Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii



Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii
Композиции, способы получения и применение каркаса на основе домена фибронектина типа iii

 

C40B50/00 -
C40B50/00 -
C40B40/10 -
C40B40/10 -

Владельцы патента RU 2562700:

ЯНССЕН БАЙОТЕК, ИНК. (US)

Изобретение относится к области биотехнологии, конкретно к получению белковых каркасов, связывающихся с IgG, и может быть использовано в диагностике или лечении. Получают белковый каркас на основе консенсусной последовательности десятого повтора фибронектина типа III (FN3) человека, содержащий последовательность аминокислот SEQ ID NO: 16. На основе полученного белкового каркаса создают библиотеку белковых каркасов путем внесения разнообразия в копии указанного полипептида посредством мутирования по меньшей мере одной петлевой области остатков 22-28 и 75-81 SEQ ID NO: 16. Изобретение позволяет получить белковый каркас с высокой термостабильностью и сниженным риском аутоиммунного ответа при введении в организм. 2 н.п. ф-лы, 8 ил., 3 табл., 3 пр.

 

ОБЛАСТЬ ПРИМЕНЕНИЯ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к белковым каркасам с новыми свойствами, включая возможность связываться с клеточными мишенями. Более конкретно, настоящее изобретение относится к белковому каркасу, основанному на консенсусной последовательности повтора фибронектина типа III (FN3).

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Наиболее часто в ситуациях, когда терапевтический белок должен иметь высокую аффинность и специфичность к молекуле-мишени, используют моноклональные антитела. Однако для биофармацевтической промышленности большой интерес также представляет изготовление не являющихся антителами белков, которые способны связываться с такими мишенями. Такие альтернативные белковые каркасы могут иметь преимущества перед традиционными антителами по причине малого размера, отсутствия дисульфидных связей, высокой стабильности и возможности экспрессироваться в прокариотических клетках-хозяевах. Для их очистки активно используют современные методы; они легко соединяются с лекарственными препаратами/токсинами, эффективно проникают в ткани и могут прекрасно использоваться в качестве многоспецифических связующих веществ .

Одним из таких альтернативных белковых каркасов является укладка цепи иммуноглобулинов (Ig). Эта укладка цепи встречается в переменных участках антител, а также в тысячах белков, не являющихся антителами. Исследования показывают, что один из таких белков Ig, десятый повтор фибронектина типа III (FN3) из человеческого фибронектина, может допускать ряд мутаций в поверхностных петлях, сохраняя при этом общую структуру укладки цепи Ig. Так, в последовательности этих петель были встроены библиотеки аминокислотных вариантов, после чего осуществлялся отбор веществ, связывающихся с рядом разнообразных мишеней . Как было обнаружено, такие созданные домены FN3 связываются с мишенями с высокой аффинностью, одновременно сохраняя свои важные биофизические свойства .

К числу желательных физических свойств, которые должны иметь потенциальные альтернативные молекулы каркаса, относятся высокая термостабильность и обратимость термального свертывания и развертывания. В целях повышения очевидной термостабильности белков и ферментов использовали несколько способов, в том числе рациональный дизайн, основанный на сравнении с термостабильными последовательностями с высокой степенью сходства, конструирование стабилизирующих дисульфидных мостиков, создание мутаций для повышения склонности к образованию α-спирали, создание солевых мостиков, изменение поверхностного заряда белка, направленная эволюция и изменение состава консенсусных последовательностей . Высокая термическая стабильность относится к числу желательных свойств таких каркасов, поскольку благодаря ей можно увеличивать выход получаемого рекомбинантного белка, улучшать растворимость очищенной молекулы, повышать активность внутриклеточных каркасов, снижать иммуногенность и сводить к минимуму потребность в «холодовой цепи» при производстве.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Настоящее изобретение представляет белковый каркас на основе белка с повтором фибронектина типа III (FN3), кодирующие или комплементарные нуклеиновые кислоты, векторы, клетки-хозяева, композиции, комбинации, препараты, устройства и способы их получения и применения. В предпочтительном варианте осуществления белковый каркас содержит консенсусную последовательность множественных доменов FN3 человеческого фибронектина. В другом предпочтительном варианте осуществления белковый каркас в соответствии с настоящим изобретением является консенсусной последовательностью из 7 доменов FN3. Белковые каркасы в соответствии с настоящим изобретением могут быть предназначены для связывания различных молекул, например, клеточного белка-мишени.

Белковые каркасы в соответствии с настоящим изобретением могут включать дополнительные молекулы или части, например, участок Fc антитела, альбумин-связывающий домен либо другую часть, влияющую на период полувыведения. В других вариантах осуществления белковые каркасы в соответствии с настоящим изобретением могут связываться с молекулой нуклеиновой кислоты, которая может кодировать белковый каркас.

Настоящее изобретение также относится по меньшей мере к одному способу экспрессии по меньшей мере одного белкового каркаса на основе консенсусной последовательности множественных доменов FN3 в клетке-хозяине, включающему культивирование клетки-хозяина как описано в настоящем документе в условиях, которые позволяют экспрессировать по меньшей мере один белковый каркас в количествах, допускающих детекцию и/или восстановление.

Настоящее изобретение также относится по меньшей мере к одной композиции, содержащей (a) белковый каркас на основе консенсусной последовательности нескольких доменов FN3 и/или кодирующей нуклеиновой кислоты, как описано в настоящем документе; и (b) подходящий и/или фармацевтически приемлемый носитель либо растворитель.

Кроме того, настоящее изобретение дополнительно включает способ создания библиотек белковых каркасов на основе повтора фибронектина типа III (FN3), предпочтительно, консенсусной последовательности множественных доменов FN3 и, более предпочтительно, консенсусной последовательности множественных доменов FN3 человеческого фибронектина. Библиотека формируется путем создания последовательных генераций каркасов за счет изменения (мутации) аминокислот или количества аминокислот в молекулах в отдельных позициях в частях каркаса, например, участках петель. Библиотеки могут создаваться посредством внесения изменений в аминокислотный состав единичной петли либо одновременного изменения множественных петель. Изменяемые петли могут быть соответствующим образом удлинены или сокращены. Возможна генерация подобных библиотек таким образом, чтобы они содержали все возможные аминокислоты в каждой позиции или особое подмножество аминокислот. Компоненты библиотек могут использоваться для скрининга при помощи дисплей-методов, таких как дисплей in vitro (ДНК, РНК, рибосомный дисплей) и фаговый дисплей.

Белковые каркасы в соответствии с настоящим изобретением имеют улучшенные биофизические свойства, например, стабильность в условиях восстановления и растворимость при высоких концентрациях; они могут быть экспрессированы и фолдированы в прокариотических системах, например, E. coli, в эукариотических системах, например, дрожжах, и в системах транскрипции/трансляции in vitro, например, лизате ретикулоцитов кролика.

Дополнительно настоящее изобретение предоставляет способ генерации молекулы каркаса, способной связываться со специфической мишенью, включающий пэннинг библиотеки каркаса в соответствии с настоящим изобретением относительно мишени и обнаружение связывающих веществ. Помимо этого, изобретение включает способы скрининга, которые могут быть использованы для генерации или аффинного созревания белковых каркасов с требуемой активностью, например, способных связываться с белками-мишенями с определенной аффинностью. Аффинное созревание может достигаться многократными процедурами мутагенеза и селекции с помощью таких систем, как фаговый дисплей или дисплей in vitro. Мутагенез в ходе этого процесса может являться результатом сайт-направленного мутагенеза к специфическим остаткам каркаса, случайным мутагенезом из-за ошибок в ПЦР либо перестановки в ДНК и/или комбинации этих способов. Настоящее изобретение дополнительно относится к любым изобретениям, описанным в настоящем документе.

ОПИСАНИЕ ФИГУР

Фиг. 1. Структура домена FN3. Кристаллическая структура 10-го домена FN3 человеческого фибронектина (PDB 1TTF) . Помечены петли B:C, D:E и F:G, подвергшиеся диверсификации.

Фиг. 2A-N. Профили плавления очищенных доменов FN3 (за исключением 7-го домена) человеческого фибронектина, определенные посредством дифференциальной сканирующей калориметрии в фосфатном буфере при pH 7,4.

Фиг. 3. Множественный сравнительный анализ линейных последовательностей 15 доменов FN3 человеческого фибронектина. Анализ линейных последовательностей осуществляли с использованием программного обеспечения VectorNTI.

Фиг. 4. Множественный сравнительный анализ линейных последовательностей доменов FN3 1, 5, 8, 10, 12, 14, и 15 человеческого фибронектина. Анализ линейных последовательностей осуществляли с использованием программного обеспечения VectorNTI.

Фиг. 5A и B. Экспрессия и очистка фибкона. A) Анализ, при помощи электрофореза в 4-12% полиакриламидном геле в присутствии додецилсульфата натрия (SDS-PAGE), целостного клеточного лизата, растворимой фракции, «проскока» Ni-NTA, элюента и фракций, элюированных с хроматографической колонки Ni-NTA. B) Очистка фибкона в фосфатном буферном растворе (ФБР) при помощи Superdex 75. Стрелками обозначен элюируемый объем и масса стандартов молекулярного веса.

Фиг. 6. Дифференциальная сканирующая калориметрия фибкона в фосфатном буфере при pH 7,4.

Фиг. 7. Развертывание полипептидной цепи фибкона под воздействием Gu-HCl контролируют посредством внутренней флуоресценции триптофана. Возбуждение было отмечено при длине волны 280 нм, а эмиссия - при 365 нм.

Фиг. 8 Аминокислотная последовательность фибкона, показывающая расположение петель A-B, B-C, C-D, D-E, E-F, F-G.

ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Настоящее изобретение представляет собой выделенный, рекомбинантный и/или синтетический белковый каркас на основе повтора фибронектина типа III (FN3) человеческого фибронектина, включая, помимо прочего, каркас животного происхождения, а также композиции и молекулы кодирующих нуклеиновых кислот, включающие по меньшей мере один полинуклеотид, кодирующий белковый каркас, основанный на структуре десятого домена FN3. Настоящее изобретение дополнительно относится, помимо прочего, к способам изготовления и использования таких нуклеиновых кислот и белковых каркасов, в том числе к диагностическим и терапевтическим композициям, способам и устройствам.

Белковые каркасы в соответствии с настоящим изобретением имеют преимущества в сравнении с общепринятыми терапевтическими веществами, такие как возможность местного или перорального применения либо воздействия после преодолевания гемато-энцефалического барьера, способность экспрессироваться в клетках E. coli, позволяющая значительно повышать уровень экспрессии в сравнении с экспрессией в клетках млекопитающих, способность подвергаться генно-инженерному конструированию с созданием биспецифичных молекул, связывающихся с множественными мишенями либо множественными эпитопами одной и той же мишени, способность соединения с лекарственными препаратами, полимерами и зондами, способность использования в форме концентрированных лекарственных препаратов, а также способность таких молекул эффективно проникать в пораженные ткани и опухоли.

Кроме того, белковые каркасы обладают многими свойствами антител с точки зрения укладки, которая имитирует вариабельный участок антитела. Такая ориентация позволяет создавать поверхностные петли FN3 по аналогии с гипервариабельными участками (CDR) антител. Предполагается, что они смогут связываться с клеточными мишенями и петли можно будет изменять, например, подвергать аффинному созреванию, для улучшения некоторых свойств связывания и т.п.

Три из шести петель белкового каркаса в соответствии с настоящим изобретением топологически соответствуют гипервариабельным участкам (CDR 1-3) антитела, т.е. антигенсвязывающим участкам, а оставшиеся три петли являются поверхностными по аналогии с участками CDR антител. Эти петли охватывают промежутки между аминокислотными остатками 13-16, 22-28, 38-43, 51-54, 60-64 и 75-81 последовательности SEQ ID NO:16, как показано ниже в таблице 3 и фиг. 8. Предпочтительно, чтобы области петель в промежутках между аминокислотными остатками 22-28, 51-54 и 75-81 были изменены в целях усиления специфичности и аффинности связывания. Эти области петель модифицируются случайным образом в целях создания библиотеки, компоненты которых могут подвергаться селекции на основании наибольшей аффинности в отношении определенной белковой мишени. Один или более участков петель могут взаимодействовать с белком-мишенью по аналогии с тем, как участок CDR антитела взаимодействует с белком.

Каркасы в соответствии с настоящим изобретением могут включать другие субъединицы, например, посредством ковалентного взаимодействия. Константный участок антитела, либо его часть, может быть присоединен к каркасу, придавая ему антителоподобные свойства, например, функции, опосредуемые комплементом (ADCC), период полужизни и т.д. Например, может осуществляться и/или контролироваться эффекторная функция, например, посредством модификации связывания C1q и/или FcγR и, таким образом, изменения комплементзависимой цитотоксичности (CDC) и/или антителозависимой клеточно-опосредованной цитотоксичности (ADCC). «Эффекторные функции» являются ответственными за усиление либо снижение биологической активности (например, в организме пациента). К эффекторным функциям относятся, в частности, связывание C1q; комплементзависимая цитотоксичность (CDC); связывание рецептора Fc; антителозависимая клеточно-опосредованная цитотоксичность (ADCC); фагоцитоз; супрессирующий эффект на рецепторы клеточной поверхности (например, рецептор клеток B (BCR)) и т.д. Такие эффекторные функции могут потребовать связывания участка Fc со связывающим доменом (петлями белкового каркаса и т.д.) и могут быть оценены с помощью различных методов анализа (например, анализа связывания Fc, анализа ADCC, анализа CDC и т.д.).

Кроме того, для получения требуемых свойств к молекуле каркаса могут быть присоединены молекулы конъюгата токсина, альбумина или связывающего альбумин вещества, полиэтиленгликоля (PEG). Любые из этих соединений могут быть получены стандартными способами, например, путем экспрессии рекомбинантного белка из рекомбинантного гибридного гена, созданного из общедоступных последовательностей генов.

Каркасы в соответствии с настоящим изобретением могут быть моноспецифическими в мономерной форме и би- или мультиспецифическими (для разных белков-мишеней или антигенных детерминант одного белка-мишени) в многомерной форме. Присоединения могут быть ковалентными или нековалентными. Например, двумерный биспецифический каркас имеет одну субъединицу со специфичностью к первому белку-мишени или первой антигенной детерминанте и вторую субъединицу со специфичностью ко второму белку-мишени или второй антигенной детерминанте. Каркасные субъединицы могут соединяться друг с другом с формированием разнообразных конформаций, что способно увеличивать их валентность и, таким образом, авидность связывания антигенов.

В настоящем документе термин «антитело» означает любую белок- или пептид-содержащую молекулу, которая состоит по меньшей мере из части молекулы иммуноглобулина, в частности, по меньшей мере из одного гипервариабельного участка (CDR) тяжелой или легкой цепи либо его лиганд-связующей части, вариабельного участка тяжелой или легкой цепи, постоянного участка тяжелой или легкой цепи, каркасного участка или их части. В некоторых случаях такое антитело дополнительно воздействует на специфический лиганд, в частности, может модулировать, снижать, увеличивать, не допускать, предотвращать, уменьшать, смягчать, блокировать, ингибировать, уничтожать и/или нарушать по меньшей мере одну активность или связь либо активность или связь рецептора in vitro, in situ и/или in vivo.

Дополнительно термин «антитело» означает антитела, продукты расщепления, указанные части и их варианты, в частности, миметики антител или составные части антител, имитирующие структуру и/или функцию антитела или его указанного фрагмента либо части, в том числе одноцепочечные антитела, однодоменные антитела и их фрагменты. Функциональные фрагменты включают антигенсвязывающие фрагменты, которые связываются с конкретной мишенью. Например, в настоящее изобретение включены фрагменты антител, способные связываться с определенной мишенью, или их части, в частности, фрагменты Fab (например, в результате расщепления папаином), Fab' (например, в результате расщепления пепсином и частичного восстановления) и F(ab')2 (например, в результате расщепления пепсином), facb (например, в результате расщепления плазмином), pFc' (например, в результате расщепления пепсином или плазмином), Fd (например, в результате расщепления пепсином, частичного восстановления и реагрегации), Fv или scFv (например, с помощью методов молекулярной биологии) (см., например, Colligan, Immunology, supra).

Такие фрагменты могут быть получены путем ферментативного расщепления, методами синтеза или рекомбинации, известными из уровня техники и/или описанными в настоящем документе. Антитела также могут быть получены в различных процессированных формах с использованием генов антител, в которых один или более стоп-кодонов добавлены выше естественного сайта терминации. Например, возможно создание комбинационного гена, кодирующего часть тяжелой цепи F(ab')2, содержащего последовательности ДНК, кодирующие домен CH1 и/или шарнирный участок тяжелой цепи. Различные части антител могут быть соединены химически традиционными способами или получены в виде единого белка методами генной инженерии.

Белковый каркас в соответствии с настоящим изобретением может быть использован для измерения или вызывания в клетке, ткани, органе или животном (включая млекопитающих и человека), диагностирования, контролирования, модулирования, лечения, смягчения, предотвращения или снижения симптомов по меньшей мере одного заболевания или состояния, выбранного из группы, включающей, помимо прочего, иммунное нарушение или заболевание, сердечно-сосудистое нарушение или заболевание, инфекцию, злокачественное заболевание и/или неврологическое нарушение или заболевание, а также другие известные или отмеченные связанные состояния.

Такой способ может включать введение эффективного количества композиции или фармацевтической композиции, содержащей по меньшей мере один белковый каркас, в клетку, ткань, орган, организм животного или пациента, которым требуется такого рода модулирование, лечение, смягчение, предотвращение или сокращение симптомов, эффектов либо механизмов. Эффективное количество может составлять от приблизительно 0,001 до 500 мг/кг для однократного (например, болюс), многократного или непрерывно применения, либо достигать сывороточной концентрации 0,01-5000 мкг/мл при однократном, многократном или непрерывном применении, либо может находиться в любом эффективном диапазоне или иметь эффективное значение в таком диапазоне, установленном или определенном известными способами, как описано в настоящем документе или известно специалистам.

Белковый каркас в соответствии с настоящим изобретением. Формирование и генерация

По меньшей мере один белковый каркас в соответствии с настоящим изобретением может быть необязательно получен с помощью линии клеток, смешанной линии клеток, иммортализованной клетки или клональной популяции иммортализованных клеток, хорошо известных в данном уровне техники. См., например, Ausubel, et al., ed., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, NY (1987-2001); Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor, NY (1989); Harlow and Lane, Antibodies, a Laboratory Manual, Cold Spring Harbor, NY (1989); Colligan, et al., eds., Current Protocols in Immunology, John Wiley & Sons, Inc., NY (1994-2001); Colligan et al., Current Protocols in Protein Science, John Wiley & Sons, NY, NY, (1997-2001).

Аминокислоты белкового каркаса могут быть изменены, добавлены и/или удалены для снижения иммуногенности или сокращения, улучшения либо изменения связывания, аффинности, скорости ассоциации, скорости диссоциации, авидности, специфичности, периода полувыведения, стабильности, растворимости или другого соответствующего свойства, известного из уровня техники.

В некоторых случаях белковые каркасы могут быть созданы с сохранением высокой аффинности к антигену и других благоприятных биологических свойств. Для достижения этой цели белковые каркасы могут быть необязательно получены путем анализа родительских последовательностей и различных концептуальных искусственных продуктов с помощью трехмерных моделей родительских и искусственных последовательностей. Трехмерные модели широко используются и известны специалистам в данной области техники. Существуют компьютерные программы, иллюстрирующие и показывающие вероятные трехмерные конформационные структуры отобранных последовательностей-кандидатов, а также способные измерять потенциальную иммуногеничность (например, программа Immunofilter разработки Xencor, Inc., Монровия, Калифорния). Изучение таких иллюстраций позволяет проанализировать предполагаемую роль остатков в функционировании последовательности-кандидата, например, остатков, влияющих на способность белкового каркаса-кандидата связывать его антиген. Таким образом, возможны селекция и комбинирование остатков из родительской и референсной последовательностей с целью получения требуемого свойства, например, аффинности к антигенам-мишеням. Помимо вышеуказанных процедур или в дополнение к ним могут быть использованы другие подходящие методы инженерии.

Скрининг

Скрининг белковых каркасов на предмет специфического связывания схожих белков или фрагментов без труда осуществляется с помощью библиотек дисплеев нуклеотидов (дисплея ДНК или РНК) или пептидов, например, дисплея in vitro. Этот способ предполагает скрининг больших количеств пептидов на предмет отдельных пептидов, имеющих требуемую функцию или структуру. Последовательности нуклеотидов или пептидов в дисплее могут содержать от 3 до 5000 и более нуклеотидов или аминокислот в длину, часто от 5 до 100 аминокислот в длину и периодически от приблизительно 8 до 25 аминокислот в длину. Помимо методов прямого химического синтеза, из уровня техники известны несколько методов рекомбинантных ДНК для генерации библиотек пептидов. Один из таких методов предусматривает дисплей последовательности пептидов на поверхности бактериофага или клетки. Каждый бактериофаг или каждая клетка содержит последовательность нуклеотидов, кодирующую отдельно взятую видимую последовательность пептидов. Такие методы описаны в патентных публикациях PCT № 91/17271, 91/18980, 91/19818 и 93/08278.

Другие системы генерации библиотек пептидов применяют как методы химического синтеза in vitro, так и рекомбинантные методы. См. патентные публикации PCT № 92/05258, 92/14843 и 96/19256. См. также патенты США № 5658754 и 5643768. В продаже доступны библиотеки пептидных дисплеев, векторы и комплекты для скрининга таких производителей, как Invitrogen (Карлсбад, Калифорния) и Cambridge Antibody Technologies (Кембриджшир, Великобритания). См., например, патенты США № 4704692, 4939666, 4946778, 5260203, 5455030, 5518889, 5534621, 5656730, 5763733, 5767260, 5856456, полученные Enzon; 5223409, 5403484, 5571698, 5837500, полученные Dyax, 5427908, 5580717, полученные Affymax; 5885793, полученные Cambridge Antibody Technologies; 5750373, полученные Genentech, 5618920, 5595898, 5576195, 5698435, 5693493, 5698417, полученные Xoma, Colligan, supra; Ausubel, supra; или Sambrook, supra.

Белковые каркасы в соответствии с настоящим изобретением могут связывать белки человека или других млекопитающих с разной степенью аффинности (KD). В предпочтительном варианте осуществления по меньшей мере один белковый каркас в соответствии с настоящим изобретением может необязательно связываться с белком-мишенью с высокой аффинностью, например, с KD, равным или составляющим менее чем приблизительно 10-7 M, в частности, 0,1-9,9 (либо любой диапазон или значение из него) × 10-8, 10-9, 10-10, 10-11, 10-12, 10-13, 10-14, 10-15 либо любой диапазон или значение из него, что может быть определено методом поверхностного плазмонного резонанса или методом Kinexa, используемыми специалистами в данной области техники.

Аффинность или авидность белкового каркаса по отношению к антигену могут быть определены экспериментально соответствующим способом. (См., например, Berzofsky, et al., «Antibody-Antigen Interactions,» In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, NY (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, NY (1992); а также способы, описанные в настоящем документе). Измеренная аффинность отдельно взятого комплекса «белковый каркас - антиген» может меняться в зависимости от условий измерения (концентрации соли, pH и т.д.). Следовательно, измерения аффинности и других параметров связывания антигена (KD, Kon, Koff и т.д.) предпочтительно производить с использованием стандартизированных растворов белкового каркаса и антигена и стандартизированного буфера, описанного, например, в настоящем документе.

Возможно проведение анализа конкурентного связывания белкового каркаса в соответствии с настоящим изобретением для определения, какие белки, антитела и другие антагонисты конкурируют за связывание белка-мишени с белковым каркасом в соответствии с настоящим изобретением и/или совместно используют участок антигенной детерминанты. Эти анализы, хорошо известные средним специалистам в данной области техники, предназначены для оценки конкуренции между антагонистами или лигандами за ограниченное количество сайтов связывания у белка. Белок и/или антитела нейтрализуют или переводят в нерастворимую форму до или после конкурентного анализа, и пробу, связавшуюся с белком-мишенью, отделяют от несвязавшейся пробы, например, путем переливания (если белок/антитело предварительно перевели в нерастворимую форму) или центрифугирования (если белок/антитело осадили после реакции конкурентного анализа). Кроме того, конкурентное связывание можно определить по тому, изменена ли функция в результате связывания или несвязывания белкового каркаса с белком-мишенью, например, молекула белкового каркаса может ингибировать или стимулировать ферментативную активность, к примеру, метки. Возможно использование ИФА и других функциональных анализов, хорошо известных из уровня техники.

Молекулы нуклеиновых кислот

Молекулы нуклеиновых кислот в соответствии с настоящим изобретением, кодирующие белковый каркас, могут иметь форму РНК, например, мРНК, гяРНК, тРНК или любую другую форму, либо форму ДНК, в частности, кДНК и геномной ДНК, полученной путем клонирования, синтеза или любой комбинации этих способов. ДНК может быть трехцепочечной, двухцепочечной и одноцепочечной либо комбинированной. Любая часть по меньшей мере одной цепи ДНК или РНК может быть кодирующей цепью, также называемой смысловой цепью, или некодирующей цепью, также называемой антисмысловой цепью.

Выделенные молекулы нуклеиновых кислот в соответствии с настоящим изобретением могут включать молекулы нуклеиновых кислот, содержащие открытую рамку считывания (ORF), в некоторых случаях с одним или несколькими интронами, в частности, по меньшей мере одну указанную часть по меньшей мере одного белкового каркаса; молекулы нуклеиновых кислот, содержащие кодирующую последовательность для белкового каркаса или участок петли, который связывается с белком-мишенью; и молекулы нуклеиновых кислот, содержащие последовательность нуклеотидов, существенно отличающуюся от вышеописанных, но из-за дегенерации генетического кода по-прежнему кодирующую белковый каркас, как описано в настоящем документе и/или известно из уровня техники. Очевидно, что генетический код хорошо известен из уровня техники. Следовательно, специалист в данной области техники без труда может получить такие дегенерировавшие варианты нуклеиновой кислоты, которые кодируют специфические белковые каркасы в соответствии с настоящим изобретением. См., например, Ausubel, et al., supra. Такие варианты нуклеиновой кислоты относятся к настоящему изобретению.

Как указано в настоящем документе, молекулы нуклеиновых кислот в соответствии с настоящим изобретением, которые составляют нуклеиновую кислоту, кодирующую белковый каркас, могут включать, помимо прочего, молекулы, кодирующие последовательность аминокислот одного фрагмента белкового каркаса; кодирующие последовательность всего белкового каркаса или его части; кодирующие последовательность белкового каркаса, фрагмента или части, а также дополнительные последовательности, например, кодирующие последовательность по меньшей мере одного сигнального пептида или слитого пептида с вышеуказанными дополнительными кодирующими последовательностями или без них, например, по меньшей мере один интрон, совместно с дополнительными некодирующими последовательностями, в частности, некодирующими 5'- и 3'-концевыми последовательностями, например, транскрибированными, не подвергшимися трансляции последовательностями, которые играют роль в транскрипции, обработке мРНК, включая сигналы сплайсинга и полиаденилирования (например, связывание рибосом и стабильность мРНК); дополнительная кодирующая последовательность, которая кодирует дополнительные аминокислоты, например, обеспечивающие дополнительные функции. Так, последовательность, кодирующая белковый каркас, может быть соединена с маркерной последовательностью, такой как последовательность, кодирующая пептид, облегчающий очистку рекомбинантного белкового каркаса, включающего фрагмент или часть белкового каркаса.

Селективная гибридизация полинуклеотидов в описанный в настоящем документе полинуклеотид

Настоящее изобретение включает выделенные нуклеиновые кислоты, которые в условиях селективной гибридизации образуют описанный в настоящем документе полинуклеотид. Таким образом, полинуклеотиды в соответствии с таким вариантом осуществления могут быть использованы для выделения, детекции и/или подсчета нуклеиновых кислот, составляющих такие полинуклеотиды. Например, полинуклеотиды в соответствии с настоящим изобретением могут быть использованы для идентификации, выделения или амплификации частичных либо полноразмерных клонов в подготовленной библиотеке. В некоторых вариантах осуществления полинуклеотиды являются последовательностями геномной ДНК или кДНК, выделенными или иным образом комплементарными относительно кДНК из библиотеки нуклеиновых кислот человека или млекопитающего.

Библиотека кДНК предпочтительно содержит по меньшей мере 80% полноразмерных последовательностей, более предпочтительно по меньшей мере 85% или 90% полноразмерных последовательностей и, наиболее предпочтительно, по меньшей мере 95% полноразмерных последовательностей. Библиотеки кДНК могут быть нормализованы с целью увеличения количества редких последовательностей. Для последовательностей, мало идентичных комплементарным последовательностям, обычно, но не исключительно, гибридизацию осуществляют в условиях низкой или умеренной жесткости. Для последовательностей с большей идентичностью необязательно применяют условия средней и высокой жесткости. Условия низкой жесткости допускают селективную гибридизацию последовательностей с уровнем идентичности приблизительно 70% и могут быть использованы для идентификации ортологических или паралогических последовательностей.

В некоторых случаях полинуклеотиды в соответствии с настоящим изобретением кодируют по меньшей мере часть белкового каркаса, кодируемого описанными в настоящем документе полинуклеотидами. Полинуклеотиды в соответствии с настоящим изобретением включают последовательности нуклеиновых кислот, которые могут использоваться для селективной гибридизации с полинуклеотидом, кодирующим белковый каркас в соответствии с настоящим изобретением. См., например, Ausubel, supra; Colligan, supra, каждый источник полностью включен в текст настоящего документа путем ссылки.

Конструирование нуклеиновых кислот

Выделенные нуклеиновые кислоты в соответствии с настоящим изобретением могут быть получены с помощью

(a) рекомбинантных способов, (b) методов синтеза, (c) методов очистки и/или

(d) их комбинаций, хорошо известных из уровня техники.

Нуклеиновые кислоты могут быть легко дополнены последовательностями, помимо полинуклеотида в соответствии с настоящим изобретением. Например, в нуклеиновую кислоту можно вставить сайт множественного клонирования, содержащий один или более сайтов рестрикции эндонуклеазы, чтобы способствовать выделению полинуклеотида. Кроме того, могут быть вставлены транслируемые последовательности, чтобы способствовать выделению транслированного полинуклеотида в соответствии с настоящим изобретением. К примеру, удобным способом очистки белков в соответствии с настоящим изобретением является гексагистидин-маркирующая последовательность. Нуклеиновая кислота в соответствии с настоящим изобретением, за исключением кодирующей последовательности, может необязательно являться вектором, адаптером или линкером для клонирования и/или экспрессии полинуклеотида в соответствии с настоящим изобретением.

В подобные клонирующие и/или экспрессирующие последовательности могут быть добавлены дополнительные последовательности, чтобы оптимизировать их функционирование при клонировании и/или экспрессии, способствовать выделению полинуклеотида или улучшить проникновение полинуклеотида в клетку. Использование клонирующих векторов, экспрессирующих векторов, адаптеров и линкеров хорошо известно из уровня техники (см., например, Ausubel, supra; или Sambrook, supra.).

Рекомбинантные способы конструирования нуклеиновых кислот

Выделенные композиции нуклеиновых кислот в соответствии с настоящим изобретением, например, РНК, кДНК, геномная ДНК или их комбинация, могут быть получены из биологических источников с помощью любого количества способов клонирования, известных специалистам в данной области техники. В некоторых вариантах осуществления пробы олигонуклеотидов, в результате селективной гибридизации в жестких условиях образующие полинуклеотиды в соответствии с настоящим изобретением, используют для идентификации требуемой последовательности в библиотеке кДНК или геномной ДНК. Способы выделения РНК и синтеза кДНК и геномных библиотек хорошо известны специалистам (например, Ausubel, supra; или Sambrook, supra).

Методы скрининга и выделения нуклеиновых кислот

Библиотека кДНК или геномной ДНК может быть подвергнута скринингу с помощью пробы, основанной на последовательности полинуклеотида в соответствии с настоящим изобретением, например, описанного в настоящем документе. Пробы могут быть использованы для гибридизации с последовательностями геномной ДНК или кДНК для выделения гомологичных генов в одинаковых либо разных организмах. Специалистам в данной области техники будет ясно, что при анализе можно варьировать жесткость условий гибридизации, при этом жесткие условия могут иметь как гибридизационная, так и промывочная среда. Чем жестче условия гибридизации, тем выше должна быть комплементарность между пробой и мишенью для образования дуплекса. Жесткость условий можно контролировать одним или более из следующих параметров: температурой, ионной силой, pH и присутствием частично денатурирующего растворителя, например, формамида. К примеру, жесткость условий гибридизации удобно регулировать путем изменения полярности реагирующего раствора, например, через подбор концентрации формамида в диапазоне от 0% до 50%. Степень комплементарности (идентичности последовательностей), необходимая для детекции связывания, зависит от жесткости условий гибридизационной и/или промывочной среды. Оптимальной является степень комплементарности, равная 100%, 70-100% либо находящаяся в любом диапазоне или имеющая любое значение из него. Однако следует понимать, что незначительные изменения последовательности в пробах и праймерах могут быть компенсированы за счет снижения жесткости гибридизационной и/или промывочной среды.

Методы амплификации РНК или ДНК хорошо известны из уровня техники и могут быть использованы в соответствии с настоящим изобретением без лишних экспериментов и на основании представленных в настоящем документе инструкций и рекомендаций.

К известным методам амплификации РНК или ДНК относятся, в частности, полимеразная цепная реакция (ПЦР) и соответствующие процессы амплификации (см., например, патенты США №№ 4683195, 4683202, 4800159, 4965188 авторства Mullis, et al.; 4795699 и 4921794 авторства Tabor, et al; 5142033 авторства Innis; 5122464 авторства Wilson, et al.; 5091310 авторства Innis; 5066584 авторства Gyllensten, et al; 4889818 авторства Gelfand, et al; 4994370 авторства Silver, et al; 4766067 авторства Biswas; 4656134 авторства Ringold) и РНК-опосредованная амплификация, применяющая антисмысловую РНК к целевой последовательности в качестве матрицы для синтеза двухцепочечной ДНК (патент США № 5130238 авторства Malek, et al, торговое наименование: NASBA); каждый источник полностью включен в текст настоящего документа путем ссылки (см., например, Ausubel, supra; или Sambrook, supra.).

К примеру, метод полимеразной цепной реакции (ПЦР) может быть использован для амплификации последовательностей полинуклеотидов в соответствии с настоящим изобретением и связанных генов напрямую из библиотек геномной ДНК или кДНК. ПЦР и другие методы амплификации in vitro могут быть также использованы, например, для клонирования последовательностей нуклеиновых кислот, кодирующих белки, которые требуется экспрессировать, чтобы получить пробы нуклеиновых кислот для определения присутствия требуемой мРНК в пробах, секвенирования нуклеиновых кислот или иных целей. Примеры способов, на основании которых специалист в данной области техники может уяснить способы амплификации in vitro, приведены в Berger, supra, Sambrook, supra, и Ausubel, supra, а также в Mullis, et al., патент США № 4683202 (1987); и Innis, et al., PCR Protocols A Guide to Methods and Applications, Eds., Academic Press Inc., San Diego, CA (1990). Имеющиеся в продаже наборы для ПЦР-амплификации геномной последовательности известны из уровня техники. См., например, набор Advantage-GC Genomic PCR (Clontech). Кроме того, возможно использование, например, белка T4 гена 32 (Boehringer Mannheim) для увеличения количества продуктов при ПЦР длинных фрагментов.

Синтетические способы конструирования нуклеиновых кислот

Выделенные нуклеиновые кислоты в соответствии с настоящим изобретением могут быть также получены прямым химическим синтезом с помощью известных способов (см., например, Ausubel, et al., supra). Химический синтез обычно позволяет получить одноцепочечный олигонуклеотид, который может быть трансформирован в двухцепочечную ДНК путем гибридизации с комплементарной последовательностью или полимеризации с использованием ДНК-полимеразы и одиночной цепи в качестве матрицы. Специалистам в данной области техники известно, что химический синтез ДНК может быть ограничен последовательностями длиной в 100 или более оснований, однако короткие последовательности можно лигировать, тем самым получив более длинные последовательности.

Рекомбинантные экспрессирующие кассеты

Настоящее изобретение дополнительно относится к рекомбинантным экспрессирующим кассетам, содержащим нуклеиновую кислоту в соответствии с настоящим изобретением. Последовательность нуклеиновых кислот в соответствии с настоящим изобретением, например, последовательность кДНК или геномной ДНК, кодирующая белковый каркас в соответствии с настоящим изобретением, может быть использована для конструирования рекомбинантной экспрессирующей кассеты, которая может быть введена в по меньшей мере одну требуемую клетку-хозяина. Рекомбинантная экспрессирующая кассета, как правило, содержит полинуклеотид в соответствии с настоящим изобретением, функционально связанный с транскрипционными инициационными регуляторными последовательностями, которые направляют транскрипцию полинуклеотида в требуемой клетке-хозяине. Для направления экспрессии нуклеиновых кислот в соответствии с настоящим изобретением могут применяться как гетерологичные, так и негетерологичные (т.е. эндогенные) промоторы.

В некоторых вариантах осуществления выделенные нуклеиновые кислоты, выступающие промотором, энхансером или другим элементом, могут быть введены в соответствующей позиции (выше, ниже или в интроне) негетерологичной формы полинуклеотида в соответствии с настоящим изобретением, чтобы увеличить или сократить экспрессию полинуклеотида в соответствии с настоящим изобретением. Например, эндогенные промоторы могут быть изменены in vivo или in vitro в результате мутации, делеции и/или замены.

Векторы и клетки-хозяева

Настоящее изобретение также относится к векторам, которые содержат выделенные молекулы нуклеиновой кислоты в соответствии с настоящим изобретением, клетки-хозяева, полученные путем генной инженерии при помощи рекомбинантных векторов, и к изготовлению по меньшей мере одного белкового каркаса с помощью рекомбинантных способов, хорошо известных из уровня техники. См., например, Sambrook, et al., supra; Ausubel, et al., supra, каждый источник полностью включен в текст настоящего документа путем ссылки.

Полинуклеотиды могут быть необязательно вставлены в вектор, содержащий селектируемый маркер, с целью размножения в клетке-хозяине. Как правило, плазмидный вектор вводят в осадок, например, осадок фосфата кальция, или в комплекс с заряженным липидом. Если в качестве вектора используют вирус, то он может быть упакован in vitro с помощью соответствующей пакующей линии клеток и затем введен в клетки-хозяева.

Вставку ДНК необходимо функционально связать с соответствующим промотором. Экспрессионные конструкции также содержат сайты для инициации транскрипции, терминации, а в транскрибированном участке - сайт связывания рибосомы для трансляции. Кодирующая часть зрелых транскриптов, экспрессируемая конструкциями, предпочтительно содержит трансляцию, инициированную в начале, и стоп-кодон (UAA, UGA или UAG), соответствующим образом расположенные в конце транслируемой мРНК, причем для экспрессии клеток млекопитающих или эукариотических клеток предпочтительны UAA и UAG.

Экспрессионные векторы предпочтительно, но необязательно, содержат по меньшей мере один селектируемый маркер. К подобным маркерам, в частности, относятся, например, метотрексат (MTX), дигидрофолатредуктаза (DHFR, патенты США №№ 4399216; 4634665; 4656134; 4956288; 5149636; 5179017, ампициллин, неомицин (G418), микофенолокислота или гены устойчивости к глутаминсинтетазе (GS, патенты США №№ 5122464; 5770359; 5827739) для эукариотических клеточных культур и гены устойчивости к тетрациклину или ампициллину для культивирования в E. coli и других бактериях или прокариотических средах (вышеуказанные патенты полностью включены в текст настоящего документа путем ссылки). Соответствующие питательные среды и условия для вышеуказанных клеток-хозяев известны из уровня техники. Подходящие для этих целей векторы известны специалистам в данной области техники. Введение векторной конструкции в клетку-хозяина может осуществляться путем кальций-фосфатной трансфекции, DEAE-декстран-опосредованной трансфекции, трансфекции, опосредованной катионными липидами, электропорации, трансдукции, инфекции или других известных способов. Такие способы известны из уровня техники, например, описаны у Sambrook, supra, главы 1-4 и 16-18; Ausubel, supra, главы 1, 9, 13, 15, 16.

По меньшей мере один белковый каркас в соответствии с настоящим изобретением может быть экспрессирован в измененном виде, например, в виде слитого белка, и может содержать не только сигналы секреции, но и дополнительные гетерологичные функциональные участки. Например, в N-конце белкового каркаса может быть добавлен участок дополнительных аминокислот, в частности, заряженных аминокислот, для повышения стабильности и устойчивости в клетке-хозяине в процессе очистки или последующих процедур обработки и хранения. Кроме того, в белковый каркас в соответствии с настоящим изобретением могут быть добавлены пептидные части для улучшения очистки. Такие участки могут быть удалены перед окончательной подготовкой белкового каркаса или по меньшей мере его одного фрагмента. Такие способы описаны в многочисленных стандартных лабораторных руководствах, например, Sambrook, supra, главы 17.29-17.42 и 18.1-18.74; Ausubel, supra, главы 16, 17 и 18.

Средним специалистам в данной области техники известны многочисленные экспрессионные системы, позволяющие экспрессировать нуклеиновую кислоту, кодирующую белок в соответствии с настоящим изобретением. Кроме того, в соответствии с настоящим изобретением, нуклеиновые кислоты могут быть экспрессированы в клетке-хозяине путем манипуляций в клетке-хозяине, содержащей эндогенную ДНК, кодирующую белковый каркас в соответствии с настоящим изобретением. Такие способы хорошо известны из уровня техники, например, описаны в патентах США №№ 5580734, 5641670, 5733746 и 5733761, каждый источник полностью включен в текст настоящего документа путем ссылки.

Примерами клеточных культур, подходящих для получения белковых каркасов, указанных частей или их вариантов, являются бактериальные, дрожжевые клетки и клетки млекопитающих, известные специалистам. Системы клеток млекопитающих часто используются в виде монослоев клеток, однако также могут быть использованы суспензии или биореакторы клеток млекопитающих. Из уровня техники известны несколько подходящих линий клеток-хозяев, способных экспрессировать интактные гликозилированные белки, в частности, линии клеток COS-1 (например, ATCC CRL 1650), COS-7 (например, ATCC CRL-1651), HEK293, BHK21 (например, ATCC CRL-10), CHO (например, ATCC CRL 1610) и BSC-1 (например, ATCC CRL-26), клетки Cos-7, клетки CHO, клетки hep G2, клетки P3X63Ag8.653, SP2/0-Ag14, 293, клетки HeLa и т.п., например, производства American Type Culture Collection, Манассас, Вирджиния (www.atcc.org). К предпочтительным клеткам-хозяевам относятся клетки лимфоидного происхождения, например, миеломные и лимфомные. Наиболее предпочтительны клетки-хозяева P3X63Ag8.653 (входящий номер ATCC CRL-1580) и клетки SP2/0-Ag14 (входящий номер ATCC CRL-1851). В наиболее предпочтительном варианте осуществления в качестве рекомбинантной клетки используется клетка P3X63Ab8.653 или SP2/0-Ag14.

Экспрессионные векторы для таких клеток могут содержать одну или более из следующих последовательностей контроля экспрессии, включающих помимо прочего: точку начала репликации; промотор (например, поздние или ранние промоторы SV40, промотор CMV (патенты США №№ 5168062; 5385839), промотор HSV tk, промотор pgk (фосфоглицераткиназа), промотор EF-1 альфа (патент США № 5266491), по меньшей мере один промотор человека; энхансер и/или сайты обработки информации, например, сайты связывания рибосомы, сайты сплайсинга РНК, сайты полиаденилирования (например, сайт добавления SV40 large T Ag poly A) и транскрипционные терминирующие последовательности. См., например, Ausubel et al., supra; Sambrook, et al., supra. Для получения нуклеиновых кислот или белков в соответствии с настоящим изобретением могут использоваться другие известные клетки, в том числе заказываемые по каталогу American Type Culture Collection Catalogue of Cell Lines and Hybridomas (www.atcc.org) либо у других известных или коммерческих поставщиков.

В случае использования эукариотических клеток-хозяев в вектор обычно добавляют последовательности полиаденилирования или транскрипционные терминирующие последовательности. Например, в качестве терминирующей последовательности может использоваться последовательность полиаденилирования из гена гормона роста крупного рогатого скота. Возможно также добавление последовательностей для точного сплайсинга транскрипта. Например, в качестве последовательности сплайсинга может быть использован интрон VP1 из SV40 (Sprague, et al., J. Virol. 45:773-781 (1983)). Кроме того, в вектор могут быть добавлены последовательности генов для контроля репликации в клетке-хозяине, известные из уровня техники.

Очистка белкового каркаса

Белковый каркас может быть восстановлен и очищен из рекомбинантных клеточных культур хорошо известными способами, включая, помимо прочего: очистку белком A, осаждение сульфатом аммония или спиртом, экстрагирование кислотой, анионо- или катионообменную хроматографию, хроматографию на фосфоцеллюлозе, гидрофобную хроматографию, аффинную хроматографию, хроматографию на гидроксилапатите и хроматографию на лектине. Для очистки можно также использовать высокоэффективную жидкостную хроматографию (ВЭЖХ). См., например, Colligan, Current Protocols in Immunology или Current Protocols in Protein Science, John Wiley & Sons, NY, NY, (1997-2001), например, главы 1, 4, 6, 8, 9, 10, каждый источник полностью включен в текст настоящего документа путем ссылки.

Белковые каркасы в соответствии с настоящим изобретением включают естественным путем очищенные продукты, продукты химического синтеза и продукты, получаемые при помощи рекомбинантных технологий из прокариотических или эукариотических клеток-хозяев, включая, например, клетки E. coli, дрожжи, высшие растения, насекомые и млекопитающие. В зависимости от хозяина, используемого в рекомбинантном способе, белковый каркас в соответствии с настоящим изобретением может быть гликозилированным или негликозилированным. Такие способы описаны в многочисленных стандартных лабораторных руководствах, например, Sambrook, supra, разделы 17.37-17.42; Ausubel, supra, главы 10, 12, 13, 16, 18 и 20, Colligan, Protein Science, supra, главы 12-14, каждый источник полностью включен в текст настоящего документа путем ссылки.

Коды аминокислот

Аминокислоты, составляющие белковые каркасы в соответствии с настоящим изобретением, часто указываются в виде аббревиатур. Наименования аминокислот могут указываться с помощью однобуквенного кода аминокислоты, трехбуквенного кода, названия или кодона из трех нуклеотидов, что хорошо известно из уровня техники (см. Alberts, B., et al., Molecular Biology of The Cell, Third Ed., Garland Publishing, Inc., New York, 1994). Белковый каркас в соответствии с настоящим изобретением может содержать одну или несколько замен, делеций или добавлений аминокислот либо в результате естественных мутаций, либо в результате человеческих манипуляций, как указано в настоящем документе. Аминокислоты в белковом каркасе в соответствии с настоящим изобретением, играющие важную роль в его функционировании, могут быть идентифицированы с помощью известных из уровня техники способов, например, сайт-направленного мутагенеза или сканирующего аланином мутагенеза (например, Ausubel, supra, главы 8, 15; Cunningham and Wells, Science 244:1081-1085 (1989)). Последняя процедура предполагает добавление одной мутации аланина в каждом остатке в молекуле. Полученные в результате мутировавшие молекулы затем тестируют на предмет биологической активности, в частности, по меньшей мере одной нейтрализующей активности. Особенно важные для связывания белкового каркаса сайты могут быть также идентифицированы путем структурного анализа, например, кристаллизации, ядерно-магнитного резонанса или фотоаффинного мечения (Smith, et al., J. Mol. Biol. 224:899-904 (1992) и de Vos, et al., Science 255:306-312 (1992)).

Специалистам будет понятно, что настоящее изобретение включает по меньшей мере один биологически активный белковый каркас, соответствующий принципам настоящего изобретения. Биологически активные белковые каркасы имеют специфическую активность по меньшей мере 20%, 30% или 40%, предпочтительно 50%, 60% или 70% и наиболее предпочтительно 80%, 90% либо 95-1000% или более от активности естественного (несинтетического), эндогенного или родственного и известного белкового каркаса. Способы качественного и количественного анализа ферментативной активности и субстратной специфичности хорошо известны специалистам в данной области техники.

Изобретение также относится к белковым каркасам и фрагментам, как описано в настоящем документе, которые модифицируются путем ковалентного присоединения органической части. Такая модификация позволяет получить фрагмент белкового каркаса с улучшенными фармакокинетическими свойствами (например, увеличенным периодом полувыведения в сыворотке in vivo). В качестве органической части может быть использована линейная или разветвленная гидрофильная полимерная группа, группа жирных кислот или группа эфиров жирных кислот. В некоторых вариантах осуществления гидрофильная полимерная группа может иметь молекулярную массу приблизительно 800-120000 Да и представлять собой полиалкангликоль (например, полиэтиленгликоль (PEG), полипропиленгликоль (PPG)), углеводный полимер, аминокислотный полимер или поливинилпиролидон, а группа жирных кислот или группа эфиров жирных кислот может содержать от приблизительно восьми до приблизительно сорока атомов углерода.

Модифицированные белковые каркасы и фрагменты в соответствии с настоящим изобретением могут содержать одну и более органических частей, ковалентно связанных напрямую или опосредованно с антителом. Каждая органическая часть, связанная с белковым каркасом или фрагментом в соответствии с настоящим изобретением, может независимо от остальных являться гидрофильной полимерной группой, группой жирных кислот или группой эфиров жирных кислот. В настоящем документе термин «жирная кислота» включает монокарбоновые кислоты и дикарбоновые кислоты. Используемый в настоящем документе термин «гидрофильная полимерная группа» означает органический полимер, который лучше растворяется в воде, чем в октане. Например, полилизин лучше растворяется в воде, чем в октане. Таким образом, в объем изобретения включен белковый каркас, модифицированный ковалентным присоединением полилизина. К линейным или разветвленным гидрофильным полимерам, пригодным для модификации белкового каркаса в соответствии с настоящим изобретением, относятся, например, полиалкангликоли (например, PEG, монометокси-полиэтиленгликоль (mPEG), PPG и т.п.), углеводы (например, декстран, целлюлоза, олигосахариды, полисахариды и т.п.), полимеры гидрофильных аминокислот (например, полилизин, полиаргинин, полиаспартат и т.п.), полиалкана оксиды (например, полиэтиленоксид, полипропиленоксид и т.п.) и поливинилпиролидон. Гидрофильный полимер, модифицирующий белковый каркас в соответствии с настоящим изобретением, предпочтительно имеет молекулярную массу от приблизительно 800 до приблизительно 150000 Да как отдельная молекулярная субстанция. Например, могут быть использованы PEG5000 и PEG20000, где индекс означает средний молекулярный вес полимера в Да. Гидрофильная полимерная группа может быть заменена группами алкилов, жирных кислот или эфиров жирных кислот в количестве от одной до приблизительно шести. Гидрофильные полимеры, заменяемые группами жирных кислот или эфиров жирных кислот, могут быть приготовлены с помощью подходящих способов. Например, полимер, содержащий группу аминов, может связываться с карбоксилатом жирной кислоты или эфира жирной кислоты, а активированный карбоксилат (например, активированный с помощью N, N-карбонил-диимидазола) на жирной кислоте или эфире жирной кислоты может связываться с гидроксильной группой на полимере.

Жирные кислоты и эфиры жирных кислот, пригодные для модификации белковых каркасов в соответствии с настоящим изобретением, могут быть насыщенными или могут содержать одну и более связей ненасыщенности. Жирные кислоты, пригодные для модификации белковых каркасов в соответствии с настоящим изобретением, включают, например, н-додеканоат (C12, лаурат), н-тетрадеканоат (C14, миристат), н-октадеканоат (C18, стеарат), н-эйкозаноат (C20, арахидат), н-докозаноат (C22, бегенат), н-триаконтаноат (C30), н-тетраконтаноат (C40), цис-Δ9-октадеканоат (C18, олеат), все цис-Δ5,8,11,14-эйкозатетраэноат (С20, арахидонат), октандикарбоновую кислоту, тетрадекандикарбоновую кислоту, октадекандикарбоновую кислоту, докозандикарбоновую кислоту и им подобные. К пригодным эфирам жирных кислот относятся моноэфиры дикарбоновых кислот, содержащие линейную или разветвленную низшую алкильную группу. Низшая алкильная группа может содержать от одного до приблизительно двенадцати, предпочтительно от одного до приблизительно шести атомов углерода.

Модифицированные белковые каркасы и фрагменты могут быть получены подходящим способом, например, путем реакции с одним или более модифицирующими веществами. Используемый в настоящем документе термин «модифицирующее вещество» означает подходящий органический полимер (например, гидрофильный полимер, жирную кислоту, эфир жирной кислоты), который включает в себя активирующую группу. Под «активирующей группой» понимаются химический элемент или функциональная группа, которые при соответствующих условиях могут вступать в реакцию со второй химической группой, тем самым образуя ковалентную связь между модифицирующим веществом и второй химической группой. Например, к амин-реактивным активирующим группам относятся электрофильные группы, такие как тозилат, мезилат, галоген (хлор, бром, фтор, йод), N-гидроксисукцинимидила (NHS) эфиры и т.п. К активирующим группам, способным реагировать с тиолами, относятся, например, малеимид, йодацетил, акрилолил, пиридила дисульфиды, 5-тиол-2-нитробензойная кислота-тиол (TNB-тиол) и т.п. Функциональная группа альдегида может быть связана с амин- или гидразид-содержащими молекулами, а группа азида может реагировать с трехвалентной фосфорной группой с образованием фосфорамидатных или фосфоримидных связей. Методы введения активирующих групп в молекулы известны из уровня техники (см., например, Hermanson, G. T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996)). Активирующая группа может быть связана непосредственно с органической группой (например, гидрофильным полимером, жирной кислотой, эфиром жирной кислоты) или через линкер, например, двухвалентную группу C1-C12, в которой один или несколько атомов углерода могут быть заменены гетероатомом, таким как кислород, азот или сера. К пригодным линкерам относятся, например, тетраэтиленгликоль, -(CH2)3-, -NH-(CH2)6-NH-, -(CH2)2-NH- и -CH2-O-CH2-CH2-O-CH2-CH2-O-CH-NH-. Модифицирующие вещества, содержащие линкер, могут быть получены, например, путем реакции моно-Boc-алкилдиамина (например, моно-Boc-этилендиамина, моно-Boc-диаминогексана) с жирной кислотой в присутствии 1-этил-3-(3-диметиламинопропил)карбодиимида (EDC) с образованием амидной связи между свободным амином и карбоксилатом жирной кислоты. Защитная Boc-группа может быть удалена из продукта обработкой трифторуксусной кислотой (ТФК), что обеспечивает доступность первичного амина, способного присоединяться к другому карбоксилату, как уже описано, либо способного взаимодействовать с малеиновым ангидридом с циклизацией результирующего продукта с образованием активированного малеимидо-производного жирной кислоты (см., например, публикацию Thompson, et al., WO 92/16221, полное содержание которой включено в настоящую заявку посредством ссылки).

Модифицированные белковые каркасы в соответствии с настоящим изобретением могут быть получены путем реакции белкового каркаса или фрагмента с модифицирующим веществом. К примеру, органические части могут быть связаны с белковым каркасом не сайт-специфичным способом с использованием амин-реактивного модифицирующего вещества, например, NHS-эфира PEG. Модифицированные белковые каркасы и фрагменты, включающие органический остаток, присоединенный к специфическим участкам белкового каркаса в соответствии с настоящим изобретением, могут быть получены подходящим способом, таким как обратный протеолиз (Fisch et al., Bioconjugate Chem., 3:147-153 (1992); Werlen et al., Bioconjugate Chem., 5:411-417 (1994); Kumaran et al., Protein Sci. 6(10):2233-2241 (1997); Itoh et al., Bioorg. Chem., 24(1): 59-68 (1996); Capellas et al., Biotechnol. Bioeng., 56(4):456-463 (1997)), и способов, описанных в Hermanson, G. T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996).

Композиции белкового каркаса, содержащие дополнительные терапевтически активные вещества

Композиции белкового каркаса в соответствии с настоящим изобретением могут необязательно дополнительно содержать эффективное количество по меньшей мере одного соединения или белка (малую или большую молекулу), выбранного из по меньшей мере одного из противоинфекционного лекарственного средства (ЛС), сердечно-сосудистого лекарственного средства, лекарственного средства для центральной нервной системы (ЦНС), лекарственного средства для вегетативной нервной системы (ВНС), лекарственного средства для респираторного тракта, лекарственного средства для желудочно-кишечного тракта (ЖКТ), гормонального лекарственного средства, лекарственного средства для водно-солевого баланса, гематологического лекарственного средства, противоопухолевого лекарственного средства, иммуномодулирующего лекарственного средства, лекарственного средства для органов зрения, слуха или носа, лекарственного средства местного действия, питательный препарат и т.п. Такие лекарственные средства хорошо известны из уровня техники, включая формулы, показания, дозировку и способ введения для каждого из представленных в настоящем документе (см., например, Nursing 2001 Handbook of Drugs, 21st edition, Springhouse Corp., Springhouse, PA, 2001; Health Professional's Drug Guide 2001, ed., Shannon, Wilson, Stang, Prentice-Hall, Inc, Upper Saddle River, NJ; Pharmcotherapy Handbook, Wells et al., ed., Appleton & Lange, Stamford, CT, каждый источник полностью включен в текст настоящего документа путем ссылки).

Противоинфекционное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из амебоцидных лекарственных средств или по меньшей мере одним из противопротозойных лекарственных средств, противоглистных лекарственных средств, фунгицидов, противомалярийных лекарственных средств, противотуберкулезных лекарственных средств или по меньшей мере одним из противолепрозных лекарственных средств, аминогликозидов, пенициллинов, цефалоспоринов, тетрациклинов, сульфонамидов, фторхинолонов, противовирусных, макролидных и прочих противоинфекционных лекарственных средств. Сердечно-сосудистое лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из инотропных, антиаритмических, противоангинных, гипотензивных средств, антилипемических и прочих сердечно-сосудистых лекарственных средств. Лекарственное средство для ЦНС может быть по меньшей мере одним из ненаркотических анальгетиков или по меньшей мере одним лекарственным средством из группы, состоящей из жаропонижающих, нестероидных противовоспалительных, наркотических или опиоидных анальгетиков, успокоительных/снотворных лекарственных средств, антиконвульсантов, антидепрессантов, противотревожных, нейролептических лекарственных средств, стимуляторов центральной нервной системы, антипаркинсонических и прочих лекарственных средств для ЦНС. Лекарственное средство для ВНС может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из холинергиков (парасимпатомиметиков), антихолинергиков, адренергетиков (симпатомиметиков), адреноблокаторов (симпатолитиков), миорелаксантов скелетных мышц и нервно-мышечных блокаторов. Лекарственное средство для респираторного тракта может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из антигистаминных лекарственных средств, бронхолитиков, отхаркивающих средств или по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из противокашлевых и прочих лекарственных средств для дыхательных путей. Лекарственное средство для ЖКТ может быть по меньшей мере одним из антацидов, по меньшей мере одним из адсорбентов, по меньшей мере одним из ветрогонных, пищеварительных ферментов или по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из лекарственных средств против желчнокаменной болезни, антидиарейных, слабительных, противорвотных и противоязвенных лекарственных средств. Гормональное лекарственное средство может быть по меньшей мере одним из кортикостероидов, андрогенов, по меньшей мере одним из анаболических стероидов, эстрогенов, по меньшей мере одним прогестином, гонадотропином, антидиабетическим лекарственным средством или по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из глюкагона, гормона щитовидной железы, антагониста гормона щитовидной железы, гормона гипофиза и подобного гормону паращитовидных желез лекарственных средств. Лекарственное средство для водно-солевого баланса может быть по меньшей мере одним из мочегонных, электролитов, по меньшей мере одним из замещающих растворов, подкислителей или по меньшей мере одним из подщелачивающих средств. Гематологическое лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из лекарственных средств, повышающих количество гемоглобина в крови, антикоагулянтов, производных крови и тромболитических ферментов. Противоопухолевое лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из алкилирующих лекарственных средств, антиметаболитов, противоопухолевых антибиотиков, противоопухолевых лекарственных средств, изменяющих гормональный баланс, а также прочих противоопухолевых лекарственных средств. Иммуномодулирующее лекарственное средство может быть по меньшей мере одним из иммунодепрессантов, вакцин, по меньшей мере одним из анатоксинов, антитоксинов или по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из противоядия, иммунной сыворотки и модификатора биологического отклика. Лекарственное средство для органов зрения, слуха или обоняния может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из офтальмологических противоинфекционных, офтальмологических противовоспалительных, миотических, мидриатических лекарственных средств, офтальмологических вазоконстрикторов, прочих лекарственных средств для органов зрения, слуха или обоняния. Лекарственное средство местного действия может быть по меньшей мере одним из противоинфекционных лекарственных средств местного действия, противочесоточных или по меньшей мере одним из педикулицидов либо кортикостероидов местного действия. Питательный препарат может быть по меньшей мере одним из препаратом, выбранным из группы, состоящей из витаминов, минералов или питательных веществ. См., например, Nursing 2001 Drug Handbook, supra.

По меньшей мере одно амебоцидное или противопротозойное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из атовакуона, хлорохина гидрохлорида, хлорохина фосфата, метронидазола, метронидазола гидрохлорида и пентамидина изетионата. По меньшей мере одно противоглистное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из мебендазола, пирантела памоата и тиабендазола. По меньшей мере один фунгицид может представлять собой по меньшей мере одно вещество, выбранное из группы, состоящей из амфотерицина B, холестерил-сульфатного комплекса амфотерицина B, липидного комплекса амфотерицина B, липосомального амфотерицина B, флуконазола, флуцитозина, гризеофульвина микрокристаллической формы, гризеофульвина ультрамикрокристаллической формы, итраконазола, кетоконазола, нистатина и тербинафина гидрохлорида. По меньшей мере одно противомалярийное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из хлорохина гидрохлорида, хлорохина фосфата, доксициклина, гидроксихлорохина сульфата, мефлохина гидрохлорида, примахина фосфата, пириметамина и пириметамина с сульфадоксином. По меньшей мере одно противотуберкулезное или противолепрозное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из клофазимина, циклосерина, дапсона, этамбутола гидрохлорида, изониазида, пиразинамида, рифабутина, рифампина, рифапентина и стрептомицина сульфата. По меньшей мере один аминогликозид может быть по меньшей мере одним веществом, выбранным из группы, состоящей из амикацина сульфата, гентамицина сульфата, неомицина сульфата, стрептомицина сульфата и тобрамицина сульфата. По меньшей мере один пенициллин может быть по меньшей мере одним веществом, выбранным из группы, состоящей из амоксициллина/клавуланата калия, амоксициллина тригидрата, ампициллина, ампициллина натрия, ампициллина тригидрата, ампициллина натрия/сульбактама натрия, клоксациллина натрия, диклоксациллина натрия, мезлоциллина натрия, нафциллина натрия, оксациллина натрия, пенициллина G бензатина, пенициллина G калия, пенициллина G прокаина, пенициллина G натрия, пенициллина V калия, пиперациллина натрия, пиперациллина натрия/тазобактама натрия, тикарциллина динатрия и тикарциллина динатрия/клавуланата калия. По меньшей мере один цефалоспорин может быть по меньшей мере одним веществом, выбранным из группы, состоящей из цефаклора, цефадроксила, цефазолина натрия, цефдинира, цефепима гидрохлорида, цефиксима, цефметазола натрия, цефоницида натрия, цефоперазона натрия, цефотаксима натрия, цефотетана динатрия, цефокситина натрия, цефподоксима проксетила, цефпрозила, цефтазидима, цефтибутена, цефтизоксима натрия, цефтриаксона натрия, цефуроксима аксетила, цефуроксима натрия, цефалексина гидрохлорида, цефалексина моногидрата, цефрадина и лоракарбефа. По меньшей мере один тетрациклин может быть по меньшей мере одним веществом, выбранным из группы, состоящей из демеклоциклина гидрохлорида, доксициклина кальция, доксициклина гиклата, доксициклина гидрохлорида, доксициклина моногидрата, миноциклина гидрохлорида и тетрациклина гидрохлорида. По меньшей мере один сульфонамид может быть по меньшей мере одним веществом, выбранным из группы, состоящей из ко-тримоксазола, сульфадиазина, сульфаметоксазола, сульфизоксазола и сульфизоксазола ацетила. По меньшей мере один фторхинолон может быть по меньшей мере одним веществом, выбранным из группы, состоящей из алатрофлоксацина мезилата, ципрофлоксацина, эноксацина, левофлоксацина, ломефлоксацина гидрохлорида, налидиксовой кислоты, норфлоксацина, офлоксацина, спарфлоксацина и тровафлоксацина мезилата. По меньшей мере один фторхинолон может быть по меньшей мере одним веществом, выбранным из группы, состоящей из алатрофлоксацина мезилата, ципрофлоксацина, эноксацина, левофлоксацина, ломефлоксацина гидрохлорида, налидиксовой кислоты, норфлоксацина, офлоксацина, спарфлоксацина и тровафлоксацина мезилата. По меньшей мере одно противовирусное лекарственное средство может быть по меньшей мере одним лекарственным средством, выбранным из группы, состоящей из абакавира сульфата, ацикловира натрия, амантадина гидрохлорида, ампренавира, цидофовира, делавирдина мезилата, диданозина, эфавиренца, фамцикловира, фомивирзена натрия, фоскарнета натрия, ганцикловира, индинавира сульфата, ламивудина, ламивудина/зидовудина, нелфинавира мезилата, невирапина, осельтамивира фосфата, рибавирина, римантадина гидрохлорида, ритонавира, саквинавира, саквинавира мезилата, ставудина, валацикловира гидрохлорида, залцитабина, занамивира и зидовудина. По меньшей мере одно макролидное противоинфекционное лекарственное средство может быть по меньшей мере одним из следующего ряда: азитромицин, кларитромицин, диритромицин, эритромицин в виде основания, эритромицина эстолат, эритромицина этилсукцинат, эритромицина лактобионат и эритромицина стеарат. По меньшей мере одно прочее противоинфекционное лекарственное средство может быть по меньшей мере одним из следующего ряда: азтреонам, бацитрацин, хлорамфеникола натрия сукцинат, клиндамицина гидрохлорид, клиндамицина пальмитата гидрохлорид, клиндамицина фосфат, имипенем и циластатин натрия, меропенем, нитрофурантоин макрокристаллической формы, нитрофурантоин микрокристаллической формы, квинупристин/дальфопристин, спектиномицина гидрохлорид, триметоприм и ванкомицина гидрохлорид (см., например, стр. 24-214 в Nursing 2001 Drug Handbook).

По меньшей мере одно инотропное лекарственное средство может быть по меньшей мере одним из следующего ряда: амринона лактат, дигоксин и милринона лактат. По меньшей мере одно антиаритмическое лекарственное средство может быть по меньшей мере одним из следующего ряда: аденозин, амиодарона гидрохлорид, атропина сульфат, бретилия тозилат, дилтиазема гидрохлорид, дизопирамид, дизопирамида фосфат, эсмолола гидрохлорид, флекаинида ацетат, ибутилида фумарат, лидокаина гидрохлорид, мексилетина гидрохлорид, морицизина гидрохлорид, фенитоин, фенитоин натрия, прокаинамида гидрохлорид, пропафенона гидрохлорид, пропранолола гидрохлорид, хинидина бисульфат, хинидина глюконат, хинидина полигалактуронат, хинидина сульфат, соталол, токаинида гидрохлорид и верапамила гидрохлорид. По меньшей мере одно противоангинальное лекарственное средство может быть по меньшей мере одним из следующего ряда: амлодипидина бесилат, амилнитрит, бепридила гидрохлорид, дилтиазема гидрохлорид, изосорбида динитрат, изосорбида мононитрат, надолол, никардипина гидрохлорид, нифедипин, нитроглицерин, пропранолола гидрохлорид, верапамил и верапамила гидрохлорид. По меньшей мере одно гипотензивное лекарственное средство может быть по меньшей мере одним из следующего ряда: ацебутолола гидрохлорид, амлодипина бесилат, атенолол, беназеприла гидрохлорид, бетаксолола гидрохлорид, бисопролола фумарат, кандесартана цилексетил, каптоприл, картеолола гидрохлорид, карведилол, клонидин, клонидина гидрохлорид, диазоксид, дилтиазема гидрохлорид, доксазозина мезилат, эналаприлат, эналаприла малеат, эпросартана мезилат, фелодипин, фенолдопама мезилат, фозиноприл натрия, гуанабенза ацетат, гуанадрела сульфат, гуанфацина гидрохлорид, гидралазина гидрохлорид, ирбесартан, исрадипин, лабеталола гидрохлорид, лизиноприл, лозартан калия, метилдопа, метилдопата гидрохлорид, метопролола сукцинат, метопролола тартрат, миноксидил, моэксиприла гидрохлорид, надолол, никардипина гидрохлорид, нифедипин, нисолдипин, нитропруссид натрия, пенбутолола сульфат, периндоприла эрбумин, фентоламина мезилат, пиндолол, празозина гидрохлорид, пропранолола гидрохлорид, квинаприла гидрохлорид, рамиприл, телмисартан, теразозина гидрохлорид, тимолола малеат, трандолаприл, валсартан и верапамила гидрохлорид. По меньшей мере одно антилипемическое лекарственное средство может быть по меньшей мере одним из следующего ряда: аторвастатин кальция, церивастатин натрия, холестирамин, колестипола гидрохлорид, фенофибрат (микронизированный), флувастатин натрия, гемфиброзил, ловастатин, ниацин, правастатин натрия и симвастатин. По меньшей мере одно прочее сердечно-сосудистое лекарственное средство может быть по меньшей мере одним из следующего ряда: абциксимаб, алпростадил, арбутамина гидрохлорид, цилостазол, клопидогреля бисульфат, дипиридамол, эптифибатид, мидодрина гидрохлорид, пентоксифиллин, тиклопидина гидрохлорид и тирофибана гидрохлорид (см., например, стр. 215-336 в Nursing 2001 Drug Handbook).

По меньшей мере одно ненаркотическое анальгетическое или жаропонижающее лекарственное средство может быть по меньшей мере одним из следующего ряда: ацетаминофен, аспирин, холина магния трисалицилат, дифлунизал и магния салицилат. По меньшей мере одно нестероидное противовоспалительное лекарственное средство может быть по меньшей мере одним из следующего ряда: целекоксиб, диклофенак калия, диклофенак натрия, этодолак, фенопрофен кальция, флурбипрофен, ибупрофен, индометацин, индометацина натрия тригидрат, кетопрофен, кеторолака трометамин, набуметон, напроксен, напроксен натрия, оксапрозин, пироксикам, рофекоксиб и сулиндак. По меньшей мере один наркотический или опиоидный анальгетик может быть по меньшей мере одним из следующего ряда: алфентанила гидрохлорид, бупренорфина гидрохлорид, буторфанола тартрат, кодеина фосфат, кодеина сульфат, фентанила цитрат, фентанил в виде трансдермальный системы, фентанил для введения через слизистую оболочку, гидроморфона гидрохлорид, меперидина гидрохлорид, метадона гидрохлорид, морфина гидрохлорид, морфина сульфат, морфина тартрат, нальбуфина гидрохлорид, оксикодона гидрохлорид, оксикодона пектинат, оксиморфона гидрохлорид, пентазоцина гидрохлорид, пентазоцина гидрохлорид и налоксона гидрохлорид, пентазоцина лактат, пропоксифена гидрохлорид, пропоксифена напсилат, ремифентанила гидрохлорид, суфентанила цитрат и трамадола гидрохлорид. По меньшей мере одно успокоительные/снотворное лекарственное средство может быть по меньшей мере одним из следующего ряда: хлоралгидрат, эстазолам, флуразепама гидрохлорид, пентобарбитал, пентобарбитал натрия, фенобарбитал натрия, секобарбитал натрия, темазепам, триазолам, залеплон и золпидема тартрат. По меньшей мере один антиконвульсант может быть по меньшей мере одним из следующего ряда: ацетазоламид натрия, карбамазепин, клоназепам, клоразепат дикалия, диазепам, дивалпроекс натрия, этосуксимид, фосфенитоин натрия, габапентин, ламотригин, магния сульфат, фенобарбитал, фенобарбитал натрия, фенитоин, фенитоин натрия, фенитоин натрия (пролонгированного действия), примидон, тиагабина гидрохлорид, топирамат, вальпроат натрия и вальпроевая кислота. По меньшей мере один антидепрессант может быть по меньшей мере одним из следующего ряда: амитриптилина гидрохлорид, амитриптилина памоат, амоксапин, бупропиона гидрохлорид, циталопрама гидробромид, кломипрамина гидрохлорид, дезипрамина гидрохлорид, доксепина гидрохлорид, флуоксетина гидрохлорид, имипрамина гидрохлорид, имипрамина памоат, миртазапин, нефазодона гидрохлорид, нортриптилина гидрохлорид, пароксетина гидрохлорид, фенелзина сульфат, сертралина гидрохлорид, транилципромина сульфат, тримипрамина малеат и венлафаксина гидрохлорид. По меньшей мере одно противотревожное лекарственное средство может быть по меньшей мере одним из следующего ряда: алпразолам, буспирона гидрохлорид, хлордиазепоксид, хлордиазепоксида гидрохлорид, клоразепат дикалия, диазепам, доксепина гидрохлорид, гидроксизина эмбонат, гидроксизина гидрохлорид, гидроксизина памоат, лоразепам, мепробамат, мидазолама гидрохлорид и оксазепам. По меньшей мере одно нейролептическое лекарственное средство может быть по меньшей мере быть одним из следующего ряда: хлорпромазина гидрохлорид, клозапин, флуфеназина деканоат, флуфеназина энантат, флуфеназина гидрохлорид, галоперидол, галоперидола деканоат, галоперидола лактат, локсапина гидрохлорид, локсапина сукцинат, месоридазина бесилат, молиндона гидрохлорид, оланзапин, перфеназин, пимозид, прохлорперазин, кветиапина фумарат, рисперидон, тиоридазина гидрохлорид, тиотиксен, тиотиксена гидрохлорид и трифлуоперазина гидрохлорид. По меньшей мере один стимулятор центральной нервной системы может быть по меньшей мере одним из следующего ряда: амфетамина сульфат, кофеин, декстроамфетамина сульфат, доксапрама гидрохлорид, метамфетамина гидрохлорид, метилфенидата гидрохлорид, модафинил, пемолин и фентермина гидрохлорид. По меньшей мере одно антипаркинсоническое лекарственное средство может быть по меньшей мере одним из следующего ряда: амантадина гидрохлорид, бензотропина мезилат, биперидена гидрохлорид, биперидена лактат, бромокриптина мезилат, карбидопа/леводопа, энтакапон, леводопа, перголида мезилат, прамипексола дигидрохлорид, ропинирола гидрохлорид, селегилина гидрохлорид, толкапон и тригексифенидила гидрохлорид. По меньшей мере одно прочее лекарственное средство для центральной нервной системы может быть по меньшей мере одним из следующего ряда: бупропиона гидрохлорид, донепезила гидрохлорид, дроперидол, флувоксамина малеат, лития карбонат, лития цитрат, наратриптана гидрохлорид, никотина полакрилекс, никотин в виде трансдермальной системы, пропофол, ризатриптана бензоат, сибутрамина гидрохлорида моногидрат, суматриптана сукцинат, такрина гидрохлорид и золмитриптан (см., например, стр. 337-530 в Nursing 2001 Drug Handbook).

По меньшей мере один холинергик (например, парасимпатомиметик) может быть по меньшей мере одним из следующего ряда: бетанехола хлорид, эдрофониума хлорид, неостигмина бромид, неостигмина метилсульфат, физостигмина салицилат и пиридостигмина бромид. По меньшей мере один антихолинергик может быть по меньшей мере одним из следующего ряда: атропина сульфат, дицикломина гидрохлорид, гликопирролат, гиосциамин, гиосциамина сульфат, пропантелина бромид, скополамин, скополамина бутилбромид и скополамина гидробромид. По меньшей мере один адренергетик (симпатомиметик) может быть по меньшей мере одним из следующего ряда: добутамина гидрохлорид, допамина гидрохлорид, метараминола битартрат, норэпинефрина битартрат, фенилэфрина гидрохлорид, псевдоэфедрина гидрохлорид и псевдоэфедрина сульфат. По меньшей мере один адреноблокатор (симпатолитик) может быть по меньшей мере одним из следующего ряда: дигидроэрготамина мезилат, эрготамина тартрат, метисергида малеат и пропранолола гидрохлорид. По меньшей мере один миорелаксант скелетных мышц может быть по меньшей мере одним из следующего ряда: баклофен, карисопродол, хлорзоксазон, циклобензаприна гидрохлорид, дантролен натрия, метокарбамол и тизанидина гидрохлорид. По меньшей мере один нервно-мышечный блокатор может быть по меньшей мере одним из следующего ряда: атракурия бесилат, цизатракурия бесилат, доксакурия хлорид, мивакурия хлорид, панкурония бромид, пипекурония бромид, рапакурония бромид, рокурония бромид, сукцинилхолина хлорид, тубокурарина хлорид и векурония бромид (см., например, стр. 531-584 в Nursing 2001 Drug Handbook).

По меньшей мере одно антигистаминное лекарственное средство может быть по меньшей мере одним из следующего ряда: бромфенирамина малеат, цетиризина гидрохлорид, хлорфенирамина малеат, клемастина фумарат, ципрогептадина гидрохлорид, дифенгидрамина гидрохлорид, фексофенадина гидрохлорид, лоратадин, прометазина гидрохлорид, прометазина теоклат и трипролидина гидрохлорид. По меньшей мере один бронхолитик может быть по меньшей мере одним из следующего ряда: альбутерол, альбутерола сульфат, аминофиллин, атропина сульфат, эфедрина сульфат, эпинефрин, эпинефрина битартрат, эпинефрина гидрохлорид, ипратропия бромид, изопротеренол, изопротеренола гидрохлорид, изопротеренола сульфат, левалбутерола гидрохлорид, метапротеренола сульфат, окстрифиллин, пирбутерола ацетат, сальметерола ксинафоат, тербуталина сульфат и теофиллин. По меньшей мере одно отхаркивающее или противокашлевое лекарственное средство может быть по меньшей мере одним из следующего ряда: бензонатат, кодеина фосфат, кодеина сульфат, декстраметорфана гидробромид, дифенгидрамина гидрохлорид, гуафенизин и гидроморфона гидрохлорид. По меньшей мере одно прочее лекарственное средство для респираторного тракта может быть по меньшей мере одним из следующего ряда: ацетилцистеин, беклометазона дипропионат, берактант, будесонид, калфактант, кромолин натрия, дорназа альфа, эпопростенол натрия, флунизолид, флутиказона пропионат, монтелукаст натрия, недокромил натрия, паливизумаб, триамцинолона ацетонид, зафирлукаст и зилеутон (см., например, стр. 585-642 в Nursing 2001 Drug Handbook).

По меньшей мере один антацид, адсорбент или одно ветрогонное лекарственное средство может быть по меньшей мере одним из следующего ряда: алюминия карбонат, алюминия гидроксид, кальция карбонат, магалдрат, магния гидроксид, магния оксид, симетикон и натрия бикарбонат. По меньшей мере один пищеварительный фермент или одно лекарственное средство против желчнокаменной болезни может быть по меньшей мере одним из следующего ряда: панкреатин, панкрелипаза и урсодиол. По меньшей мере одно антидиарейное лекарственное средство может быть по меньшей мере одним из следующего ряда: аттапульгит, висмута субсалицилат, кальция поликарбофил, дифеноксилата гидрохлорид и атропина сульфат, лоперамид, октреотида ацетат, настойка опия и настойка опия (с камфорой). По меньшей мере одно слабительное лекарственное средство может быть по меньшей мере одним из следующего ряда: бисакодил, кальция поликарбофил, каскара саграда, ароматический жидкий экстракт каскара саграда, жидкий экстракт каскара саграда, касторовое масло, докузат кальция, докузат натрия, глицерин, лактулоза, магния цитрат, магния гидроксид, магния сульфат, метилцеллюлоза, минеральное масло, полиэтиленгликоль или раствор электролита, подорожник, сенна и натрия фосфаты. По меньшей мере одно противорвотное лекарственное средство может быть по меньшей мере одним из следующего ряда: хлорпромазина гидрохлорид, дименгидринат, доласетрона мезилат, дронабинол, гранисетрона гидрохлорид, меклизина гидрохлорид, метоклопрамида гидрохлорид, ондансетрона гидрохлорид, перфеназин, прохлорперазин, прохлорперазина эдизилат, прохлорперазина малеат, прометазина гидрохлорид, скополамин, тиэтилперазина малеат и триметобензамида гидрохлорид. По меньшей мере одно противоязвенное лекарственное средство может быть по меньшей мере одним из следующего ряда: циметидин, циметидина гидрохлорид, фамотидин, лансопразол, мизопростол, низатидин, омепразол, рабепрозол натрия, ранитидина висмута цитрат, ранитидина гидрохлорид и сукральфат (см., например, стр. 643-695 в Nursing 2001 Drug Handbook).

По меньшей мере один кортикостероид может быть по меньшей мере одним из следующего ряда: бетаметазон, бетаметазона ацетат или бетаметазона натрия фосфат, бетаметазона натрия фосфат, кортизона ацетат, дексаметазон, дексаметазона ацетат, дексаметазона натрия фосфат, флудрокортизона ацетат, гидрокортизон, гидрокортизона ацетат, гидрокортизона ципионат, гидрокортизона натрия фосфат, гидрокортизона натрия сукцинат, метилпреднизолон, метилпреднизолона ацетат, метилпреднизолона натрия сукцинат, преднизолон, преднизолона ацетат, преднизолона натрия фосфат, преднизолона тебутат, преднизон, триамцинолон, триамцинолона ацетонид и триамцинолона диацетат. По меньшей мере один андроген или анаболический стероид может быть по меньшей мере одним из следующего ряда: даназол, флюоксиместерон, метилтестостерон, нандролона деканоат, нандролона фенпропионат, тестостерон, тестостерона ципионат, тестостерона энантат, тестостерона пропионат и тестостерон в виде трансдермальной системы. По меньшей мере один эстроген или прогестин может быть по меньшей мере одним из следующего ряда: этерифицированные эстрогены, эстрадиол, эстрадиола ципионат, эстрадиол/норэтиндронацетат в виде трансдермальной системы, эстрадиола валерат, эстрогены (конъюгированные), эстропипат, этинилэстрадиол, этинилэстрадиол и дезогестрел, этинилэстрадиол и этинодиола диацетат, этинилэстрадиол и дезогестрел, этинилэстрадиола и этинодиола диацетат, этинилэстрадиол и левоноргестрел, этинилэстрадиол и норэтиндрон, этинилэстрадиол и норэтиндрона ацетат, этинилэстрадиол и норгестимат, этинилэстрадиол и норгестрел, этинилэстрадиол и норэтиндрон и ацетат и железа фумарат, левоноргестрел, медроксипрогестерона ацетат, местранол и норэтиндрон, норэтиндрон, норэтиндрона ацетат, норгестрел и прогестерон. По меньшей мере один гонадотропин может быть по меньшей мере одним из следующего ряда: ганиреликса ацетат, гонадорелина ацетат, гистрелина ацетат и менотропин. По меньшей мере одно антидиабетическое лекарственное средство или глюкагон может быть по меньшей мере одним из следующего ряда: акарбоза, хлорпропамид, глимепирид, глипизид, глюкагон, глибурид, инсулины, метформина гидрохлорид, миглитол, пиоглитазона гидрохлорид, репаглинид, розиглитазона малеат и троглитазон. По меньшей мере один гормон щитовидной железы может быть по меньшей мере одним из следующего ряда: левотироксин натрия, лиотиронин натрия, лиотрикс и тироид. По меньшей мере один антагонист гормона щитовидной железы может быть по меньшей мере одним из следующего ряда: метимазол, калия йодид, калия йодид (насыщенный раствор), пропилтиоурацил, радиоактивный йод (натрия йодид 131I) и Люголя раствор. По меньшей мере один гормон гипофиза может быть по меньшей мере одним из следующего ряда: кортикотропин, косинтропин, десмопрессина ацетат, лейпролида ацетат, кортикотропин продленного действия, соматрем, соматропин и вазопрессин. По меньшей мере одно подобное гормону паращитовидных желез лекарственное средство может быть по меньшей мере одним из следующего ряда: кальцифедиол, кальцитонин (человек), кальцитонин (лосось), кальцитриол, дигидротахистерол и этидронат динатрия (см., например, стр. 696-796 в Nursing 2001 Drug Handbook).

По меньшей мере одно мочегонное средство может быть по меньшей мере одним из следующего ряда: ацетазоламид, ацетазоламид натрия, амилорида гидрохлорид, буметанид, хлорталидон, этакринат натрия, этакриновая кислота, фуросемид, гидрохлоротиазид, индапамид, маннит, метолазон, спиронолактон, торасемид, триамтерен и мочевина. По меньшей мере один электролитический или замещающий раствор может быть по меньшей мере одним из следующего ряда: кальция ацетат, кальция карбонат, кальция хлорид, кальция цитрат, кальция глубионат, кальция глуцептат, кальция глюконат, кальция лактат, кальция фосфат (двухосновный), кальция фосфат (трехосновный), декстран (с высокой молекулярной массой), декстран (с низкой молекулярной массой), гидроксиэтилкрахмал, магния хлорид, магния сульфат, калия ацетат, калия бикарбонат, калия хлорид, калия глюконат, раствор Рингера, раствор Рингера (лактат) и натрия хлорид. По меньшей мере один подкислитель или одно подщелачивающее средство может быть по меньшей мере одним из следующего ряда: натрия бикарбонат, натрия лактат и трометамин (см., например, стр. 797-833 в Nursing 2001 Drug Handbook).

По меньшей мере одно лекарственное средство, повышающее количество гемоглобина в крови, может быть по меньшей мере одним из следующего ряда: железа фумарат, железа глюконат, железа сульфат, железа сульфат (высушенный), железа декстран, железа сорбит, железополисахаридный комплекс, комплекс натрия и железа глюконата. По меньшей мере один антикоагулянт может быть по меньшей мере одним из следующего ряда: ардепарин натрия, дальтепарин натрия, данапароид натрия, эноксапарин натрия, гепарин кальция, гепарин натрия и варфарин натрия. По меньшей мере одно производное крови может быть по меньшей мере одним из следующего ряда: альбумин 5%, альбумин 25%, антигемофильный фактор, антиингибиторный коагулянтный комплекс, антитромбин III (человек), фактор IX (человек), комплекс фактора IX и фракции белков плазмы. По меньшей мере один тромболитический фермент может быть по меньшей мере одним из следующего ряда: альтеплаза, анистреплаза, ретеплаза (рекомбинантная), стрептокиназа и урокиназа (см., например, стр. 834-866 в Nursing 2001 Drug Handbook).

По меньшей мере одно алкилирующее лекарственное средство может быть по меньшей мере одним из следующего ряда: бусульфан, карбоплатин, кармустин, хлорамбуцил, цисплатин, циклофосфамид, ифосфамид, ломустин, хлорметина гидрохлорид, мелфалан, мелфалана гидрохлорид, стрептозоцин, темозоломид и тиотеп. По меньшей мере один антиметаболит может быть по меньшей мере одним из следующего ряда: капецитабин, кладрибин, цитарабин, флоксуридин, флударабина фосфат, фторурацил, гидроксимочевина, меркаптопурин, метотрексат, метотрексат натрия и тиогуанин. По меньшей мере один противоопухолевый антибиотик может быть по меньшей мере одним из следующего ряда: блеомицина сульфат, дактиномицин, даунорубицина цитрат липосомальной формы, даунорубицина гидрохлорид, доксорубицина гидрохлорид, доксорубицина гидрохлорид липосомальной формы, эпирубицина гидрохлорид, идарубицина гидрохлорид, митомицин, пентостатин, пликамицин и вальрубицин. По меньшей мере одно противоопухолевое лекарственное средство, изменяющее гормональный баланс, может быть по меньшей мере одним из следующего ряда: анастрозол, бикалютамид, эстрамустина натрия фосфат, экземестан, флутамид, госерелина ацетат, летрозол, лейпролида ацетат, мегестрола ацетат, нилутамид, тамоксифена цитрат, тестолактон и торемифена цитрат. По меньшей мере одно прочее противоопухолевое лекарственное средство может быть по меньшей мере одним из следующего ряда: аспарагиназа, бацилла Кальметта-Герена (BCG) (живая внутрипузырная), дакарбазин, доцетаксел, этопозид, этопозида фосфат, гемцитабина гидрохлорид, иринотекана гидрохлорид, митотан, митоксантрона гидрохлорид, паклитаксел, пегаспаргаза, порфимер натрия, прокарбазина гидрохлорид, ритуксимаб, тенипозид, топотекана гидрохлорид, трастузумаб, третиноин, винбластина сульфат, винкристина сульфат и винорельбина тартрат (см., например, стр. 867-963 в Nursing 2001 Drug Handbook).

По меньшей мере один иммунодепрессант может быть по меньшей мере одним из следующего ряда: азатиоприн, базиликсимаб, циклоспорин, даклизумаб, лимфоцитарный иммуноглобулин, муромонаб CD3, микофенолятмофетил, микофенолятмофетила гидрохлорид, сиролимус и такролимус. По меньшей мере одна вакцина или анатоксин может быть по меньшей мере одним из следующего ряда: вакцина BCG, вакцина холеры, дифтерийно-столбнячные анатоксины (адсорбированные), дифтерийно-столбнячные анатоксины и бесклеточная коклюшная вакцина адсорбированная, дифтерийно-столбнячные анатоксины и цельноклеточная коклюшная вакцина, конъюгированные вакцины Haemophilius В, вакцина против гепатита А (инактивированная), вакцина против гепатита B (рекомбинантная), вакцина против вируса гриппа 1999-2000 трехвалентных типов A и B (очищенный поверхностный антиген), вакцина против вируса гриппа 1999-2000 трехвалентных типов A и B (субвирионная или очищенная субвирионная), вакцина против вируса гриппа 1999-2000 трехвалентных типов A и B (полностью вирионная), вакцина против вируса японского энцефалита (инактивированная), вакцина против болезни Лайма (рекомбинантная OspA), вакцина против кори, эпидемического паротита и краснухи (живая), вакцина против кори, эпидемического паротита и краснухи (живая ослабленная), вакцина против кори (живая ослабленная), полисахаридная менингококковая вакцина, вакцина против эпидемического паротита (живая), вакцина от чумы, пневмококковая вакцина (поливалентная), полиомиелитная вакцина (инактивированная), полиомиелитная вакцина (живая, пероральная, трехвалентная), вакцина против бешенства (адсорбированная), вакцина против бешенства (человеческие диплоидные клетки), вакцина против краснухи и эпидемического паротита (живая), вакцина против краснухи (живая, ослабленная), столбнячный анатоксин (адсорбированный), столбнячный анатоксин (жидкость), вакцина против брюшного тифа (пероральная), вакцина против брюшного тифа (парентеральная), полисахаридная вакцина против брюшного тифа Vi, вакцина против ветряной оспы и вакцина против желтой лихорадки. По меньшей мере один антитоксин или одно противоядие может быть по меньшей мере одним из следующего ряда: противоядие от укуса паука «черная вдова», противоядие от укуса змеи Crotalidae (поливалентное), дифтерийный антитоксин (лошадь) и противоядие против укуса змеи Micrurus fulvius. По меньшей мере одна иммунная сыворотка может быть по меньшей мере одной из следующего ряда: иммуноглобулин цитомегаловирусный (внутривенно), иммуноглобулин человеческий против гепатита B (человек), иммуноглобулин внутримышечно, иммуноглобулин внутривенно, иммуноглобулин против бешенства (человек), иммуноглобулин против респираторного синцитиального вируса внутривенно (человек), иммуноглобулин Rh0(D) (человек), иммуноглобулин Rh0(D) внутривенно (человек), иммуноглобулин против столбняка (человек) и иммуноглобулин против ветряной оспы. По меньшей мере один модификатор биологического отклика может быть по меньшей мере одним из следующего ряда: альдеслейкин, эпоэтин альфа, филграстим, глатирамера ацетат для инъекций, интерферон альфакон-1, интерферон альфа-2а (рекомбинантный), интерферон альфа-2b (рекомбинантный), интерферон бета-1a, интерферон бета-1b (рекомбинантный), интерферон гамма-1b, левамизола гидрохлорид, опрелвекин и сарграмостим (см., например, стр. 964-1040 в Nursing 2001 Drug Handbook).

По меньшей мере одно офтальмологическое противоинфекционное лекарственное средство может быть по меньшей мере одним из следующего ряда: бацитрацин, хлорамфеникол, ципрофлоксацина гидрохлорид, эритромицин, гентамицина сульфат, офлоксацин 0,3%, полимиксина B сульфат, сульфацетамид натрия 10%, сульфацетамид натрия 15%, сульфацетамид натрия 30%, тобрамицин и видарабин. По меньшей мере одно офтальмологическое противовоспалительное лекарственное средство может быть по меньшей мере одним из следующего ряда: дексаметазон, дексаметазона натрия фосфат, диклофенак натрия 0,1%, флуорометолон, флурбипрофен натрия, кеторолака трометамин, преднизолона ацетат (суспензия) и преднизолона натрия фосфат (раствор). По меньшей мере одно миотическое лекарственное средство может быть по меньшей мере одним из следующего ряда: ацетилхолина хлорид, карбахолин (внутриглазной), карбахолин (местного действия), эхотиофата йодид, пилокарпин, пилокарпина гидрохлорид и пилокарпина нитрат. По меньшей мере одно мидриатическое лекарственное средство может быть по меньшей мере одним из следующего ряда: атропина сульфат, циклопентолата гидрохлорид, эпинефрина гидрохлорид, эпинефрила борат, гоматропина гидробромид, фенилэфрина гидрохлорид, скополамина гидробромид и тропикамид. По меньшей мере один офтальмологический вазоконстриктор может быть по меньшей мере одним из следующего ряда: нафазолина гидрохлорид, оксиметазолина гидрохлорид и тетрагидрозолина гидрохлорид. По меньшей мере одно прочее офтальмологическое лекарственное средство может быть по меньшей мере одним из следующего ряда: апраклонидина гидрохлорид, бетаксолола гидрохлорид, бримонидина тартрат, картеолола гидрохлорид, дипивефрина гидрохлорид, дорзоламида гидрохлорид, эмедастина дифумарат, флуоресцеин натрия, кетотифена фумарат, латанопрост, левобунолола гидрохлорид, метипранолола гидрохлорид, натрия хлорид (гипертонический) и тимолола малеат. По меньшей мере одно лекарственное средство для органов слуха может быть по меньшей мере одним из следующего ряда: борная кислота, карбамида перекись, хлорамфеникол и триэтаноламина полипептида олеата конденсат. По меньшей мере одно лекарственное средство для носа может быть по меньшей мере одним из следующего ряда: беклометазона дипропионат, будесонид, эфедрина сульфат, эпинефрина гидрохлорид, флунизолид, флутиказона пропионат, нафазолина гидрохлорид, оксиметазолина гидрохлорид, фенилэфрина гидрохлорид, тетрагидрозолина гидрохлорид, триамцинолона ацетонид и ксилометазолина гидрохлорид (см., например, стр. 1041-1097 в Nursing 2001 Drug Handbook).

По меньшей мере одно противоинфекционное лекарственное средство местного действия может быть по меньшей мере одним из следующего ряда: ацикловир, амфотерицин В, крем с азелаиновой кислотой, бацитрацин, бутоконазола нитрат, клиндамицина фосфат, клотримазол, эконазола нитрат, эритромицин, гентамицина сульфат, кетоконазол, мафенида ацетат, метронидазол (местного действия), миконазола нитрат, мупироцин, нафтифина гидрохлорид, неомицина сульфат, нитрофуразон, нистатин, серебра сульфадиазин, тербинафина гидрохлорид, терконазол, тетрациклина гидрохлорид, тиоконазол и толнафтат. По меньшей мере одно противочесоточное или один педикулицид может быть по меньшей мере одним из следующего ряда: кротамитон, линдан, перметрин и пиретрины. По меньшей мере один кортикостероид местного действия может быть по меньшей мере одним из следующего ряда: бетаметазона дипропионат, бетаметазона валерат, клобетазола пропионат, дезонид, дезоксиметазон, дексаметазон, дексаметазона натрия фосфат, дифлоразона диацетат, флуоцинолона ацетонид, флюоцинонид, флурандренолид, флутиказона пропионат, галцинонид, гидрокортизон, гидрокортизона ацетат, гидрокортизона бутират, гидрокортизона валерат, мометазона фуроат и триамцинолона ацетонид (см., например, стр. 1098-1136 в Nursing 2001 Drug Handbook).

По меньшей мере один витамин или минерал может быть по меньшей мере одним из следующего ряда: витамин A, комплекс витаминов группы B, цианокобаламин, фолиевая кислота, гидроксокобаламин, лейковорин кальция, ниацин, ниацинамид, пиридоксина гидрохлорид, рибофлавин, тиамина гидрохлорид, витамин С, витамин D, холекальциферол, эргокальциферол, аналог витамина D, доксеркальциферол, парикальцитол, витамин Е, аналог витамина K, фитонадион, натрия фторид, натрия фторид (местного действия), микроэлементы, хром, медь, йод, марганец, селен и цинк. По меньшей мере одно питательное вещество может быть по меньшей мере одним из следующего ряда: вливания аминокислот (кристаллических), вливания аминокислот в декстрозе, вливания аминокислот с электролитами, вливания аминокислот с электролитами в декстрозе, вливания аминокислот против печеночной недостаточности, вливания аминокислот против высокого метаболического стресса, вливания аминокислот против почечной недостаточности, декстроза, жировые эмульсии и триглицериды со средней цепью (см., например, стр. 1137-1163 в Nursing 2001 Drug Handbook).

Композиции белковых каркасов в соответствии с настоящим изобретением могут дополнительно содержать по меньшей мере одно любое пригодное и эффективное количество композиции либо фармацевтической композиции, содержащей белковый каркас, путем приведения в контакт либо введения взаимодействующий с клеткой, тканью, органом, животным или пациентом, нуждающимися в такого рода модулировании, лечении или терапии, необязательно дополнительно содержащей по меньшей мере одно из следующего ряда: антагонист TNF (в частности, химический или белковый антагонист TNF, моноклональное или поликлональное антитело либо фрагмент TNF, растворимый рецептор TNF (например, p55, p70 и p85) или фрагмент, их слитые полипептиды или антагонист TNF с малой молекулой, например, TNF-связующий белок I или II (TBP-1 или TBP-II), нерелимонмаб, инфликсимаб, этанерцепт, CDP-571, CDP-870, афелимомаб, ленерцепт и т.п.), противоревматическое лекарственное средство (например, метотрексат, ауранофин, ауротиоглюкоза, азатиоприн, этанерцепт, натрия ауротиомалат, гидроксихлорохина сульфат, лефлуномид, сульфазалцин), миорелаксант, наркотик, нестероидный противовоспалительный препарат (НПВП), анальгетик, обезболивающее, успокоительное, местное обезболивающее, нервно-мышечный блокатор, антимикробное лекарственное средство (например, аминогликозид, противогрибковое, противопаразитарное, противовирусное, карбапенем, цефалоспорин, фторхинолон, макролид, пенициллин, сульфонамид, тетрациклин, другое антимикробное), противопсориазное, кортикостероид, анаболический стероид, противодиабетическое лекарственное средство, минерал, питательное вещество, связанное с щитовидной железой вещество, витамин, связанный с кальцием гормон, антидиарейное, противокашлевое, противорвотное, противоязвенное, слабительное, антикоагулянт, эритропоэтин (например, эпоэтин альфа), филграстим (например, G-CSF, нейпоген), сарграмостим (GM-CSF, лейкин), иммунизация, иммуноглобулин, иммунодепрессант (например, базиликсимаб, циклоспорин, даклизумаб), гормон роста, гормон-заместительное лекарственное средство, модулятор рецептора эстрогена, мидриатик, лекарственное средство против циклоплегии, алкилирующее лекарственное средство, антиметаболит, митотический ингибитор, радиофармпрепарат, антидепрессант, противоманиакальное, антипсихотическое, анксиолитическое, гипнотическое, симпатомиметик, стимулятор, донепезил, такрин, лекарственное средство против астмы, бета-агонист, вдыхаемый стероид, ингибитор лейкотриенов, метилксантин, кромолин, эпинефрин или аналог, дорназа альфа (пульмозим), цитокин или антагонист цитокинов. Неограничивающие примеры таких цитокинов включают, помимо прочего, любые из интерлейкинов, от IL-1 до IL-32 (например, IL-1, IL-2 и т.д.). Подходящие дозы хорошо известны из уровня техники. См., например, Wells et al., eds., Pharmacotherapy Handbook, 2nd Edition, Appleton and Lange, Stamford, CT (2000); PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 2000, Deluxe Edition, Tarascon Publishing, Loma Linda, CA (2000), каждый источник полностью включен в текст настоящего документа путем ссылки.

Такие противораковые или противоинфекционные лекарственные средства могут также включать молекулы токсина, которые связаны, соединены, объединены в один препарат или вводятся совместно по меньшей мере с одним белковым каркасом в соответствии с настоящим изобретением. Токсин может необязательно воздействовать на патологическую клетку или ткань с целью ее уничтожения. В качестве патологической клетки может выступать раковая или другая клетка. В частности, к таким токсинам относятся очищенный или рекомбинантный токсин либо фрагмент токсина, содержащий по меньшей мере один функциональный цитотоксический домен токсина, например, по меньшей мере один из следующего ряда: рицин, дифтерийный токсин, ядовитый токсин или бактериальный токсин. Термин «токсин» также включает в себя эндотоксины и экзотоксины, выделяемые любыми естественными, мутантными или рекомбинантными бактериями либо вирусами, которые могут вызывать любое патологическое состояние у человека и других млекопитающих, включая токсический шок, способный привести к смерти. К таким токсинам относятся, в частности, термолабильный энтеротоксин (LT) энтеротоксигенных E. coli, термостабильный энтеротоксин (ST), цитотоксин шигелл, энтеротоксины аэромонас, токсин-1 токсического шока (TSST-1), энтеротоксин A стафилококков (SEA), B (SEB) или C (SEC), энтеротоксины стрептококков и т.п. К таким бактериям относятся, в частности, штаммы энтеротоксигенных E. coli (ETEC), энтерогеморрагических E. coli (например, штаммы серотипа 0157:H7), разновидностей стафилококков (например, Staphylococcus aureus, Staphylococcus pyogenes), разновидностей шигелл (например, Shigella dysenteriae, Shigella flexneri, Shigella boydii и Shigella sonnei), разновидностей сальмонелл (например, Salmonella typhi, Salmonella cholera-suis, Salmonella enteritidis), разновидностей клостридий (например, Clostridium perfringens, Clostridium dificile, Clostridium botulinum), разновидностей кампилобактера (например, Camphlobacter jejuni, Camphlobacter fetus), разновидностей хеликобактера (например, Heliobacter pylori), разновидностей аэромонас (например, Aeromonas sobria, Aeromonas hydrophila, Aeromonas caviae), разновидностей Pleisomonas shigelloides, Yersina enterocolitica, Vibrios (например, Vibrios cholerae, Vibrios parahemolyticus), разновидностей клебсиелл, Pseudomonas aeruginosa и стрептококков. См., например, Stein, ed., INTERNAL MEDICINE, 3rd ed., pp 1-13, Little, Brown and Co., Boston, (1990); Evans et al., eds., Bacterial Infections of Humans: Epidemiology and Control, 2d. Ed., pp 239-254, Plenum Medical Book Co., New York (1991); Mandell et al, Principles and Practice of Infectious Diseases, 3d. Ed., Churchill Livingstone, New York (1990); Berkow et al, eds., The Merck Manual, 16th edition, Merck and Co., Rahway, N.J., 1992; Wood et al, FEMS Microbiology Immunology, 76:121-134 (1991); Marrack et al, Science, 248:705-711 (1990), каждый источник полностью включен в текст настоящего документа путем ссылки.

Соединения, композиции или комбинации белковых каркасов в соответствии с настоящим изобретением могут дополнительно содержать по меньшей мере одно подходящее вспомогательное вещество, включая, помимо прочего, разбавитель, связывающее вещество, стабилизатор, буферы, соли, липофильные растворители, консервант, адъювант и т.п. Предпочтительными являются фармацевтически приемлемые вспомогательные вещества. Неограничивающие примеры таких стерильных растворов и способов их получения хорошо известны из уровня техники, в частности, описаны в Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, PA) 1990. Фармацевтически приемлемые носители можно подобрать обычным способом, исходя из способа введения, растворимости и/или стабильности белкового каркаса, фрагмента либо варианта композиции, как хорошо известно из уровня техники или описано в настоящем документе.

К фармацевтическим наполнителям и добавкам, пригодным для использования в настоящей композиции, относятся, помимо прочего, белки, пептиды, аминокислоты, липиды и углеводы (например, сахар, в том числе моносахариды, ди-, три-, тетра- и олигосахариды; производные сахаров, например, альдит, альдоновая кислота, этерифицированные сахара и т.п.; полисахариды или полимеры сахара), которые могут присутствовать по отдельности или в комбинации, составляя по отдельности или в комбинации 1-99,99% по весу или объему. К примерам белковых наполнителей относятся, в частности, сывороточный альбумин, например, человеческий сывороточный альбумин (HSA), рекомбинантный человеческий альбумин (rHA), желатин, казеин и т.п. К аминокислотным/белковым компонентам, которые также могут использоваться как буфер, относятся, в частности, аланин, глицин, аргинин, бетаин, гистидин, глутаминовая кислота, аспарагиновая кислота, цистеин, лизин, лейцин, изолейцин, валин, метионин, фенилаланин, аспартам и т.п. Одной из предпочтительных аминокислот является глицин.

К углеводным наполнителям, пригодным для использования в настоящем изобретении, относятся, в частности, моносахариды, такие как фруктоза, мальтоза, галактоза, глюкоза, D-манноза, сорбоза и т.п.; дисахариды, такие как лактоза, сахароза, трегалоза, целлобиоза и т.п.; полисахариды, такие как раффиноза, мелицитоза, мальтодекстрины, декстраны, крахмал и т.п.; и альдиты, такие как маннит, ксилит, мальтит, лактит, ксилит, сорбит (глюцитол), миоинозитол и т.п. Предпочтительными углеводными наполнителями для использования в настоящем изобретении являются маннит, трегалоза и раффиноза.

Композиции белкового каркаса могут также включать буфер или рН-регулирующее вещество; как правило, буфером является соль, полученная из органической кислоты или основания. К таким буферам относятся, в частности, соли органических кислот, такие как соли лимонной кислоты, аскорбиновой кислоты, глюконовой кислоты, углекислоты, винной кислоты, янтарной кислоты, уксусной кислоты или фталевой кислоты; буферы с трис, трометамина гидрохлоридом, фосфатом. Предпочтительными буферами для использования в настоящих композициях являются соли органических кислот, такие как цитрат.

Дополнительно композиции белкового каркаса в соответствии с настоящим изобретением могут включать полимерные наполнители/добавки, такие как поливинилпирролидоны, фиколлы (полимерный сахар), декстраты (например, циклодекстрины, такие как 2-гидроксипропил-β-циклодекстрин), полиэтиленгликоли, вкусовые добавки, антимикробные агенты, подсластители, антиоксиданты, антистатические агенты, сурфактанты (например, полисорбаты, такие как «TWEEN 20» и «TWEEN 80»), липиды (например, фосфолипиды, жирные кислоты), стероиды (например, холестерин), и хелатирующие агенты (например, ЭДТА).

Эти и другие известные фармацевтические наполнители и/или добавки, пригодные для использования в белковом каркасе, его части или вариантах композиций в соответствии с настоящим изобретением, известны из уровня техники, например, указаны в Remington: The Science & Practice of Pharmacy, 19th ed., Williams & Williams, (1995) и Physician's Desk Reference, 52nd ed., Medical Economics, Montvale, NJ (1998), каждый вышеуказанный источник полностью включен в текст настоящего документа путем ссылки. Предпочтительными носителями или наполнителями являются углеводы (например, сахариды и альдиты) и буферы (например, цитрат) или полимерные агенты. Примером молекулы-носителя является мукополисахарид, гиалуроновая кислота, которая может быть пригодна для внутрисуставного введения.

Препараты

Как отмечалось выше, изобретение относится к стабильным веществам, которые предпочтительно содержат фосфатный буфер с физиологическим раствором или выбранной солью, а также консервированные растворы и препараты, содержащие консервант, а также консервированные препараты для многократного использования, подходящие для применения в фармацевтических или ветеринарных целях, содержащие по меньшей мере один белковый каркас в фармацевтически приемлемом препарате. Консервированные препараты содержат по меньшей мере один известный консервант или необязательно по меньшей мере один консервант, выбранный из группы, включающей по меньшей мере один: фенол, м-крезол, п-крезол, о-крезол, хлорокрезол, бензиловый спирт, фенилртути нитрит, феноксиэтанол, формальдегид, хлорбутанол, магния хлорид (например, гексагидрат), алкилпарабен (метил, этил, пропил, бутил и т.п.), бензалкония хлорид, бензетония хлорид, натрия дегидроацетат и тимеросал, полимеры или их смеси в водном разбавителе. Возможно использование любой подходящей концентрации или смеси, известной из уровня техники, например, 0,0015% либо любого диапазона, его значения или части. Неограничивающими примерами являются (без консервантов) приблизительно 0,1-2% м-крезола (например, 0,2; 0,3; 0,4; 0,5; 0,9; 1,0%), приблизительно 0,1-3% бензилового спирта (например, 0,5; 0,9; 1,1; 1,5; 1,9; 2,0; 2,5%), приблизительно 0,001-0,5% тимеросала (например, 0,005; 0,01), приблизительно 0,001-2,0% фенола (например, 0,05; 0,25; 0,28; 0,5; 0,9; 1,0%), 0,0005-1,0% алкилпарабенов (например, 0,00075; 0,0009; 0,001; 0,002; 0,005; 0,0075; 0,009; 0,01; 0,02; 0,05; 0,075; 0,09; 0,1; 0,2; 0,3; 0,5; 0,75; 0,9; 1,0%) и т.п.

Как отмечалось выше, изобретение относится к изделию, включающему упаковочный материал и по меньшей мере один флакон, содержащий раствор по меньшей мере одного белкового каркаса с указанными буферами и/или консервантами, в некоторых случаях в водном разбавителе, при этом данный упаковочный материал содержит этикетку с указанием, что раствор разрешено хранить в течение 1, 2, 3, 4, 5, 6, 9, 12, 18, 20, 24, 30, 36, 40, 48, 54, 60, 66, 72 часов или дольше. Изобретение также относится к изделию, включающему упаковочный материал, один флакон, содержащий по меньшей мере один лиофилизированный белковый каркас, и второй флакон, содержащий водный разбавитель указанного буфера или консерванта, причем указанный упаковочный материал содержит этикетку с указанием для пациента разбавить по меньшей мере один белковый каркас в водном разбавителе для получения раствора, который разрешено хранить в течение двадцати четырех часов или дольше.

По меньшей мере один белковый каркас в соответствии с настоящим изобретением может быть получен рекомбинантным способом, в том числе из клеток млекопитающих или трансгенных препаратов, либо путем очистки других биологических источников, как описано в настоящем документе или известно из уровня техники.

Диапазон по меньшей мере одного белкового каркаса в изделии по настоящему изобретению включает в себя объемы, дающие после разбавления в случае сухой/влажной системы концентрации от приблизительно 1,0 мкг/мл до приблизительно 1000 мг/мл, хотя более низкие и высокие концентрации также функциональны и зависят от предполагаемого способа доставки, например, введение препарата в виде раствора отличается от введения такими способами, как трансдермальный пластырь, через легкие, через слизистую, осмотический насос или микронасос.

Предпочтительно водный растворитель необязательно содержит фармацевтически приемлемый консервант. К предпочтительным консервантам относится следующие вещества, выбранные из группы, состоящей из фенола, м-крезола, п-крезола, о-крезола, хлорокрезола, бензилового спирта, алкилпарабена (метил, этил, пропил, бутил и т.п.), бензалкония хлорида, бензетония хлорида, натрия дегидроацетата и тимеросала или их смеси. Концентрация консерванта, используемая в препарате, должна быть достаточной для достижения противомикробного действия. Такая концентрация зависит от выбранного консерванта и будет ясна специалисту.

Предпочтительно в разбавитель необязательно добавляют другие наполнители, например, вещества изотонического действия, буферы, антиоксиданты и средства, усиливающие консервацию. Вещества изотонического действия, например, глицерин, широко используются в известных концентрациях. Предпочтительно добавление физиологически приемлемого буфера для улучшения контроля рН. Препараты могут включать широкий диапазон рН, например, от приблизительно рН 4 до приблизительно рН 10, предпочтительно от приблизительно рН 5 до приблизительно рН 9 и наиболее предпочтительно от приблизительно 6,0 до приблизительно 8,0. Предпочтительно препараты в соответствии с настоящим изобретением имеют рН приблизительно от 6,8 до приблизительно 7,8. Предпочтительны фосфатные буферы, наиболее предпочтителен натрия фосфат, в частности, забуференный фосфатом физиологический раствор (ФБР).

Другие добавки, такие как фармацевтически приемлемые растворители, как, например, Tween 20 (полиоксиэтилен (20) сорбитан монолаурат), Tween 40 (полиоксиэтилен (20) сорбитан монопальмитат), Tween 80 (полиоксиэтилен (20) сорбитан моноолеат), Pluronic F68 (блок-сополимеры полиоксиэтилен-полиоксипропилена) и ПЭГ (полиэтиленгликоль) или неионные сурфактанты, такие как полисорбат 20 или 80 либо полоксамер 184 или 188, полиолы Pluronic®, другие блок-сополимеры и хелатирующие вещества, такие как ЭДТА и ЭГТА, могут необязательно добавляться к препаратам или композициям с целью уменьшения агрегации. Эти добавки особенно полезны, если для введения препарата используется насос или пластиковый контейнер. Наличие фармацевтически приемлемого поверхностно-активного вещества снижает склонность белка к агрегации.

Препараты в соответствии с настоящим изобретением могут быть получены способом, включающим смешивание по меньшей мере одного белкового каркаса и консерванта, выбранного из группы, состоящей из фенола, м-крезола, п-крезола, о-крезола, хлорокрезола, бензилового спирта, алкилпарабена (метил, этил, пропил, бутил и т.п.), бензалкония хлорида, бензетония хлорида, натрия дегидроацетата и тимеросала или их смесей в водном разбавителе. Смешивание по меньшей мере одного белкового каркаса и консерванта в водном разбавителе осуществляют с использованием обычных процедур растворения и смешивания. Например, для приготовления подходящего препарата отмеренное количество по меньшей мере одного белкового каркаса в буферном растворе связывают с требуемым консервантом в буферном растворе в количестве, достаточном для получения требуемой концентрации белка и консерванта. Вариации этого процесса хорошо ясны среднему специалисту в данной области техники. Например, для оптимизации с учетом концентрации и способа введения могут быть изменены такие факторы, как порядок добавления компонентов, использование дополнительных добавок, температура и рН, при которых получают препарат.

Заявляемые препараты могут быть предоставлены пациентам в виде прозрачных растворов или двухкомпонентных флаконов, где первый флакон содержит по меньшей мере один лиофилизированный белковый каркас, смешиваемый с содержимым второго флакона, содержащего воду, консервант и/или наполнители, предпочтительно фосфатный буфер и/или физиологический раствор и выбранную соль, в водном разбавителе. Как однокомпонентный флакон с раствором, так и двухкомпонентный флакон с раствором, предполагающий смешивание, могут быть использованы многократно и подходят для одного или нескольких циклов лечения пациента, что более удобно по сравнению с существующим в настоящее время подходом.

Заявляемые в настоящем документе изделия пригодны для введения как немедленно, так и в течение двадцати четырех часов или дольше. Соответственно, заявляемые в настоящем документе изделия обеспечивают значительные преимущества для пациентов. Препараты в соответствии с настоящим изобретением необязательно могут безопасно храниться при температуре от приблизительно 2°C до приблизительно 40°C, сохраняя биологическую активность белка в течение продолжительных периодов времени, в связи с чем на упаковке присутствует этикетка, указывающая, что раствор необходимо хранить и/или использовать в течение 6, 12, 18, 24, 36, 48, 72, 96 или более часов. Если используется разбавитель с консервантом, то на этикетке может быть указан срок годности до 1-12 месяцев, полугода, полутора лет и/или двух лет.

Растворы по меньшей мере одного белкового каркаса в соответствии с настоящим изобретением могут быть получены способом, предполагающим смешивание по меньшей мере одного белкового каркаса в водном разбавителе. Смешивание осуществляют с помощью обычных процедур растворения и смешивания. Например, чтобы подготовить подходящий разбавитель, отмеренное количество по меньшей мере одного белкового каркаса в воде или буфере связывают в количестве, достаточном для получения требуемой концентрации белка и необязательно консерванта или буфера. Вариации этого процесса хорошо ясны среднему специалисту в данной области техники. Например, для оптимизации с учетом концентрации и способа введения могут быть изменены такие факторы, как порядок добавления компонентов, использование дополнительных добавок, температура и рН, при которых получают препарат.

Заявляемые изделия могут поступать пациентам в виде прозрачных растворов или двухкомпонентных флаконов, где первый флакон содержит по меньшей мере один лиофилизированный белковый каркас, смешиваемый с содержимым второго флакона, где находится водный разбавитель. Как однокомпонентный флакон с раствором, так и двухкомпонентный флакон с раствором, предполагающий смешивание, могут быть использованы многократно и подходят для одного или нескольких циклов лечения пациента, что более удобно по сравнению с существующим в настоящее время подходом.

Заявляемые изделия могут поставляться пациентам не напрямую (через аптеки, поликлиники или другие учреждения) в виде прозрачных растворов или двухкомпонентных флаконов, где первый флакон содержит по меньшей мере один лиофилизированный белковый каркас, смешиваемый с содержимым второго флакона, где находится водный разбавитель. В этом случае объем прозрачного раствора может составлять один литр или более, тем самым обеспечивается большая емкость, из которой аптека или поликлиника может отмерять раствор по меньшей мере одного белкового каркаса однократно или многократно небольшими порциями для переноса во флаконы меньшего размера с целью предоставления своим клиентам и/или пациентам.

Общепринятые устройства, включающие системы с одним флаконом, включают ручки-инжекторы, такие как BD Pens, BD Autojector®, Humaject®, NovoPen®, B-D®Pen, AutoPen®, и OptiPen®, GenotropinPen®, Genotronorm Pen®, Humatro Pen®, Reco-Pen®, Roferon Pen®, Biojector®, Iject®, J-tip Needle-Free Injector®, Intraject®, Medi-Ject®, например, производимые или разработанные компаниями Becton Dickensen (Franklin Lakes, NJ, www.bectondickenson.com), Disetronic (Burgdorf, Switzerland, www.disetronic.com; Bioject, Portland, Oregon (www.bioject.com); National Medical Products, Weston Medical (Peterborough, UK, www.weston-medical.com), Medi-Ject Corp (Minneapolis, MN, http://ww), а также устройства сходного принципа действия. Общепринятые устройства, представляющие собой системы с двумя флаконами, включают ручки-инжекторы, в которых происходит разведение лиофилизированного препарата внутри картриджа и его последующее введение, такие как HumatroPen®. Примеры других приемлемых устройств включают шприцы, предварительно заполненные препаратом, аутоинжекторы, безыгольные инжекторы и безыгольные системы для внутривенного введения препаратов.

Заявляемые в настоящем документе изделия включают упаковочный материал. В дополнение к информации в соответствии с предписаниями контролирующих органов на упаковочном материале также указываются условия, при которых может быть использовано изделие. Упаковочный материал в соответствии с настоящим изобретением содержит инструкции для пациента по разбавлению по меньшей мере одного белкового каркаса в водном разбавителе для получения раствора и использованию раствора в течение 2-24 часов или дольше в случае двухфлаконного сухого/влажного изделия. В случае однофлаконного изделия в виде раствора на упаковке указывают, что такой раствор может быть использован в течение 2-24 часов или дольше. Заявляемые в настоящем документе изделия предназначены для использования человеком в фармацевтических целях.

Препараты по настоящему изобретению могут быть получены способом, включающим смешивание по меньшей мере одного белкового каркаса и выбранного буфера, предпочтительно фосфатного буфера, содержащего физиологический раствор или выбранную соль. Смешивание по меньшей мере одного белкового каркаса и буфера в водном разбавителе осуществляют с помощью обычных процедур растворения и смешивания. Например, чтобы подготовить подходящий препарат, отмеренное количество по меньшей мере одного белкового каркаса в воде или буфере связывают с требуемым буферным веществом в воде в количестве, достаточном для получения требуемой концентрации белка и буфера. Вариации этого процесса хорошо ясны среднему специалисту в данной области техники. Например, для оптимизации с учетом концентрации и способа введения могут быть изменены такие факторы, как порядок добавления компонентов, использование дополнительных добавок, температура и рН, при которых получают препарат.

Заявляемые стабильные или консервированные препараты могут быть предоставлены пациентам в виде прозрачных растворов или двухкомпонентных флаконов, где первый флакон содержит лиофилизированный белковый каркас, смешиваемый с содержимым второго флакона, где находится консервант или буфер и наполнители в водном разбавителе. Как однокомпонентный флакон с раствором, так и двухкомпонентный флакон с раствором, предполагающий смешивание, могут быть использованы многократно и подходят для одного или нескольких циклов лечения пациента, что более удобно по сравнению с существующим в настоящее время подходом.

Другие препараты или способы стабилизации белкового каркаса могут дать результаты, отличающиеся от прозрачного раствора лиофилизированного порошка, содержащего белковый каркас. К непрозрачным растворам относятся, в частности, препараты, содержащие взвешенные частицы, которые являются композициями, содержащими белковый каркас в структуре переменной размерности, и известны как микросферы, микрочастицы, наночастицы, наносферы или липосомы. Такие относительно однородные, в целом сферические, растворы в виде частиц, содержащие активное вещество, могут быть получены путем связывания водной фазы, содержащей активное вещество и полимер, с неводной фазой с последующим испарением неводной фазы и соединением частиц из водной фазы, как описано в патенте США № 4589330. Пористые микрочастицы могут быть получены, если в качестве первой фазы использовать суспензию, содержащую активное вещество и полимер, диспергированные в непрерывно действующем растворителе, и удалить названный растворитель из суспензии методом сублимационной сушки или разбавления, экстрагирования и осаждения, как описано в патенте США № 4818542. Предпочтительными полимерами для таких препаратов являются естественные или синтетические сополимеры либо полимеры, выбранные из группы, состоящей из желатинового агара, крахмала, арабиногалактана, альбумина, коллагена, полигликолевой кислоты, полимолочной кислоты, гликолид-L(-)лактид поли(эпсилон-капролактона, поли(эпсилон-капролактон-CO-молочной кислоты), поли(эпсилон-капролактон-CO-гликолевой кислоты), поли(ß-гидроксимасляной кислоты), полиэтиленоксида, полиэтилена, поли(алкил-2-цианакрилата), поли(гидроксиэтилметакрилата), полиамидов, поли(аминокислот), поли(2-гидроксиэтил DL-аспартамида), поли(эфир мочевины), поли(L-фенилаланин/этиленгликоль/1,6-диизоцианатогексана) и поли(метилметакрилата). Наиболее предпочтительными полимерами являются полиэфиры, такие как полигликолевая кислота, полимолочная кислота, гликолид-L(-) лактид поли(эпсилон-капролактон, поли(эпсилон-капролактон-CO-молочная кислота) и поли(эпсилон-капролактон-CO-гликолевая кислота. К растворителям, пригодным для растворения полимера и/или активного вещества, относятся вода, гексафторизопропанол, метиленхлорид, тетрагидрофуран, гексан, бензол или гексафторацетона полуторагидрат. Процесс диспергирования содержащей активное вещество фазы с помощью второй фазы может включать принудительный пропуск первой фазы через отверстие в сопле для получения каплеобразной формы.

Препараты в виде сухого порошка могут быть получены методами помимо лиофилизации, например, путем распылительной сушки, экстрагирования растворителя испарением либо осаждения кристаллической композиции, за которыми следуют одно или несколько действий по удалению водного или неводного растворителя. Подготовка препарата белкового каркаса путем распылительной сушки описана в патенте США № 6019968. Композиции белкового каркаса в виде сухого порошка могут быть получены путем распылительной сушки растворов или суспензий белкового каркаса и в некоторых случаях наполнителей в растворителе при условиях, обеспечивающих получение вдыхаемого сухого порошка. В качестве растворителей могут быть использованы, в частности, полярные соединения, такие как вода и этанол, которые можно легко высушить. Стабильность белковых каркасов может быть повышена, если процедуры распылительной сушки проводятся в отсутствие кислорода, например, под азотной подушкой или с помощью азота в качестве сушильного газа. Другой препарат в виде относительно сухого порошка получают диспергированием множества перфорированных микроструктур в суспензионной среде, обычно содержащей пропеллент гидрофторалкан, как описано в WO 9916419. Стабилизированный диспергированный препарат может быть введен в легкие пациента с помощью ингалятора отмеренных доз. Оборудование, пригодное для коммерческого производства лекарственного средства путем распылительной сушки, выпускается Buchi Ltd. или Niro Corp.

По меньшей мере один белковый каркас в виде стабильного или консервированного препарата или раствора, как описано здесь, может быть введен пациенту в соответствии с настоящим изобретением с помощью различных способов, включая подкожные или внутримышечные инъекции, трансдермальный, через легкие, через слизистую, имплантат, осмотический насос, картридж, микронасос или другие средства, ясные специалисту, как хорошо известно из уровня техники.

Терапевтическое применение

Настоящее изобретение также относится к способу модулирования или лечения заболеваний в клетках, тканях, органах, животных либо пациентах, как известно из уровня техники или описано здесь, с использованием по меньшей мере одного белкового каркаса в соответствии с настоящим изобретением, например, посредством приведения терапевтически эффективного количества белкового каркаса в контакт с клеткой, тканью, органом, животным или пациентом путем введения либо реакции. Настоящее изобретение также относится к способу модулирования или лечения заболеваний в клетках, тканях, органах, животных либо пациентах, в частности, по меньшей мере одного из следующего ряда: ожирение, иммунное заболевание, сердечно-сосудистое заболевание, инфекционное заболевание, злокачественное заболевание или неврологическое заболевание.

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одного иммунного заболевания в клетках, тканях, органах, животных либо пациентах, включая, но не ограничиваясь, по меньшей мере одно из следующего ряда: ревматоидный артрит, ювенильный ревматоидный артрит, ювенильный ревматоидный артрит в системной форме в начальной стадии, псориатический артрит, анкилозирующий спондилит, язва желудка, серонегативные артропатии, остеоартрит, остеолиз, асептическое расшатывание ортопедических имплантатов, воспалительное заболевание кишечника, язвенный колит, системная красная волчанка, антифосфолипидный синдром, иридоциклит/увеит/неврит зрительного нерва, идиопатический легочный фиброз, системный васкулит/гранулематоз Вегенера, саркоидоз, орхит/обратная операция при вазэктомии, аллергические/атопические заболевания, астма, аллергический ринит, экзема, аллергический контактный дерматит, аллергический конъюнктивит, пневмонит на фоне гиперчувствительности, заболевания, связанные с пересадкой органов, отторжение пересаженных органов, болезнь «трансплантат против хозяина», синдром системной воспалительной реакции, синдром сепсиса, грамположительный сепсис, грамотрицательный сепсис, отрицательный в культуре сепсис, грибковый сепсис, нейтропеническая лихорадка, уросепсис, менингококцемия, травма/кровотечение, ожоги, ионизирующее облучение, острый панкреатит, респираторный дистресс-синдром взрослых, ревматоидный артрит, алкогольный гепатит, хронические воспалительные патологии, саркоидоз, болезнь Крона, серповидно-клеточная анемия, диабет, нефроз, атопические заболевания, реакции гиперчувствительности, аллергический ринит, сенная лихорадка, перениальный ринит, конъюнктивит, эндометриоз, астма, крапивница, системная анафилаксия, дерматит, злокачественная анемия, гемолитические заболевания, тромбоцитопения, отторжение трансплантата органа или ткани, отторжение трансплантата почки, отторжение трансплантата сердца, отторжение трансплантата печени, отторжение трансплантата поджелудочной железы, отторжение трансплантата легкого, отторжение трансплантата костного мозга (BMT), отторжение аллотрансплантата кожи, отторжение трансплантата хряща, отторжение трансплантата кости, отторжение трансплантата тонкой кишки, отторжение имплантата тимуса плода, отторжение трансплантата паращитовидных желез, отторжение ксенотрансплантата органа или ткани, отторжение аллотрансплантата, реакции гиперчувствительности с участием антирецепторов, болезнь Грейвса, болезнь Рейно, инсулиннезависимый диабет 2-го типа, астма, миастения, антитело-опосредованная цитотоксичность, реакции гиперчувствительности типа III, POEMS-синдром (полинейропатия, органомегалия, эндокринопатия, моноклональная гаммапатия и синдром изменения кожи), полиневропатия, органомегалия, эндокринопатия, моноклональная гаммапатия, синдром изменения кожи, антифосфолипидный синдром, пузырчатка, склеродермия, смешанное заболевание соединительной ткани, идиопатическая болезнь Аддисона, сахарный диабет, хронический активный гепатит, первичный билиарный цирроз, витилиго, васкулит, посткардиотомный синдром после ИМ, гиперчувствительность типа IV, контактный дерматит, пневмонит на фоне гиперчувствительности, отторжение аллотрансплантата, гранулемы на фоне внутриклеточных организмов, чувствительность к лекарственным средствам, метаболическое/идиопатическое заболевание, болезнь Вильсона-Коновалова, гемохроматоз, дефицит альфа-1-антитрипсина, диабетическая ретинопатия, тиреоидит Хашимото, остеопороз, оценка гипоталамо-гипофизарно-надпочечниковой оси, первичный билиарный цирроз, тиреоидит, энцефаломиелит, кахексия, кистозный фиброз, неонатальное хроническое заболевание легких, хроническая обструктивная болезнь легких (COPD), семейный гемофагоцитарный лимфоцитарный гистиоцитоз, дерматологические состояния, псориаз, облысение, нефротический синдром, нефрит, клубочковый нефрит, острая почечная недостаточность, гемодиализ, уремия, токсичность, преэклампсия, терапия OKT3, терапия анти-CD3, цитокин-терапия, химиотерапия, лучевая терапия (в частности, астения, анемия, кахексия и т.п.), хроническая интоксикация салицилатами и т.п. См., например, Merck Manual, 12th-17th Editions, Merck & Company, Rahway, NJ (1972, 1977, 1982, 1987, 1992, 1999), Pharmacotherapy Handbook, Wells et al., eds., Second Edition, Appleton and Lange, Stamford, Conn. (1998, 2000), каждый источник полностью включен в текст настоящего документа путем ссылки.

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одного сердечно-сосудистого заболевания в клетках, тканях, органах, животных либо пациентах, в частности, по меньшей мере одного из следующего ряда: синдром снижения сердечной активности, инфаркт миокарда, застойная сердечная недостаточность, инсульт, ишемический инсульт, кровоизлияние, острый коронарный синдром, артериосклероз, атеросклероз, рестеноз, диабетический артериосклероз, гипертензия, артериальная гипертензия, вазоренальная гипертензия, обморок, шок, сифилис сердечно-сосудистой системы, сердечная недостаточность, легочное сердце, первичная легочная гипертензия, сердечная аритмия, предсердная экстрасистола, трепетание предсердий, фибрилляция предсердий (постоянная или пароксизмальная), постперфузионный синдром, воспаление на фоне искусственного кровообращения, хаотическая или мультифокальная предсердная тахикардии, регулярная тахикардия с узкими QRS-комплексами, специфические аритмии, фибрилляция желудочков, аритмии пучка Гиса, атриовентрикулярная блокада, блокада ножки пучка Гиса, ишемические нарушения миокарда, ишемическая болезнь сердца, стенокардия, инфаркт миокарда, кардиомиопатия, дилатационная застойная кардиомиопатия, рестриктивная кардиомиопатия, пороки сердца, эндокардит, заболевание перикарда, сердечные опухоли, аневризмы аорты и периферийных артерий, расслоение аорты, воспаление аорты, окклюзия брюшной аорты и ее ветвей, периферические сосудистые расстройства, окклюзионные расстройства артериального кровообращения, атеросклеротическое заболевание периферических артерий, облитерирующий тромбангиит, функциональные расстройства периферических артерий, явление и болезнь Рейно, акроцианоз, эритромелалгия, венозные заболевания, венозный тромбоз, варикозные вены, артериовенозная фистула, лимфедема, жировой отек, нестабильная стенокардия, реперфузионное повреждение, синдром полиорганной недостаточности после искусственного кровообращения, ишемически-реперфузионное повреждение и т.п. Такой способ может необязательно включать введение эффективного количества композиции или фармацевтической композиции, содержащей по меньшей мере один белковый каркас, в клетки, ткани, органы, животным либо пациентам, которым требуется такого рода модулирование, лечение или терапия.

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одного инфекционного заболевания в клетках, тканях, органах, животных либо пациентах, в частности, по меньшей мере одного из следующего ряда: острая или хроническая бактериальная инфекция, острые и хронические паразитарные или инфекционные процессы, включая бактериальные, вирусные и грибковые инфекции, ВИЧ-инфекция/ВИЧ-невропатия, менингит, гепатит (например, A, B или C и т.п.), септический артрит, перитонит, пневмония, эпиглоттит, E. coli 0157:h7, гемолитический уремический синдром/тромболитическая тромбоцитопеническая пурпура, малярия, геморрагическая лихорадка Денге, лейшманиоз, проказа, синдром токсического шока, стрептококковый миозит, газовая гангрена, микобактериальный туберкулез, mycobacterium avium intracellulare, пневмоцистная пневмония, воспалительное заболевание тазовых органов, орхит/эпидидимит, легионеллы, болезнь Лайма, грипп типа a, вирус Эпштейна-Барра, вирус-ассоциированный гемафагоцитарный синдром, вирусный энцефалит/асептический менингит и т.п.

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одного злокачественного заболевания в клетках, тканях, органах, животных либо пациентах, в частности, по меньшей мере одного из следующего ряда: лейкоз, острый лейкоз, острый лимфобластный лейкоз (ALL), острый лимфоцитарный лейкоз, B-клеточный, T-клеточный или FAB ALL, острый миелолейкоз (AML), острый миелогенный лейкоз, хронический миелоцитарный лейкоз (CML), хронический лимфолейкоз (CLL), волосатоклеточный лейкоз, миелодиспластический синдром (MDS), лимфома, болезнь Ходжкина, злокачественная лимфома, неходжкинская лимфома, лимфома Беркитта, множественная миелома, саркома Капоши, колоректальный рак, рак поджелудочной железы, рак носоглотки, злокачественный гистиоцитоз, паранеопластический синдром/гиперкальциемия при злокачественных новообразованиях, солидные опухоли, рак мочевого пузыря, рак молочной железы, колоректальный рак, рак эндометрия, рак головы, рак шеи, наследственный неполипозный рак, лимфома Ходжкина, рак печени, рак легких, немелкоклеточный рак легких, рак яичников, рак поджелудочной железы, рак простаты, почечно-клеточный рак, рак яичек, аденокарциномы, саркомы, злокачественная меланома, гемангиома, метастазы, связанная с раком резорбция костей, связанные с раком боли в костях и т.п.

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одного неврологического заболевания в клетках, тканях, органах, животных либо пациентах, в частности, по меньшей мере одного из следующего ряда: нейродегенеративные заболевания, рассеянный склероз, мигрень, СПИД-дементный комплекс, демиелинизирующие заболевания, например, рассеянный склероз и острый поперечный миелит; экстрапирамидные и мозжечковые расстройства, например, поражения кортико-спинальной системы; заболевания базальных ганглиев; гиперкинетические двигательные расстройства, например, хорея Хантингтона и старческая хорея; медикаментозные двигательные расстройства, например, вызванные лекарственными средствами, которые блокируют рецепторы дофамина ЦНС; гипокинетические двигательные расстройства, например, болезнь Паркинсона; прогрессирующий надъядерный паралич; структурные поражения мозжечка; спиноцеребеллярные дегенерации, например, спинная атаксия, атаксия Фридрейха, церебеллярные кортикальные дегенерации, дегенерации множественных систем (Mencel, Dejerine-Thomas, Shi-Drager и Machado-Joseph); системные нарушения (болезнь Рефсума, абеталипопротеинемия, атаксия, телеангиэктазия и митохондриальные расстройства множественных систем); демиелинизирующие заболевания мозга, например, рассеянный склероз, острый поперечный миелит; расстройства моторной единицы, например, нейрогенная мышечная атрофия (дегенерация клеток переднего рога спинного мозга, например, боковой амиотрофический склероз, инфантильная спинальная мышечная атрофия и ювенильная спинальная мышечная атрофия); болезнь Альцгеймера; синдром Дауна в среднем возрасте; заболевание с диффузными тельцами Леви; сенильная деменция, ассоциированная с тельцами Леви; синдром Вернике-Корсакова; хронический алкоголизм; болезнь Крейтцфельдта-Якоба; подострый склерозирующий панэнцефалит, болезнь Халлеррордена-Шпатца; деменция боксеров; нейротравмы (например, травма спинного мозга, черепно-мозговая травма, сотрясение мозга, повторное сотрясение мозга); боль; воспалительные боли; аутизм; депрессия; инсульт; когнитивные расстройства; эпилепсия; и т.п. Такой способ может необязательно включать введение эффективного количества композиции или фармацевтической композиции, содержащей по меньшей мере одно антитело к TNF, указанную часть или вариант, в клетки, ткани, органы, животным либо пациентам, которым требуется такого рода модулирование, лечение или терапия. См., например, Merck Manual, 16th Edition, Merck & Company, Rahway, NJ (1992).

Настоящее изобретение также относится к способу модулирования или лечения по меньшей мере одной раны, травмы, повреждения тканей или связанного хронического состояния в клетках, тканях, органах, животных либо пациентах, в частности по меньшей мере одного из следующего ряда: телесные повреждения или травмы, связанные с челюстно-лицевой хирургией, в том числе хирургией пародонта, удаление зубов, эндодонтическое лечение, установка зубных имплантатов, применение и использование зубного протеза; или раны из следующего ряда: асептические раны, ушибы, резаные раны, рваные раны, непроникающие раны, открытые раны, проникающие раны, сквозные раны, колотые раны, гнойные раны, инфаркты и подкожные раны; или раны из следующего ряда: ишемические язвы, пролежни, свищи, сильные укусы, термические ожоги и раны донорского участка; или раны, являющейся афтозной раной, травматической раной или герпес-ассоциированной раной.

Раны и/или язвы обычно выступают на коже или на поверхности слизистой оболочки либо возникают в результате инфаркта в органе. Рана может являться результатом повреждения мягких тканей, поражения или основного заболевания. В данном контексте термин «кожа» относится к внешней поверхности тела животных, в том числе человека, и включает неповрежденную или почти неповрежденную кожу, а также поврежденную поверхность кожи. Термин «слизистая оболочка» относится к неповрежденной или поврежденной слизистой оболочке животных, например, человека, и включает слизистую оболочку рта, щек, ушей, носа, легких, глаз, желудочно-кишечного тракта, вагинальную и прямой кишки.

В данном контексте термин «рана» означает телесные повреждения с нарушением нормальной целостности тканевых структур. Этот термин также включает понятия «кожная болезнь», «поражение», «некроз» и «язва». Распространенный термин «кожная болезнь» обычно означает практически любое поражение кожи или слизистых оболочек, а термин «язва» является локальным дефектом, полостью на поверхности органа или ткани, которая возникает в результате отторжения некротических тканей. «Поражение» в целом относится к любому дефекту ткани. «Некроз» относится к ткани, омертвевшей в результате инфекции, травмы, воспаления или инфарктов.

Термин «рана» в данном контексте означает любую рану (см. классификацию ран ниже) на любом отдельном этапе процесса заживления, в том числе на этапе до начала лечения или даже нанесения специальной раны, например, хирургического разреза (профилактическое лечение). Настоящее изобретение предназначено для предотвращения и/или лечения, например, следующих ран: асептические раны, ушибы, резаные раны, рваные раны, непроникающие раны (т.е. раны без нарушения кожи, но с повреждением нижележащих структур), открытые раны, проникающие раны, сквозные раны, колотые раны, гнойные раны, подкожные раны и т.д. Примерами кожных болезней являются пролежни, афтозные стоматиты, хромовые язвы, герпес и т.д. Примерами язв являются язвенная болезнь, язва двенадцатиперстной кишки, язва желудка, подагрическая язва, диабетическая язва, гипертоническая ишемическая язва, варикозная язва, язва нижних конечностей (венозная язва), подъязычная язва, подслизистая язва, симптоматическая язва, трофическая язва, тропическая язва и венерическая язва, например, вызванная гонореей (в том числе уретрит, эндоцервицит и проктит). К заболеваниям, связанным с ранами или кожными болезнями, которые могут успешно устранены с помощью настоящего изобретения, относятся ожоги, сибирская язва, столбняк, газовая гангрена, скарлатина, рожа, сикоз, фолликулит, контагиозное импетиго или буллезное импетиго и т.д. Термины «рана» и «язва», а также «рана» и «кожная болезнь» часто используются для обозначения одного и того же состояния; эти термины также часто являются взаимозаменяемыми без какой-либо последовательности. Поэтому, как упоминалось выше, в данном контексте термин «рана» включает термины «язва», «поражение», «кожная болезнь» и «инфаркт», причем, если не указано иного, эти термины являются взаимозаменяемыми.

Типы ран, поддающихся лечению с помощью настоящего изобретения, также включают (i) общие раны, например, хирургические, травматические, инфекционные, ишемические, тепловые, химические и буллезные раны; (ii) раны, специфические для полости рта, например, возникающие после удаления, эндодонтические раны, особенно связанные с лечением кист и абсцессов, язвы и поражения бактериального, вирусного или аутоиммунного генеза, механические, химические, тепловые, инфекционные и лихеноидные раны, герпес, афтозный стоматит, острый некротизирующий язвенный гингивит и синдром жжения полости рта; а также (iii) раны на коже, например, неоплазмы, ожоги (например, химические, тепловые), поражения (бактериальные, вирусные, аутоиммунные), укусы и хирургические разрезы. Согласно другой классификации раны разделяют на (i) небольшие потери ткани в связи с хирургическими разрезами, небольшими ссадинами и мелкими укусами и (ii) значительные потери ткани. В последнюю группу входят ишемические язвы, пролежни, свищи, рваные раны, сильные укусы, тепловые ожоги, раны донорского участка (в мягких и твердых тканях) и инфаркты.

В связи с настоящим изобретением важное значение также имеют такие раны, как ишемические язвы, пролежни, свищи, сильные укусы, тепловые ожоги и раны донорского участка. Ишемические язвы и пролежни - это раны, которые обычно заживают очень медленно, и в таких случаях улучшение и ускорение процесса заживления очень важны для пациента. Кроме того, когда заживление улучшается и ускоряется, стоимость лечения пациентов, страдающих от таких ран, заметно снижается.

Раны донорского участка - это раны, возникающие, к примеру, в связи с переносом твердых тканей из одной части тела в другую, например, в результате трансплантации. Раны, возникающие в результате таких операций, крайне болезненны, поэтому задача улучшения лечения является исключительно важной. Термин «кожа» используется в очень широком смысле и включает эпидермальный слой кожи, а в тех случаях, когда поверхность кожи повреждена в той или иной степени, также дермальный слой кожи. Не считая рогового слоя, эпидермальный слой кожи является внешним (эпителиальным) слоем, а более глубокий слой соединительной ткани кожи называется дермой.

Любой способ в соответствии с настоящим изобретением может включать введение эффективного количества композиции или фармацевтической композиции, содержащей по меньшей мере один белковый каркас, в клетки, ткани, органы, животным либо пациентам, которым требуется такого рода модулирование, лечение или терапия. Такой способ необязательно включает совместное введение или комбинированную терапию для лечения таких заболеваний или расстройств, при которых до, во время и/или после введения по меньшей мере одного названного белкового каркаса, его указанной части или варианта дополнительно вводится по меньшей мере одно лекарственное средство из следующего ряда: антагонист TNF (в частности, химический или белковый антагонист TNF, моноклональное или поликлональное антитело либо фрагмент TNF, растворимый рецептор TNF (например, p55, p70 и p85) или фрагмент, их слитые полипептиды или антагонист TNF с малой молекулой, например, TNF-связующий белок I или II (TBP-1 или TBP-II), нерелимонмаб, инфликсимаб, этанерцепт (Enbrel™), адалимумаб (Humira™), CDP-571, CDP-870, афелимомаб, ленерцепт и т.п.), противоревматическое лекарственное средство (например, метотрексат, ауранофин, ауротиоглюкоза, азатиоприн, натрия ауротиомалат, гидроксихлорохина сульфат, лефлуномид, сульфазалцин), миорелаксант, наркотик, нестероидный противовоспалительный препарат (НПВП), анальгетик, обезболивающее, успокоительное, местное обезболивающее, нервно-мышечный блокатор, антимикробное лекарственное средство (например, аминогликозид, противогрибковое, противопаразитарное, противовирусное, карбапенем, цефалоспорин, фторхинолон, макролид, пенициллин, сульфонамид, тетрациклин, другое антимикробное), противопсориазное, кортикостероид, анаболический стероид, противодиабетическое лекарственное средство, минерал, питательное вещество, связанное с щитовидной железой вещество, витамин, связанный с кальцием гормон, антидиарейное, противокашлевое, противорвотное, противоязвенное, слабительное, антикоагулянт, эритропоэтин (например, эпоэтин альфа), филграстим (например, G-CSF, нейпоген), сарграмостим (GM-CSF, лейкин), иммунизация, иммуноглобулин, иммунодепрессант (например, базиликсимаб, циклоспорин, даклизумаб), гормон роста, гормон-заместительное лекарственное средство, модулятор рецептора эстрогена, мидриатик, лекарственное средство против циклоплегии, алкилирующее лекарственное средство, антиметаболит, митотический ингибитор, радиофармпрепарат, антидепрессант, противоманиакальное, антипсихотическое, анксиолитическое, гипнотическое, симпатомиметик, стимулятор, донепезил, такрин, лекарственное средство против астмы, бета-агонист, вдыхаемый стероид, ингибитор лейкотриенов, метилксантин, кромолин, эпинефрин или аналог, дорназа альфа (пульмозим), цитокин или антагонист цитокинов. Подходящие дозы хорошо известны из уровня техники. См., например, Wells et al., eds., Pharmacotherapy Handbook, 2nd Edition, Appleton and Lange, Stamford, CT (2000); PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 2000, Deluxe Edition, Tarascon Publishing, Loma Linda, CA (2000); Nursing 2001 Handbook of Drugs, 21st edition, Springhouse Corp., Springhouse, PA, 2001; Health Professional's Drug Guide 2001, ed., Shannon, Wilson, Stang, Prentice-Hall, Inc, Upper Saddle River, NJ, каждая из этих публикаций полностью включена в настоящую заявку посредством ссылки.

Цитокины включают любые известные цитокины. См., например, CopewithCytokines.com. Антагонисты цитокинов включают, в частности, белковый каркас, антитело, фрагмент или миметик, растворимый рецептор, фрагмент или миметик, антагонист с малой молекулой или их комбинацию.

Как правило, лечение патологических состояний осуществляют путем введения эффективного количества или дозы по меньшей мере композиции белкового каркаса, которая в среднем содержит по меньшей мере приблизительно 0,01-500 мг по меньшей мере одного белкового каркаса на килограмм пациента в расчете на одну дозу и предпочтительно по меньшей мере приблизительно 0,1-100 мг белкового каркаса на килограмм пациента за одно или несколько введений в зависимости от специфической активности активного вещества, содержащегося в композиции. Альтернативно, эффективная концентрация в сыворотке может составлять 0,1-5000 мкг/мл после однократного или многократного введения. Подходящие дозы известны медицинским специалистам и, разумеется, зависят от конкретного патологического состояния, конкретного действия вводимой композиции и конкретного пациента, подвергающегося лечению. В некоторых случаях для достижения необходимого терапевтического уровня вещества может возникать необходимость в его повторном введении, т.е. повторном введении определенной контролируемой или измеряемой дозы, когда однократное введение препарата повторяется до тех пор, пока не оказывается достигнутыми требуемая дневная доза или эффект.

Количество предпочтительных доз может необязательно находиться в диапазоне от приблизительно 0,1 до 99 и/или от 100 до 500 мг/кг/введение, или в любом диапазоне, его значении или части, либо быть таким, чтобы сывороточная концентрация составляла приблизительно от 0,1 до 5000 мкг/мл в результате однократного или многократного введения, либо находилась в любом диапазоне, его значении или части. Предпочтительный диапазон дозировки для белкового каркаса в соответствии с настоящим изобретением составляет от приблизительно 1 мг/кг до приблизительно 3, приблизительно 6 или приблизительно 12 мг/кг веса тела пациента.

Кроме того, вводимая доза может варьироваться в зависимости от известных факторов, таких как фармакодинамические характеристики конкретного вещества, режим и способ его введения, возраст, состояние здоровья и вес пациента, характер и масштаб симптомов, характер проводимого параллельно лечения, частота лечения и требуемый эффект. Обычно доза активного вещества составляет приблизительно 0,1-100 мг на килограмм веса тела. Обычно от 0,1 до 50 и, предпочтительнее, от 0,1 до 10 мг на килограмм в расчете на одно введение, или при использовании лекарственных форм с замедленным высвобождением оказываются эффективными для достижения желаемых результатов.

Неограничивающим примером является лечение людей или животных путем однократного или периодического введения по меньшей мере одного белкового каркаса в соответствии с настоящим изобретением в количестве приблизительно 0,1-100 мг/кг или любого диапазона, его значения или части в день по меньшей мере в один из дней 1-40 или в качестве альтернативы либо дополнительно по меньшей мере в одну из недель 1-52 или в качестве альтернативы либо дополнительно по меньшей мере в один из 1-20 лет (возможно любое сочетание временных сроков) с помощью однократного введения, в/в вливания или неоднократного введения.

Лекарственные формы (композиция), пригодные для внутреннего введения, обычно содержат от приблизительно 0,001 мг до приблизительно 500 мг активного вещества на единицу или контейнер. В этих фармацевтических композициях активное вещество обычно присутствует в количестве приблизительно 0,5-99,999% в пересчете на общую массу композиции.

Для парентерального введения белковый каркас может быть приготовлен в виде раствора, суспензии, эмульсии, частиц, порошка или лиофилизированного порошка в сочетании с фармацевтически приемлемым парентеральным носителем или может поставляться раздельно с таким носителем. Примерами таких носителей являются вода, физиологический раствор, раствор Рингера, раствор декстрозы и человеческий сывороточный альбумин приблизительно 1-10%. Возможно также использование липосом и неводных наполнителей, таких как жирные масла. Наполнитель или лиофилизированный порошок может содержать добавки, способствующие изотоничности (например, хлорид натрия, маннит) и химической стабильности (например, буферы и консерванты). Препарат стерилизуется известными или приемлемыми методами.

Приемлемые фармацевтические носители описаны в последнем издании Remington's Pharmaceutical Sciences, A. Osol, которое является наиболее авторитетным источником в данной области техники.

Альтернативные способы введения

В соответствии с настоящим изобретением для введения фармацевтически эффективного количества по меньшей мере одного белкового каркаса в соответствии с настоящим изобретением могут быть использованы многие известные и разработанные способы. Далее описано ингаляционное введение, однако в соответствии с настоящим изобретением также могут быть использованы другие способы введения, дающие приемлемые результаты. Белковые каркасы в соответствии с настоящим изобретением могут доставляться в носителе, в виде раствора, эмульсии, коллоида, суспензии или сухого порошка, с помощью разнообразных устройств и способов, пригодных для введения ингаляционным или другим способом, описанным здесь либо известным из уровня техники.

Парентеральные препараты и введение

Препараты для парентерального введения могут в качестве общих наполнителей содержать стерильную воду, физиологический раствор, полиалкиленгликоли, такие как полиэтиленгликоль, масла растительного происхождения, гидрогенизированные нафталины и т.п. Водные или масляные суспензии для инъекций могут быть получены с помощью соответствующего эмульгатора или увлажнителя и суспендирующего вещества известными способами. Для инъекций могут быть использованы нетоксичные разбавители, не предназначенные для перорального введения, например, водный раствор, стерильный раствор для инъекций или суспензия в растворителе. В качестве носителя или растворителя допускается использовать воду, раствор Рингера, изотонический физиологический раствор и т.д.; в качестве обычного растворителя или суспендирующего растворителя может быть использовано стерильное нелетучее масло. Для этих целей допускается использовать любого рода нелетучее масло и жирную кислоту, включая естественные, синтетические и полусинтетические жирные масла или жирные кислоты, естественные, синтетические и полусинтетические моно-, ди- и триглицериды. Парентеральное введение известно из уровня техники и осуществляется, в частности, с помощью традиционных видов инъекций, пневматического безыгольного инъекционного устройства, описанного в патенте США № 5851198, и лазерного перфоратора, как описано в патенте США № 5839446; каждый источник полностью включен в текст настоящего документа путем ссылки.

Альтернативные способы доставки

Изобретение также относится к введению по меньшей мере одного белкового каркаса следующими способами: парентеральный, подкожный, внутримышечный, внутривенный, внутрисуставный, внутрибронхиальный, внутрибрюшной, интракапсулярный, внутрихрящевой, внутриполостной, интрацелиальный, интрацеребеллярный, интрацеребровентрикулярный, внутрь толстой/ободочной кишки, интрацервикальный, внутрижелудочный, внутрипеченочный, интрамиокардиальный, внутрикостный, внутритазовый, интраперикардиальный, внутрибрюшинный, внутриплевральный, внутрипростатический, внутрилегочный, интраректальный, интраренальный, интраретинальный, интраспинальный, интрасиновиальный, внутригрудной, внутриматочный, интравезикулярный, внутрь пораженных тканей, болюсный, вагинальный, ректальный, буккальный, сублингвальный, интраназальный или трансдермальный. По меньшей мере одна композиция белкового каркаса может быть приготовлена к использованию для парентерального (подкожного, внутримышечного или внутривенного) или любого другого введения, в частности, в виде жидких растворов или суспензий; для вагинального или ректального введения, в частности, в полутвердых формах, в том числе в виде кремов и суппозиториев; для буккального или сублингвального введения, в частности, в виде таблеток или капсул; для интраназального введения, в частности, в виде порошков, капель или аэрозолей в нос либо определенных веществ; для трансдермального введения, в частности, в виде геля, мази, лосьона, суспензии или пластыря с химическими усиливающими веществами, такими как диметилсульфоксид, добавленными с целью изменить структуру кожи или увеличить концентрацию вещества в трансдермальном пластыре (Junginger, et al. In «Drug Permeation Enhancement»; Hsieh, D. S., Eds., 59-90 (Marcel Dekker, Inc. New York 1994, источник полностью включен в текст настоящего документа путем ссылки), с окисляющими веществами, позволяющими применять на коже препараты с содержанием белков и пептидов (WO 98/53847), с применением электрического поля для создания промежуточных путей доставки, например, путем электропорации, для ускорения движения заряженных лекарственных средств через кожу, например, путем ионофореза, применения ультразвука, например, сонофореза (патенты США №№ 4309989 и 4767402) (вышеуказанные публикации и патенты полностью включены в текст настоящего документа путем ссылки).

Легочное/назальное введение

При легочном введении предпочтительно по меньшей мере одна композиция белкового каркаса доставляется в виде частиц, размер которых достаточен для проникновения в нижние дыхательные пути легких или синусы. В соответствии с изобретением по меньшей мере один белковый каркас может быть доставлен с помощью разнообразных ингаляционных или назальных устройств для введения лекарственного средства при вдыхании, известных из уровня техники. Такие устройства, предназначенные для доставки аэрозольных препаратов в полости синуса или альвеолы пациента, включают ингаляторы отмеренных доз, небулайзеры, генераторы сухого порошка, распылители и т.п. Из уровня техники также известны другие устройства, пригодные для легочного или назального введения белковых каркасов. Все устройства такого рода могут доставлять препараты, подходящие для введения белкового каркаса в виде аэрозоля. Такие аэрозоли могут содержать либо растворы (как водные, так и неводные), либо твердые частицы.

Ингаляторы отмеренных доз, например, Ventolin®, как правило, задействуют пропеллент и должны приводиться в действие во время вдоха (см., например, WO 94/16970, WO 98/35888). Порошковые ингаляторы, например, TurbuhalerTM (Astra), Rotahaler® (Glaxo), Diskus® (Glaxo), SpirosTM (Dura), устройства, поставляемые Inhale Therapeutics, и порошковые ингаляторы Spinhaler® (Fisons) приводятся в действие дыханием и подают смешанный порошок (US 4668218 Astra, EP 237507 Astra, WO 97/25086 Glaxo, WO 94/08552 Dura, US 5458135 Inhale, WO 94/06498 Fisons, каждый источник полностью включен в текст настоящего документа путем ссылки). Небулайзеры, например, AERxTM Aradigm, небулайзер Ultravent® (Mallinckrodt) и небулайзер Acorn II® (Marquest Medical Products) (US 5404871 Aradigm, WO 97/22376) (вышеуказанные источники полностью включены в текст настоящего документа путем ссылки), подают аэрозоли из растворов, тогда как ингаляторы отмеренных доз, порошковые ингаляторы и т.д. подают аэрозоли с мелкими частицами. Эти имеющиеся в продаже ингаляционные устройства приведены в качестве примеров конкретных устройств, пригодных для применения настоящего изобретения, и не ограничивают объем изобретения.

Предпочтительно композиция, содержащая по меньшей мере один белковый каркас, доставляется с помощью порошкового ингалятора или распылителя. Ингаляционное устройство для введения по меньшей мере одного белкового каркаса в соответствии с настоящим изобретением отличается рядом преимуществ. Например, доставка с помощью ингаляционного устройства характеризуется надежностью, воспроизводимостью и точностью. Ингаляционное устройство может необязательно осуществлять доставку сухих частиц малого размера, например, меньших чем 10 мкм, предпочтительнее приблизительно 1-5 мкм, что обеспечивает эффективную доставку на вдохе.

Введение композиций белкового каркаса в виде спрея

Спрей, содержащий композицию белкового каркаса, может быть получен путем принудительного пропуска суспензии или раствора по меньшей мере одного белкового каркаса через сопло под давлением. Размер и конфигурации сопла, действующее давление и скорость подачи жидкости могут быть выбраны в соответствии с требуемыми результатами и размером частиц. Например, электрораспыление осуществляется с помощью электрического поля и подачи через капиллярную трубку или сопло. Предпочтительно, чтобы частицы композиции по меньшей мере одного белкового каркаса, доставляемые в виде спрея, имели размер меньше чем приблизительно 10 мкм, предпочтительно в диапазоне от приблизительно 1 мкм до приблизительно 5 мкм и наиболее предпочтительно от приблизительно 2 мкм до приблизительно 3 мкм.

Препараты по меньшей мере одной композиции белкового каркаса, подходящие для использования с распылителем, обычно включают композицию белкового каркаса в водном растворе с концентрацией по меньшей мере одной композиции белкового каркаса на мл раствора или мг/г от приблизительно 0,1 мг до приблизительно 100 мг или в любом его диапазоне, значении или части. Препарат может включать такие вещества, как наполнитель, буфер, вещество изотонического действия, консервант, поверхностно-активное вещество и предпочтительно цинк. Препарат может также включать наполнитель или вещество для стабилизации композиции белковых каркасов, например, буфер, восстановитель, белок-наполнитель или углевод. К белкам-наполнителям, пригодным для приготовления композиций белкового каркаса, относятся альбумин, протамин и т.п. К типичным углеводам, пригодным для приготовления композиций белкового каркаса, относятся сахароза, маннит, лактоза, трегалоза, глюкоза и т.п. Препарат композиции белкового каркаса может также содержать поверхностно-активное вещество, способное уменьшить или предотвратить агрегацию композиции белкового каркаса на поверхности, вызываемую превращением раствора в аэрозоль. Можно использовать ряд традиционных поверхностно-активных веществ, таких как полиоксиэтилированные эфиры жирных кислот и спирты и полиоксиэтиленсорбитановые эфиры жирных кислот. Количества, как правило, составляют от 0,001 до 14% вес. препарата. Наиболее предпочтительными поверхностно-активными веществами для целей настоящего изобретения являются полиоксиэтиленсорбитанмоноолеат, полисорбат 80, полисорбат 20 и т.п. В препарат могут быть также включены известные из уровня техники дополнительные вещества, подходящие для добавления в препарат белка, такого как белковый каркас, его указанные части или варианты.

Введение композиций белкового каркаса с помощью небулайзера

Композиции белкового каркаса в соответствии с настоящим изобретением могут вводиться с помощью небулайзера, например, компрессорного или ультразвукового. В компрессорном небулайзере обычно используется источник сжатого воздуха для подачи струи воздуха через отверстие с высокой скоростью. По мере того как газ за соплом расширяется, возникает область низкого давления, под действием которой раствор композиции белкового каркаса подается через капиллярную трубку, соединенную с резервуаром с жидкостью. На выходе из капиллярной трубки поток жидкости разделяется на неустойчивые струи и капли, тем самым образуя аэрозоль. Для достижения требуемых характеристик можно подобрать компрессорный небулайзер с соответствующими параметрами конфигурации, скорости потока и типа экрана. В ультразвуковом небулайзере высокочастотная электрическая энергия используется для создания механических колебаний, как правило, с помощью пьезоэлектрического преобразователя. Эта энергия передается препарату композиции белкового каркаса напрямую или через связующую жидкость, в результате чего образуется аэрозоль, содержащий композицию белкового каркаса. Предпочтительно, чтобы размер частиц композиции белкового каркаса, доставляемых при помощи небулайзера, составлял меньше 10 мкм, предпочтительно находился в диапазоне от приблизительно 1 мкм до приблизительно 5 мкм и наиболее предпочтительно от приблизительно 2 мкм до приблизительно 3 мкм.

Препараты по меньшей мере одного белкового каркаса, подходящие для использования с компрессорным или ультразвуковым небулайзером, обычно содержат по меньшей мере один белковый каркас в концентрации от приблизительно 0,1 мг до приблизительно 100 мг на мл раствора. Препарат может включать такие вещества, как наполнитель, буфер, агент изотонического действия, консервант, поверхностно-активное вещество и предпочтительно цинк. Препарат может также включать наполнитель или вещество для стабилизации по меньшей мере одной композиции белкового каркаса, например, буфер, восстановитель, белок-наполнитель или углевод. К белкам-наполнителям, пригодным для приготовления композиций, содержащих по меньшей мере один белковый каркас, относятся альбумин, протамин и т.п. К типичным углеводам, пригодным для приготовления композиций, содержащих по меньшей мере один белковый каркас, относятся сахароза, маннит, лактоза, трегалоза, глюкоза и т.п. Препарат композиции, содержащей по меньшей мере один белковый каркас, может также содержать поверхностно-активное вещество, способное уменьшить или предотвратить агрегацию композиции, содержащей по меньшей мере один белковый каркас, на поверхности, вызываемую превращением раствора в аэрозоль. Можно использовать ряд традиционных поверхностно-активных веществ, таких как полиоксиэтилированные эфиры жирных кислот и спирты и полиоксиэтиленсорбитановые эфиры жирных кислот. Количества, как правило, составляют приблизительно от 0,001 до 4% вес. препарата. Наиболее предпочтительными поверхностно-активными веществами для целей настоящего изобретения являются полиоксиэтиленсорбитанмоноолеат, полисорбат 80, полисорбат 20 и т.п. В препарат могут быть также включены известные из уровня техники дополнительные вещества, подходящие для добавления в препарат белка, такого как белковый каркас.

Введение композиций белкового каркаса с помощью ингалятора отмеренных доз

В ингаляторе отмеренных доз (MDI) пропеллент, по меньшей мере один белковый каркас и любые наполнители или другие добавки находятся в канистре в виде смеси, содержащей сжиженный сжатый газ. Приведение в действие отмеряющего клапана высвобождает смесь в виде аэрозоля, предпочтительно содержащего частицы, меньшие по размеру, чем примерно 10 мкм, предпочтительно находящиеся в диапазоне от приблизительно 1 мкм до приблизительно 5 мкм и наиболее предпочтительно от приблизительно 2 мкм до приблизительно 3 мкм. Требуемый размер частиц аэрозоля можно варьировать, используя различные способы приготовления композиции белкового каркаса, известные специалистам в данной области техники, в том числе размол на струйной мельнице, распылительную сушку, конденсацию в критических точках и т.п. Предпочтительными являются ингаляторы отмеренных доз, выпускаемые 3M или Glaxo и использующие в качестве пропеллента гидрофторуглерод. Препараты по меньшей мере с одним белковым каркасом для использования в ингаляторе отмеренных доз обычно включают мелкодисперсный порошок, содержащий по меньшей мере один белковый каркас в виде суспензии в неводной среде, например, взвешенный в пропелленте с помощью поверхностно-активного вещества. Пропеллент может быть выбран из числа веществ, традиционно используемых в этих целях, например, хлорфторуглерода, гидрохлорфторуглерода, гидрофторуглерода или углеводорода, в том числе трихлорфторметана, дихлордифторметана, дихлортетрафторэтанола и 1,1,1,2-тетрафторэтана, HFA-134a (гидрофторалкана-134a), HFA-227 (гидрофторалкана-227) и т.п. Предпочтительным пропеллентом является гидрофторуглерод. Поверхностно-активное вещество может служить таким целям, как стабилизация по меньшей мере одного белкового каркаса в виде суспензии в пропелленте, защита активного вещества от химической деградации и т.п. В качестве поверхностно-активных веществ могут быть использованы, в частности, сорбитана триолеат, соевый лецитин, олеиновая кислота и т.п. В некоторых случаях предпочтительными являются аэрозоли растворов, в которых применяются растворители, такие как этанол. В препарат белка могут быть также включены известные из уровня техники дополнительные вещества, подходящие для добавления в препарат белка. Средним специалистам в данной области техники будет ясно, что способы в соответствии с настоящим изобретением могут быть достигнуты путем легочного введения по меньшей мере одной композиции белкового каркаса через устройства, не описанные в настоящем документе.

Пероральные препараты и введение

Препараты для перорального введения предполагают совместное введение с адъювантами (например, резорцинами и неионогенными поверхностно-активными веществами, такими как полиоксиэтилена олеиловый эфир и н-гексадецил-полиэтилена эфир) для искусственного увеличения проницаемости стенок кишечника, а также совместное введение с ферментативными ингибиторами (например, ингибиторами трипсина поджелудочной железы, диизопропилфлуорофосфатом (DFF) и трасилолом) для подавления ферментативной деградации. Препараты для доставки гидрофильных веществ, включая белки, белковые каркасы и комбинации по меньшей мере двух поверхностно-активных веществ, предназначенные для перорального, буккального, мукозального, назального, легочного, вагинального, трансмембранного или ректального введения, описаны в патенте США № 6309663. Активное соединение, входящее в состав твердой лекарственной формы для перорального введения, может быть смешано по меньшей мере с одной добавкой, включая сахарозу, лактозу, целлюлозу, маннит, трегалозу, раффинозу, мальтит, декстран, крахмалы, агар, аргинаты, хитины, хитозаны, пектины, трагакант, гуммиарабик, желатин, коллаген, казеин, альбумин, синтетический или полусинтетический полимер и глицерид. Эти лекарственные формы могут также содержать добавки других типов, например, неактивный разбавитель, скользящее вещество, такое как стеарат магния, парабен, консервант, такой как сорбиновая кислота, аскорбиновая кислота, альфа-токоферол, антиоксидант, такой как цистеин, дезинтегратор, связывающее вещество, загуститель, буферное вещество, подсластитель, ароматизатор, отдушку и т.п.

Таблетки и пилюли могут быть дополнительно покрыты кишечнорастворимой оболочкой. К жидким препаратам для перорального введения относятся эмульсия, сироп, эликсир, суспензия и раствор, подходящие для медицинского применения. Эти препараты могут содержать неактивные разбавители, традиционно используемые в данной области техники, например, воду. В качестве систем доставки инсулина и гепарина также предложены липосомы (патент США № 4239754). В недавнем времени для доставки лекарственного средства были предложены микросферы из искусственных полимеров смешанных аминокислот (протеиноидов) (патент США № 4925673). Кроме того, из уровня техники известны носители, описанные в патентах США №№ 5879681 и 5871753 и предназначенные для перорального введения биологически активных веществ.

Мукозальные препараты и введение

Препарат для перорального введения биологически активного вещества, инкапсулированного в одном или нескольких биосовместимых полимерных или сополимерных наполнителях, предпочтительно в биоразлагаемых полимерах или сополимерах, таким образом представляющий собой микрокапсулы, которые в силу соответствующего размера способны обеспечить получение вещества групповыми лимфатическими фолликулами животного, называемыми также бляшками Пейера или GALT, без потери эффективности, характерной при прохождении через желудочно-кишечный тракт. Аналогичные групповые лимфатические фолликулы содержатся в бронхах (BALT) и толстой кишке. Вышеуказанные ткани в целом называются лимфоретикулярными тканями, ассоциированными со слизистыми оболочками (MALT). К композициям и способам введения по меньшей мере одного белкового каркаса через слизистые оболочки относится эмульсия, содержащая множество субмикронных частиц, мукоадгезивную макромолекулу, биологически активный пептид и непрерывную водную фазу, способствующую всасыванию через слизистые оболочки за счет мукоадгезии частиц эмульсии (патент США № 5514670). Способы введения эмульсий в соответствии с настоящим изобретением через слизистые оболочки включают роговичный, конъюнктивальный, буккальный, сублингвальный, назальный, вагинальный, легочный, желудочный, кишечный и ректальный. Препараты для вагинального или ректального введения, например, суппозитории, в качестве наполнителей могут содержать, например, полиалкиленгликоли, вазелин, масло какао и т.п. Препараты для интраназального введения могут быть твердыми и в качестве наполнителей содержать, например, лактозу, или могут быть водными либо масляными растворами в виде капель для носа. Для буккального введения могут применяться такие наполнители, как сахар, кальция стеарат, магния стеарат, прежелатинированный крахмал и т.п. (патент США № 5849695).

Трансдермальные препараты и введение

Для трансдермального введения по меньшей мере один белковый каркас инкапсулируется в средстве доставки, таком как липосомы или полимерные наночастицы, микрочастицы, микрокапсулы или микросферы (совместно именуемые микрочастицами, если не указано иное). Известен ряд приемлемых средств, в том числе микрочастицы из синтетических полимеров, таких как полигидроксикислоты, например, полимолочная кислота, полигликолевая кислота и их сополимеры, полиортоэфиры, полиангидриды и полифосфазены, и естественных полимеров, таких как коллаген, полиаминокислоты, альбумин и другие белки, альгинат и другие полисахариды и их комбинации (патент США № 5814599).

Препараты и введение, обеспечивающие пролонгированное действие

Возможны ситуации, в которых однократно введенные соединения в соответствии с настоящим изобретением должны доставляться пациенту в течение длительного периода времени, например, от одной недели до одного года. Возможно применение различных лекарственных форм для замедленного высвобождения, пролонгированного действия или имплантации. К примеру, лекарственная форма может содержать фармацевтически приемлемую нетоксичную соль соединений, которая имеет низкую степень растворимости в жидкостях организма, например, (a) соль присоединения кислоты с многоосновной кислотой, такой как фосфорная кислота, серная кислота, лимонная кислота, винная кислота, дубильная кислота, памовая кислота, альгиновая кислота, полиглутаминовая кислота, нафталина моно- или ди-сульфокислоты, полигалактуроновая кислота и т.п.; (b) соль с поливалентным катионом металла, таким как цинк, кальций, висмут, барий, магний, алюминий, медь, кобальт, никель, кадмий и т.п., либо с органическим катионом, образованным, например, из N,N'-дибензил-этилендиамина или этилендиамина, либо (c) комбинации (a) и (b), например, соль танната цинка. Кроме того, соединения в соответствии с настоящим изобретением или предпочтительно относительно нерастворимая соль, например, из числа вышеуказанных, могут быть получены в виде геля, в частности, подходящего для инъекций гелеобразного алюминия моностеарата, например, с кунжутным маслом. Наиболее предпочтительными солями являются соли цинка, соли танната цинка, соли памовой кислоты и т.п. Другой тип препарата замедленного высвобождения или пролонгированного действия для инъекций содержит соединение или соль, диспергированные для инкапсуляции в медленно деградирующем, нетоксичном, неантигенном полимере, таком как полимер полимолочной кислоты/полигликолевой кислоты, как описано, например, в патенте США № 3773919. Соединения или предпочтительно относительно нерастворимые соли, например, из числа вышеуказанных, могут быть также получены в виде капсул Silastic с холестериновым матриксом, особенно подходящих для использования у животных. В литературе также упоминаются другие препараты для замедленного высвобождения, пролонгированного действия или имплантации, например, липосомы в виде газа или жидкости (патент США № 5770222 и «Sustained and Controlled Release Drug Delivery Systems», J. R. Robinson ed., Marcel Dekker, Inc., N.Y., 1978).

Приведенное выше общее описание изобретения дополнительно разъясняется далее с помощью примеров, которые представлены в качестве иллюстрации и не являются ограничивающими.

Примеры

Пример 1. Конструкция фибкона

10-ый домен FN3 человеческого фибронектина (SEQ ID NO: 10) был использован в качестве альтернативного каркаса, который может быть подвергнут конструктивным изменениям, позволяющим осуществлять связывание специфических мишеней посредством поверхностно расположенных петель, структурно схожих с гипервариабельными участками антител (CDR), обозначенных как B:C, D:E и F:G петли (фигура 1) . Белок фибронектина содержит 14 других независимо свернутых доменов FN3, каждый из которых, как предполагается на основании сходства первичной аминокислотной последовательности, приобретает конформацию, сходную с 10-ым доменом FN3 (SEQ ID NO: 1-9, 11-15). Действительно, консервация структуры нескольких из этих доменов подтверждается высокоразрешающим структурным анализом 1, 7, 8, 9, 10, 12, 13 и 14 доменов FN3 фибронектина . С целью подтверждения того, что все 15 доменов могут образовывать независимо свернутые структуры, при помощи ПЦР-амплификации из одного источника человеческой кДНК были получены генные последовательности, кодирующие каждый из этих доменов (Biochain Institute Inc. (Hayward, CA)) с использованием стандартных методов ПЦР, далее субклонированные в модифицированный вектор pET15 (Novagen), с последующей трансформацией BL21Star(DE3) E. coli (Invitrogen), высеянных на планшеты с LB агаром, содержащим 75 мкг/мл карбенициллина. Нуклеотиды, кодирующие 6X полигистидиновый тег, добавляли к C-концу каждого гена в ходе ПЦР. 7 домен FN3 не мог быть удачно клонирован из данного источника кДНК, поэтому этот домен не был включен в представленный в настоящем документе анализ. Для каждой из генетических конструкций были отобраны единичные бактериальные колонии, которые выращивали в течение ночи при 37°C в объеме 50 мл среды TB, содержащей 2% глюкозы и 100 мкг/мл карбенициллина. Эту культуру использовали для посева в 500 мл аутоиндукционной среды (Overnight Express Instant TB media, Novagen) в колбе Ultra Yield (Thomson Instrument Company) объемом 2,5 л. Рост и экспрессия осуществлялись с использованием двухэтапной программы (3 часа при 37°C, 300 об/мин и последующей инкубацией 16 часов при 30°C, 250 об/мин) в инкубаторе ATR Multitron с подвижной платформой.

Культуру собирали и центрифугировали при 7000 об/мин в течение 15 минут в роторе JL8.1 для осаждения клеток. Клетки ресуспендировали в 30 мл буфера, содержащего 20 мМ фосфата натрия, pH 7,5, 500 мМ NaCl, 10% глицерина, 20 мМ имидазола, 0,37 мг/мл лизоцима, 1X ингибитора протеаз, не содержащего ЭДТА (Complete Protease inhibitor, EDTA-free; Roche) и бензоназу (Benzonase, Sigma-Aldrich, конечная концентрация 0,25 мкл/мл) и лизировали при помощи соникатора Misonix XL2020 в течение 5 минут на льду, в пульсовом режиме (включение в течение 5 секунд, выключение в течение 30 секунд). Нерастворимый материал удаляли центрифугированием при 17000 об/мин в течение 30 мин с использованием ротора JA-17.

Белки FN3 очищали из растворимой фракции лизата при помощи 2-ступенчатого хроматографического процесса. Вначале в процессе афинной хроматографии с использованием иммобилизованных металлов белок захватывали при добавлении к лизату 2 мл Ni-NTA агарозных бус (Qiagen) и инкубировании смеси на качающейся платформе в течение 1 часа при 4°C. Смолу затем помещали в колонку Poly-Prep (Bio-Rad) и промывали 20 мМ натрия фосфата, рН 7,5, 500 мМ NaCl, 10%-ного глицерина и 20 мМ имидазола для удаления несвязанного материала. Белки элюировали из смолы с помощью 20 мМ натрия фосфата, рН 7,5, 500 мМ NaCl, 10%-ного глицерина и 500 мМ имидазола. Фракции анализировали с помощью SDS-PAGE, включая окрашивание Кумасси и вестерн-блоттинг с использованием HRP-конъюгированных антител к гистамину (Immunology Consultants Laboratory). Требуемые фракции объединили и диализовали в ФБР рН 7,4. На втором этапе очистки белок загрузили в колонку Superdex-75 HiLoad 16/60 (GE Healthcare), уравновешенную в ФБР. Фракции анализировали с помощью SDS-PAGE, и фракции, содержащие белок FN3, объединяли и концентрировали с использованием концентратора Centriprep UltraCel YM-3 (Amicon).

Концентрацию белка определяли с помощью измерительного устройства BioTek путем измерения оптической плотности пробы при 280 нм. Конечный продукт анализировали при помощи окрашивания Кумасси, вестерн-блота с антителом к гистидину и HPLC-SEC хроматографии с использованием колонки G3000SW-XL (TOSOH Biosciences) уравновешенной ФБР. Анализ SDS-PAGE показал, что домены FN3 мигрируют между 6 и 14 кДа, в соответствии с предполагаемыми массами мономерных белков.

Свертывание и термостабильность каждого домена FN3 были охарактеризованы с помощью дифференциальной сканирующей калориметрии. Данные дифференциальной сканирующей калориметрии были получены при нагревании раствора каждого домена FN3 в ФБР с концентрацией 1,0 мг/мл от 35°C до 95°C со скоростью 1°C/мин в калориметре N-DSCII (Applied Thermodynamics). Кривую контрольного образца, содержащего только буфер, вычитали при получении результатов, представленных на фигурах 2A-N. На основании этих данных с помощью программного обеспечения CpCalc (Microcal) для каждого домена рассчитывали температуру плавления, результаты представлены в таблице 1. Эти данные указывают на то, что каждый домен независимо свернут и что домены демонстрируют широкий диапазон термостабильности.

В целях выявления консенсусной аминокислотной последовательности был осуществлен множественный сравнительный анализ линейных последовательностей 15 доменов FN3. Множественный сравнительный анализ линейных последовательностей на фигуре 3 показывает, что хотя эти 15 доменов сворачиваются с образованием сходных структур, они имеют достаточно незначительное сходство первичных аминокислотных последовательностей, в диапазоне от 27 до 48%. Первая консенсусная последовательность, выполненная так, чтобы включать наиболее консервативные аминокислотные остатки в каждом из сравниваемых положений, показана на фигуре 3. Первая консенсусная последовательность идентична аминокислотным последовательностям 15 доменов FN3 фибронектина в диапазоне от 42 до 62%, со средней степенью идентичности, равной 45%. Аминокислотная последовательность первой консенсусной последовательности была транслирована в обратном направлении, и синтетическая генная последовательность, кодирующая этот белок, была синтезирована при помощи перекрывающихся ПЦР и субклонирована в модифицированный вектор pET15 с целью экспрессии. В целях экспрессии вектор трансформировали в клетки E. coli BL21-Gold(DE3) (Stratagene), и отдельные колонии инокулировали в 0,5 мл среды 2YT, содержащей ампициллин. Экспрессию индуцировали добавлением ИПТГ (изопропил-β-D-1-тиогалактопиранозида) до конечной концентрации 1 мМ, когда оптическая плотность суспензионной культуры достигала ~0,6 при длине волны 600 нм. Экспрессию контролировали с помощью SDS-PAGE через 5 часов после индукции при 30°C. Анализ результатов SDS-PAGE показал отсутствие признаков экспрессии этого белка в клетках E. coli.

Поскольку сравнительный анализ линейных последовательностей на фигуре 3 показывает, что существуют множественные положения, для которых невозможно определить подлинную консенсусную последовательность, то в качестве попытки получения белка, который мог бы экспрессироваться в клетках E. coli, была создана альтернативная консенсусная последовательность. Вторая консенсусная последовательность была идентична первой в 79 из 89 положений, что давало идентичность последовательности в диапазоне от 37 до 63% (средняя степень идентичности равна 51%) 15 доменам FN3 фибронектина. Аминокислотная последовательность второй консенсусной последовательности была транслирована в обратном направлении и генная последовательность использовалась для создания экпрессирующего вектора, как описано в случае первой консенсусной последовательности. Как и в первом случае, экспрессия второй консенсусной последовательности на детектируемом уровне отсутствовала в клетках E. coli.

Поскольку первые две созданные консенсусные последовательности не были экспрессированы в клетках E. coli, был избран третий подход к решению этой проблемы. В рамках этого подхода с целью максимального увеличения шансов выработки стабильного консенсусного белка осуществили сравнительный анализ первичных аминокислотных последовательностей лишь наиболее стабильных доменов FN3. В таблице 1 показано, что все 1, 2, 5, 8, 10, 12, 14 и 15 домены имеют температуру плавления выше 70°C. С целью создания консенсусной последовательности был выполнен множественный сравнительный анализ линейных последовательностей 1, 5, 8, 10, 12, 14, и 15 доменов (фигура 4). 2 домен был исключен из анализа, поскольку структурный анализ ранее показал, что N-концевая нить «A» этого домена является неупорядоченной . Фибкон (SEQ ID NO: 16) был создан посредством отбора наиболее часто используемых аминокислотных остатков в каждом из сравниваемых положений, показанных на фигуре 4. Идентичность фибкона индивидуальным доменам, показанным на фигуре 4, находится в диапазоне от 40 до 64%.

Аминокислотная последовательность фибкона была транслирована в обратном направлении в целях получения нуклеотидной последовательности, демонстрируемой SEQ ID NO: 17 и субклонированной в модифицированный вектор pET27 (Novagen) при помощи методов клонирования без использования лигазы. Этот вектор был использован для трансформации клеток BL21-GOLD (DE3), которые высевали на планшеты с LB агаром с добавлением 50 мкг/мл канамицина. 10 мл среды 2YT/Kan инокулировали клетками 1 колонии с планшета и выращивали в течение ночи при температуре 37°C. Такую ночную культуру использовали для последующей инокуляции 500 мл среды 2YT, содержащей 50 мкг/мл канамицина, и дальнейшей инкубации при 37°C до тех пор, пока оптическая плотность суспензионной культуры не достигала ~0,6 при длине волны 600 нм, когда добавляли ИПТГ, и температура снижалась до 30°C. Клетки собирали центрифугированием при 4000×g через 5 часов после индукции экспрессии. Клеточный осадок лизировали добавлением 5 мл реагента BugBuster (Novagen) и 1 мкл бензоназы (Novagen) в расчете на один грамм влажного осадка и инкубацией на раскачивающейся платформе при комнатной температуре, в течение 30 минут, после чего лизат очищали центрифугированием при 15000×g в течение 30 минут. Очищенный лизат наносили на хроматографическую колонку Hitrap HP Ni-NTA (GE Healthcare) объемом 1 мл и промывали 10-кратным объемом ФБР pH 7,4 и 12,5 мМ раствора имидазола. Фибкон элюировали с колонки посредством градиента имидазола от 12,5 мМ до 250 мМ в объеме, превышающем объем колонки в 20 раз. Фракции анализировали с помощью SDS-PAGE (фигуры 5A и 5B), объединяли и концентрировали перед нанесением на колонку для гель-фильтрации superdex 75 16/60 (GE Healthcare) в ФБР. Фигуры 5A и 5B демонстрируют, что фибкон целиком экспрессируется растворимой фракцией E. coli, эффективно очищается и присутствует только в мономерной форме.

Свертывание и термостабильность фибкона оценивали дифференциальной сканирующей калориметрией и внутренней флуоресценцией триптофана. Данные дифференциальной сканирующей калориметрии были получены при нагревании раствора фибкона в ФБР с концентрацией 1,0 мг/мл от 30°C до 115°C со скоростью 1°C/мин в калориметре N-DSCII (Applied Thermodynamics). Кривую контрольного образца, содержащего только буфер, вычитали при получении результатов, представленных на фигуре 6. Профиль температуры плавления соответствует конформации домена, показывая, что фибкон является высокоустойчивым белком с температурными переходами при 82°C и 105°C. Переход при 105°C наиболее вероятно связан с агрегацией фибкона при высоких температурах, поскольку этот переход зависит от концентрации.

Фибкон содержит единственный остаток триптофана, который, как предполагается на основании данных структурного анализа других доменов FN3, спрятан внутри гидрофобной сердцевины белка. Флуоресценцию этого остатка триптофана использовали в целях контроля конформационного свертывания фибкона посредством уравновешивания раствора фибкона (10 мкМ) забуференными растворами 50 мМ фосфата натрия с pH 7,0, 150 мМ NaCl и гуанидина гидрохлорида (Gu-HCl) в 96-луночном планшете. Концентрация раствора Gu-HCl варьировала в каждой лунке планшета от 0 до 6,5 M с инкрементами по 0,25 M. Флуоресценцию триптофана контролировали посредством возбуждения при длине волны 280 нм и эмиссии при 365 нм с использованием планшеточного детектора, снабженного монохроматором SpectraMax M5 (Molecular Devices). Фигура 7 демонстрирует конформационное сворачивание фибкона при концентрациях Gu-HCl ниже 4 M. Флуоресценция остатка триптофана в ходе титрования гуанидина подтверждает конформацию и структуру фибкона.

Преимущества

Белок фибкона имеет высокую термостабильность, равную 82°C. На основании такой высокой стабильности можно предполагать, что данная каркасная молекула будет легко поддаваться аминокислотным заменам в составе петель или нитей, а также будет легко производиться, что делает ее ценной альтернативной каркасной молекулой. Мутации, снижающие стабильность белка, вероятно будут иметь меньше негативных последствий в контексте более стабильного каркаса, и, таким образом, молекулярный каркас с высокой степенью стабильности с большей вероятностью даст начало наиболее функциональным, хорошо упакованным связывающим веществам из библиотеки каркасных вариантов. Поскольку этот новый белок не является белком, кодируемым человеческим геномом, при его назначении людям в качестве терапевтического или диагностического инструмента будет возникать меньший риск развития иммунной реакции на естественные домены человеческого фибронектина в сравнении с каркасными молекулами, основанными на первичной аминокислотной последовательности естественных доменов фибронектина, таких как 10-ый домен FN3.

Пример 2. Создание библиотек фибкона

Библиотеки вариантов фибкона могут быть созданы многими различными способами в зависимости от требуемой степени их сложности и относительного расположения мутаций в молекуле. Способы синтеза ДНК являются предпочтительными при создании мутаций, рассеянных вдоль всего гена фибкона. Возможно также использование клонирования с помощью ферментов рестрикции, позволяющее рекомбинировать фрагменты ДНК, содержащие мутации в различных участках гена. Насыщающий мутагенез в пределах определенного малого участка гена, такого как единичная петля фибкона, может обеспечиваться использованием вырожденного олигонуклеотида и мутагенеза, направляемого олигонуклеотидом .

При помощи мутагенеза, направляемого олигонуклеотидом, создана библиотека фибкона, предназначенная для замены петли FG 7-12 случайными аминокислотами. Синтезирован олигонуклеотид, включающий вырожденные нуклеотиды NNS в положениях, кодирующих петлю FG и две фланкирующие последовательности протяженностью 20-27 п.н., комплементарные последовательности гена фибкона. При такой конструкции все двадцать аминокислот могут быть представлены в петле FG.

Матрица для мутагенеза, направляемого олигонуклеотидом, создана посредством замены последовательности, кодирующей петлю F:G фибкона, шпилечными последовательностями, содержащими рестрикционный сайт AscI. Эта система допускает ликвидацию фоновой ДНК-матрицы после мутагенеза за счет расщепления полученной ДНК с помощью AscI до трансформации. Для очистки одноцепочечной ДНК-матрицы для последующего мутагенеза единичную колонию клеток E. coli CJ236, содержащих вектор, использовали для инокуляции 5 мл ростовой среды 2YT, содержащей карбенициллин (конечная концентрация 50 мкг/мл) и хлорамфеникол (10 мкг/мл). Через 6 часов добавляли бактериофаг VCSM13 до конечной концентрации 1010 БОЕ/мл, после чего культуру инкубировали без встряхивания в течение 10 мин., добавляли к 150 мл среды 2YT, содержащей карбенициллин (10 мкг/мл) и уридин (0,25 мкг/мл), и инкубировали при 37°C и встряхивании со скоростью 200 об/мин в течение ночи. Клетки осаждали центрифугированием, супернатант отбирали и бактериофаги осаждали при помощи ПЭГ NaCl. Одноцепочечную ДНК очищали из осадка с использованием набора QIAprep Spin M13 (Qiagen) в соответствии с инструкциями производителя.

Для отжига вырожденного нуклеотида и матрицы 5 мкг матричной ДНК смешивали с олигонуклеотидом в молярном соотношении 10:1 в растворе Tris-HCl (50 мМ, pH 7,5) и MgCl2 (10 мМ) и инкубировали при 90°C в течение 2 мин, 60°C в течение 3 мин и 20°C в течение 5 мин. По завершении отжига к реакционной смеси добавляли АТФ (10 мМ), дНТФ ( 25 мМ каждый), ДТТ (100 мМ), лигазу T4 (7 единиц) и ДНК полимераза T7 (10 единиц), и инкубацию продолжали при 14°C в течение 6 часов, а затем при 20°C в течение 12 часов. Образующуюся в результате ДНК очищали с использованием набора для очистки продуктов ПЦР (Qiagen) и растворяли в 100 мкл воды. Библиотеку ДНК подвергали обработке 10 единиц. рестриктазы AscI в течение 4 часов, а затем вновь очищали при помощи набора для очистки продуктов ПЦР. В завершение библиотеку ДНК растворяли в 50 мкл воды. Окончательный препарат двухцепочечной ДНК использовали для трансформации клеток E. coli MC1061F' посредством электропорации.

Трансформированные клетки собирали в 20 мл среды SOC и инкубировали в течение 1 часа при 37°C. По окончании часовой инкубации небольшой объем трансформированных клеток серийно разбавляли и высевали на планшеты с питательной средой, содержащей карбенициллин (100 мкг/мл) и 1% глюкозы, с целью определения общего количества трансформированных клеток. Оставшийся объем культуры в среде SOC использовали для инокуляции 1 л среды 2xYT, содержащей карбенициллин и 1% глюкозы, и последующего роста до тех пор, пока оптическая плотность при OD600 не достигала 0,6. 100 мл этой культуры инокулировали бактериофагом M13 до конечной концентрации 1010/мл, инкубировали при 37°C и осаждали центрифугированием. Клеточный осадок ресуспендировали в 500 мл свежей среды 2xYT, содержащей карбенициллин (100 мкг/мл) и канамицин (35 мкг/мл), и выращивали при 30°C в течение ночи перед осаждением центрифугированием. Фаговые частицы преципитировали добавлением ПЭГ/NaCl и хранили при -80°C.

Вторую библиотеку создали с целью одновременного внесения разнообразия в пределах петель фибкона B:C и F:G. Для осуществления этой задачи синтезировали два нуклеотида. Прямоориентированный олигонуклеотид фосфорилирован и содержит вырожденный кодон NNS в каждом из положений кодирующих петлю B:C, в то время как обратноориентированный олигонуклеотид биотинилирован с 5' конца и содержит 21 основание NNS кодона в каждом из положений, кодирующих петлю F:G. Оба олигонуклеотида фланкированы двумя последовательностями из 18 п.о., идентичными участку, предшествующему и следующему за участком, который подвергается мутагенезу.

Для создания библиотеки шестнадцать ПЦР в объеме 100 мкл каждая выполняли с использованием указанных олигонуклеотидов с целью амплификации ДНК-матрицы фибкона, одновременно внося кодоны NNS в состав петель B:C и F:G. Двухцепочечные продукты ПЦР смешивали с магнитными бусами, покрытыми стрептавидином (Dynal) в буфере B&W (10 мМ Tris-HCl, pH 7,5, 1 мМ ЭДТА, 2M NaCl, 0,1% Tween-20) и инкубировали в течение 20 мин, бусы осаждали магнитным полем и дважды промывали буфером B&W. Прямоориентированную нить элюировали с бус 300 мкл 150 мМ раствора NaOH. Такой «мегапраймер», представляющий собой смесь длинных праймеров, теоретически имеющих степень разнообразия более чем 8×1016, используют для отжига с библиотекой одноцепочечных матриц. Создание библиотеки выполняется в соответствии с вышеописанным подходом, использованным для создания первой библиотеки.

Пример 3. Селекция веществ, связывающихся с белком-мишенью

С целью селекции компонентов библиотеки фибкона, связывающихся с белком-мишенью, белок-мишень биотинилируется с использованием реагента сульфо-NHS-LC-биотин (Pierce) и диализируется относительно ФБР. Для проведения селекции 200 мкл библиотек фагового дисплея блокируют при помощи 200 мкл реагента Chemiblocker с последующим добавлением биотинилированного белка-мишени в концентрации 500 нМ (1 этап) или 100 нМ (этапы 2 и 3). Связанные фаги выделяют при помощи магнитного микроносителя Neutravidin (Seradyne) на 1 этапе или магнитного микроносителя, покрытого стрептавидином (Promega) на этапах 2 и 3. Несвязанные фаговые частицы вымывают из бус в результате 5-10 этапов промывания 1 мл солевого раствора с Tris-буфером и твином (TBST) с последующими 2 этапами промывания 1 мл солевого раствора с Tris-буфером (TBS). Связанные фаги элюируют с бус добавлением клеток E. coli MC1061F', находящихся в середине логарифмической фазы роста. Инфицированные клетки высевают на планшеты с агаром LB с добавлением карбенициллина и глюкозы. На следующий день клетки соскребают с планшета и выращивают до середины логарифмической фазы роста, когда к ним добавляют хелперный фаг VCSM13 и культивирование продолжают в течение ночи. Фаговые частицы изолируют преципитацией ПЭГ/NaCl и используют на следующем этапе селекции.

После 3-х или более раундов пэннинга относительно белка-мишени результирующий продукт субклонируют в вектор pET27, модифицированный таким образом, чтобы он имел независимые от лигазы сайты клонирования, при помощи амплификации гена фибкона в ходе ПЦР. Такой продукт ПЦР отжигают с вектором и используют для трансформации клеток BL21-GOLD(DE3) (Stratagene). Индивидуальными колониями инокулируют 1 мл ростовой среды в 96-луночном планшете с глубокими лунками (Corning), выращивая культуры до насыщения в течение ночи при 37°C. На следующий день 50 мкл ночной культуры используют для инокуляции 1 мл свежей среды. Культуры выращивают при 37°C в течение 2 часов, затем добавляют ИПТГ до 1 мМ, снижая при этом температуру инкубации до 30°C. Клетки осаждают центрифугированием спустя 16 часов после индукции и лизируют 100 мкл реагента BugBuster (Novagen). Получаемые в результате лизаты очищают центрифугированием и используют для оценки связывания с IgG методом ELISA.

Планшеты Maxisorp (Nunc) покрывают в течение ночи 0,1 мкг анти-HIS антитела (Qiagen), промывают TBST и блокируют реагентом Starting Block T20 (Thermo Scientific). Очищенные лизаты разбавляют в пропорции 1:4 реагентом Starting Block и добавляют к планшетам для осуществления связывания в течение 1 часа, после чего планшеты промывают TBST. Биотинилированные IgG или HSA добавляют в концентрации 1 мкг/мл и планшеты промывают TBST после 1 часа инкубации. Обнаружение связавшихся IgG или HSA осуществляют посредством добавления стрептавидин-HRP (Jackon Immunoresearch) и последующей детекции с помощью хемилюминесцентного субстрата POD.

Для целей настоящего изобретения 70-100%-ную идентичность последовательности аминокислот или нуклеотидов (то есть 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 либо любой диапазон или значение из него) определяют с помощью подходящего компьютерного алгоритма, известного из уровня техники.

Очевидно, что изобретение может быть реализовано способами помимо конкретных способов, указанных в вышеприведенных описаниях и примерах. В соответствии с вышеуказанной информацией возможны многочисленные изменения и вариации настоящего изобретения, которые, таким образом, включены в прилагаемую формулу изобретения.

Таблица 1
Температуры плавления доменов FN3, определенные методом дифференциальной сканирующей калориметрии
Домен FN3 Температура плавления (°C)
1 81,2
2 70,7
3 66,1
4 52,3
5 72,3
6 68,3
7 Не опред.
8 72,6
9 47,0
10 82,5
11 53,9
12 76,1
13 65,8
14 70,3
15 86,5
Таблица 2
Последовательности:
SEQ ID NO: 1:
MSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTI
KGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSGGHHHHHH
SEQ ID NO: 2:
MSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKG
LKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSGGHHHHHH
SEQ ID NO: 3:
MGAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDL
QPGVQYNITIYAVEENQESTPVVIQQETTGGHHHHHH
SEQ ID NO: 4:
MTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGL
SPGVTYYFKVFAVSHGRESKPLTAQQTTGGHHHHHH
SEQ ID NO: 5:
MKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQ
PASEYTVSLVAIKGNQESPKATGVFTTLGGHHHHHH
SEQ ID NO: 6:
MQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGV
EYVYTIQVLRDGQERDAPIVNKVVTGGHHHHHH
SEQ ID NO: 7:
MGLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTF
DNLSPGLEYNVSVYTVKDDKESVPISDTIIPAGGHHHHHH
SEQ ID NO: 8:
MGVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTN
LLPGTEYVVSVSSVYEQHESTPLRGRQKTGGHHHHHH
SEQ ID NO: 9:
MLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLT
PGTEYVVSIVALNGREESPLLIGQQSTGGHHHHHH
SEQ ID NO: 10:
MGVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISG
LKPGVDYTITVYAVTGRGDSPASSKPISINYRTGGHHHHHH
SEQ ID NO: 11:
MGEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEG
LQPTVEYVVSVYAQNPSGESQPLVQTAVTGGHHHHHH
SEQ ID NO: 12:
MTIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGL
MVATKYEVSVYALKDTLTSRPAQGVVTTLGGHHHHHH
SEQ ID NO: 13:
MENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGL
QPGTDYKIYLYTLNDNARSSPVVIDASTGGHHHHHH
SEQ ID NO: 14:
MAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGL
EPGTEYTIYVIALKNNQKSEPLIGRKKTGGHHHHHH
SEQ ID NO: 15:
MGHRPRPYPPNVGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGL
TRGATYNIIVEALKDQQRHKVREEVVTVGNSGGHHHHHH
SEQ ID NO: 16:
MPAPTDLRFTNETPSSLLISWTPPRVQITGYIIRYGPVGSDGRVKEFTVPPSVSSATITGLKP
GTEYTISVIALKDNQESEPLRGRVTTGGHHHHHH
SEQ ID NO: 17:
atgccggcgccgaccgatctgcgctttaccaacgaaaccccgagcagcctgctgattagctgg
accccgccgcgcgtgcagattaccggctatattattcgctatggcccggtgggcagcgatggc
cgcgtgaaagaatttaccgtgccgccgagcgtgagcagcgcgaccattaccggcctgaaaccg
ggcaccgaatataccattagcgtgattgcgctgaaagataaccaggaaa
Таблица 3
Петли фибкона
Петля Остатки SEQ ID NO: 16 Последовательность аминокислот
A-B 13-16 TPSS
B-C 22-28 TPPRVQI
C-D 38-43 VGSDGR
D-E 51-54 PSVS
E-F 60-64 GLKPG
F-G 75-81 KDNQESEP

1. Выделенный белковый каркас, основанный на домене фибронектина типа III (FN3), содержащий аминокислотную последовательность SEQ ID NO: 16.

2. Библиотека, созданная путем обеспечения полипептида, имеющего последовательность аминокислот SEQ ID NO: 16, и внесения разнообразия в копии указанного полипептида путем мутирования по меньшей мере одной петлевой области остатков 22-28 и 75-81 SEQ ID NO: 16 с получением библиотеки белковых каркасов.



 

Похожие патенты:

Изобретение относится к области биотехнологии, генной инженерии и иммунологии. Раскрыты связывающие gp41 ВИЧ-1 одноцепочечные 3-нитиевые альфа-спиральные суперспирализованные молекулы, обозначенные как "Альфатела".

Настоящее изобретение относится к биотехнологии. Предложено моноклональное антитело, которое специфически связывается со вторым доменом Кунитца ингибитора пути тканевого фактора (TFPI), которое характеризуется тем, что содержит 6 CDR.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Изобретение относится к области биотехнологии и может быть использовано для рекомбинантного получения фолликулостимулирующего гормона (ФСГ) человека. Конструируют плазмиду для экспрессии в клетках СНО рекомбинантного ФСГ человека, включающую область начала репликации плазмиды pUC, открытую рамку считывания бета-лактамазы (bla) и прокариотический промотор гена bla, участок терминального повтора вируса Эпштейн-Барр человека (EBVTR), функциональные элементы гена фактора элонгации 1 альфа китайского хомячка, последовательность Козак; открытые рамки считывания альфа- и бета-субъединиц ФСГ человека с блоками стоп-кодонов; внутренний сайт связывания рибосом (IRES) вируса EMCV; открытую рамку считывания дигидрофолатредуктазы (DHFR), экспрессирующуюся в составе трицистронной мРНК вместе с геном, кодирующим альфа- и бета-субъединицы ФСГ человека.

Настоящее изобретение относится к области биотехнологии, конкретно к ингибиторам ангиогенеза, и может быть использовано в медицине для ингибирования патологического ангиогенеза.

Изобретение относится к области биотехнологии, конкретно к гибридным белкам рецептора фактора роста фибробластов (FGFR), и может быть использовано в медицине для лечения заболеваний, связанных с избыточной экспрессией FGF.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биотехнологии. Предложено трансгенное животное, представляющее собой мышь или крысу, в геном которого встроена нуклеиновая кислота, кодирующая перестроенную вариабельную область легкой цепи иммуноглобулина человека, функционально связанную с константной областью иммуноглобулина указанного животного и функционально связанную с промотором, обеспечивающим экспрессию трансгенной легкой цепи в В-клетках млекопитающего, таким образом, что она образует пары с различными эндогенными тяжелыми цепями, обеспечивая получение антител.

Настоящее изобретение относится к области иммунологии. Предложен выделенный пептид, представляющий собой фрагмент белка CDC45L и обладающий способностью индуцировать цитотоксические Т-лимфоциты в форме комплекса с молекулой HLA-A*2402 или HLA-A*0201.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Изобретение относится к области биотехнологии и может быть использовано для рекомбинантного получения фолликулостимулирующего гормона (ФСГ) человека. Конструируют плазмиду для экспрессии в клетках СНО рекомбинантного ФСГ человека, включающую область начала репликации плазмиды pUC, открытую рамку считывания бета-лактамазы (bla) и прокариотический промотор гена bla, участок терминального повтора вируса Эпштейн-Барр человека (EBVTR), функциональные элементы гена фактора элонгации 1 альфа китайского хомячка, последовательность Козак; открытые рамки считывания альфа- и бета-субъединиц ФСГ человека с блоками стоп-кодонов; внутренний сайт связывания рибосом (IRES) вируса EMCV; открытую рамку считывания дигидрофолатредуктазы (DHFR), экспрессирующуюся в составе трицистронной мРНК вместе с геном, кодирующим альфа- и бета-субъединицы ФСГ человека.

Настоящее изобретение относится к области биотехнологии, конкретно к ингибиторам ангиогенеза, и может быть использовано в медицине для ингибирования патологического ангиогенеза.

Изобретение относится к области биотехнологии, конкретно к гибридным белкам рецептора фактора роста фибробластов (FGFR), и может быть использовано в медицине для лечения заболеваний, связанных с избыточной экспрессией FGF.

Настоящее изобретение относится к биотехнологии. Предложены варианты антител против Bv8 человека или макака, каждое из которых характеризуется тем, что содержит 6 CDR.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Изобретение охватывает вакцины против гриппа, в частности вакцины от птичьего гриппа.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биохимии, в частности к антителу или его антиген-связывающему фрагменту, которые специфически связываются с TNFα человека . Также раскрыты выделенная молекула нуклеиновой кислоты, кодирующая вышеуказанное антитело, вектор экспрессии, содержащий указанную молекулу нуклеиновой кислоты, и клетка-хозяин, содержащая указанный вектор, для экспрессии вышеуказанного антитела.

Изобретение относится к биотехнологии и представляет собой гибридный белок на основе мутантной рекомбинантной L-аспарагиназы бактерий Wolinella succinogenes с пониженной глутаминазной активностью и повышенной устойчивостью к действию трипсина, слитой с N-концевой аминокислотной последовательностью гепарин-связывающего пептида.
Наверх