положениях 28 и 29 в последовательности вариабельного домена легкой цепи; (ii) положение 52a в последовательности вариабельного домена тяжелой цепи; (iii) положение 54 в последовательности вариабельного домена тяжелой цепи; и (iv) остатки, смежные с положениями 95 и 96 в последовательности вариабельного домена тяжелой цепи.

Создавали варианты антитела h2G9.K4G1 против Bv8 с заменой одной аминокислоты в положениях остатков, указанных выше, и каждый вариант представляли в виде Fab на фаге. Создали всего 12 вариантов со следующими модификациями одной аминокислоты, и оценивали их аффинности связывания посредством конкурентного фагового ELISA: CDR-L1 - D28E, D28S, G29A, G29S; CDR-H2 - C52aA, C52aS, N54A, N54S; CDR-H3: D95E, D95S, G96A, G96S. Аффинности связывания 12 вариантов по сравнению с h2G9.K4G1 представлены на фиг. 14A и 14B. На этих фиг. показано, что большинство вариантов сохраняло схожую или слегка улучшенную аффинность связывания. К удивлению, вариант с заменой D95S в CDR-H3 полностью утратил связывание при 1 мкМ Bv8 человека. Кроме того, вариант с заменой D95E в CDR-H3 показал значительное снижение аффинности связывания в 100 раз по сравнению с h2G9.K4G1.

Клон, идентифицируемый как h2G9.K4G1.Polish, создавали посредством комбинации всех из следующих четырех замен аминокислот: CDR-L1 - D28S; CDR-H2 - C52aS, N54S; CDR-H3: G96S. анализ BIAcore показал схожие аффинности связывания для Fab химерного 2G9 и Fab h2G9.K4G1.Polish, и как химерное IgG 2G9, так и IgG h2G9.K4G1.Polish показали полное блокирование индуцируемой Bv8 клеточной пролиферации КЭКН (фиг. 21). Кроме того, замены аминокислот в CDR-L1 - D28S; CDR-H2 - C52aS, N54S; CDR-H3: G96S (антитело против Bv8 h2G9.K4G1.Polish) неожиданно восстанавливали аффинность связывания, близкую к таковой у химерного антитела 2G9 против Bv8.

Мягкая рандомизация гипервариабельных областей

Разнообразие последовательности вводили в каждую гипервариабельную область, чтобы дополнительно улучшить аффинность для клона h2G9.K4G1.Polish с использованием стратегии мягкой рандомизации, которая сохраняет смещение в сторону последовательности гипервариабельной области мыши. Это осуществляли с использованием стратегии синтеза отравленного олигонуклеотида, которую впервые описали Gallop et al, J. Med. Chem. 37:1233-1251 (1994). Для заданного положения в гипервариабельной области, подлежащего мутации, кодон, кодирующий аминокислоту дикого типа, отравляют смесью нуклеотидов 70-10-10-10, что ведет к уровню мутаций в среднем 50 процентов в каждом положении. Мягко рандомизированные олигонуклеотиды были расположены после последовательностей гипервариабельной области мыши и охватывали те же области, которые определены посредством прямой пересадки гипервариабельной области.

Создание фаговых библиотек

Объединенные образцы рандомизированных олигонуклеотидов, сконструированные для каждой гипервариабельной области, фосфорилировали отдельно в шести 20 мкл реакциях, содержащих 660 нг олигонуклеотида, 50 мМ Tris pH 7,5, 10 мМ MgCl2, 1 мМ АТФ, 20 мМ DTT, и 5 Ед полинуклеотидкиназы в течение 1 часа при 37°C. Затем шесть фосфорилированных объединенных образцов олигонуклеотидов комбинировали с 20 мкг матрицы Кункеля в 50 мМ Tris pH 7,5, 10 мМ MgCl2 в конечном объеме 500 мкл, что привело к отношению олигонуклеотида матрице, равному 3. Смесь отжигали при 90°C в течение 4 мин, 50°C в течение 5 мин и затем охлаждали на льду. Избыточный неотожженный олигонуклеотид удаляли с использованием набора для очистки QIAquick PCR (Catalog 28106, QIAGEN Inc., Valencia, CA), используя модифицированный протокол для предотвращения чрезмерной денатурации отожженной ДНК. К 500 мкл отожженной смеси добавляли 150 мкл PB, и смесь разделяли между 2 колонками с диоксидом кремния. После промывания каждой колонки 750 мкл PE и дополнительного центрифугирования колонок до сухости, каждую колонку элюировали с использованием 110 мкл 10 мМ Tris, 1 мМ ЭДТА, pH 8. Затем отожженную и очищенную матрицу (220 мкл) достраивали посредством добавления 1 мкл 100 мМ АТФ, 10 мкл 25 мМ dNTP (по 25 мМ каждого из dATP, dCTP, dGTP и dTTP), 15 мкл 100 мМ DTT, 25 мкл 10× буфера TM (0,5 M Tris pH 7,5, 0,1 M MgCl2), 2400 Ед лигазы T4 и 30 Ед полимеразы T7 в течение 3 часов при комнатной температуре.

Достроенный продукт анализировали на Tris-ацетат-ЭДТА/агарозных гелях (Sidhu et al, Methods in Enzymology 328:333-363 (2000)). Обычно видны три полосы: нижняя полоса представляет собой правильно достроенный и лигированный продукт, средняя полоса достроена, но не лигирована, а верхняя полоса представляет собой замещение цепи. Верхнюю полосу получают посредством характерной побочной активности полимеразы T7, которой сложно избежать (Lechner et al, J. Biol. Chem. 258:11174-11184 (1983)); однако, эта полоса трансформируется в 30 раз менее эффективно, чем нижняя полоса, и обычно вносит небольшой вклад в библиотеку. Средняя полоса обусловлена отсутствием 5'-фосфата для конечной реакции лигирования; эта полоса трансформируется эффективно и, к сожалению, преимущественно дает последовательность дикого типа.

Затем достроенный продукт очищали и электропорацией внедряли в клетки SS320 и выращивали в присутствие хелперного фага M13/KO7, как описано авторами Sidhu et al, Methods in Enzymology 328:333-363 (2000). Размеры библиотек варьировали от 1-2×109 независимых клонов. Для оценки качества библиотеки секвенировали случайные клоны из исходных библиотек.

Отбор фагов

Bv8 человека (PeproTech) использовали в качестве мишени для отбора фагов. Bv8 человека покрывали микротитровальные планшеты MaxiSorp (Nunc) в концентрации 10 мкг/мл в PBS для первого раунда пэннинга. Для первого раунда отбора использовали 8 лунок мишени; одну лунку мишени использовали для последующих раундов отбора. Лунки блокировали в течение 1 ч с использованием Super Blocker (Pierce). Фаг собирали из культурального супернатанта и суспендировали в PBS, содержащем 1% BSA и 0,05% Tween 20 (PBST). После связывания с лунками в течение 2 ч, несвязанный фаг удаляли тщательным промыванием в PBS, содержащем 0,05% Tween 20 (PBT). Связанный фаг элюировали посредством инкубации лунок с 50 мМ HC1, 0,5 M KC1 в течение 30 мин. Фаг размножали и амплифицировали с использованием клеток XL1 blue (Strategene) и хелперного фага M13/KO7 (New England BioLabs) и растили в течение ночи при 37°C в 2YT, 50 мкг/мл карбенациллина в течение следующего раунда пэннинга. Титры фага, элюированного из покрытой мишенью лунки, сравнивали с титрами фага, извлеченного из не покрытой мишенью лунки, чтобы оценить обогащение.

Начиная с сортировки во втором раунде, фаговые библиотеки сортировали с использованием способа сортировки в растворе (Lee, C.V., et al. (2004) J. Mol. Biol 340(5): 1073-93), который позволяет увеличить строгость отбора, чтобы выделить клоны с улучшенной аффинностью. Bv8 человека биотинилировали, используя Sulfo-NHS-LC-Biotin (b-Bv8, Pierce, Rockford, IL). Микротитровальные планшеты покрывали нейтравидином 10 мкг/мл в PBS в течение ночи при 4°С и затем блокировали в течение 1 ч с использованием Super Blocker (Pierce). Для второго раунда отбора 200 мкл фага, суспендированного в буфере PBST, смешивали с 5 нМ b-Bv8 в течение 2 ч при комнатной температуре (КТ). Фаг, связанный с b-Bv8, захватывали на покрытых нейтравидином лунках в течение 15 мин при КТ, а несвязанный фаг вымывали буфером PBT. Фаг элюировали с использованием 100 мМ HCl в течение 30 мин, нейтрализовали и выращивали, как описано выше. Следующие раунды отбора осуществляли также, как отбор на 2 раунде, за следующими исключениями: в раунде 3 и 4 конечная концентрация b-Bv8 составляла 0,1 нМ, в раунде 5 конечная концентрация b-Bv8 составляла 0,05 нМ. Начиная с раунда 4 и 5, после связывания фага с b-Bv8, 500- и 1000-кратный избыток небиотинилированного Bv8 человека соответственно добавляли в смесь на 1-2 ч при КТ, чтобы вытеснить связующие средства с высокой скоростью диссоциации до захвата на нейтравидине.

Фаговый конкурентный ELISA для определения IC50 фага

Микротитровальные планшеты MAXISORP™ покрывали рекомбинантным Bv8 человека (PeproTech) в концентрации 2 нг/мл в PBS в течение ночи и затем блокировали буфером PBST (0,5% BSA и 0,05% Tween 20 в PBS) в течение часа при комнатной температуре (КТ). Фаг из культуральных супернатантов инкубировали с серийно разведенным Bv8 человека в буфере PBST в микротитровальном планшете для культуры ткани в течение часа при КТ, после чего 80 мкл смеси переносили в покрытые мишенью лунки в течение 15 минут, чтобы захватить несвязанный фаг. Планшет промывали буфером PBT (0,05% Tween 20 в PBS), и конъюгированное с HRP антитело против M13 (Amersham Pharmacia Biotech) добавляли (1:5000 в буфер PBST) на 40 минут. Планшет промывали буфером PBT и проявляли посредством добавления субстрата тетраметилбензидин (Kirkegaard and Perry Laboratories, Gaithersburg, MD). Строили график поглощения при 450 нм в качестве функции концентрации мишени в растворе для определения IC50 фага. Ее использовали в качестве оценки аффинности для клона Fab, представленного на поверхности фага. На фиг. 14A и 14B приведены результаты фагового конкурентного анализа, демонстрирующие связывание улучшенных вариантов h2G9.K4G1 (L1: D28E, D28S, G29A, G29S, H2: C52aA, C52aS, N54A, N54S, H3: D95E, D95S, G96A и G96S) против Bv8 человека. На фиг. 16 и 17 приведены результаты фагового конкурентного анализа, демонстрирующие связывание вариантов h2G9.K4G1.Polish с улучшенной аффинностью (h2G9.K4G1.v27, v52, v55, v63, v64, v67, v77, v80 из мягко рандомизированной библиотеки L1/L2; h2G9.K4G1.v19, v25, v37, v65, v73, v75, v77. v92 из мягко рандомизированной библиотеки H1/H2) против Bv8 человека.

Определение аффинности антитела с помощью BIAcore

Для определения аффинности связывания антител против Bv8 (Fab или IgG), использовали измерение поверхностного плазмонного резонанса (SRP) на приборе BIAcore™-3000. В кратком изложении, биосенсорный чип CM5 активировали реактивами EDC и NHS в соответствии с инструкциями поставщика и связывали Bv8 человека (PeproTech) или яванского макака (Genentech; PUR21590), чтобы достичь приблизительно 150 единиц ответа (RU), за чем следовало блокирование непрореагировавших групп 1M этаноламином. Для измерения кинетики двукратные серийные разведения Fab против Bv8 (от 0,19 нМ до 25 нМ) или IgG (от 0,019 нМ до 10 нМ) инъецировали в буфере HBS-P (0,01M HEPES pH 7,4, 0,15M NaCl, 0,005% поверхностно-активного вещества P20) при 25°C со скоростью потока 30 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) вычисляли с использованием простой модели связывания Ленгмюра один-к-одному (программное обеспечение для оценки BIAcore версии 3.2). Равновесную константу диссоциации (Kd) вычисляли как отношение koff/kon. См. фиг. с 18 до 21. Результаты показывают, что гуманизированные антитела против Bv8, h2G9.K4G1.v19 и h2G9.K4G1.v55, связываются с Bv8 человек и яванского макака по меньшей мере в два раза сильнее, чем химерное антитело 2G9 против Bv8.

Анализ пролиферации КЭКН

Клетки КЭКН высевали при плотности 5000 клеток на лунку в 6-луночные планшеты в среду для выращивания. Сначала для анализа ингибирования антитела против Bv8 добавляли в указанных концентрациях (мкг/мл). Затем через 0,5-1 ч Bv8 человека (Peprotech) добавляли до конечной концентрации 10 нМ. Через 6 суток клетки диссоциировали за счет добавления 1 мл 2×Trypsin (GIBCO) в каждую лунку и проводили подсчет в дублированных лунках с использованием счетчика частиц Культера и анализатора размеров Z2 (Beckman Coulter). См. фиг. 12, 13, 15, 23 и 24. На фиг. 23 показано, что гуманизированные антитела против Bv8 h2G9K4G1.v19, h2G9K4G1.v52, h2G9K4G1.v55 и h2G9K4G1.v73 показывали значительное улучшение блокирования индуцированной Bv8 человека пролиферации КЭКН.

Конкурентный ELISA для картирования эпитопов Bv8 для антител

96-луночные иммунологические планшеты NUNC™ Maxisorp (NUNC; Roskilde, Denmark) покрывали химерным IgG 2B9 в концентрации 1 мкг/мл в PBS в течение ночи и затем блокировали в течение часа при комнатной температуре буфером PBST (0,5% BSA и 0,05% Tween 20 в PBS). Биотинилирование Bv8 человека получали с использованием реактива EZ-link Sulfo-NHS-LC-Biotin (Catalog 21335; Pierce; Rockford, IL) в молярном отношении 1:4 (HuBv8:биотин).

Чтобы определить количество биотинилированного Bv8 человека в конкурентном анализе, трехкратно серийно разведенное биотинилированное Bv8 человека от 100 нМ до 0,04 нМ добавляли в покрытые антителом планшеты на 15 минут. Затем планшеты промывали буфером PBT (PBS и 0,05% Tween 20). Связанные биотинилированные обнаруживали с использованием стрептавидина, который конъюгировали с пероксидазой хрена (Catalog 21126; Pierce; Rockford, IL) и разводили 1:2500 в буфере PBST. После 45 минут инкубации планшет промывали и в каждую лунку добавляли 100 мкл тетраметилбензидина (R&D Systems) приблизительно на 5 минут, чтобы индуцировать развитие сигнала. Когда возникала синяя окраска, в каждую лунку добавляли по 100 мкл 1M фосфорной кислоты, чтобы остановить процесс развития. Оптическую плотность считывали спектрофотометрически при 450 нм.

Чтобы картировать эпитопы Bv8 для антител с использованием химерного 2B9, трехкратные серийные разведения IgG (химерное 2B9, химерное 3F1, химерное 2D3, химерное 2G9 и контрольное IgG) сначала инкубировали с 2 нМ биотинилированным Bv8 человека, который определяли в указанном выше анализе связывания, в буфере PBST в течение 1-2 часов при комнатной температуре, и затем переносили его на покрытый антителом (химерное IgG2B9; 1 мкг/мл) планшет на 15 мин. Затем планшет промывали буфером PBT и количество биотинилированного Bv8 человека, связанного с химерным IgG 2B9 на планшете, обнаруживали с помощью протоколов, как описано выше.

В конкурентном анализе химерное антитело 3F1 и химерное антитело 2G9 конкурировали с химерным антителом 2B9, связывающимся с Bv8 человека, что указывает на то, что оба антитела обладают эпитопами, перекрывающимися с химерным антителом 2B9. Однако, химерное антитело 2D3 показало только частичную конкуренцию с химерным антителом 2B9, связывающимся с Bv8 человека, что указывает на то, что химерное антитело 2D3 может иметь эпитоп(ы), отличающийся от химерного антитела 2B9, а также химерного антитела 3F1 и химерного антитела 2G9 (фиг. 11).

Пример 2: Исследование эффективности in vivo

Клетки человека HT-55, Colo-205 (карцинома толстой кишки), A673 (рабдомиосаркома), HP AC (карцинома поджелудочной железы) и Calu-6 (карцинома легких) получали из American Type Culture Collection (Manassas, VA). Клеточная линия карциномы толстой кишки HM7 человека представляет собой производное LS 174T. Calu-6, A673, HP AC и HM7 выращивали в среде Хэма F12, низкая глюкоза DMEM 1:1. Colo-205 и HT-55 выращивали в среде RPMI 1640. В обе среды добавляли 10% об./об. FBS, 1% об./об. пенициллин/стрептомицин (Invitrogen, Carlsbad, CA), 2 мМ L-глутамин (Invitrogen, Carlsbad, CA) и 1 нг/мл Фунгизон™ (Invitrogen, Carlsbad, CA). Клетки выращивали при 37°C в 5% CO2 до смыкания, собирали и ресуспендировали в стерильном Matrigel по 15×106 клеток на мл. Ксенотрансплантаты инокулировали голым мышам BALB/c в возрасте от 6 до 8 недель (Charles River; Hollister, CA) посредством дорсально-боковой подкожной (S.C.) инъекции 1,5×106 клеток на мышь и оставляли расти. Лечение антителами против Bv8, химерным 2D3, химерным 3F1, химерным 2B9 и химерным 2G9; гуманизированным вариантом 2G9 19, гуманизированным вариантом 2G9 55 и гуманизированным 2G9.K4G1.Polish, интраперитонеально в дозе 10 мг/кг два раза в неделю начинали через 24 ч после инокуляции опухолевых клеток. В качестве контролей использовали МАт против GP-120 10 мг/кг два раза в неделю и МАт против VEGF G6.31 или B20 5мг/кг два раза в неделю (Liang, W.C., et al, JBiol Chem 281, 951-961 (2006)). Во всех экспериментах трансплантированные опухоли измеряли два раза в неделю вдоль самой длинной оси и перпендикулярной оси с использованием кронциркуля. Объемы опухолей вычисляли, используя формулы эллипсоидного объема (0,5×L×W×W), и средние объемы опухолей и стандартная ошибка для 10 мышей на группу во всех лечениях приведены на фигурах. Антитела против Bv8 также имеют аддитивный эффект, оказываемый на немелкоклеточную карциному легких человека LXFL529, когда их используют в комбинации с антителом против VEGF. Голым мышам Beige (n=7~9) имплантировали клетки немелкоклеточной карциномы легких человека LXFL529. Затем мышей лечили контрольными антителами против Ragweed 1428 и против Bv8 мыши (3F1 и 2B9) не позднее 24 часов после инокуляции опухоли. Мышей лечили антителом против VEGF после того, как опухоли достигали ~400 мм3. Результаты показывают, что лечение химерным и гуманизированным антителом против Bv8 приводило к снижению опухолевого роста в различных опухолях в качестве единственного средства и в комбинации с антителом против VEGF. См. фиг. с 25 до 37.

Клетки LLC мыши (карцинома легких Льюиса), H460 (немелкоклеточная карцинома легких) и HT29 человека (карцинома толстой кишки) получали из American Type Culture Collection (Manassas, VA). Клетки LLC и HM7 культивировали в среде RPMI1640 с добавлением 1% L-глутамина и 10% эмбриональной телячьей сыворотки (Hyclone; Logan, UT). Клетки выращивали при 37°C в 5% CO2, собирали, центрифугировали, промывали один раз сбалансированным солевым раствором Хэнка (HBSS) и подсчитывали. Клетки LLC ресуспендировали в 50% HBSS и 50% Matrigel™ (BD Biosciences; San Jose, CA), а клетки HM7 ресуспендировали в HBSS (Invitrogen; Carlsbad, CA), и те и другие в концентрации 3,5×107 клеток/мл для инъекции мышам. Клетки H460 культивировали в среде RPMI-1640, содержащей 10% эмбриональную телячью сыворотку, 100 единиц/мл пенициллина G, 100 мкг/мл сульфата стрептомицина, 1 мМ пирувата натрия, 2 мМ глутамина, 10 мМ HEPES, 0,075% бикарбоната натрия и 25 мкг/мл гентамицина. Клетки культивировали во флаконах для тканевых культур в увлажненном инкубаторе при 37°C, в атмосфере 5% CO2 и 95% воздуха, затем собирали и ресуспендировали в фосфатно-солевом буфере (PBS) в концентрации 5×107 клеток/мл для инъекции мышам. Клетки HT29 исходно получали из ATCC, и получаемые ксенотрансплантатные опухоли впоследствии поддерживали в качестве линии in vivo посредством серийной подкожной трансплантации бестимусным голым мышам перед имплантацией для эксперимента. Клетки LLC инокулировали самкам голых мышей BALB/c в возрасте от 8 до 9 недель (Charles River, Hollister, CA) посредством дорсально-боковой подкожной (S.C.) инъекции 3,5×106 клеток на мышь и оставляли расти в виде аллотрансплантатов. Клетки HM7 инокулировали самкам бестимусных мышей (nu/nu) в возрасте 12 недель (Harlan Sprague Dawley, Inc; Frederick, MD) посредством подкожной инъекции в заднюю ногу 3,5×106 клеток на мышь, клетки H460 инокулировали самкам бестимусных голых мышей (nu/nu) в возрасте от 10 до 11 недель (Harlan Sprague Dawley, Inc; Federick, MD) посредством дорсально-боковой подкожной инъекции 1×107 клеток на мышь и фрагменты опухоли HT29 размером 1 мм3 имплантировали подкожно в бок самкам бестимусных голых мышей (nu/nu) в возрасте от 11 до 12 недель (Harlan Sprague Dawley, Inc; Federick, MD). Химерное 2D3, мышиное 3F1 и мышиное 2B9 антитело против Bv8 дозировали интраперитонеально 10 мг/кг два раза в неделю и гуманизированное антитело против Bv8 2G9 интраперитонеально в дозе 30 мг/кг раз в неделю. В качестве контролей вводили MAb против амброзии интраперитонеально по 30 или 100 мг/кг два раза в неделю и MAb против VEGF B20-4.1.1 интраперитонеально по 5 мг/кг два раза в неделю. Лечение начинали по истечении промежутка времени после инокуляции клеток или имплантации опухоли (HT29): 7 ч для LLC, 8 суток для HM7, 11 суток для H460 и 36 суток для НТ29. Измеряли опухоли и массу тела и выполняли общие клинические наблюдение минимум два раза в неделю на продолжении исследования. Объемы опухолей вычисляли с использованием формулы объема эллипсоида (0,5×L×W×W). Чтобы анализировать повторные измерения объемов опухолей у одних и тех же животных с течением времени, использовали подход смешанного моделирования, и создавали эмпирические данные об объеме опухолей (Pinheiro et al. nlme: linear and nonlinear mixed effects models; 2009; пакет Version R версии 3.1-96). Графики Каплана-Мейера строили, чтобы показать процентную долю животных, оставшихся в исследовании, как функцию времени. Лечение мышиными и гуманизированными антителами против Bv8 приводило к снижению опухолевого роста в различных опухолях (см. фиг. с 38 до 40 и 42) и пролонгированной выживаемости (см. фиг. 41 и 43) в качестве единственного средства и в комбинации с антителом против VEGF.

Пример 3: Конкурентный ELISA для измерения способности гуманизированных антител против Bv8 блокировать связывание Bv8 человека с антителом мыши 2G9

384-луночные планшеты Maxisorp покрывали 1 мкг/мл родительским антителом мыши IgG1 2G9 по 25 мкл/лунка в 50 мМ буфере из карбоната натрия, pH 9,6, при 4°C в течение ночи. Планшеты промывали фосфатно-солевым буфером (PBS), содержащим 0,05% полисорбата, pH 7,4 и блокировали с использованием PBS, содержащего 0,5% BSA, 10 м.д. Proclin, pH 7,4, по 80 мкл/лунка. После инкубации в течение 1 ч при комнатной температуре планшеты промывали. Смесь серийно разведенных гуманизированных антител 2G9 (0,11 пМ-180 нМ) в PBS, содержащем 0,5% BSA, 0,05% полисорбата 20, pH 7,4 и биотинилированный Bv8 человека (конечная концентрация 0,5 нг/мл или 57 пМ) добавляли по 25 мкл/лунка. После двух часов инкубации планшеты промывали и добавляли стрептавидин, конъюгированный с пероксидазой хрена (GE Healthcare). После финальных 30 минут инкубации планшеты промывали и добавляли субстрат 3,3',5,5'-тетраметилбензидин (Kirkegaard & Perry Laboratories). Реакцию останавливали добавлением 1M фосфорной кислоты и считывали поглощение при 450 нм на считывателе Multiskan Ascent (Thermo Scientific, Hudson, NH). Для анализа данных подбирали кривые титрования с использованием программы четырехпараметрического подбора кривой нелинейной регрессии и определяли концентрации IC50 (KaleidaGraph, программное обеспечение Synergy, Reading, PA).

Результаты показывают, что гуманизированные антитела против Bv8 h2G9.K4G1.v19, h2G9.K4G1.v52, h2G9.K4G1.v55, h2G9.K4G1.v73 и h2G9.K4G1.v19H/v55L обладают более высокой способностью блокировать связывание Bv8 человека с антителом мыши 2G9 по сравнению с химерным антителом 2G9 и антителом h2G9.K4G1.Polish против Bv8. См. фиг. 22.

Все источники, процитированные на всем протяжении раскрытия, таким образом, включены в явной форме по ссылке в полном объеме.

Несмотря на то, что настоящее изобретение описано со ссылкой на то, что считают конкретными вариантами осуществления, следует понимать, что изобретение не ограничено такими вариантами осуществления. Напротив, изобретение предназначено для того, чтобы покрывать различные модификации и эквиваленты, включенные в объем и сущность приложенной формулы изобретения.

На всем протяжении настоящей заявки, включая формулу изобретения, термин «содержит» используют как включающую, открытую связывающую фразу, которая не исключает дополнительные не перечисленные элементы или стадии способов.

1. Антитело против Bv8 человека или макака, где антитело содержит:
(1) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO:61;
(2) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO:62;
(3) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO:63;
(4) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO:64;
(5) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO:65; и
(6) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO:66, или его антигенсвязывающий фрагмент.

2. Антитело против Bv8 человека или макака, где антитело содержит:
(1) HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO:91;
(2) HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO:92;
(3) HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO:93;
(4) HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO:94;
(5) HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO:95; и
(6) HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO:96, или его антигенсвязывающий фрагмент.

3. Антитело против Bv8 по п.1, содержащее вариабельный домен легкой цепи, содержащий SEQ ID NO:7, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO:8, или его антигенсвязывающий фрагмент.

4. Антитело против Bv8 по п.2, содержащее вариабельный домен легкой цепи, содержащий SEQ ID NO:11, и вариабельный домен тяжелой цепи, содержащий SEQ ID NO:12, или его антигенсвязывающий фрагмент.

5. Антитело против Bv8 по любому из пп.1-4, где антитело против Bv8 связывается с Bv8 человека со значениями Kd менее чем приблизительно 0,02 нМ.

6. Антитело против Bv8 по любому из пп.1-4, где антитело против Bv8 связывается с Bv8 человека по меньшей мере в два раза сильнее, чем антитело против Bv8, содержащее HVR-L1, которая содержит аминокислотную последовательность SEQ ID NO:49, HVR-L2, которая содержит аминокислотную последовательность SEQ ID NO:50, HVR-L3, которая содержит аминокислотную последовательность SEQ ID NO:51, HVR-H1, которая содержит аминокислотную последовательность SEQ ID NO:52, HVR-H2, которая содержит аминокислотную последовательность SEQ ID NO:53, и HVR-H3, которая содержит аминокислотную последовательность SEQ ID NO:54.

7. Нуклеиновая кислота, кодирующая антитело по любому из пп.1-6.

8. Экспрессирующий вектор для получения антитела по любому из пп.1-6, содержащий нуклеиновую кислоту по п.7.

9. Клетка-хозяин, экспрессирующая антитело по любому из пп.1-6, содержащая экспрессирующий вектор по п.8.

10. Фармацевтическая композиция для лечения опухоли, рака или нарушения пролиферации клеток, содержащая в эффективном количестве антитело по любому из пп.1-6.

11. Композиция по п. 10, где композиция содержит носитель.

12. Способ получения антитела против Bv8 по любому из пп.1-6, где указанный способ включает (а) экспрессию экспрессирующего вектора по п.8 в подходящей клетке-хозяине и (b) извлечение антитела.

13. Способ по п.12, где клетка-хозяин является прокариотической.

14. Способ по п.12, где клетка-хозяин является эукариотической.

15. Применение антитела по любому из пп.1-6 для лечения опухоли, рака или нарушения пролиферации клеток, где лечение включает введение субъекту эффективного количества указанного антитела против Bv8.

16. Применение по п.15, где рак выбирают из группы, состоящей из рака молочной железы, рака толстой кишки, рака легких, рака почки, глиобластомы, рака пищевода, меланомы, рака мочевого пузыря, рака яичников, рака поджелудочной железы и гепатоцеллюлярной карциномы.

17. Применение антитела по любому из пп.1-6 для снижения или ингибирования ангиогенеза у субъекта, имеющего патологическое состояние, ассоциированное с ангиогенезом, включающее введение субъекту эффективного количества указанного антитела против Bv8, тем самым снижая или ингибируя ангиогенез у субъекта.

18. Применение по п.17, где указанное патологическое состояние представляет собой неопластическое состояние.

19. Применение антитела по любому из пп.1-6 для ингибирования пролиферации клеток эндотелия, включающее введение субъекту эффективного количества указанного антитела.

20. Применение по любому из пп.15-19, дополнительно включающее введение субъекту эффективного количества второго лекарственного средства, где антитело против Bv8 представляет собой первое лекарственное средство.

21. Применение по п.20, где второе лекарственное средство представляет собой другое антитело, химиотерапевтическое средство, цитотоксическое средство, антиангиогенное средство, иммуносупрессорное средство, пролекарство, цитокин, антагонист цитокина, цитотоксическую лучевую терапию, кортикостероид, противорвотное средство, вакцину против рака, обезболивающее средство или ингибирующее рост средство.

22. Применение по п.21, где второе лекарственное средство представляет собой антиангиогенное средство.

23. Применение по п.22, где антиангиогенное средство представляет собой антитело против VEGF.

24. Применение по п.23, где антителом против VEGF является бевацизумаб.

25. Применение по любому из пп.15-24, дополнительно включающее введение субъекту эффективного количества химиотерапевтического средства.



 

Похожие патенты:

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Изобретение охватывает вакцины против гриппа, в частности вакцины от птичьего гриппа.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биохимии, в частности к антителу или его антиген-связывающему фрагменту, которые специфически связываются с TNFα человека . Также раскрыты выделенная молекула нуклеиновой кислоты, кодирующая вышеуказанное антитело, вектор экспрессии, содержащий указанную молекулу нуклеиновой кислоты, и клетка-хозяин, содержащая указанный вектор, для экспрессии вышеуказанного антитела.

Изобретение относится к области биохимии, в частности к выделенному варианту сериновой протеазы, содержащему, по меньшей мере, от пяти до восьми аминокислотных замен в положениях, выбранных из группы, состоящей из положений 12, 14, 15, 16, 24, 35, 36, 39, 49, 54, 61, 63, 64, 65, 67, 69, 75, 76, 78, 79, 81, 86, 92, 93, 99, 109, 112, 121, 123, 125, 127, 143, 159, 179, 181, 184, 189, где заменяющая аминокислота в указанном положении выбрана из группы, состоящей из F, G, L, V, I, S, A, Y, K, W, M, P, N, Q, T, E, H, R, C, N и D, где указанные замены сделаны в положениях, эквивалентных положениям в протеазе Cellulomonas 69 В4, а также к молекуле нуклеиновой кислоты, ее кодирующей.

Настоящее изобретение относится к области биотехнологии. Предложены варианты гуманизированного анти-CD79b антитела, каждый из которых характеризуется наличием легкой и тяжелой цепи и набором 6 CDR с установленной аминокислотной последовательностью.

Изобретение относится к области биотехнологии, конкретно к получению ингибиторов адгезии и/или агрегации тромбоцитов, и может быть использовано в медицине. Рекомбинантным путем с использованием матрицы кДНК слюнной железы Anopheles stephensi получают полипептид, который используют в составе фармацевтической композиции и в наборах для скрининга ингибиторов адгезии или агрегации тромбоцитов.

Изобретение относится к области генетической инженерии и биотехнологии. Предложен способ оценки биоактивности химических соединений, где на первой стадии проводят транзиентную трансфекцию клеток линии HEK 293 плазмидным вектором pX-Y-neo (X - любой транскрипционный фактор эукариот, Y - протеотипический пептид, соответствующий данному транскрипционному фактору), содержащим минимальный промотор аденовируса человека типа 5; ген зеленого флуоресцирующего белка; последовательность нуклеотидов, кодирующих сайт связывания транскрипционного фактора; последовательность нуклеотидов, кодирующих протеотипический пептид; ген устойчивости к неомицину, затем на второй стадии определяют активность транскрипционного фактора путем флуоресцентного анализа и хромато-масс-спектрометрического измерения содержания протеотипического пептида в трансфицированной культуре клеток в присутствии тестируемого вещества в сравнении с трансфицированной интактной культурой клеток.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Изобретение относится к области биотехнологии, конкретно к получению аналогов инсулина, и может быть использовано в медицине в качестве лекарственного средства для снижения уровня глюкозы в крови у пациента.

Настоящее изобретение относится к иммунологии и биотехнологии. Предложено выделенное антитело против гепсина, где антитело связывается с гепсином в комплексе, содержащем гепсин и ингибитор сериновой протеазы, который связывает субсайт S1 гепсина человека.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биотехнологии. Предложено трансгенное животное, представляющее собой мышь или крысу, в геном которого встроена нуклеиновая кислота, кодирующая перестроенную вариабельную область легкой цепи иммуноглобулина человека, функционально связанную с константной областью иммуноглобулина указанного животного и функционально связанную с промотором, обеспечивающим экспрессию трансгенной легкой цепи в В-клетках млекопитающего, таким образом, что она образует пары с различными эндогенными тяжелыми цепями, обеспечивая получение антител.

Изобретение относится к области биохимии, в частности к антителу или его антиген-связывающему фрагменту, которые специфически связываются с TNFα человека . Также раскрыты выделенная молекула нуклеиновой кислоты, кодирующая вышеуказанное антитело, вектор экспрессии, содержащий указанную молекулу нуклеиновой кислоты, и клетка-хозяин, содержащая указанный вектор, для экспрессии вышеуказанного антитела.

Изобретение относится к области биотехнологии, конкретно к рекомбинантной продукции белков человека, и может быть использовано в производстве химерных антител к фактору некроза опухоли человека.

Изобретение относится к области биохимии, в частности к гуманизированному антителу к фактору некроза опухоли опухоли-α или его антигенсвязывающему фрагменту Fab. Также раскрыты ген, кодирующий белок антитела или Fab, генетический материал, экспрессирующий указанное антитело или Fab-фрагмент.

Предложенное изобретение относится к иммунологии. Предложено моноклональное анти-IFNAR1 антитело с мутациями L234F, L235E и P331S в области Fc человеческого IgG1, обладающее пониженным сродством в отношении Fcgamma RI, Fcgamma RIIIА и c1q рецепторов по сравнению с немодифицированным антителом.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная плазмидная ДНК, кодирующая химерное антитело против фактора некроза опухолей-альфа человека (ФНО-альфа), на основе плазмиды pOptiVECTM-TOPO®.

Предложенное изобретение относится к иммунологии. Предложены варианты антител, нейтрализующих инфекцию субтипа группы 1 и субтипа группы 2 вируса гриппа А.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).
Наверх