Fgf-r-fc слитый белок и его использование

Авторы патента:


Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование
Fgf-r-fc слитый белок и его использование

 


Владельцы патента RU 2560573:

ЯНЬТАЙ ЖУНЧАН БАЙОТЕКНОЛОДЖИЗ КО., ЛТД. (CN)

Изобретение относится к области биотехнологии, конкретно к гибридным белкам рецептора фактора роста фибробластов (FGFR), и может быть использовано в медицине для лечения заболеваний, связанных с избыточной экспрессией FGF. Конструируют растворимый слитый белок FGFR, состоящий из фрагмента, полученного из промежуточной функциональной последовательности (IFS) Ig-подобного домена FGFR, второго Ig-подобного домена FGFR (D2), третьего Ig-подобного домена FGFR (D3), и Fc области иммуноглобулина. Полученный слитый белок используют для ингибирования ангиогенеза у млекопитающих. Изобретение позволяет повысить сродство связывания с FGF. 8 н. и 3 з.п. ф-лы, 6 ил., 3 табл., 7 пр.

 

Область техники

[01] Настоящее изобретение относится к области биотехнологии, а также относится к лечению заболеваний, особенно лечению заболеваний, связанных с избыточной экспрессией FGF. В частности, настоящее изобретение относится к FGFR-Fc слитому белку и его использованию в лечении заболеваний, связанных с регулированием ангиогенеза. Более конкретно, настоящее изобретение относится к выделенному растворимому FGFR-Fc слитому белку и использованию его в получении лекарственного средства для лечения заболеваний, связанных с регулированием ангиогенеза.

Предшествующий уровень техники

[02] Ангиогенез (Angiogenesis) представляет собой один из основных элементов, которые вызывают рост и метастазу злокачественных опухолей [1]. Процесс ангиогенеза регулируется множеством цитокинов, некоторые факторы стимулируют ангиогенез, некоторые факторы ингибируют ангиогенез, таким образом, регуляция ангиогенеза является очень сложным динамическим процессом [2]. Антиангиогенная терапия направлена на предотвращение ангиогенеза опухоли путем блокировки фактора, стимулирующего рост кровеносных сосудов, или препятствия ангиогенезу опухоли при помощи ингибитора ангиогенеза, с тем чтобы достичь целей контроля роста опухоли. Уже известно довольно много стимулирующих факторов ангиогенеза, таких, как фактор роста эндотелия сосудов (Vascular endothelial growth factor, VEGF), фактор роста фибробластов (фактор роста фибробластов, FGF), фактор роста гепатоцитов (Фактор роста гепатоцитов, HGF). Эти факторы могут стимулировать деление, эндотелий, дифференцировку, морфогенез эндотелиальных клеток кровеносных сосудов. В чем, VEGF, как известно, является наиболее унитарным наиболее эффективным фактором роста ангиогенеза [3, 4].

[03] В гипоксической среде опухолевой ткани, опухолевые клетки секретируют большое количество VEGF, вызывают деление, миграцию сосудистых эндотелиальных клеток, и в результате этого установлена сосудистая сеть опухоли. Многочисленные исследования на животных показывают, что VEGF для ингибирования ангиогенеза может предотвратить ангиогенез сосудов опухоли, подавляя тем самым рост опухоли. Из-за этого, VEGF и его рецептором является самым важным таргетингом нового препарата анти-ангиогенеза. В настоящее время в клинических испытаниях проявляет существенный лечебный эффект препарат анти-ангиогенеза бевацизумаб (бевацизумаб, торговое название Авастин), который может непосредственно блокировать VEGF, ингибировать опухолевый ангиогенез, в 2004 году был утвержден FDA США, представляет собой препарат первой линии, предназначенный для лечения колоректального рака, является первым препаратом, который был одобрен для продажи, путем ингибирования ангиогенеза играет роль в противораковом лечении. Авастин представляет собой гуманизированное моноклональное антитело против VEGF, которая проводили известной американской биотехнологической компанией Genentech. В крупномасштабных клинических испытаниях фазы III, применение Авастина в комбинации с химиотерапевтическими препаратами может значительно продлить время выживания пациентов с различными опухолями, в том числе рак толстой кишки, рак легких, рак молочной железы, рак почек и т.д. [5, 6]. Успех Авастина в клинических испытаниях имеет всемирно-историческое значение, антиангиогенная терапия, направленная на сосудистую сеть является клинически эффективной терапией для лечения различных опухолей, откроет совершенно новый способ для лечения разных опухолей. В западных странах Авастин широко использовали в лечении рака, в настоящее время является одним из важных лекарственных средств по сумме мировых продаж.

[04] В дополнение к Авастину, в разных странах есть ряд лекарственных средств анти- VEGF сигналов, которые находятся в поздней стадии клинических испытаний на человеке, как ожидается, клиническое применение их будет проводиться в ближайшие несколько лет. Среди них, Афлиберцепт (или VEGF -Трап), который проводили на основе сотрудничества между биотехническими американскими компаниями Regeneron и Sanofi-Aventist, в настоящее время находится в крупномасштабных клинических испытаниях [7]. Препарат моноклонального антитела IMC-1121B на основе рецептора II против VEGF(VEGFR2), разработанный компанией Imclone, находится в клинических испытаниях фазы III также [8]. В Китае, противоопухолевый препарат для таргетинга опухолевого ангиогенеза в настоящее время является горячей точкой разработки новых лекарств. Есть целый ряд отечественных компаний и исследовательских институтов, которые разрабатывают препараты на основе VEGF и его рецептора или других таргетингов ангиогенеза. Несомненно, что эти новые препараты будут обеспечивать новые возможности лечения рака, приносить пациентам новую надежду.

[05] Препарат анти-VEGF добился значительного прогресса в клиническом лечении рака, но клинические испытания также показали, что у терапии анти-VEGF существуют значительные ограничения. Исходя из эффектов лечения рака, Авастин может продлить время жизни у половины больных с колоректальным раком на около 3-4 мес. [9, 10], у половины больных раком молочной железы - на около 7-8 мес. [11], Таким образом, Авастин не может эффективно долгосрочно ингибировать опухолевый рост кровеносных сосудов. Поэтому, дальнейшее совершенствование антиангиогенного эффекта при клиническом лечении рака является задачей исследователей, также как и направление научного исследования и разработки лекарственных средств анти-ангиогенеза следующего поколения.

[06] Причина, приводящая к неэффективности лечения или возникновению сопротивляемости к анти-VEGF, может заключаться в том, что опухолевый ангиогенез контролируется различными факторами, хотя VEGF играет важную роль анти-VEGF, но он не единственный фактор для стимуляции ангиогенеза. Между тем, из-за гетерогенности и сложности микроокружения опухоли, а также компенсационной реакции организма, когда активность VEGF подавляется в долгосрочное время, другие стимулирующие факторы ангиогенеза будут экспрессируемы [12], в результате этого опухолевый рост кровеносных сосудов больше не зависит от VEGF сигнальных путей. Команда Hanahan университета Калифорнии в Сан-Франциско изучила изменения экспрессирующего фактора рост ангиогенеза во время лечения опухолей поджелудочной железы с применением анти VEGFR2, обнаружила, что некоторые фрагменты гена изменены, из которых наиболее известно, что уровень экспрессии FGF-2 значительно увеличивается. Исследования показали, что в процессе лечения опухолей с применением анти-VEGF увеличивалась толерантность к FGF, особенно цувеличивалась уровень экспрессии FGF-2, значительно, ангиогенез активирована снова, и после блокирования FGF сигнальных путей ингибировалась опухолевая регенерация [13]. Это показывает, что избыточная экспрессия FGF-2 и лекарственноустойчивость при лечении от опухоли с применением анти VEGFR тесно связаны друг с другом. По-нашему, блокирование каналов может эффективно ингибировать ангиогенез опухоли, отдельно или в сочетании с анти VEGF эффективно лечить от болезней, связанных с регулированием ангиогенеза.

[07] Фактор роста фибробластов (FGF) является одним из группы гепаринсвязывающих факторов, у млекопитающих есть 22 вида таких факторов (FGF 1-14, 16-23). FGF играет важную роль в различных биологических функциях, таких как клеточная пролиферация, дифференцировка, миграция, ангиогенез и онкогенез. Путем связывания и активации рецепторов FGF (FGFR) на поверхности клеток, он выполняет свои разнообразные биологические функции. (См. Eswarakumar et al. Cytokine Growth Factor Rev. 16: 139-149, 2005). Рецептор фактора роста фибробластов (broblast growth factor receptor, FGFR) является рецептором, связывающим с членом семейства факторов роста фибробластов. Фрагменты рецептора фактора роста фибробластов участвуют в процессе заболевания. FGFR может связываться с FGF, активировать сигнальные пути вниз по течению в процессе эмбриогенеза, роста, развития кровеносных сосудов, расширения кровеносных сосудов, нервной регуляции, защиты от ишемии, заживления ран и онкогенеза и играют важную роль в других физиологических и патологических процессах [14, 15]. Было подтверждено, что избыточная экспрессия FGF/FGFR в естественных условиях тесно связана с опухолями (такими как фибромы, глиомы, меланомы, опухоли предстательной железы, лимфомы, лейкемии, рак мочеполовой системы), заболеваниями костей (карликовый рост, краниосиностоз, ахондроплазия, акантоз) и почечной недостаточностью и другими заболеваниями [14-19]. Сообщается, что повышенные уровни экспрессии FGF и рецептора могут непосредственно способствовать выживанию и пролиферации клеток опухоли, понижение FGF посредством миРНК значительно снижает выживание раковых клеток печени [22]. Таким образом, создание FGF FGFR-Fc слитого белка, обладающего способностью антагонизма, может блокировать FGF пути и лечить от болезней, связанных с избыточной экспрессией FGF.

[08] В настоящее время относительно небольшое количество антиангиогенных новых лекарственных средств на основе таргетинга FGF и его рецептора, находится в фазе клинических испытаний работы исследования и разработки. Препарат FP-1039, разработанный американской фирмой Five Prime, находится в фазе клинических испытаний, теперь производится вербовка добровольцев, FP-1039 является слитым белком, который состоит из внеклеточного домена человека FGFR1, фрагмента Fc человеческого домена IgG1. В то время исследования Ван и Olsen и других специалистов показывают, что линкерный фрагмент между первым Ig-подобным доменом и вторым Ig-подобным доменом внеклеточного человеческого домена FGFR1 ингибирует связывание между FGFR1 и FGF [20, 21].

[09] Поэтому, создание FGF FGFR-Fc слитого белка, обладающего способностью антагонизма, может блокировать FGF пути, эффективно ингибирует ангиогенез или непосредственно воздействует на опухолевые клетки и ингибирует их рост, в результате этого может лечить от болезней, связанных с избыточной экспрессией FGF, лечит от опухолей, и других болезней, связанных с регулированием ангиогенеза.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

[10] Пространственная структура белка имеет близкую связь с его биологической функцией. Конформация каждых IG-подобных доменов внеклеточного домена FGFR и связанных фрагментов непосредственно влияет на его способность связывания с FGF, способом генной инженерии создается слитый белок из фрагмента IG-подобного домена внеклеточного домена FGFR, фрагмента Fc-области IgG разных длин, чтобы формировать слитый белок, имеющий различные конформации, способом рассортировки получаются слитые белки, имеющие способность связывания с FGF, высокую биологическую активность.

[11] Млекопитающие имеют четыре гена FGFR: fgfR 1-fgfR4. Рецептор фактора роста фибробластов состоит из трансмембранного домена, и внутриклеточного домена внеклеточной области, семейство FGFR имеет множество членов, свойства его лигана не такие, как другой домен киназы, но они имеют сходные внеклеточные области. Их внеклеточные области содержат три иммуноглобулин-подобных (Ig-подобных) доменов: первый Ig-подобный домен, второй Ig-подобный домен и третий Ig-подобный домен, промежуток между первым и вторым Ig-подобными доменами также включает в себя участок последовательности, в настоящем техническом решении, участок последовательности между первым и вторым Ig-подобными доменами также называется промежуточной функциональной последовательностью Ig -подобного домена FGFR (В этой статье последовательность между первым Ig-подобным доменом и вторым Ig-подобным доменом называется IFS). Указанная область промежуточной функциональной последовательности содержит один фрагмент последовательности кислой аминокислоты под названием кислая ячейка (acidic box, AB).

[12] Настоящее изобретение относится к слитому белку рецептора выделенного растворимого фактора роста фибробластов (FGFR), содержащему: участок области промежуточной функциональной последовательности, полученный из Ig -подобного домена FGFR (далее IFS), 2-й Ig подобный домен FGFR (далее D2), 3-й Ig подобный домен FGFR (далее D3), Fc область иммуноглобулина (далее Fc).

[13] Настоящее изобретение относится к слитому белку, содержавшему или состоящему из следующих частей: участок области промежуточной функциональной последовательности, полученный из Ig -подобного домена FGFR, 2-й Ig подобный домен FGFR, 3-й Ig подобный домен FGFR (далее D3), Fc область иммуноглобулина. В некоторых вариантах осуществления, фрагмент, полученный из IFS не не содержит кислотной ячейки. В другом варианте осуществления указанный IFS фрагмент имеет аминокислотную последовательность SEQ ID NO: 1 № 134-162, № 145-162 или № 151-162, или имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 1 № 134-162, № 145-162 или № 151-162.

[14] Настоящее изобретение также относится к слитому белку, содержавшему или состоящему из следующих частей: 1-й Ig подобный домен FGFR (далее D1) или его часть, участок области промежуточной функциональной последовательности, полученный из Ig-подобного домена FGFR (далее IFS), 2-й Ig подобный домен FGFR, 3-й Ig подобный домен FGFR, Fc область иммуноглобулина. Предпочтительно, D1 домен или его часть, содержащая:

[15] аминокислотную последовательность SEQ ID NO: 1 № 40-118, или имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 1 № 40-118; или

[16] аминокислотную последовательность SEQ ID NO: 1 № 77-118, или имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере80%, 90%, 93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 1 № 77-118; или

[17] В одном аспекте настоящее изобретение относится к слитому белку, содержащему или состоящему из следующих частей: участок области промежуточной функциональной последовательности, полученный из Ig -подобного домена FGFR или его часть, 2-й Ig подобный домен FGFR, 3-й Ig подобный домен FGFR, Fc область иммуноглобулина. Предпочтительно, D1 домен или его часть, где:

[18] 2-й Ig подобный домен FGFR имеет аминокислотную последовательность SEQ ID NO: 1 № 163-247, или имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 1 №163-247; или

[19] 3-й Ig подобный домен FGFR имеет аминокислотную последовательность SEQ ID NO: 1 №270-359, или имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере80%, 90%, 93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 1 № 270-359.

[20] Настоящее изобретение также относится к слитому белку, содержащему или состоящему из следующих частей: внеклеточную область FGFR, Fc область иммуноглобулина, где указанная внеклеточная область FGFR:

[21] (1) имеет любую аминокислотную последовательность из SEQ ID NO: 9 № 358-580, SEQ ID NO: 10 № 304-526, SEQ ID NO: 11 № 278-500, SEQ ID NO: 12 № 246-468, SEQ ID NO: 13 № 235-457, SEQ ID NO: 14 № 229-451 и SEQ ID NO: 15 № 224-446, или аминокислотную последовательность, кодируемую любой нуклеотидной последовательностью из SEQ ID NO: 16 № 1074-1740, SEQ ID NO: 17 № 912-1578, SEQ ID NO: 18 № 834-1500, SEQ ID NO: 19 № 738-1404, SEQ ID NO: 20 № 705-1371, SEQ ID NO: 21 № 687-1353, SEQ ID NO: 22 № 672-1338;

[22] (2) имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью SEQ ID NO: 9 № 358-580, SEQ ID NO: 10 № 304-526, SEQ ID NO: 11 № 278-500, SEQ ID NO: 12 № 246-468, SEQ ID NO: 13 № 235-457, SEQ ID NO: 14 № 229-451 и SEQ ID NO: 15 № 224-446, и состоит из них; или

[23] (3) имеет любую аминокислотную последовательность, по крайней мере, идентичность которой 70%, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью, кодируемой нуклеотидной последовательностью из SEQ ID NO: 16 № 1074-1740, SEQ ID NO: 17 № 912-1578, SEQ ID NO: 18 № 834-1500, SEQ ID NO: 19 № 738-1404, SEQ ID NO: 20 № 705-1371, SEQ ID NO: 21 № 687-1353 и SEQ ID NO: 22 № 672-1338.

[24] Настоящее изобретение также относится к слитому белку, указанный белок:

[25] (1) имеет любую аминокислотную последовательность из SEQ ID NO: 9-15, или аминокислотную последовательность, кодируемую любой нуклеотидной последовательностью из SEQ ID NO: 16-22;

[26] (2) имеет аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью из SEQ ID NO: 9-15; или

[27] (3) имеет любую аминокислотную последовательность, по крайней мере, идентичность которой 70%, предпочтительно по меньшей мере 80%, 90%,93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью, кодируемой нуклеотидной последовательностью из SEQ ID NO: 16-22.

[28] Слитый белок по настоящему изобретению, предпочтительно содержащий Fc-область иммуноглобулина, более предпочтительно Fc -область человека IgG1, еще более предпочтительно указанную Fc человека IgG1, содержащую:

[29] аминокислотную последовательность SEQ ID NO: 7, или аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%,93%, 95%, 97%, 98% или 99% с аминокислотной последовательностью SEQ ID NO: 7; или

[30] аминокислотную последовательность, кодируемую нуклеотидной последовательностью SEQ ID NO: 8, или аминокислотную последовательность, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с такой аминокислотной последовательностью, кодируемой нуклеотидной последовательностью SEQ ID NO: 8.

[31] В одном варианте осуществления настоящего изобретения, указанная Fc область иммуноглобулина расположена в конце С слитого белка.

[32] Предпочтительно, настоящее изобретение также относится к предшественнику слитого белка, содержащему области секреторного сигнала пептида, такие как области сигнального пептида секретируемого белка VEGFR1, предпочтительно содержащие аминокислотную последовательность SEQ ID NO: 2 № 1-26, или аминокислотную последовательность, кодируемую такой нуклеотидной последовательностью, или SEQ ID NO: 23. Указанная область сигнального пептида предпочтительно находится на конце N указанного предшественника.

[33] В другом аспекте настоящее изобретение относится к слитому белку, содержащему последовательности от конца N- к концу С: фрагменты, полученные из IFR, D2, D3, Fc область иммуноглобулина.

[34] В еще одном аспекте настоящего изобретения, домены и/или участки фрагментов, содержащиеся в слитом белке по настоящему изобретению, непосредственно соединены друг с другом или через линкер. В одном варианте осуществления, фрагменты, полученные из внеклеточной области VEGFR,, фрагменты, полученные из области Fc иммуноглобулина, непосредственно соединены. В другом варианте, фрагменты, полученные из внеклеточной области FGFR, фрагменты, полученные из области Fc иммуноглобулина, соединены через линкер.

[35] В одном из аспектов, слитый белок по настоящему изобретению ингибирует ангиогенез. В другом своем аспекте, слитый белок по настоящему изобретению в естественных условиях и/или в пробирке связывается FGF, предпочтительно связывается с FGF2. В еще одном аспекте слитый белок по настоящему изобретению непосредственно ингибирует рост опухолевых клеток.

[36] Настоящее изобретение также относится к FGFR-Fc-слитому белку, содержащему фрагмент, полученный из внеклеточной области FGFR, фрагмент, полученный из Fc-области иммуноглобулина. В частности, фрагмент, полученный из внеклеточной области FGFR, представляет собой фрагмент, полученный из внеклеточной области FGFR1. Предпочтительно, указанная Fc область иммуноглобулина является Fc областью человеческого иммуноглобулина, как Fc-область IgG1 человека. В одном аспекте настоящего изобретения, FGFR-Fc слитый белок имеет способность связывания с FGF и/или способность противодействия фрагменту FGF, тем самым может ингибировать ангиогенез.

[37] FGFR-Fc слитый белок по настоящему изобретению, содержащий фрагмент, полученный из внеклеточной области FGFR, который включает в себя один или более фрагментов, выбранных из следующих кластеров: D1 домен или его часть, участок, полученный из IFS, D2 домен или его часть, D3 домен или его часть. В одном варианте осуществления, фрагмент, полученный из внеклеточной области FGFR, включает в себя участок, полученный из IFS, D2 домен и D3 домен, указанный участок, полученный из IFS, предпочтительно содержащий аминокислотную последовательность, представленную в SEQ ID NO: 1 № 134-162, № 145-162 или № 151-162. В некоторых предпочтительных вариантах осуществления настоящего изобретения, FGFR-Fc-слитый белок не содержит D1 или его часть. В другом предпочтительном варианте осуществления настоящего изобретения, FGFR-Fc-слитый белок не содержит IFS, за исключением аминокислотной последовательности, представленной в SEQ ID NO: 1 № 134 162, № 145-162 или № 151-162.

[38] В некоторых вариантах осуществления настоящего изобретения, последовательность каждых фрагментов и/или отдельных доменов, содержащихся в FGFR-Fc слитом белке от конца N- к концу С может быть произвольной, или она может быть приведенной на фиг 1. В еще одном варианте осуществления, указанная последовательность может другой, которая не показана на фиг 1.

[39] В некоторых вариантах осуществления настоящего изобретения, FGFR -Fc слитый белок еще содержит один или более дисульфидных связей, предпочтительно, Ig -подобный домен содержит один или более дисульфидных связей.

[40] В одном аспекте настоящего изобретения, FGFR-Fc слитый белок может быть получен с использованием молекулы нуклеиновых кислот, содержащей любую нуклеиновую последовательность из SEQ ID NO: 16-22, экспрессируемых в линии клеток млекопитающих. В частности, указанная линия клеток млекопитающего представляет собой СНО клеточную линию

[41] Кроме того, настоящее изобретение также обеспечит FGFR-Fc слитые белки, содержащие домены и/или области, которые могут быть непосредственно соединены или соединены через линкер.

[42] В другом аспекте, настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей слитый белок по изобретению или его предшественник. Предпочтительно, указанная молекула нуклеиновой кислоты содержит любую нуклеотидную последовательность из SEQ ID NO: 16-22.

[43] В еще одном аспекте настоящее изобретение обеспечивает вектор, содержащий молекулу нуклеиновой кислоты по настоящему изобретению.

[44]В еще другом аспекте настоящее изобретение также обеспечивает клетки, трансформированные/трансформируемые указанным вектором, которые предпочтительно представляют собой клетки СНО.

[45] Настоящее изобретение также обеспечивает композицию, которая содержит слитый белок по настоящему изобретению, и смешивается с фармацевтически приемлемым вектором.

[46] В еще другом аспекте настоящее изобретение обеспечивает фармацевтическую композицию, содержащую слитый белок, молекулу нуклеиновой кислоты, вектор или клетки, и фармацевтически приемлемый вектор.

[47] В еще другом аспекте настоящее изобретение обеспечивает способ получения слитого белка, ингибирующего развитие кровеносных сосудов, указанный слитый белок может быть получен с использованием клеточных линий в прокариотических клетках или эукариотических клетках, особенно клетках млекопитающих, экспрессирующих слитый белок по настоящему изобретению.

[48] Настоящее изобретение также относится к способу получения слитых белков, ингибирующих ангиогенез, с использованием молекулы нуклеиновой кислоты в линии клеток млекопитающих, экспрессирующей слитый белок по настоящему изобретению. Предпочтительно, указанная линия клеток млекопитающего представляет собой СНО клеточную линию.

[49] В другом аспекте настоящее изобретение относится к способу ингибирования ангиогенеза, включающему введение эффективного количества FGFR-Fc слитого белка по настоящему изобретению, кодирующей молекулы нуклеиновой кислоты, вектора, содержащего молекулу нуклеиновой кислоты, и/или фармацевтической композицию, содержащей любой из предшествующих пунктов. Предпочтительно, указанный способ осуществляется у млекопитающего.

[50] В еще другом аспекте, настоящее изобретение относится к способу лечения или профилактики опухолей у млекопитающего, включающий введение эффективного количества FGFR-Fc слитого белка по настоящему изобретению, кодирующей молекулы нуклеиновой кислоты, вектора, содержащего молекулу нуклеиновой кислоты, и/или фармацевтическую композицию, содержащей любой из предшествующих пунктов объекту, нуждающемуся в лечении, предпочтительно, указанная опухоль представляет собой солидную опухоль.

[51] В еще другом аспекте, настоящее изобретение обеспечивает способ лечения или профилактики глазных связанных с ангиогенезом заболеваний у млекопитающих, включающий введение эффективного количества FGFR-Fc слитого белка по настоящему изобретению, кодирующей молекулы нуклеиновой кислоты, вектора, содержащего молекулу нуклеиновой кислоты, и/или фармацевтической композицию, содержащей любой из предшествующих пунктов объекту, нуждающемуся в лечении. Указанные заболевания глазного ангиогенеза, предпочтительно представляют собой возрастную макулярную дегенерацию и т.д.

[52] Настоящее изобретение также относится к использованию FGFR-Fc слитого белка по настоящему изобретению, кодирующей молекулы нуклеиновой кислоты, вектора, содержащего молекулу нуклеиновой кислоты, и/или фармацевтической композицию, содержащей любой из предшествующих пунктов в изготовлении лекарства, ингибирующего ангиогенез. Кроме того, настоящее изобретение также относится к использованию FGFR-Fc слитого белка по настоящему изобретению, кодирующей молекулы нуклеиновой кислоты, вектора, содержащего молекулу нуклеиновой кислоты, и/или фармацевтической композицию, содержащей любой из предшествующих пунктов в изготовлении лекарства, предназначенного для лечения или профилактики заболеваний, связанных с регулированием ангиогенеза, предпочтительно, связанные с регулированием ангиогенеза заболевания представляют собой опухоль или глазные заболевания, связанные с регулированием ангиогенеза.

[53] С учетом того, что в различных странах патентная система имеет разные положения по теме защиты изображения, настоящее изобретение также обеспечивает соответствующие фармацевтические применения вышеуказанным способам, препараты для назначенных применений. Эти различные фармацевтические цели и лекарственные средства также входят в объем настоящего изобретения, как они были конкретно описаны в настоящем описании.

[54] Настоящее раскрытое описание лишь иллюстрирует некоторые конкретные варианты, которые входят в объем изобретения, технические функции, описанные в одном или нескольких технических решениях, могут быть композицией любого одного или более технических решений, эти технические решения по композициям также входят в объем изобретения, как они были раскрыты в настоящем описании.

[55] В сочетании с прилагаемыми чертежами и нижеследующим подробным описанием дополнительно иллюстрируется настоящее изобретение. Следует отметить, что последующее описание только иллюстрирует технические решения примерами, входящими в объем изобретения, но не любые ограничения на эти технические решения. Объем изобретения, содержащийся в прилагаемой формуле изобретения, имеет преимущественную силу.

Краткое описание чертежей

[56] Фиг. 1 представляет собой структурную схему FGFR-Fc слитого белка, FGFR1- Fc слитый белок показан сплошными линиями, делеция аминокислоты обозначена пунктирной линией; Подобный домен антитела обозначен кольцом; тип подобного домена разного антитела представлен в виде букв 1-3, дисульфидная связь представлена в виде s s; Человеческий Fc область IgG1 человека показана как серое поле. SP представляет собой VEGFR1 сигнальный пептид; Последовательность кислой ячейки показана как квадратную рамку с буквами AB.

[57] Фиг. 2 представляет собой схему сравнения связывания FGFR1-Fc слитого белка с FGF-2, где метод ELISA предназначен для определения уровня связывания Fc слитого белка (20 нг/мл) со покрытыми белками VEGF165 и/или FGF-2 (содержание гепарина 100).

[58] Фиг. 3 представляет собой схему ДСН-ПААГ слитого белка FGFR1-Fc №26.

[59] На Фиг. 4 представлен градиент связывания слитого белка FGFR1-Fc № 26 с FGF-2.

[60] На Фиг. 5 представлен аффинитет слитого белка FGFR1-Fc № 26с FGF-2.

[61] На фиг. 6 показано влияние слитого белка FGFR1-Fc № 26 на деление HUVEC клеток, индуцированное FGF-2.

ОПИСАНИЕ ПРЕДПОЧТИТЕЛЬНЫХ ВАРИАНТОВ ОСУЩЕСТВЛЕНИЯ

Определения

[62] Если не указано иное, все термины, используемые в данном описании, имеют такое же значение, как понятно специалистам в данной области. Касательно определения и терминологий в данной области, конкретные специалисты могут прочитать Current Protocols in Molecular Biology (Ausubel). Аббревиатура аминокислотных остатков, используемая в данной области, представляет собой одну из 20 стандартных 3-букв L-аминокислоты и/или 1-буквенный код.

[63] Несмотря на то, что численные диапазоны и параметры, показанные в широком объеме настоящего изобретения приблизительны, но конкретные значения, указанные в варианте осуществления, описаны как можно точнее. Тем не менее, любой числовое значение собственно содержит определенные ошибки, особенно отклонение стандартов в их соответствующих измерениях. Кроме того, все диапазоны, описанные здесь, должны охватывать содержащие любые и все поддиапазоны. Например, как описанный диапазон «1 до 10» должен содержать любые и все под диапазоны, содержащие минимальное значение 1 и максимальное значение 10 (включая концы); То есть, любые все поддиапазоны, содержащие минимальное значение 1 или больше стартовое значение, например, 1-6,1, любые все поддиапазоны, содержащие максимальное значение 10 или меньше значение прекращения, например, 5,5-10. Кроме того, любые ссылочные документы, называемые "включенный текст в настоящее описание”, должны рассматриваться как включенные документы в полном объеме.

[64] Следует также отметить, например, используемая в данном описании форма единственного числа также включает в себя форму множественного числа описанного объекта, если ясно не ограничивается одним предметом. Термин "или", термин "и/или" использовали взаимозаменяемо, если контекст четко не указан.

[65] Используемые здесь термины "Fc", "Fc-область", "Fc-фрагмент" или "Fc-область иммуноглобулина" означают кристаллизующийся фрагмент иммуноглобулина, в настоящем изобретении Fc область предпочтительно представляет собой IgG1 Fc-область человека.

[66] Термин "Fc-слитый белок" относится к антитело-подобной молекуле, обладающей специфичностью связывания гетерологичного белка, эффекторной функцией константного домена иммуноглобулина. С точки зрения структуры, Fc-слитый белок содержит аминокислотную последовательность, имеющую специфичность связывания, последовательность константного домена иммуноглобулина. Fc-слитый белок обычно содержит сайт связывания рецептора или лиганда. Указанная последовательность константного домена иммуноглобулина может быть получена из любого иммуноглобулина, например IgG-1, IgG-2, IgG-3 или IgG-4 подтипов, IgA (включая IgA-1 и IgA-2), IgE IgD или IgM.

[67] Используемый термин "растворимый" белок относится к белку, который может быть растворен в водном растворе при биологически значимых температурах, рН и осмотическом напряжении. Используемый термин "растворимый слитый белок" означает, что слитый белок не содержит трансмембранный участок и внутриклеточный участок.

[68] Используемый в данном описании термин "выделенный" относится к веществу и/или предмету (1), при начальном производстве (в естественной окружающей среде и/или в испытательной установке), который выделяется от исходных связанных некоторых компонентов, и/или (2) проводили путем искусственного изготовления, подготовки и/или производства. Выделяемые вещества и/или предметы, по крайней мере, около 10%, около 20%, около 30%, около 40%, около 50%, около 60%, около 70%, около 80%, около 90%, около 95% около 98% до около 99%, почти 100% или 100% выделены от его исходных связанных других компонентов.

[69] Термины "участок" и "фрагмент" относятся к взаимозаменяемой части полипептида, нуклеиновой кислоте или других строений молекулы.

[70] Используемый в данном описании термин "Ig-подобный домен" относится к домену иммуноглобулина, который встречается в различных семействах белков, участвуют в разнообразных биологических функциях, включая клетки - признание клетки, рецепторы клеточной поверхности, иммунную функцию, и так далее.

[71] Фактор роста фибробластов (FGF) является одним из гуппы гепаринсвязывающих факторов, у млекопитающих есть 22 видов таких факторов (FGF 1-14, 16-23). FGF играет важную роль в различных биологических функциях, таких как клеточную пролиферацию, дифференцировку, миграцию, ангиогенез и онкогенеза. Путем связывания и активации рецепторов FGF (FGFR) на поверхности клеток, он выполняет свои разнообразные биологические функции. (См., например Eswarakumar et al. Cytokine Growth Factor Rev. 16: 139-149, 2005). Рецептор фактора роста фибробластов (broblast growth factor receptor, FGFR) является рецептором, связывающим с членом семейства факторов роста фибробластов. Фрагменты рецептора фактора роста фибробластов участвуют в процессе заболевания. Есть четыре FGFR генов у млекопитающих: FGFR1-fgfR4. Рецептор фактора роста фибробластов состоит из внеклеточного домена, трансмембранного домена и внутриклеточного домена. В FGFR семействе, у каждых видов факторов есть разные свойства связывания, домен киназы, схожие внеклеточные области. Их внеклеточные области содержат три иммуноглобулин- подобных (Ig-подобных) доменов: 1-й Ig-подобный домен, 2-й Ig-подобный домен и 3-й Ig-подобный домен, между первым и вторым Ig-подобными доменами также содержится один фрагмент последовательности, в данном описании, фрагмент между 1-й и 2- й Ig-подобными доменами называется областью промежуточной функциональной последовательности. Указанная область промежуточной функциональной последовательности содержит один фрагмент последовательности кислой аминокислоты под названием кислая ячейка (acidic box, AB).

[72] Используемый в данном описании термин "1-й Ig-подобный домен FGFR "или " 1-й Ig-подобный домен "относится к первому Ig-подобному домену от конца N белка FGFR, имеющему последовательность аминокислотных остатков 40-118 SEQ ID NO: 1. Аналогично, 2-й Ig-подобный домен FGFR "или " 2-й Ig-подобный домен "относится ко второму Ig-подобному домену от конца N белка FGFR, имеющему последовательность аминокислотных остатков 163-247 SEQ ID NO: 1; 3-й Ig-подобный домен FGFR "или " 3-й Ig-подобный домен "относится к третьему Ig-подобному домену от конца N белка FGFR, имеющему последовательность аминокислотных остатков 270-359 SEQ ID NO: 1. Предпочтительно, FGFR является FGFR1, 1-й Ig-подобный домен FGFR представляет собой 1-й Ig-подобный домен FGFR1, 2-й Ig-подобный домен FGFR представляет собой 2-й Ig-подобный домен FGFR1, 3-й Ig-подобный домен FGFR представляет собой 3-й Ig-подобный домен FGFR1.

[73] Частичная последовательность hFGFR1 приведена ниже, заштрихованные части последовательно иллюстрируют различные Ig-подобные домены, см. http://www.ncbi.nlm.nih.gov/protein/AAH15035.1

MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG180TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP300DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEER

[74] FGFR1 аминокислотная последовательность представлена в SEQ ID NO: 1 кодирующая нуклеотидная последовательность см. SEQ ID NO: 4.

[75] Используемый в данном описании термин "область промежуточной функциональной последовательности Ig-подобного домена FGFR" или "IFS", относится к последовательности между первым Ig-подобным доменом и вторым Ig-подобным доменом белка FGFR, предпочтительно, последовательность IFS имеет аминокислотную последовательность 118-162 SEQ ID NO: 1. Авторы настоящего изобретения неожиданно обнаружили, что указанная область промежуточной функциональной последовательности имеет существенное влияние на функцию Ig-подобного домена. Где указанный FGFR белок предпочтительно представляет собой FGFR1 (SEQ ID NO: 1), в частности FGFR1 белок человека. Аминокислотная последовательность, кодирующая FGFR1 белок человека, показана как SEQ ID NO: 1, последовательность cDNA представлена в SEQ ID NO: 4.

[76] Используемый в данном описании термин "FGFR" относится к рецептору фактора роста фибробластов, который может быть FGFR1, FGFR2, FGFR3 и/или FGFR4. FGFR по настоящему изобретению относится к FGFR 1, более предпочтительно для человека представляет собой VEGFR.

[77] Используемый в данном описании термин "вырожденный вариант" относится к вырожденным вариантам, которые включают замены третьего кодона на другие кодоны, кодирующие те же самые аминокислоты, например, положение качания (wobble position)триплетного кода содержит одно или несколько вариантов, вырожденный вариант также известный как вариант-синоним.

[78] Используемый в данном описании термин "объект" относится к млекопитающим, таким как люди, но также может быть другими животными, такими как домашние животные (например, собаки, кошки и т.д.), сельскохозяйственные животные (например, коровы, овцы, свиньи, лошади и т.д.) или экспериментальные животные (например, обезьяны, крысы, мыши, кролики, морские свинки и т.д.).

[79] Используемый в данном описании термин "однородность", "процентная однородность", "гомология" или "идентичность" относятся к однородности последовательности между двумя аминокислотными последовательностями или последовательностями нуклеиновой кислоты. Количество идентичных остатков (т.е. аминокислот или нуклеотидов) определяется путем сравнения процентной идентичности этих двух последовательностей. Стандартные алгоритмы в данной области (например, Smith и Waterman, 1981, Adv Appl Math 2:482; Needleman и Wunsch, 1970, J. Biol 48:443; Pearson и Lipman, 1988, Proc, Natl.. Acad. Sci., USA, 85:2444) или компьютерные версии этих алгоритмов (Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive, Madison, WI) могут быть использованы при выравнивании и сравнении последовательностей, компьютерные версии BLAST и FASTA общедоступны. Кроме того, программный пакет Entrez, разработанный американским национальным институтом здравоохранения (Bethesda MD), может быть использован для сравнения последовательностей. При использовании программного пакета BLAST, программного анализа разрывов BLAST, параметры по умолчанию каждых программ (например, программа BLASTN доступна на Интернет-сайте американского национального центра биотехнологической информации). В одном варианте осуществления, процентная идентичность между двумя последовательностями определяется посредством использования программного пакета GCG с применением веса разрыва 1, чтобы вес разрыва комплекса аминокислоты не совпадал с весом разрыва одной аминокислоты между двумя последовательностями. Кроме того, вы можете использовать программный пакет ALIGN (версия 2.0), включенный в пакете программ GCG (Accelrys, San Diego, CA) выравнивания последовательностей.

[80] Используемый в данном описании термин "рекомбинация" относится к процессу стабильного двухцепочечного полинуклеотида посредством нековалентной рекомбинации двух одноцепочечных полинуклеотидов. Термин "рекомбинация" может также относиться к трехцепочечной рекомбинации. Полученный двухцепочечный полинуклеотид (как правило) "рекомбинированное" или "двухцепочечное тело". "Условия рекомбинации" обычно представляют собой менее чем около 1M, чаще менее чем около 500 мм, менее примерно 200 мМ концентрацией соли. Температура рекомбинации может быть ниже 5°С, но, как правило, выше, чем примерно 22°С, более предпочтительно выше примерно 30°С, предпочтительно выше примерно 37°С. Рекомбинация обычно проводится в жестких условиях (то есть, условия рекомбинации с мишенью своей последовательности). Жесткие условия рекомбинации варьируются в зависимости от последовательности. Более длинные фрагменты могут потребовать более высокой температуре рекомбинации для проведения специфической рекомбинации. В связи с этим, что другие факторы (включая состав и длину нуклеотида комплементарной цепи, присутствие органических растворителей и степень несоответствия нуклеотида) могут влиять на строгость рекомбинации, комбинация параметров более важна, чем абсолютное значение любого одного параметра. Как правило, жесткие условия -это определенная ионная сила, температура ниже Tm определенной последовательности при рН примерно на 5°С. Типичные строгие условия - это при рН 7,0 8,3, по меньшей мере, концентрация иона Na(или других солей) 0,01 М-1 М, температура менее 25°С. Для получения информации о жестких условиях, см., например, Sambrook, Fritsche и Maniatis "Molecular Cloning A Laboratory Manual, 2-е изд, Cold Spring Harbor Press (1989), Anderson “Nucleic Acid Hybridization”, 1-0 изд, BIOS Scientific Publishers Limited (1999), они предназначены для всех вышеуказанных целей, включены в данное описание путем ссылки на целом.

[81] Используемый в данном описании термин "линкер", "пептидный линкер", "связывающая последовательность" или "линкерная последовательность", относятся к структурным доменам и/или локальным коротким аминокислотным последовательностям, содержанным в слитом белке по настоящему изобретению, длина которых обычно составляет 0-20 аминокислот, предпочтительно 2-10 аминокислот.

[82] Используемый в данном описании термин "аминокислотная последовательность SEQ ID NO: N", кодирующий слитый белок или его часть, или домен, является аминокислотной последовательностью, кодирующей слитый белок или его часть, или домен, представленной в виде SEQ ID NO: N, предпочтительно, указанный слитый белок или его часть содержит не более 1, 2, 3, 4, 5, 10 или 20 заменимых, дополненных или делеционных аминокислотных остатков; Еще предпочтительно указанный слитый белок или его часть, или структурный домен, имеют аминокислотную последовательность, которые обладают 80%, 90%, 93%, 95%, 97%, 98% или 99% идентичностью последовательности с последовательностью аминокислотных остатков SEQ ID NO: N; Более предпочтительно, указанный слитый белок или его часть, или структурный домен имеют аминокислотную последовательность SEQ ID NO: N.

[83] Используемый в данном описании термин " FGFR-Fc слитый белок" содержит фрагмент, полученный из внеклеточной области FGFR, слитый белок, полученный из Fc-области иммуноглобулина. В некоторых вариантах осуществления,фрагмент, полученный из внеклеточной области FGFR любую аминокислотную последовательность из (1) SEQ ID NO: 9-15 ;(2) любую аминокислотную последовательность или состоит из ней, которая обладает, по меньшей мере, 70%-ной идентичностью последовательности, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью из SEQ ID NO: 16-2 2, или состоит из этих последовательностей; или (3). любую аминокислотную последовательность, по крайней мере, идентичность которой 70%, предпочтительно по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% с любой аминокислотной последовательностью, кодируемой нуклеотидной последовательностью из SEQ ID NO: 9-15 или состоит из этих последовательностей.

[84] В некоторых предпочтительных вариантах осуществления, в указанном FGFR-Fc слитом белке, указанная нуклеиновая последовательность содержит любую последовательность, полученную путем рекомбинации ее дополнения с любой нуклеотидной последовательностью из SEQ ID NO: 16-22 в жестких условиях рекомбинации, или вырожденные варианты любой нуклеотидной последовательности из SEQ ID NO: 16-22. В некоторых предпочтительных вариантах осуществления, в указанном VEGFR-FGFR-Fc слитом белке содержащиеся фрагменты, полученные из Fc-области иммуноглобулина, могут быть кодируемы нуклеотидной последовательностью, причем указанная нуклеиновая последовательность содержит любую последовательность, полученную путем рекомбинации ее дополнения с любой нуклеотидной последовательностью из SEQ ID NO: 8 в жестких условиях рекомбинации, или вырожденные варианты любой нуклеотидной последовательности из SEQ ID NO: 8.

[85] В некоторых предпочтительных вариантах осуществления, указанный FGFR-Fc-слитый белок содержит вариант FGFR-Fc слитого белка. В одном варианте осуществления, указанный вариант содержит фрагмент IFS, содержащий любую аминокислотную последовательность из SEQ ID NO: 1, № 134-162, № 145-162 или № 151-162, которая содержит не более 2, 3, 4, 5, 10 или 20 заменимых, дополненных или делеционных вариантов аминокислотных остатков, указанные варианты предпочтительно поддерживают способность ингибировать ангиогенез. В другом варианте осуществления, указанные варианты аминокислотных остатков расположены на домене D2, содержащем любую аминокислотную последовательность из SEQ ID NO: 1, № 163-247, которая содержит не более 2, 3, 4, 5, 10 или 20 заменимых, дополненных или делеционных вариантов аминокислотных остатков, указанные варианты предпочтительно поддерживают способность ингибировать ангиогенез. В еще другом варианте осуществления, указанные варианты аминокислотных остатков расположены на домене D3, содержащем любую аминокислотную последовательность из SEQ ID NO: 1, № 270-359, которая содержит не более 2, 3, 4, 5, 10 или 20 заменимых, дополненных или делеционных вариантов аминокислотных остатков, указанные варианты предпочтительно поддерживают способность ингибировать ангиогенез. В дополнительном варианте осуществления, указанные заменимые, дополненные или делеционные варианты аминокислотных остатков расположены в линкере или линкерной части.

[86] FGFR-Fc слитый белок может также содержать посттрансляционные модификации фрагментов, полученных из внеклеточной области FGFR, фрагментов, полученных из Fc области иммуноглобулина. Такие модификации включают, но не ограничиваются следующим: ацетилирование, карбоксилирование, гликозилирование, фосфорилирование, липидизация и ацилирование. Модифицированные FGFR-Fc слитые белки могут включать в себя неаминокислотные компоненты, например, полиэтиленгликоль, липид, полисахарид или моносахарид, фосфат. Влияние неаминокислотных компонентов на FGFR-Fc слитые белки могут быть тестированы, как указанные другие варианты FGFR-Fc слитого белка. При появлении FGFR-Fc слитого белка в клетках посттрансляционные модификации могут быть важными для правильной укладки и/или функции белка. Различные клетки (например, СНО, HeLa, MDCK, 293, WI38, NIH-3T3 или HEK293) имеют специфическую клеточную машину и механизм для активизации этих посттрансляционной активности, и могут выбрать различные клетки, чтобы обеспечить правильную модификацию и обработку FGFR-Fc слитого белка.

[87] Указанные слитые белки в этом описании могут быть получены любыми способами, известными в данной области техники, такими как химический синтез или экспрессию молекул нуклеиновой кислоты. Указанные слитые белки по настоящему изобретению могут быть легко получены известным в данной области усовершенствованным способом синтеза типичного жидкого или предпочтительно, твердофазного пептида (см., например, JM Stewart, JD Young, Solid Phase Peptide Synthesis, 2nd edition, Pierce Chemical Company, Rockford, Illinois (1984), in M. Bodanzsky, A. Bodanzsky, The Practice of Peptide Synthesis, Springer Verlag, New York (1984)). Известные технологии в данной области могут быть использованы для создания одного или нескольких внутримолекулярных сшивания между остатками цистеина в полипептидной последовательности, содержащейся в указанный белок всего расположена ожидаемый (см., например, патент США № 5478925). Кроме того, обычная модификация указанного белка может быть выполнена путем добавления цистеина или биотин на конце С или N.

[88] Используемый в данном описании термин "терапевтически эффективное количество" или "эффективное количество" относится к достаточной дозе, которая может оказывать действие на объект применения лекарств. Суммы фактического применения и нормы расхода и время, конечно, будут зависеть от лечения их собственными обстоятельствами и тяжестью болезни. Рецепт (например, решение дозы и т.д.) определяется терапевтов и других врачей, доза зависит от их решения, определяется обстоятельством отдельного пациента, местом доставки, способом введения, и для врачей известными другими факторами.

[89] Автор настоящего изобретения обеспечит способ создания серии FGFR-Fc слитого белка, который обладает высокой способностью связывания VEGF, а также эффективно ингибировать клеточное деление, индуцированное FGF. Указанный слитый белок предпочтительно включает в себя: фрагмент IFS, D2, D3 и Fc область иммуноглобулина.

[90] Авторы настоящего изобретения также неожиданно обнаружили, что длина фрагмента, полученного из IFS, существенно повлиять на связывание слитого белка с FGF. Соответственно, в некоторых вариантах осуществления настоящее изобретение обеспечивает слитные белки, содержавший фрагмент различных длин, полученный из IFS. Предпочтительно, указанный фрагмент, полученный из IFS, не содержит кислой ячейки, более предпочтительно, имея аминокислотную последовательность SEQ ID NO: 1, № 134-162, № 145-162 или № 151-162. В некоторых предпочтительных вариантах осуществления, в котором указанный фрагмент, полученный из IFS, имеет аминокислотную последовательность SEQ ID NO: №145-162, кодирующую слитый белок, имеющий особенно высокую аффинность в отношении FGF, который особенно эффективно ингибирует деление клеток, индуцированное FGF.

[91] В некоторых вариантах осуществления настоящее изобретение обеспечит растворимый FGFR-Fc слитый белок, включающий: D1, фрагмент, полученный из IFS, D2, D3 и Fc область иммуноглобулина. Отличающийся тем, предпочтительно, указанный фрагмент, полученный из IFS, не содержит кислотной ячейки и, более предпочтительно, имеет аминокислотную последовательность SEQ ID NO: 1, № 134-162, № 145-162 или № 151-162.

[92] В еще одном варианте осуществления настоящее изобретение обеспечит растворимый FGFR-Fc слитый белок, включающий: часть D1, фрагмент, полученный из IFS, D2, D3 и Fc область иммуноглобулина. Отличающийся тем, предпочтительно, указанный фрагмент, полученный из IFS, не содержит кислотной ячейки, более предпочтительно, имея аминокислотную последовательность SEQ ID NO: 1, № 134-162, № 145-162 или № 151-162.

[93] В других вариантах осуществления настоящее изобретение обеспечит растворимый FGFR-Fc слитый белок, включающий в себя следующий состав: фрагмент, полученный из IFS, D2, D3 и Fc область иммуноглобулина. Отличающийся тем, что предпочтительно указанный фрагмент, полученный из IFS, не содержит кислотной ячейки, более предпочтительно, имея аминокислотную последовательность SEQ ID NO: 1, № 134-162, 145-162 или 151-162.

[94] В еще одном варианте осуществления настоящее изобретение обеспечит растворимый FGFR-Fc слитый белок от конца Н до конца С, в свою очередь состоит из следующего: фрагмент, полученный из IFS, D2, D3 и Fc область иммуноглобулина. Отличающийся тем, предпочтительно, указанный фрагмент, полученный из IFS, не содержит кислотной ячейки, более предпочтительно, имея аминокислотную последовательность SEQ ID NO: 1, № 134-162, № 145-162 или № 151-162.

[95] В другом варианте осуществления настоящее изобретение обеспечит FGFR-Fc слитый белок, прямо или косвенно ингибирующий рост опухолевых клеток. В предпочтительном варианте, FGFR-Fc слитый белок по настоящему изобретению прямо ингибирует рост опухолевой клетки. В более предпочтительном варианте, FGFR-Fc слитый белок по настоящему изобретению ингибирует рост опухолевых клеток, по крайней мере, на 10%, 20%, 30%, 40%, 50%, 80%, 90%, 95% и т.д. Указанные опухолевые клетки могут быть любыми опухолевыми клетками, такими как клетки лейкоза, рака легких, рака печени, рака головы и шеи, рака желудка, рака мочевого пузыря, рака шейки матки и т.д. В частности, ингибирование опухолевых клеток осуществляется путем непосредственного связывания с опухолевыми клетками.

[96] В некоторых вариантах осуществления, настоящее изобретение обеспечит нижеуказанные композиции для изготовления лекарств опосредованного ангиогенеза или связанных заболеваний и их лекарственные назначения: (i) FGFR-Fc слитый белок или (ii), полинуклеотидная последовательность, кодирующая данный слитый белок. Например, в одном варианте осуществления настоящее изобретение включает применение указанных частей в подготовке ингибиторов ангиогенеза: (i) FGFR-Fc слитый белок или (ii), полинуклеотидная последовательность, кодирующая данный слитый белок.

[97] В некоторых вариантах осуществления, FGFR-Fc слитый белок может быть получен с использованием молекулы нуклеиновых кислот, содержавшей любую нуклеиновую последовательность из SEQ ID NO: 16-22, экспрессируемых в линии клеток млекопитающих. В частности, указанная линия клеток млекопитающего представляет собой СНО клеточную линию

[98] Кроме того, настоящее изобретение также обеспечит нижеуказанные FGFR-Fc слитые белки, в которых фрагменты, полученные из внеклеточной области VEGFR, фрагменты, полученные из внеклеточной области FGFR, фрагменты, полученные из области Fc иммуноглобулина, непосредственно соединены или через линкер.

[99] В другом варианте осуществления настоящее изобретение включает выделенные молекулы нуклеиновой кислоты FGFR-Fc слитого белка, также включает в себя использование этих молекул в производстве лекарственного средства. Указанные нуклеиновые кислоты могут быть рекомбинантными, синтетическими или порожденными любым из методов, доступных в данной области, указанный способ включает клонирование с использованием стандартных методик.

[100] В еще других вариантах осуществления настоящее изобретение включает вектор, содержащий выделенную молекулу нуклеиновой кислоты по настоящему изобретению. Указанный вектор может быть экспрессирующими векторами, указанная нуклеиновая кислота эффективно подключена к контролирующей последовательности такой нуклеиновой кислоты, экспрессированной в клетке-хозяине. Например, подходящий вектор может содержать вирус (например, поксвирус, аденовирус, бакуловирус и т.д.); дрожжевые векторы, фаг, хромосомы, искусственные хромосомы, плазмиды, космиды.

[101] В некоторых вариантах осуществления настоящее изобретение также включает клетки, трансфицированные этими векторами для экспрессирования FGFR-Fc слитого белка. Применимые в настоящем изобретении клетки-хозяева могут быть прокариотическими клетками или эукариотическими клетками. Они включают, но не ограничиваются следующим: бактерии, такие как кишечные палочки, дрожжи, клетки насекомых и клетки млекопитающих. Линии клеток млекопитающих, которые могут быть использованы, включают, клетки яичника китайского хомячка (СНО), клетки детенышей хомяка почки, NS 0 клетки миеломы мыши, клеточные линии обезьяны и человека и их вырожденные клеточные линии, и так далее.

[102] В другом аспекте настоящее изобретение обеспечивает способ ингибирования ангиогенеза, включающий введение эффективного количества FGFR-Fc слитого белка по настоящему изобретению объекту, нуждающемуся в лечении. Предпочтительно, способ осуществляется у млекопитающего.

[103] В другом аспекте, настоящее изобретение обеспечивает способ слияния FGF в пробирке или в естественных условиях, включая взаимодействие FGF со слитым белком по настоящему изобретению.

[104] В другом своем аспекте, настоящее изобретение обеспечивает способ лечения или профилактики опухолей у млекопитающего, включающий введение эффективного количества эффективного количества FGFR-Fc слитого белка по настоящему изобретению объекту, нуждающемуся в лечении. Опухоль предпочтительно представляет собой солидную опухоль.

[105] В еще другом аспекте, настоящее изобретение обеспечивает способ лечения или профилактики глазных связанных с регулированием ангиогенеза заболеваний у млекопитающих, включающий введение эффективного количества FGFR-Fc слитого белка по настоящему изобретению объекту, нуждающемуся в лечении. Указанные заболевания глазного ангиогенеза, предпочтительно представляют собой возрастную макулярную дегенерацию.

[106] Настоящее изобретение также относится к применению FGFR-Fc слитого белка по настоящему изобретению в приготовлении лекарства для ингибирования ангиогенеза. Кроме того, настоящее изобретение также относится к применению FGFR-Fc слитого белка по настоящему изобретению в приготовлении лекарства, предназначенного для лечения или профилактики заболеваний, связанных с регулированием ангиогенеза, предпочтительно, связанные с регулированием ангиогенеза заболевания представляют собой опухоль или глазные заболевания, связанные с регулированием ангиогенеза.

[107] Описанные в настоящем изобретении заболевания, связанные с регулированием ангиогенеза, включают, но не ограничиваются следующим:, зависимый от ангиогенеза рак, включая твердые опухоли, опухоли крови (например, лейкоз), метастаз опухоли; доброкачественные опухоли, например, гемангиомы, невриномы слухового нерва (acoustic neuroma), нейрофиброма (neurofibroma), трахома (neurofibroma) и гнойные гранулемы (pyogenic granuloma); ревматоидный артрит; псориаз, покраснение радужки (rubeosis); Ослера-Вебера синдром (Osler-Webber Syndrome); инфаркт ангиогенеза (myocardial angiogenesis); неоваскуляризации бляшки (plaque neovascularization); телеангиоэктазия (telangiectasia); гемофилический артрит (hemophiliac joint) и ангиофиброма (angiofibroma)

[108] В некоторых вариантах осуществления указанных способов можно использовать совместно (одновременно) или в различные моменты времени (последовательно) один или более FGFR-Fc слитого белка. Кроме того, указанный слитый белок может использоваться вместе с другим типом препарата для лечения от рака или ингибирования ангиогенеза.

[109] В некоторых вариантах осуществления настоящего изобретения, описанные методы могут быть использованы отдельно. Или, указанный способ может использоваться в сочетании с другой обычной противоопухолевой терапией для лечения или профилактики пролиферативных заболеваний (например, опухоль). Например, эти способы могут быть использованы для профилактики рака, предотвращения рецидива рака и передачи после хирургического вмешательства, а также могут использоваться как дополнительный способ для лечения от другого рака. Настоящее изобретение доказал, что при проведении обычных противораковых терапий (например, химиотерапия, лучевая терапия, светолечение, иммунотерапия и хирургия) эффективность лечения может быть повышена за счет использования целевого полипептида терапевтического агента.

[110] Глазной ангиогенез связывается со следующим: диабетическая ретинопатия, ретинопатия недоношенных (retinopathy of prematurity), возрастная дегенерация желтого пятна, отторжение трансплантата роговицы, неоваскулярная глаукома и ретролентальная фиброплазия (retrolental fibroplasia). VEGFR-FGFR-Fc слитые белки, описанные здесь, могут быть введены способом внутриглазного введения или с помощью других способов. Другие глазные болезни, связанные с регулированием ангиогенеза, включают, но не ограничиваются следующим: эпидемический кератоконъюнктивит (epidemic keratoconjunctivitis),дефицит витамина А) (Vitamin A deficiency), износ контактных линз (contact lens overwear), атопический кератита (atopic keratitis), верхний лимбальный, кератоконъюнктивит (superior limbic keratitis), птеригиум фетальных кератит (pterygium keratitis sicca), болезнь Шегрена (sjogren), розацеа (acne rosacea), фликтенулез, сифилис (syphilis), микобактерия (Mycobacteria infection), дегенерации липидов (lipid degeneration), химические ожоги (chemical bum), бактериальные язвы (bacterial ulcer), грибковые язвы (fungal ulcer), инфекция простого герпеса (Herpes simplex infection), опоясывающий лишай (Herpes zoster infection), простейшими инфекции (protozoan infection), саркома Капоши (Kaposi sarcoma), язвы Морена( (Mooren ulcer), краевая дегенерация роговицы Терьена (Terrien's marginal degeneration),мелкоточечный кератолиз (mariginal keratolysis), ревматоидный артрит, системная красная волчанка (systemic lupus), полиартрит (polyarteritis), травмы (trauma), Вегенер саркоидоз (Wegeners sarcoidosis), склерит (Scleritis), Стивен Джонсон болезнь (Steven's Johnson disease), радиальная кератотомия пемфигоида (periphigoid radial keratotomy), отторжение трансплантата после пересадки роговицы (comeal graph rejection), серповидно-клеточная анемия (sickle cell anemia), псевдоксантома эластическая (sarcoid), псевдоксантома эластическа (pseudoxanthoma elasticum), болезнь Педжета (Pagets disease), окклюзии вены (vein occlusion), закупорка артерий (artery occlusion), обструктивная болезнь сонной артерии (carotid obstructive disease), хронический увеит/витрит (chronic uveitis/vitritis), микобактериальная инфекция (mycobacterial infections), болезнь Лайма (Lyme's disease), истемная красная волчанка (systemic lupus erythematosis), ретинопатия недоношенных (retinopathy of prematurity), Eales болезнь (Eales disease), болезнь Бехчета (Bechets disease), инфекции, приведенные к ретиниту (retinitis) или хориоидиту (choroiditis), предполагаемый глазной гистоплазмоз (presumed ocular histoplasmosis), Бестс болезнь (Bests disease), миопии (myopia), миопии (optic pit), болезнь Штутгарт (Stargarts disease), воспаление pars plana (pars planitis), хроническая отслойка сетчатки (chronic retinal detachment), синдром повышенной вязкости крови (hyperviscosity syndromes), (токсоплазмоз(toxoplasmosis), травмы (trauma), осложнение после лазерной хирургии (post-laser complication). Другие заболевания, включают, но не ограничиваются следующим: заболевания, связанные с неоваскуляризацией радужки (neovasculariation of the angle), заболевания, вызванные аномальной пролиферацией фиброваскулярной ткани (fibrovascular), фиброзной ткани (fibrous tissue), включая все формы пролиферативной витреоретинопатии ретинопатии (vitreoretinopathy).

Способы применения

[111] Слитый белок по настоящему изобретению вводится отдельно, но предпочтительно вводили в виде фармацевтической композиции, как правило, представляет собой подходящий фармацевтический наполнитель, разбавитель или вектор, определенный по плану применения. Слитый белок может быть применен у пациентов, нуждающихся в лечении любым подходящим способом. Точная доза будет варьироваться в зависимости от нескольких факторов, в том числе характеристики слитого белка.

[112] Некоторые подходящие способы включают (но не ограничиваясь ими) пероральное применение, ректальное, назальное, локальное (включая пероральное и сублингвальное), подкожное, вагинальное или парентеральное (включая подкожное, внутримышечное, внутривенное, внутрикожное, интратекальное и эпидуральное) применение.

[113] Для внутривенной инъекции и инъекции в локализации боли, активный ингредиент будет представлен в парентерально приемлемом виде водного раствора, его пироген не имеет подходящие рН, изотоничность и стабильность.

[114] Соответствующие специалисты в данной области могут использовать подходящий растворитель или препарат для изготовления слитых белков, например изотонические наполнители, такие как инъекции натрия хлорида для инъекции, раствор Рингера для инъекций, Рингера лактат для инъекций. Консерванты, стабилизаторы, буферы, антиоксиданты и/или другие добавки могут быть добавлены в соответствии с требованиями. Орально фармацевтические композиции могут быть в форме таблеток, капсул, порошков или жидкости, принимаемой внутрь. Таблетка может включать твердый вектор, такой как желатин или адъювант. Жидкие фармацевтические композиции обычно включают жидкий вектор, такой как вода, минеральные, животные или растительные масла, минеральное масло или синтетическое масло. Также включают физиологический солевой раствор, декстроза или другой раствор сахарида или гликоли, такие как этиленгликоль, пропиленгликоль или полиэтиленгликоль.

[115] Примеры вышеупомянутых технологий и решений, а также другие технологии и решения которые могут быть использованы в соответствии с настоящим изобретением, могут быть найдены в Remington's Pharmaceutical Sciences, 16th edition, Oslo, A. (ed), 1980.

Клонирование слитого белка и создание экспрессирующей плазмиды

[116] Фрагмент рецептора FGF получены путем амплификации кДНК-матрицы методом ПЦР, Fc-фрагмента IgG1 человека получен путем амплификации кДНК IgG1 человека методом ПЦР. При конструировании праймеров для ПЦР, введена ликерная последовательность в место между различными фрагментам, чтоб каждые фрагменты могли быть связаны путем перекрывания ПЦР, формировали различные рамки считывания слитого белка, в то время на двух концах кДНК, соответственно добавили сайты BSPE I, Pst I эндонуклеазы. После добавления сайтов BSPE I, Pst I эндонуклеазы, кДНК различного слитого белка может быть клонирована в экспрессирующую плазмиду. Клонированная плазмида после ферментативного расщепления BSPE I, Pst I эндонуклеазой, электрофоретического анализа определяется путем секвенирования ДНК.

Экспрессия и очистка слитого белка

[117] Слитый белок по настоящему изобретению может быть экспрессирован и очищен часто использующимися способами в данной области.С использованием набора Qiagen набора для очистки плазмид (MAX) проводили очистка ДНК плазмиды соответствующего слитого белка, способом УФ-спектрофотометрии определяется концентрация ДНК плазмиды, с использованием Fugene 6 липосомы (Roche), плазмида трансфицируется в клетки СНО. Конкретный метод трансфекции определяется в соответствии с описанием товара. В этом исследовании использовали два метода экспрессии белка в соответствии с уровнем экспрессии белка: первый способ - временная экспрессия, культуральный супернатант, содержащий слитый белок, обычно собирали надосадочную жидкость через 48-72 часов после трансфекции, с использованием IgG ELISA определяется отвекторное содержание слитого белка, тем самым быстро и эффективно получится слитый белок; Второй способ заключается в создании стабильной клеточной линии, с использованием экспрессии рекомбинантных белковых препаратов проводили часто использующиеся DHFR-дефицитные системы экспрессии клеток основной процесс включает трансфекцию клеток и стабильную трансфекцию клеток, скрининг клонов, амплификацию при повышенном напряжении, оптимизацию культурной среды, и в конечном осуществляется крупномасштабная суспензионная культура CHO клеточных линий в среде без сыворотки. Собирается продукт культуры, с использованием способом аффинной хроматографии Protein A проводили очистка слитого белка. Способом додецилсульфата натрия в полиакриламидном геле (ДСН-ПААГ) проводили анализ очищенного белка, а затем объединить элюата, содержащие экспрессирующий продукт, с использованием мембранного фильтра размера пор 0,22 мкм проводили фильтрация, методом Лоури проводили дозирование белка. Объем биореактора культуры клеток CHO будет составлять 10 литров, очищенный слитый белок способен удовлетворить потребность в белке животного теста, чтоб заложить фундамент для дальнейшего расширения процесса.

Проверка нейтрализации FGF с использованием слитого белка на уровне белка

[118] После получения слитого белка, экспрессируемого на клетках СНО, это исследование будет оценивать способность связывания слитого белка с FGF по уровне белка. Это исследование включает испытание на связывание, испытание на аффинитет. Испытание на связывание проводили следующим образом: сначала соответственно FGF покрывали 96-луночный планшет ELISA, затем блокируйте с использованием BSA, добавили разные слитые белки той же концентрации, после промывания добавили вторичное антитело против человеческого Fc-области IgG-HRP. После проявления цвета считывали оптической плотность планшета при длине волны 450 нм. согласно интенсивности сигнала, выбирали FGF-2 белки, обладающие высокой способностью связывания. Испытание на аффинитет предназначается для проверки аффинитета слитого белка в растворе с FGF. Сначала отдельно покрывали 96-луночный планшет ELISA с использованием захваченного антитела FGF, затем блокируйте с использованием BSA, добавили смешивающуюся жидкость из предварительно изготовленного, инкубированного антитела FGF-2, стандартный разбавленный раствор, после инкубирования добавили контрольное антитело HRP(с использованием специфической детекции проверяется свободное FGF-2-антитело 2). После проявления цвета считывали оптической плотность планшета при длине волны 450 нм. чтоб определить векторную концентрацию свободного антитела FGF-2 в смеси слитого белка с антителом FGF-2.С помощью вышеуказанных испытаний получили слитые белки, имеющие ингибирующее действие на FGF-2.

Проверка нейтрализации FGF с использованием слитого белка на клеточном уровне

[119] После определения связывающей способности слитого белка с FGF-2 на белковом уровне, настоящее исследование предназначается для дальнейшей проверки его ингибирования ангиогенеза. В настоящем исследовании, посредством испытания на расщепление человеческой эндотелиальной клетки пупочной вены (HUVEC), испытания на миграцию клеток HUEVC проверяется способность слитого белка ингибировать деление клеток, миграцию сосудистой эндотелиальной клетки. Испытание на расщепление HUVEC клетки может проверять способность слитого белка ингибировать деление клеток HUVEC. При проведении испытания сначала на лунку в 96-луночные планшеты инокулировали3000 HUVEC клеток при 37°С, в 5% СО2 инкубаторе культуры культивируйте, затем отдельно добавили смесь слитого белка разных концентраций с антителом FGF-2, продолжайте культивирование в течение 3-4 дней, добавили 10%-CCK-8, продолжайте культивирование, через 2 часа считывать оптическую плотность при 450 нм длины волны. Можно оценить способность ингибирования деления сосудистой эндотелиальной клетки, индуцированного FGF-2, получить среднюю эффективную концентрацию слитого белка ингибирования FGF-2. Испытание на миграцию клеток HUEVC может проверить способность слитого белка ингибировать миграцию HUVEC клеток, инокулировали 5000 HUVEC клеток, слитый белок разных концетраций в верхней камере. Добавьте 600 мкл культуральной среды, содержащей антитело FGF-2, культивируйте в 37°С, 5% СО 2 инкубаторе в течение 20-24 часов, после культитивирования стереть клетки на положительной поверхности верхней камеры, прикрепляйте, окрашивайте клетки на задней стороне планки, промывайте мембрану с использованием PBS, при помощи микроскопа наблюдайте, производите подсчет клеток на задней стороне пленка, путем подсчета количества HUVEC клеток получить информацию о миграции HUVEC клеток при стимуляции FGF-2, добавка слитого белка разных концентраций в культуральную среду позволяет проверить способность слитого белка ингибировать миграцию сосудистых эндотелиальных клеток. С помощью приведенных выше испытаний вы можете проверять способность нового слитого белка согласно настоящему исследованию ингибировать деление, миграцию сосудистой эндотелиальной клетки, индуцированное FGF-2, а также заложить основу для дальнейших испытаний на животных.

Проверка слитого белка способность ингибировать рост опухоли при помощи модели опухоли

[120] После того, как испытания на уровне белка, на уровне клетки уже доказывали, что новый слитый белок по настоящему исследованию оказывает блокирующий эффект на FGF-2 сигнал, что это исследование будет проверить его противоопухолевую активность при помощи животной модели опухоли. В этом исследовании, способ верификации модели, обычно используемый в исследовании препаратов против ангиогенеза, противоопухолевых препаратов, будет использован, чтоб доказывать, что слитый белок оказывает ингибирующее влияние на ангиогенез и опухоль, например, карцинома легких LLC у мышей, U87 глиобластома, опухоль меланома В16.В исследованиях на животных, в дополнение к обычной контрольной группой, а также включает обычные аналогичные контрольные группы, такие как VEGF-Trap, FP-1039, для того чтобы получить сравнительные данные по противоопухолевой способности. В процессе испытания, опухолевые клетки100 мкл соответствующего количества вводили подкожно в заднюю часть C57 стороне задней мыши, объем опухоли измеряют с использованием штангенциркуля два раза в неделю, когда опухоль выросла до около 200 мм3, производят подкожную инъекцию слитого белка различных концентраций, через 1-2 недели убивают мышей, объем опухоли измеряют штангенциркулем, в соответствии с размером опухоли проверяется противоопухолевый эффект слитого белка. Кроме того, с использованием иммуногистохимического метода и других методов анализируют различные опухолевые ткани, чтоб изучить механизм регуляции ангиогенеза.

Примеры осуществления

Пример осуществления 1: создание рекомбинированной экспрессирующей плазмины FGFR 1 -Fc слитого белка

[121] Фрагмент рецептора FGF получен путем амплифицирования матрицы кДНК рецептора FGF способом ПЦР., Fc фрагмент IgG1 получен путем амплифицирования кДНК матрицы IgG1 человека способом ПЦР. Коммерчески доступная кДНК (ПЦР готовые первые цепи кДНК, полученные из тканей рака толстой кишки у взрослых, фирма BioChain) используется в качестве матрицы FGFR1 фрагмента. Коммерчески доступные плазмины pBLAST45-hFLT1s7cDNA (фирма Invivogen) использовали в качестве матрицы VEGFR1 фрагмента. Коммерчески доступные плазмиды pBLAST45-hFLK1s7 (фирма Invivogen) использовали в качестве матрицы VEGFR2 фрагмента. Используя комплект для экстракции РНК из крови человека (Qiagen), экстрагируют тотальную РНК из крови здоровых людей. Проводили ОТ-ПЦР с использованием M-MLV обратной транскриптазы (фирма Promega) в соответствии с инструкциями по применению набора обратной транскриптазы (фирма Promega), путем обратной транскрипции РНК превратился в кДНК, который использовали как матрицу IgG1 Fc-фрагмента.ОТ-ПЦР проводили в соответствии с инструкцией по использованию комплекта обратной транскриптазы, конкретные операции: перемешивали олиго дТ, дНТФ, тотальную РНК и DEPC H2O размерно, проводили реакцию при 70°C в течение 10 минут, поставите на льду в течение 5 минут, добавили ингибитор фермента РНК, M-MLV обратную транскриптазу и реакционный буфер, проводили реакция при 42°C на 1 час, затем подвергали реакции при 70°С в течение 15 минут, чтоб получить кДНК может быть использован в качестве матрицы.

[122] Используя кДНК ткани рака толстой кишки у взрослых в качестве матрицы, различные FGFR1 фрагменты амплифицировали способом ПЦР (праймеры приведены ниже в таблице 1), используя кДНК крови человека в качестве матрицы, амплифицировали фрагмент Fc IgG1 способом ПЦР (праймеры приведены ниже в таблицах 1 и 2). Условия реакции ПЦР: при 98°C проводили предварительную денатурацию в течение 5 мин, при 98°С проводили денатурацию в течение 30 секунд, затем при 56°С проводили отжиг 45 секунд, и проводили амплификацию при 72°С в течение 2 минут, всего проводили 30 циклов, в конце проводили амплификацию в течение 10 минут. При реконструкции праймеров для ПЦР, вводили 20 или комплементарных нуклеотидных последовательностей в места между фрагментом фрагментом FGFR1, фрагментом Fc IgG1, которые использовали в качестве линкерной последовательности, каждые фрагменты могут быть соединены путем перекрытия ПЦР, формировали различные рамки считывания слитого белка, в то время на двух концах кДНК, соответственно добавили сайты BSPE I, Pst I эндонуклеазы.

[123] Затем перекрывали ПЦР, путем амплифицирования получены различные FGFR1-Fc фрагменты слитого белка. Перекрытие ПЦР разделено на два этапа ПЦР, реакции на первом этапе содержат соединяемые фрагменты, но не содержат праймеров. Условия реакции ПЦР: при 98°C проводили предварительную денатурацию в течение 5 мин, при 98°С проводили денатурацию в течение 30 секунд, затем при 56°С проводили отжиг 45 секунд, и проводили амплификацию при 72°С в течение 2 минут, всего проводили 6 циклов, в конце проводили амплификацию в течение 10 минут. Затем прибавляли праймеры к обоим концам. Второй этап ПЦР проводили в условиях: при 98°C проводили предварительную денатурацию в течение 5 мин, при 98°С проводили денатурацию в течение 30 секунд, затем при 56°С проводили отжиг45 секунд, и проводили амплификацию при 72°С в течение 2 минут, всего проводили 30 циклов, в конце при 72°С проводили амплификацию в течение 10 минут, формировали различные рамки считывания слитого белка, в то время на двух концах кДНК, соответственно добавили сайты BSPE I, Pst I эндонуклеазы.

[124] После амплифицирования, используя набор для очистки QIAquick PCR (фирма QIAGEN), проводили очистку амплифицированных фрагментов с использованием ПЦР, отдельно проводили ферментативное расщепление кДНК, эукариотических экспрессирующих плазмидыр SV2-dhfr (ATCC)различных слитых белков. С использованием BSPE I, Pst I эндонуклеаз, при напряжении 90В, проводили электрофорез в 1% агарозном геле, используя напор для экстракции из геля QIAquick (фирма Qiagen) проводили сбор целевых фрагментов, с использованием лигазы (фирма NEB) проводили соединение при 16°С в течение 1 часа, реакционную смесь трансформировали в компетентные бактерии Top10 кишечной палочки в условиях 42°С, подвергали реакции в течение 90 секунд, а затем укладывали на льду в течение 3 минут, добавляя стерильную культуральную среду LB без антибиотика, при 37°С инкубировали в течение 1 часа в шейкере при 250 об/мин, наносили на LB пластину, содержащую ампициллинв инкубировали в течение ночи при 37°С в инкубаторе. Выбирали одну колонию в культуральной среде LB, содержащей ампициллин при 37°С, в шейкере при скорости 250 об/минкультивировали в течение ночи, после экстракции плазмиды способом щелочного лизиса, с использованием рестриктазы при 90В напряжения проводили ферментативное расщепление, проводили электрофорез в 1% агарозном геле, взяв рекомбинантную плазмиду, проводили секвенирование ДНК.В соответствии с процедурой, изложенной выше, проводили реконструкцию 19#, 13#, 22#, 23#, 26#, 29# и 8# рекомбинантных экспрессирующих плазмид слитого белка FGFR1-Fc. Белковые последовательности различных FGFR-Fc слитых белков и их кодирующие нуклеотидные последовательности приведены в таблице 3. Конструктивная схема слитого белка показана на рисунке 1.

Таблица 1
Используемые праймеры для амилифицирования фрагментов FGFR 1 в процессе создания вектора
Слитый белок Обратный праймер Праймер
19# 19#-FGFR1For (SEQ ID NO: 24)
TAGTTCCGGAAGGCCGTCCCCGACCTT
GCCTG
FGFR1Rev (SEQ ID NO: 31)
GTTTTGTCCTCCAGGTACAGGG
GCGAGGTC
13# 13#-FGFR1For (SEQ ID NO: 25)
TAGTTCCGGAAAAAATCGCACCCGCAT
CACAG
FGFR1Rev
22# 22#-FGFR1For (SEQ ID NO: 26)
TAGTTCCGGAGTAACCAGCAGCCCCTC
GGGC
FGFR1Rev
23# 23#-FGFR1For (SEQ ID NO: 27)
TAGTTCCGGATCCTCTTCAGAGGAGAA
AGAAAC
FGFR1Rev
26# 26#-FGFR1For (SEQ ID NO: 28)
TAGTTCCGGAAAACCTAACCCCGTAGC
TCCAT
FGFR1Rev
29# 29#-FGFR1For (SEQ ID NO: 29)
TAGTTCCGGACCATATTGGACATCCCC
AGAAAAG
FGFR1Rev
8# 8#-FGFR1For (SEQ ID NO: 30)
CTAGCTCCGGACCAGAAAAGATGGAA
AAGAAATTGC
FGFR1Rev
Таблица 2
Используемые праймеры для амилифицирования фрагментов IgG1 Fc
Обратный праймер Праймер
фрагмент IgG1 Fc FcFor (SEQ ID NO: 32)
CTGTACCTGGAGGACAAAA
CTCACACATGC
FcRev (SEQ ID NO: 33)
GATATCTGCAGTCATTTACC
CGGAGACAGG
Таблица 3
Белковые последовательности и нуклеотидные последовательности FGFR1-Fc слитого белка
Слитый белок Аминокислотная последовательность Нуклеотидная последовательность
19# SEQ ID NO: 9 SEQ ID NO: 16
13# SEQ ID NO: 10 SEQ ID NO: 17
22# SEQ ID NO: 11 SEQ ID NO: 18
23# SEQ ID NO: 12 SEQ ID NO: 19
26# SEQ ID NO: 13 SEQ ID NO: 20
29# SEQ ID NO: 14 SEQ ID NO: 21
8# SEQ ID NO: 15 SEQ ID NO: 22

Пример 2: Временная экспрессия и количественный состав слитых белков

[126] Используя набор для очистки MAX плазмиды (фирма Qiagen), проводили очистку плазмиды соответствующего слитого белка, используя способ ультрафиолетовой спектрофотометрии, определяли концентрацию плазмиды ДНК, положили 1 мкг рекомбинантной плазмиды, 6 ул липосома (FuGENE 6 Transfection Reagent, фирма Roche) в 100 мл свежей культуральней среды IMDM (GIBCO), перемешивали равномерно, выдерживали в течение 15 минут, добавили согласно плотности клеток 3×105/мл, инокулировали в СНО (АТСС) клетках в 6-луночном планшете, культуральная среда клеток содержит 88% IMDM, 10% FBS, 1% HT и 1% глутамина (все они представляют собой продукцию GIBCO), в 5% CO2 инкубаторе при температуре 37°С, собирали надосадочную жидкость через 48 часов после начала культирования, используя ELISA напор для дозирования IgG-белков человека (Bethyl), определили отвекторное содержание слитого белка, экспрессирующего секреторные клетки СНО. Конкретные шаги заключаются в следующем: добавили 100 мкл совместимого очищенного античеловеческого IgG-Fc белка концентрации 10 мг/мл, чтоб покрыть 96-луночные планшеты ELISA (фирма Immulon), покрывали в течение ночи. PBST промывочной жидкостью пять раз промывали, используя 200 мкл свежеприготовленного блокирующего рабочего раствора (фирма KPL) (блокирующий жидкий раствор: PBS=1:19), блокировали каждые лунки, инкубировали при 37°С в течение 1 ч, используя 300 мкл PBST промывочной жидкости, промывали пять раз, проливали 100 мкл по лункам, проводили градиентное разбавление(начало разбавления представляет собой 200 нг/мл, проводили разбавление при 2-кратном разбавлении раствора ЗФР), используя разбавленный раствор IgG в качестве матрицы, инкубировали супернатант клеток разных слитых белков в 100 мкл разбавленном растворе (начало разбавления представляет собой супернатант, проводили разбавление при 5- кратном разбавлении раствора ЗФР) при 37°С в течение 2 ч. Используя 300 мкл PBST промывочной жидкости, промывали пять раз,добавляя 100 мкл раствор второго антитела против человеческого Fc-области IgG-HRP (фирма BETHYL), разбавленный 1:10000 раствором ЗФР, инкубировали в течение 1 часа при 37°С. Используя 300 мкл PBST промывочной жидкости, промывали пять раз, добавляя 100 мкл хромогенной жидкости (фирма KPL) для проявления цвета, в конце добавили 100 мкл стоп-раствора (фирма KPL). После проявления цвета поместили пластинку ELISA на микропланшет-ридер, считывать оптическую плотность при длине волны 450 нм. Согласно стандартной кривой определяли концентрацию разных слитых белок.

Пример 3: Испытание на связывание слитого белка

[127] Используя метод ELISA, проверяли связывающую способность 19#, 13#, 22#, 23#, 26#, 29# и 8# слитых белков с FGF-2. Сначала в 96-луночный планшет ИФА (Immulon Ко) соответственно приливали 100 мкл автора, содержащего 20 нг/мл VEGF (фирма R&D Systems), 50 нг/мл FGF -2 (фирма R&D Systems) (содержание гепарина составляет 100 нг/мл (компания Sigma)). Используя 300мкл PBST промывочного раствора промывали пять раз, используя 200 мкл свежеприготовленного блокирующего рабочего раствора (фирма KPL) (блокирующий раствор хранения: PBS=1:19), блокировали каждые лунки, инкубировали в течение 1 часа при 37°С, используя 300 мкл PBST промывочного раствора промывали пять раз, добавляя 100 мкл раствор второго антитела против человеческого Fc-области IgG-HRP (фирма BETHYL), разбавленный 1:10000 раствором ЗФР, инкубировали в течение 1 часа при 37°С. Используя 300 мкл PBST промывочной жидкости, промывали пять раз,добавляя 100 мкл хромогенной жидкости (фирма KPL) для проявления цвета, в конце добавили 100мкл стоп-раствора (фирма KPL). После проявления цвета поместили пластинку ELISA на микропланшет-ридер, считывали оптическую плотность при длине волны 450 нм, тем выше связывающая способность слитых белков с FGF-2, чем выше оптическая плотность белка, мощность сигнала, в соответствии с силой сигнала определяли связывающую способность слитых белков, 26-й слитый белок обладает самой высокой связывающей способностью с FGF-2. Сравнение связывания слитых белков с FGF-2 показано на рисунке 2. Как показано на рисунке, созданные по настоящему изобретению слитые белки, 19#, 13#, 22#, 23#, 26# и 29# имеют различную способность связывания с FGF в присутствии гепарина, в частности степень интеграции слитых белков 23#, 26# и 29# гораздо более белков в контрольной группе, также выше, чем 19#, 13# и 22#. Это доказывает, что слитые белки по настоящему изобретению без кислой ячейки имеют особенно хорошие результаты. Среди них, в частности слитый белок 26# проявляет высокую способность связывания, поэтому, слитые белки по настоящему изобретению, содержащие участок области промежуточной функциональной последовательности определенной длины, полученный из Ig-подобного домена FGFR, имеют значительно лучшие результаты связывания.

Пример 4: Стабильная экспрессия и очистка слитых белков

[128] Рекомбинантные экспрессионные плазмиды слитого белка № 26, обладающего высокой связывающей способностью FGF-2, трансфицировали липосомами (фирма Roche) в DHFR-дефицитные клетки СНО (АТСС). В частности, добавили 5 мкг рекомбинантной плазмиды, и 30 мкл липосом (FuGENE 6 реагента для трансфекции, фирма Roche) в 100 мкл свежей культуральной среде IMDM (фирма GIBCO), смешивали равномерно, выдерживали 15 минут, добавили в 10 см чашке для культивирования клетки (фирма Corning) согласно плотности клеток 3×105/мл,, где культивировали в течение ночи DHFR-дефицитные клетки СНО (АТСС), клеточная культуральная среда представляет собой IMDM культуральную среду, содержащую 10% FBS, 1% HT и 1% глутамина в культуре(все они приобретены у компании GI ВСО), культивировали в 5% CO2 инкубаторе при температуре 37°С в течение 2-3 дней, переваривали клетки трипсином (фирма GIBCO), в соответствии с плотностью распределения клеток 3×105 клеток/мл инокулировали в 30 мл 302 среде без сыворотки(SAFC) в колебательной колбе, при 100 об/мин, 37°С, в 5% СО2 инкубаторе культивировали, при этом плотность распределения клеток составляет 10 6/мл, затем инокулировали 3000 клеток в каждой 10 см чашке для культивирования клетки (фирма Corning) (в IMDM культуральной среде, содержащей 10% FBS, 1% глутамина), культивировали в 5% CO2 инкубаторе при температуре 37°С, чтобы сформировать, выбрать моноклональные клетки, культивировали их в 96-луночных культуральных планшетах (Corning). Используя набор для дозирования IgG ELISA человеческого белка (фирма Bethyl компании), определяли векторное содержание соответствующих моноклональных экспрессирующих секреторных слитых белков, конкретные условия и процедура такие же, как в примере 2 Определение векторного содержания указанного слитого белка, выбрали слитые белки, обладающие самым высоким уровнем экспрессии, в 6-луночных планшетах культивировали, уровень связывания клетки составляет около 70%, клетки расщепляли трипсином, переносили в 10 см чашку для культивирования, Добавили Метотрексат (methotrexate, MTX) (фирма Sigma), постепенно проводилиам амплификацию при повышенном напряжении, (МТХ концентрация ответственно составляет 10 нМ, 20 нМ, 50 нМ, 100 нМ, 200 нМ, 500 нМ). После окончания амплификации при повышенном напряжении, клетки культивировали трипсином в 3×105/мл колебательных колбах, измеряли единичную экспрессию клеток, получили инженерные линии клеток СНО, эксперссирующие специальный слитый белок, в конце культивировали CHO клеточные линии в рН 7,0 бессывороточной среде 302 (SAFC) при 37°С, содержащей 5% СО2, 40% растворенного кислорода при скоростью 80 об/мин, крупномасштабную суспензионную жидкость, объем культуральной среды составляет 10 л. Способ центрифугирования собирали продукт культивирования, супернатант фильтровали через 0,45 мембраны (Millipore), в соответствии с руководством по эксплуатации колонки аффинной хроматографии протеина А (GE) проводили аффинную хроматографию, сначала PBS буфером (рН 7,0) уравновесили колонку аффинной хроматографии протеина А, а затем загружали супернатант на колонку, элюировали остаток в буфере PBS, в конце цитратным буфером (рН 3,0) элюирование проводили, собранный элюент фильтровали мембраной с размером пор 0,45, добавили S/D (0,3% фосфорной кислоты трибутил/1% Твин 80), выдерживали при 24°С в течение 6 часов, чтоб инактивировать вирус, проводили хроматографию с использованием молекулярных сит для дальнейшей очистки белков, сначала загружали элюент аффинной хроматографии протеина А в диализу (фирма Millipore), диализировали в PBS буфере, затем помещали в 10 KD чашку ультрафильтрации (Фирма Millipore), концентрировали белок; PBS буфером уравновешивали колонку хроматографии молекулярного сита Superdex 200 (фирма GE), чашу ультрафильтрации чашку концентрировали через жидкость на образце, а затем элюировали PBS буфером, собирали пик элюции. Способом додецилсульфата натрия в полиакриламидном геле (ДСН-ПААГ) проводили анализ очищенного белка (см. фиг.3), а затем объединили элюата, содержащие продукт экспрессии, фильтровали мембраном с размером пор 0,22 мкм (фирма Millipore), после фильтрования методом Лоури и другими методам производили дозирование белка.

Пример 5: Испытание на градиентное связывание слитого белка

[129] Рекомбинантные экспрессионные плазмиды FGF-2 слитого белка № 26, обладающего высокой связывающей способностью трансфицировали липосомами (Roche) в DHFR-дефицитные клетки СНО (АТСС). В частности, добавили 5 мкг рекомбинантной плазмиды, и 30 мкл липосом (FuGENE 6 реагента для трансфекции, фирма Roche) в 100 мкл свежей культуральной среде IMDM (фирма GIBCO), смешивали равномерно, выдерживали 15 минут, добавили в 10 см чашке для культивирования клетки (фирма Corning) согласно плотности клеток 3×10 5/мл, где культивировали в течение ночи DHFR-дефицитные клетки СНО (АТСС), клеточная культуральная среда представляет собой IMDM культуральную среду, содержащую 10% FBS, 1% HT и 1% глутамина в культуре(все они приобретены у компании GI ВСО), культивировали в 5% CO2 инкубаторе при температуре 37°С в течение 2-3 дней, переваривали клетки трипсином (фирма GIBCO), в соответствии с плотностью распределения клеток 3×105 клеток/мл инокулировали в 30 мл 302 среде без сыворотки(SAFC) в колебательной колбе,при 100 об/мин, 37°С, в 5% СО2 инкубаторе культивировали, при этом плотность распределения клеток составляет 106/мл, затем инокулировали 3000 клеток в каждой 10 см чашке для культивирования клетки (фирма Corning) (в IMDM культуральной среде, содержащей 10% FBS, 1% глутамина), культивировали в 5% CO2 инкубаторе при температуре 37°С, чтобы сформировать, выбрать моноклональные клетки, культивировали их в 96-луночных культуральных планшетах (Corning). Используя набор для дозирования IgG ELISA человеческого белка (фирма Bethyl компании), определяли векторное содержание соответствующих моноклональных экспрессирующих секреторных слитых белков, конкретные условия и процедура такие же, как в примере 2 Определение векторного содержания указанного слитого белка, выбрали слитые белки, обладающие самым высоким уровнем экспрессии, в 6-луночных планшетах культивировали, уровень связывания клетки составляет около 70%, клетки расщепляли трипсином, переносили в 10 см чашку для культивирования, Добавили Метотрексат (methotrexate, MTX) (фирма Sigma), постепенно проводили амплификацию при повышенном напряжении, (МТХ концентрация ответственно составляет 10 нМ, 20 нМ, 50 нМ, 100 нМ, 200 нМ, 500 нМ). После окончания амплификации при повышенном напряжении, клетки культивировали трипсином в 3×105/мл колебательных колбах, измеряли единичную экспрессию клеток, получили инженерные линии клеток СНО, эксперссирующие специальный слитый белок, в конце культивировали CHO клеточные линии в рН 7,0 бессывороточной среде 302 (SAFC) при 37°С, содержащей 5% СО2, 40% растворенного кислорода при скоростью 80 об/мин, крупномасштабную суспензионную жидкость, объем культуральной среды составляет 10 л. Способ центрифугирования собирали продукт культивирования, супернатант фильтровали через 0,45 мембраны (Millipore), в соответствии с руководством по эксплуатации колонки аффинной хроматографии протеина А (GE) проводили аффинную хроматографию, сначала PBS буфером (рН 7,0) уравновесили колонку аффинной хроматографии протеина А, а затем загружали супернатант на колонку, элюировали остаток в буфере PBS, в конце цитратным буфером (рН 3,0) элюирование проводили, собранный элюент фильтровали мембраной с размером пор 0,45, добавили S/D (0,3% фосфорной кислоты трибутил/1% Твин 80), выдерживали при 24°С в течение 6 часов, чтоб инактивировать вирус, проводили хроматографию с использованием молекулярных сит для дальнейшей очистки белков, сначала загружали элюент аффинной хроматографии протеина А в диализу (фирма Millipore), диализировали в PBS буфере, затем помещали в 10KD чашку ультрафильтрации (Фирма Millipore), концентрировали белок; PBS буфером уравновешивали колонку хроматографии молекулярного сита Superdex 200 (фирма GE), чашу ультрафильтрации чашку концентрировали через жидкость на образце, а затем элюировали PBS буфером, собирали пик элюции. Способом додецилсульфата натрия в полиакриламидном геле (ДСН-ПААГ) проводили анализ очищенного белка (см. фиг.3), а затем объединили элюата, содержащие продукт экспрессии, фильтровали мембраной с размером пор 0,22 мкм (фирма Millipore), после фильтрования методом Лоури и другими методами производили дозирование белка.

Пример 6: Испытание на аффинитет слитого белка

[130] Испытание на аффинитет предназначается для проверки аффинитета слитого белка в растворе с FGF. Сначала отдельно покрывали 96-луночный планшет ELISA с использованием 100 мкл раствора захваченного антитела FGF-2 концентрации 2,0 мкг/мл (фирма R&D Systems), с использованием 300 л PBST моющего раствора промывали пять раз, с использованием блокирующего рабочего раствора (фирма KPL) блокировали каждые лунки (см. пример 3), при температуре 37°С инкубировали в течение 1 часа, с использованием 300 л PBST моющего раствора промывали пять раз, добавили предварительно изготовленный смесь инкубированного слитого белка (при 4°С в течение 1 ночи) с FGF-2, контрольный раствор, разбавленный способом градиентного разбавления, конкретный способ изготовления заключается в следующем: раствор 26# слитого белка (растворенного в PBS) начальная концентрация которого составляет 400 pM, соответственно разбавляли в 2 раза, смешивали с 20 пМ FGF-2 раствором в отношении 1:1, то есть начальная концентрация каждого белка составляет 200 pM, конечная концентрация FGF-2 составляет 10 pM. При 37°С выдерживали в течение 2 ч, промывали пять раз 300 мкл с использованием промывочного раствора PBST, добавляли 100 мкл раствора детектирующего антитела FGF-2 концентрации 250 мкг/мл (фирма R&D Systems) (предназначенного для обнаружения свободного FGF-2 антитела), при 37°С инкубировали в течение 2 ч, пять раз промывали 300 мкл с использованием PBST промывочной жидкости, добавили HRP-меченый стрептавидин-биотин (фирма R&D Systems) (разбавленный PBS в отношении 1:200), при температуре 37°С выдерживали в течение часа, добавили +100 мл хромогенного реагента (фирма KPL), пять раз промывали с использованием 300 мкл PBST промывочной жидкости, через некоторое время (примерно 15-30 минут), добавили 100 мкл стоп раствора (KPL), поместили ELISA на микропланшет-ридер для считывания оптической плотности при длине волны 450 нм, определили векторную концентрацию свободного FGF-2 в смеси слитого белка. Аффинитет слитого белка № 26 в растворном системе с FGF-2 показан на фиг. 5. Этот пример показывает, что слитый белок № 26 имеет высокий аффинитет с FGF-2 в растворном системе, и аффинитет возрастает в сопровождении увеличения концентрации, количество свободного FGF-2 уменьшается в сопровождении увеличения концентрации слитого белка.

Пример 7: Испытание на ингибирование расщепления человеческой эндотелиальной клетки пупочной вены

[131] Испытание на ингибирование расщепления человеческой эндотелиальной клетки пупочной вены (HUVEC) позволяет проверять способность слитого белка ингибировать расщепления человеческой эндотелиальной клетки. В полной культуральной среде HUVEC клеток (фирма AllCells Company) при 37°С, в 5% СО2 инкубаторе культивировали HUVEC клетки (фирма AllCells). В логарифмической фазе роста обрабатывали трипсином, вычисляли количество HUVEC клеток, в каждых лунках 96-луночной планшеты высевали 3000 HUVEC клеток в HUVEC культуральной среде(фирма AllCells), содержащей 1% FBS, культивировали в течение ночи при 37°С в 5% СО2 инкубаторе. Соответственно добавили 100 мкл FGF-2 раствора конечной концентрации 5 мкг/мл (фирма R&D Systems), разбавленного культуральной средой HUVEC клеток, 100 мкл смеси разного количества слитого белка № 26 и FGF-2, конечная концентрация слитого белка которой составляет 40 pM, разбавляли в 10 разов с использованием HUVEC культуральной среды (фирма AllCells), содержащей 1% FBS, при этом конечная концентрация FGF-2 составляет 5 мкг/мл, культивировали в течение 3-4 дней, высасывали культуральную среду, добавили культуральную среду, содержащую 10% ССК-8 реагента (фирма Dojindo), культивировали в течение 2 часа, поместили пластинку ELISA на микропланшет-ридер, считывали оптическую плотность при длине волны 450 нм. Определяли способность ингибирования расщепления HUVEC клеток, индуцированного FGF-2, коэффициент торможения показано на рисунке 6. Этот пример показывает, что настоящее изобретение обеспечит создание VEGFR-FGFR-Fc слитого белка № 26, обладающего биологической активностью и функции на клеточном уровне, ингибирующего расщепление HUVEC клеток, индуцированное FGF-2, имеющего связывающую способность с FGF-2, и эта способность связывания увеличится в сопровождении увеличения молярной концентрации, расщепление HUVEC клеток, индуцированного FGF-2, подавляется.

[132] В примерах осуществления настоящего изобретения были описаны различные конкретные варианты осуществления. Тем не менее, специалистам в данной области техники, могут быть понятно, что настоящее изобретение не ограничено конкретным вариантом осуществления, специалистами в данной области различные модификации могут быть сделаны в пределах объема настоящего изобретения, или их варианты, различные технические признаки, упомянутые в настоящем описании могут быть объединены друг с другом, при этом не отходя от сущности и объема настоящего изобретения. Такие модификации и изменения находятся в пределах объема настоящего изобретения.

Справочные документы

[1] Hanahan D, Weinberg RA. The hallmarks of cancer. Cell, 2000, 100(1):57-70.

[2] Hanahan D, Folkman J. Patterns and emerging mechanisms of the angiogenic switch during tumorigenesis. Cell. 1996, 86:353-64.

[3] Ferrara N, Gerber HP, LeCouter J. The biology of VEGF and its receptors. Nat Med. 2003, 9:669-76.

[4] Ferrara N. Vascular endothelial growth factor as a target for anticancer therapy. Oncologist. 2004, 1:2-10.

[5] Jenab-Wolcott J, Giantonio BJ. Bevacizumab: current indications and future development for management of solid tumors. Expert Opin Biol Ther. 2009, 9(4):507-17.

[6] Summers J, Cohen MH, Keegan P, Pazdur R. FDA drug approval summary: bevacizumab plus interferon for advanced renal cell carcinoma. Oncologist. 2010, 15(1):104-11.

[7] Hsu JY, Wakelee HA. Monoclonal antibodies targeting vascular endothelial growth factor: current status and future challenges in cancer therapy. BioDrugs. 2009, 23(5):289-304.

[8] Krupitskaya Y, Wakelee HA. Ramucirumab, a fully human mAb to the transmembrane signaling tyrosine kinase VEGFR-2 for the potential treatment of cancer. Curr Opin Investig Drugs. 2009, 10(6):597-605.

[9] Hurwitz H, Fehrenbacher L, Novotny W, Cartwright T, Hainsworth J, Heim W, Berlin J, Baron A, Griffing S, Holmgren E, Ferrara N, Fyfe G, Rogers B, Ross R, Kabbinavar F. Bevacizumab plus irinotecan, fluorouracil, and leucovorin for metastatic colorectal cancer. N Engl J Med. 2004, 350(23):2335-42.

[10] Sandler A, Gray R, Perry MC, Brahmer J, Schiller JH, Dowlati A, Lilenbaum R, Johnson DH. Paclitaxel-carboplatin alone or with bevacizumab for non-small-cell lung cancer. N Engl J Med. 2006, 355(24):2542-50.

[11] Jenab-Wolcott J, Giantonio BJ. Bevacizumab: current indications and future development for management of solid tumors. Expert Opin Biol Ther, 2009, 9(4):507-17.

[12] Dorrell MI, Aguilar E, Scheppke L, Barnett FH, Friedlander M. Combination angiostatic therapy completely inhibits ocular and tumor angiogenesis. Proc Natl Acad Sci U S A. 2007, 104(3):967-72.

[13] Casanovas O, Hicklin DJ, Bergers G, Hanahan D. Drug resistance by evasion of antiangiogenic targeting of VEGF signaling in late-stage pancreatic islet tumors. Cancer Cell. 2005, 8(4):299-309.

[14] A Beenken, M Mohammadi. Nature Rev., 2009, 8(3): 235~53.

[15] M Mohammadi, S K Olsen, O A Ibrahimi. Cytokine, 2005, 16: 107~137.

[16] M Presta, P D Era, S Mitola et al. Cytokine, 2005, 16(2): 159~178.

[17] R Grose, C Dickson. Cytokine, 2005, 16(2): 179~186.

[18] Y H Cao, R H Cao, E M Hedlund. J. Mol. Med., 2008, 86(7): 785~789.

[19] M J Cross, L C Welsh. Trends Pharmacol. Sci., 2001, 22(4): 201~207.

[20] Wang F. et al., J Biol Chem. 1995, 270:10231-10235

[21] Olsen SK. et al., Proc Natl Acad Sci U S A. 2004, 101:935-940

[22] Gauglhofer C, Sagmeister S, Schrottmaier W, Fischer C, Rodgarkia-Dara C, Mohr T, Stättner S, Bichler C, Kandioler D, Wrba F, Schulte-Hermann R, Holzmann K, Grusch M, Marian B, Berger W, Grasl-Kraupp B. Hepatology. 2011 Mar;53(3):854-64.

1. Выделенный растворимый слитый белок рецептора фактора роста фибробластов (FGFR) с повышенным связыванием с FGF, состоящий из следующих компонентов последовательно: фрагмент, полученный из промежуточной функциональной последовательности (IFS) Ig-подобного домена FGFR, второй Ig-подобный домен FGFR (D2), третий Ig-подобный домен FGFR (D3), и Fc область иммуноглобулина, где
фрагмент, полученный из IFS, имеет аминокислотную последовательность, соответствующую последовательности SEQ ID NO: 1, начиная с положения 134-151 SEQ ID NO: 1 и заканчивая положением 162 SEQ ID NO: 1, при условии, что фрагмент, полученный из IFS, не является последовательностью, представленной положениями 148-162 SEQ ID NO: 1,
указанный домен D2 имеет аминокислотную последовательность, соответствующую последовательности положений 163-247 SEQ ID NO: 1,
указанный домен D3 имеет аминокислотную последовательность, соответствующую последовательности положений 270-359 SEQ ID NO: 1,
IFS относится к последовательности между первым Ig-подобным доменом и вторым Ig-подобным доменом в белке FGFR, и
указанные фрагмент, домены и/или области связаны непосредственно и/или с помощью линкера.

2. Слитый белок по п. 1, который связывается с фактором роста фибробластов (FGF), предпочтительно, с FGF2, in vivo и/или in vitro.

3. Слитый белок по п. 1, где фрагмент, полученный из IFS, обладает аминокислотной последовательностью, соответствующей положениям 134-162, положениям 145-162 или положениям 151-162 SEQ ID NO: 1.

4. Слитый белок по п. 1, в котором Fc область иммуноглобулина представляет собой Fc область человеческого иммуноглобулина IgG, предпочтительно человеческого иммуноглобулина IgG1, предпочтительно обладающий:
аминокислотной последовательностью SEQ ID NO: 7, или аминокислотной последовательностью с, по меньшей мере, 70%-ной идентичностью, предпочтительно, по меньшей мере, 80%, 90%, 93%, 95%, 97%, 98% или 99% идентичностью с аминокислотной последовательностью SEQ ID NO: 7; или
аминокислотной последовательностью, кодируемой нуклеотидной последовательностью SEQ ID NO: 8, или аминокислотной последовательностью, кодируемой нуклеотидной последовательностью с, по меньшей мере, 70% идентичностью, предпочтительно, по меньшей мере 80%, 90%, 93%, 95%, 97%, 98% или 99% идентичностью с нуклеотидной последовательностью SEQ ID NO: 8.

5. Выделенный растворимый слитый белок рецептора выделенного растворимого фактора роста фибробластов (FGFR) с повышенным связыванием с FGF, который состоит из следующих компонентов последовательно: фрагмент, полученный из внеклеточного домена FGFR, и Fc область иммуноглобулина, где фрагмент, полученный из внеклеточного домена FGFR, обладает аминокислотной последовательностью, обозначенной как положения 1-241 SEQ ID NO: 12, положения 1-230 SEQ ID NO: 13 или положения 1-224 SEQ ID NO: 14; или кодируется нуклеотидной последовательностью, обозначенной как положения 1-723 SEQ ID NO: 19, положения 1-690 SEQ ID NO: 20 или положения 1-672 SEQ ID NO: 21.

6. Выделенный растворимый слитый белок рецептора фактора роста фибробластов (FGFR) с повышенным связыванием с FGF, где указанный белок состоит из аминокислотной последовательности, обозначенной любой из SEQ ID NO: 12-14, или состоит из них, или аминокислотной последовательности, кодируемой молекулой нуклеиновой кислоты нуклеотидной последовательности, обозначенной любой из SEQ ID NO: 19-21.

7. Выделенная молекула нуклеиновой кислоты, кодирующая слитый белок по любому из предшествующих пунктов.

8. Вектор экспрессии слитого белка FGFR-Fc, содержащий молекулу нуклеиновой кислоты по п. 7.

9. Клетка CHO для экспрессии слитого белка FGFR-Fc, трансфицированная вектором по п. 8.

10. Фармацевтическая композиция для ингибирования ангиогенеза у млекопитающих, содержащая эффективное количество слитого белка по любому из пп. 1-6, молекулы нуклеиновой кислоты п. 7, вектора по п. 8 или клетки по п. 9, а также фармацевтически приемлемый носитель.

11. Применение слитого белка по любому из пп. 1-6, молекулы нуклеиновой кислоты по п. 7, вектора по п. 8, клетки по п. 9 или фармацевтической композиции по п. 10 для ингибирования ангиогенеза у млекопитающих.



 

Похожие патенты:

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биотехнологии. Предложено трансгенное животное, представляющее собой мышь или крысу, в геном которого встроена нуклеиновая кислота, кодирующая перестроенную вариабельную область легкой цепи иммуноглобулина человека, функционально связанную с константной областью иммуноглобулина указанного животного и функционально связанную с промотором, обеспечивающим экспрессию трансгенной легкой цепи в В-клетках млекопитающего, таким образом, что она образует пары с различными эндогенными тяжелыми цепями, обеспечивая получение антител.

Настоящее изобретение относится к области биотехнологии. Предложены варианты гуманизированного анти-CD79b антитела, каждый из которых характеризуется наличием легкой и тяжелой цепи и набором 6 CDR с установленной аминокислотной последовательностью.

Изобретение относится к области биотехнологии, конкретно к новым гетеромультимерным белкам, полученным из модифицированного убиквитина, и может быть использовано в медицине для лечения или диагностики заболеваний, ассоциированных с гиперпродукцией экстрадомена В фибронектина (ED-B).

Изобретение относится к области биотехнологии, конкретно к рекомбинантной продукции белков человека, и может быть использовано в производстве химерных антител к фактору некроза опухоли человека.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная плазмидная ДНК, кодирующая химерное антитело против фактора некроза опухолей-альфа человека (ФНО-альфа), на основе плазмиды pOptiVECTM-TOPO®.

Изобретение относится к области биотехнологии и иммунологии. Описаны различные варианты антител, специфические в отношении IL-1R1.

Изобретение относится к области биотехнологии и может быть использовано для идентификации гетеромультимерных убиквитинов со способностью связываться с лигандом-антигеном.

Настоящее изобретение относится к биотехнологии. Предложены варианты антител против Bv8 человека или макака, каждое из которых характеризуется тем, что содержит 6 CDR.

Настоящее изобретение относится к биотехнологии и иммунологии, а именно к модулированию Т-клеточного иммунитета в отношении клеток, экспрессирующих специфический мембранный антиген предстательной железы (PSMA).

Изобретение относится к области биотехнологии, генной инженерии и вирусологии. Изобретение охватывает вакцины против гриппа, в частности вакцины от птичьего гриппа.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антиген-связывающий фрагмент, способные связывать простагландин Е2 (PGE2) и охарактеризованные последовательностями CDR.

Изобретение относится к области биохимии, в частности к антителу или его антиген-связывающему фрагменту, которые специфически связываются с TNFα человека . Также раскрыты выделенная молекула нуклеиновой кислоты, кодирующая вышеуказанное антитело, вектор экспрессии, содержащий указанную молекулу нуклеиновой кислоты, и клетка-хозяин, содержащая указанный вектор, для экспрессии вышеуказанного антитела.

Изобретение относится к области биохимии, в частности к выделенному варианту сериновой протеазы, содержащему, по меньшей мере, от пяти до восьми аминокислотных замен в положениях, выбранных из группы, состоящей из положений 12, 14, 15, 16, 24, 35, 36, 39, 49, 54, 61, 63, 64, 65, 67, 69, 75, 76, 78, 79, 81, 86, 92, 93, 99, 109, 112, 121, 123, 125, 127, 143, 159, 179, 181, 184, 189, где заменяющая аминокислота в указанном положении выбрана из группы, состоящей из F, G, L, V, I, S, A, Y, K, W, M, P, N, Q, T, E, H, R, C, N и D, где указанные замены сделаны в положениях, эквивалентных положениям в протеазе Cellulomonas 69 В4, а также к молекуле нуклеиновой кислоты, ее кодирующей.

Настоящее изобретение относится к области биотехнологии. Предложены варианты гуманизированного анти-CD79b антитела, каждый из которых характеризуется наличием легкой и тяжелой цепи и набором 6 CDR с установленной аминокислотной последовательностью.

Изобретение относится к области биотехнологии, конкретно к получению ингибиторов адгезии и/или агрегации тромбоцитов, и может быть использовано в медицине. Рекомбинантным путем с использованием матрицы кДНК слюнной железы Anopheles stephensi получают полипептид, который используют в составе фармацевтической композиции и в наборах для скрининга ингибиторов адгезии или агрегации тромбоцитов.

Изобретение относится к области генетической инженерии и биотехнологии. Предложен способ оценки биоактивности химических соединений, где на первой стадии проводят транзиентную трансфекцию клеток линии HEK 293 плазмидным вектором pX-Y-neo (X - любой транскрипционный фактор эукариот, Y - протеотипический пептид, соответствующий данному транскрипционному фактору), содержащим минимальный промотор аденовируса человека типа 5; ген зеленого флуоресцирующего белка; последовательность нуклеотидов, кодирующих сайт связывания транскрипционного фактора; последовательность нуклеотидов, кодирующих протеотипический пептид; ген устойчивости к неомицину, затем на второй стадии определяют активность транскрипционного фактора путем флуоресцентного анализа и хромато-масс-спектрометрического измерения содержания протеотипического пептида в трансфицированной культуре клеток в присутствии тестируемого вещества в сравнении с трансфицированной интактной культурой клеток.

Изобретение относится к области биотехнологии, конкретно к интернализации терапевтических молекул внутрь клетки, и может быть использовано в медицине. Получают композицию для доставки молекул нуклеиновых кислот в клетки, содержащую по меньшей мере один пептид с по меньшей мере 92% идентичностью к GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); или YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), присоединенный к одной или нескольким молекулам нуклеиновых кислот.

Изобретение относится к области биотехнологии и может быть использовано для отбора аффинных молекул. Конструируют плазмидную ДНК pGST/APT/X длиной 6193 п.
Наверх