Лечение интерстициального цистита



Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита
Лечение интерстициального цистита

 


Владельцы патента RU 2570559:

ПФАЙЗЕР ЛИМИТЕД (GB)

Настоящее изобретение относится к области медицины. Предложено применение антагонистического антитела против ФРН в лечении или профилактике неотложных позывов к мочеиспусканию, ассоциированных с интерстициальным циститом, и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у субъекта, где указанное антагонистическое антитело против ФРН может быть представлено антителом Е3 или аналогичным ему. Применение антитела по изобретению приводит к снижению показателя оценки боли (NRS) и показателя выраженности симптомов интерстициального цистита (ICSI). 11 з.п. ф-лы, 11 табл., 5 пр.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение связано с применением антитела против ФРН (фактор роста нервов) для лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей ((LUTS), lower urinary tract symptom), ассоциированного с интерстициальным циститом и/или с синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Интерстициальный цистит (ИЦ), или [IC], является хроническим заболеванием мочевого пузыря неизвестной природы, характеризующимся болевыми симптомами, такими как боль в области таза, и симптомами со стороны нижних мочевыводящих путей (LUTS), такими как учащенные неотложные позывы/частота мочеиспускания. В более современной терминологии, наряду с ИЦ, выделяют синдром раздраженного мочевого пузыря (СРМП) [painful bladder syndrome, PBS] (MacDiarmid SA et al. Rev Urol 2007; 9(1):9-16) или болевой синдром мочевого пузыря (БСМП) [bladder pain syndrome, BPS] (van der Merve et al. European Urology 53(2008) 60-67), то есть для более полного описания указанного симптомокомплекса используют терминологию ИЦ/СРМП/БСМП.

Коэффициент распространенности ИЦ/СРМП/БСМП колеблется от 67 до 230 на 100000 женщин, имеющих клинически подтвержденный диагноз заболевания, хотя на самом деле этот показатель, по-видимому, выше в связи с наличием ошибочно диагностированных или не диагностированных случаев, обычно в связи с эндометриозом, рецидивирующей инфекцией мочевых путей, с гиперактивным мочевым пузырем или вульводинией (Forrest J B et al. Clinical Courier 2006; 24(3):1-8). ИЦ существенно влияет на качество жизни, являясь помехой в путешествиях, в семейных отношениях и на службе (Slade D et al. Urol 1997; 49 (5A Suppl):10-3), а кроме того, он ассоциирован с депрессивными симптомами (Rothrock N E et al. J Urol 2002; 167: 1763-1767).

Проведено несколько качественно выполненных плацебо-контролируемых рандомизированных испытаний, связанных с терапией, нацеленной на ИЦ, и лечение часто состоит в мультимодальном подходе метода проб и ошибок, как следует из обзора патентов, составленного на основании изучения базы данных по интерстициальному циститу, в котором сообщается о 183 различных типах лечения (Rovner E et al. J Urol 2000; 56:940-5).

Единой этиологии идентифицировано не было, и наиболее вероятно, что имеет место многофакторный процесс с участием нескольких урологических повреждающих факторов, вызывающих самоподдерживающийся процесс дисфункции эпителиальных клеток, активации нервного волокна C и пролиферации тучных клеток, приводящих к усугублению тканевого повреждения, образованию рубцов и фиброзу. Повторная стимуляция волокон C от воспаления и повышающая регуляция афферентных нервов в мочевом пузыре в конечном итоге приводят к перманентным перестройкам (централизация), приводящим к гиперальгезии, хронической боли мочевого пузыря и дисфункции его опорожнения (Forrest J B et al. Clinical Courier 2006; 24(3):1-8).

Несмотря на то, что единого мнения относительно фундаментальных причин ИЦ достичь не удается, существующие данные приводят к заключению, что здесь могут участвовать три патофизиологических механизма: эпителиальная дисфункция, активация тучных клеток и нейрогенное воспаление (Nazif O et al. Urol 2007; 69 (Suppl 4A):24-33).

По-прежнему остается потребность в обеспечении нового, эффективного лечения боли и/или симптома интерстициального цистита со стороны нижних мочевыводящих путей, и/или синдрома раздраженного мочевого пузыря, и/или болевого синдрома мочевого пузыря, которое было бы лишено нежелательных побочных эффектов или ограничений эффективности существующих в настоящее время терапевтических подходов.

Имеется сообщение, в котором описано, как у пациентов с интерстициальным циститом тестировали рекомбинантное человеческое антитело против ФРН (фактор роста нервов) (Dimitrakov, et al., J. Urology. Vol. 171 (4), Supplement, 363 (2004)). Хотя предметом изучения и являлась оценка эффективности и безопасности "в группе пациентов с ИЦ со значительным повреждением нерва и невропатическим болевым компонентом, для которых целый ряд предшествующих попыток лечения оказался безуспешным", в указанной публикации с использованием уровней маркера повреждения нерва были представлены только эффекты, связанные с повреждением нерва. Важно отметить, что в ней не сообщается ни о какой эффективности в лечении боли и/или симптома со стороны нижних мочевыводящих путей при указанном состоянии.

Анти-ФРН-антитело E3 было ранее описано как антитело, применимое для лечения боли, включая боль при ревматоидном артрите, боль при остеоартрите и послеоперационную боль (см., например, WO 2004/058184). Однако если принять во внимание этиологию интерстициального цистита и плохое понимание механизмов указанного состояния, нелегко предугадать, что анти-ФРН-антитело, такое как антитело E3, может быть использовано для лечения боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

В одном из аспектов данного изобретения предложен способ лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, предусматривающий введение эффективного количества антагонистического антитела против ФРН. В одном из аспектов изобретения указанное антитело

(a) связывается с ФРН с KD, составляющей менее приблизительно 2 нМ;

(b) ингибирует зависимое от человеческого ФРН выживание тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 100 пМ или менее, где показатель IC50 измеряют в присутствии приблизительно 15 пМ человеческого ФРН; и/или

(c) ингибирует зависимое от человеческого ФРН выживание тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 10 пМ или менее, где показатель IC50 измеряют в присутствии приблизительно 1,5 пМ ФРН.

Боль, ассоциированная с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, включает в себя боль в нижнем брюшном (тазовом) отделе; боль, связанную с мочевым пузырем; боль в надлобковой области; вагинальную боль; боль в пенисе, яичке, мошонке и в промежности; боль в уретре; диспареунию; боль, давление или дискомфорт, которые могут нарастать при наполнении мочевого пузыря.

Симптомы со стороны нижних мочевыводящих путей включают в себя три группы симптомов мочевыводящих путей, которые могут быть определены как симптомы накопления (раздражение), опорожнения (непроходимость) и постмочеиспускательный симптом. Симптомы, связанные с накоплением, включают в себя императивность позывов, их частоту, ночные позывы, императивное недержание и недержание мочи при напряжении, которые могут быть ассоциированы с гиперактивностью мочевого пузыря (ГАМП) [over active bladder, OAB] и доброкачественной гиперплазией предстательной железы (ДГПЖ) [benign prostatic hyperplasia, BPH]. Симптомы, связанные с опорожнением, включают в себя затрудненное начало мочеиспускания, недостаточность струи, прерывистость, растянутость и расстройство мочеиспускания. Постмочеиспускательные симптомы включают в себя отхождение мочи по каплям в конце акта мочеиспускания, отхождение мочи по каплям после мочеиспускания и ощущение неполного опорожнения.

Гиперактивность мочевого пузыря (ГАМП) определяется как императивность позывов к мочеиспусканию в сочетании с императивным недержанием или без него, обычно с повышенной частотой мочеиспускания и ночными позывами [Abrams et al., Neurourology and Urodynamics 21:167-178 (2002)]. Распространенность ГАМП у мужчин и женщин сходна, при этом в США от этого состояния страдает приблизительно 16% популяции [Stewart et al, Prevalence of Overactive Bladder in the United States: Results from the NOBLE Program; Abstract Presented at the 2nd International Consultation on Incontinence, July 2001, Paris, France].

Термины мокрая и сухая ГАМП относятся, соответственно, к пациентам с наличием или отсутствием недержания мочи. Раньше кардинальным симптомом ГАМП считалось недержание мочи. Однако с появлением новых терминов это не имеет никакого смысла для большого числа страдающих этим заболеванием, у которых нет недержания (т.е. для пациентов с сухой ГАМП). Таким образом, в исследовании, проведенном в 2001 году Liberman et al. ['Health Related Quality of Life Among Adults with Symptoms of Overactive Bladder: Results From A US Community-Based Survey'; Urology 57(6), 1044-1050, 2001], изучали влияние всех симптомов ГАМП на качество жизни на примере местного населения в популяции США. Данное исследование показало, что индивиды, страдающие от ГАМП, и так, без какого-либо заметного непроизвольного мочеиспускания, имеют ухудшенное качество жизни по сравнению с контролем.

ДГПЖ является хронически прогрессирующим заболеванием, которое может привести к таким осложнениям как острая задержка мочи, возвратная инфекция мочевыводящих путей, камни в мочевом пузыре и почечная дисфункция. Большая частота встречаемости и средняя степень тяжести LUTS, ассоциированного с ДГПЖ, у мужчин с возрастом повышается.

ДГПЖ приводит к увеличению объема предстательной железы, вызывая обструкцию выходного потока из уретры и мочевого пузыря, а также вторичные изменения функции мочевого пузыря. Эти эффекты обнаружены как на уровне симптомов накопления (вызывающих раздражение), так и на уровне симптомов опорожнения (непроходимость).

Согласно настоящему изобретению, показано, что антагонистическое антитело против ФРН способно к ингибированию или блокированию боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдром мочевого пузыря. В некоторых воплощениях указанная боль и/или симптом со стороны нижних мочевыводящих путей облегчается(блегчаются) в течение приблизительно 24 часов после введения антагонистического антитела против ФРН. В некоторых воплощениях указанная боль и/или симптом со стороны нижних мочевыводящих путей облегчается(облегчаются) в течение приблизительно 4 дней после введения антагонистического антитела против ФРН. В некоторых воплощениях указанная боль и/или симптом со стороны нижних мочевыводящих путей облегчается(облегчаются) еще до контрольного осмотра в ходе испытаний или же в отсутствие каких-либо признаков, указывающих на то, что состояние индивида улучшилось.

В следующем аспекте данного изобретения предложен способ лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, предусматривающий введение эффективного количества антагонистического антитела против ФРН, включающего в себя вариабельную область тяжелой цепи, содержащую

(a) область CDR1, представленную в SEQ ID NO: 3;

(b) область CDR2, представленную в SEQ ID NO: 4; и

(c) область CDR3, представленную в SEQ ID NO: 5.

В следующем аспекте данного изобретения предложен способ лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, предусматривающий введение эффективного количества антагонистического антитела против ФРН, включающего в себя вариабельную область легкой цепи, содержащую

(a) область CDR1, представленную в SEQ ID NO: 6;

(b) область CDR2, представленную в SEQ ID NO: 7; и

(c) область CDR3, представленную в SEQ ID NO: 8.

Антагонистическое антитело против ФРН может дополнительно включать в себя вариабельную область тяжелой цепи, содержащую

(a) область CDR1, представленную в SEQ ID NO: 3;

(b) область CDR2, представленную в SEQ ID NO: 4; и

(c) область CDR3, представленную в SEQ ID NO: 5.

Антагонистическое антитело против ФРН может включать в себя вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере на 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичную аминокислотной последовательности SEQ ID NO: 1, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере на 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичную аминокислотной последовательности SEQ ID NO: 2, при этом указанное антитело должно специфически связываться с ФРН.

Вариабельная область тяжелой цепи и/или вариабельная область легкой цепи анти-ФРН-антитела могут содержать одну или более соответствующих мутаций рамки считывания. В одном из аспектов мутация рамки считывания может быть связана с заменой остатка в человеческой рамке считывания комплементарным остатком мышиной рамки считывания. Такая мутация может включать в себя замену V71K в вариабельной области тяжелой цепи.

Антагонистическое антитело против ФРН может включать в себя вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 1, и/или может включать в себя вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 2.

Антагонистическое антитело против ФРН может быть антителом, содержащим аминокислотные последовательности, представленные в SEQ ID NO: 1 и 2. Антагонистическое антитело против ФРН может быть антителом, содержащим аминокислотные последовательности, представленные в SEQ ID NO: 16 и 17.

Антагонистическое антитело против ФРН может включать в себя тяжелую цепь, содержащую аминокислотную последовательность, по меньшей мере на 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичную аминокислотной последовательности SEQ ID NO: 16, и легкую цепь, содержащую аминокислотную последовательность, по меньшей мере на 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичную аминокислотной последовательности SEQ ID NO: 17, при этом указанное антитело должно специфически связываться с ФРН.

При этом, как определено в настоящем описании, антагонистическое антитело против ФРН может конкурировать за связывание с ФРН с другим антагонистическим антителом против ФРН. Антагонистическое антитело против ФРН может конкурировать за связывание с ФРН с антителом, включающим в себя вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 1, и вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 2.

Антагонистическое антитело против ФРН может быть гуманизированным. Указанное антитело может быть антителом E3, которое специфически связывается с человеческим ФРН и с ФРН грызунов. Антитело E3 описано в международной заявке WO 2004/058184, содержание которой в полном объеме включено в настоящее описание в виде ссылки. Аминокислотные последовательности вариабельных областей тяжелой цепи и легкой цепи антитела E3 представлены, соответственно, в SEQ ID NO: 1 и 2 (фиг.1A и 1B в международной заявке WO 2004/058184). Области CDR антитела E3 (включая области CDR Чата и Кабат) представлены в виде диаграммы на фиг.1A и 1B в международной заявке WO 2004/058184. Аминокислотные последовательности тяжелых и легких цепей антитела E3, также как и индивидуальных удлиненных областей CDR, также приведены ниже (см. "последовательности антител" ниже). Антитело E3 является очень эффективным в блокировании ФРН и предотвращении взаимодействия с его рецептором. Антитело E3 и его мышиный предшественник, антитело 911, являются эффективными анальгетиками, как было показано на неклинических животных моделях патологической боли, включая боль при артритах, боль при злокачественной опухоли и послеоперационную боль.

В другом аспекте указанное антитело включает в себя фрагмент или область антитела E3 (которое может быть обозначено в настоящем описании просто как "E3"). В одном из аспектов указанный фрагмент является легкой цепью антитела E3, как показано на фиг.1B в международной заявке WO 2004/058184, а также здесь в последовательности SEQ ID NO: 17. В другом воплощении указанный фрагмент является тяжелой цепью антитела E3, как показано на фиг.1A в международной заявке WO 2004/058184, также как и здесь в последовательности SEQ ID NO: 16. Еще в одном воплощении указанный фрагмент содержит одну или более вариабельных областей из легкой цепи и/или тяжелой цепи антитела E3. Еще в одном воплощении указанный фрагмент содержит одну или более областей CDR из легкой цепи и/или тяжелой цепи антитела E3, как показано на фиг.1A и 1B в международной заявке WO 2004/058184 и здесь, в последовательностях SEQ ID NO: 17 и 16, соответственно.

В другом аспекте указанное антитело содержит легкую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4893 или ATCC № PTA-4894. В другом аспекте указанное антитело содержит тяжелую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4895. В другом аспекте указанное антитело содержит (a) легкую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4894 или ATCC № PTA-4893; и (b) тяжелую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4895 (здесь для удобства полинуклеотиды, продуцируемые депонированной клеткой-хозяином, обозначаются как имеющие депозитарные номера в ATCC No. PTA-4894, PTA-4893 и PTA-4895). В другом аспекте указанное антитело содержит вариабельную область легкой цепи такой легкой цепи, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4894 или ATCC № PTA-4893. В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи такой тяжелой цепи, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4895. В другом аспекте указанное антитело содержит (a) вариабельную область легкой цепи такой легкой цепи, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4894 или ATCC № PTA-4893, и (b) вариабельную область тяжелой цепи такой тяжелой цепи, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4895. Еще в одном аспекте указанное антитело содержит одну или более областей CDR, кодируемых (a) полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4894; и/или (b) тяжелую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита в ATCC № PTA-4895.

В некоторых воплощениях указанное антитело может быть полноразмерным антителом, которое может относиться к антителам подкласса IgG2. Указанное антитело может включать в себя константную область тяжелой цепи IgG2a человека. В некоторых воплощениях указанное антитело содержит константную область легкой каппа-цепи человека. В некоторых воплощениях указанное антитело содержит модифицированную константную область, такую как константная область, которая является иммунологически инертной, например, такой, которая не является триггером опосредованного комплементом лизиса или которая не стимулирует антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC, antibody-dependent cell mediated cytotoxicity). В других воплощениях константная область является модифицированной, как описано в публикациях Eur. J. Immunol. (1999) 29: 2613-2624; PCT WO 9958572. Указанное антитело может включать в себя константную область тяжелой цепи IgG2a человека, содержащую следующие мутации: от A330P331 до S330S331 (нумерация аминокислот соответствует таковой в последовательности IgG2a дикого типа).

В некоторых воплощениях указанное антитело может быть фрагментом антитела, таким как Fab- или Fab'2-фрагменты, или одноцепочечным антителом.

В другом аспекте указанное антитело содержит любой один или более из указанных ниже элементов: a) одну или более областей CDR антитела E3, представленных в SEQ ID NO: 1-8 (фиг.1A и 1B в международной заявке WO 2004/058184); b) CDR H3 из тяжелой цепи антитела E3, представленной в SEQ ID NO: 1 и 5 (фиг.1A в международной заявке WO 2004/058184); c) CDR L3 из легкой цепи антитела E3, представленной в SEQ ID NO: 2 и 8 (фиг.1B в международной заявке WO 2004/058184); d) три области CDR из легкой цепи антитела E3, представленные в SEQ ID NO: 2, 6-8 (фиг.1B в международной заявке WO 2004/058184); e) три области CDR из легкой цепи антитела E3, представленные в SEQ ID NO: 1, 3-5 (фиг.1A в международной заявке WO 2004/058184); и f) три области CDR из легкой цепи и три области CDR из тяжелой цепи антитела E3, представленного в SEQ ID NO: 1-8 (фиг.1A и 1B в международной заявке WO 2004/058184). В другом аспекте указанное антитело может содержать любой один или более из указанных ниже элементов: a) одну или более (одну, две, три, четыре, пять или шесть) областей CDR из антитела E3, представленных в SEQ ID NO: 1-8 (фиг.1A и 1B в международной заявке WO 2004/058184); b) область CDR, полученную из CDR H3 из тяжелой цепи антитела E3, представленной в SEQ ID NO: 1 и 5 (фиг.1A в международной заявке WO 2004/058184); и/или c) область CDR, полученную из CDR L3 из легкой цепи антитела E3, представленной в SEQ ID NO: 2 и 8 (фиг.1B в международной заявке WO 2004/058184). В некоторых воплощениях области CDR могут быть областями CDR Кабат, областями CDR Чата или же комбинацией областей CDR Чата и Кабат (обозначаемых здесь как «удлиненные» или «комбинированные» области CDR). В некоторых воплощениях указанные полипептиды содержат любую из описанных здесь конфигураций CDR (включая комбинации, варианты и т.д.).

В одном из аспектов указанное антитело содержит вариабельную область тяжелой цепи, содержащую SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 заменено на N, T или S. Здесь для удобства термины "замененный" или "является, представляет собой", в данном контексте, со ссылкой на аминокислоту, относятся к заменам аминокислоты (аминокислот) в данном положении. Следует понимать, что замещение или выборка могут относиться здесь к аминокислоте, представленной в SEQ ID.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; где Y101 представляет собой Y или W; где G103 представляет собой G, A или S; где T104 представляет собой T или S; где S105 представляет собой S, A или T; где Y106 представляет собой Y, R, T или M; где Y107 представляет собой Y или F; где F108 представляет собой F или W; где D109 представляет собой D, N или G; и где Y110 представляет собой Y, K, S, R или T.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; где Y101 представляет собой Y или W; где G103 представляет собой G, A или S; где T104 представляет собой T или S; где S105 представляет собой S, A или T; где Y106 представляет собой Y, R, T или M; где Y107 представляет собой Y или F; где F108 представляет собой F или W; где D109 представляет собой S, A, C, G, D, N, T или G; и где Y110 представляет собой любую аминокислоту.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 представляет собой любую аминокислоту.

В другом аспекте указанное антитело содержит вариабельную область легкой цепи, содержащую SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q.

В другом аспекте указанное антитело содержит вариабельную область легкой цепи, содержащую SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T.

В другом аспекте указанное антитело содержит вариабельную область легкой цепи, содержащую SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R. В другом аспекте указанное антитело содержит вариабельную область легкой цепи, содержащую SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой любую аминокислоту; T93 представляет собой любую аминокислоту; и в которой Y96 представляет собой Y или R.

В одном из аспектов указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 представляет собой N, T или S.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; и в которой Y110 представляет собой Y, K, S, R или T.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 является любой аминокислотой.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 является любой аминокислотой.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 является любой аминокислотой; T93 является любой аминокислотой; и в которой Y96 представляет собой Y или R.

В другом аспекте указанное антитело включает в себя вариабельную область тяжелой цепи, содержащую область CDR1 с последовательностью SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 представляет собой N, T или S; область CDR2 с последовательностью SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; в которой Y110 представляет собой Y, K, S, R или T. В некоторых воплощениях вариабельная область тяжелой цепи содержит область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; в которой Y110 является любой аминокислотой. В других воплощениях вариабельная область тяжелой цепи содержит область CDR3 с последовательностью SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 является любой аминокислотой. В некоторых воплощениях антитело дополнительно содержит вариабельную область легкой цепи антитела.

В другом аспекте указанное антитело включает в себя вариабельную область легкой цепи, содержащую область CDR1 с последовательностью SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; область CDR2 с последовательностью SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и область CDR3 с последовательностью SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R. В некоторых воплощениях вариабельная область легкой цепи содержит область CDR3 с последовательностью SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 является любой аминокислотой; T93 является любой аминокислотой; и в которой Y96 представляет собой Y или R. В некоторых воплощениях антитело дополнительно содержит вариабельную область тяжелой цепи антитела.

В другом аспекте указанное антитело включает в себя (a) вариабельную область легкой цепи, содержащую область CDR1 с последовательностью SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 представляет собой N, T или S; область CDR2 с последовательностью SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; в которой Y110 представляет собой Y, K, S, R или T; и (b) вариабельную область легкой цепи, содержащую область CDR1 с последовательностью SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; область CDR2 с последовательностью SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и область CDR3 с последовательностью SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R. В некоторых воплощениях вариабельная область легкой цепи содержит область CDR3 с последовательностью SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой любую аминокислоту; T93 представляет собой любую аминокислоту; и в которой Y96 представляет собой Y или R. В некоторых воплощениях вариабельная область тяжелой цепи содержит область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; в которой Y110 представляет собой любую аминокислоту. В других воплощениях вариабельная область тяжелой цепи содержит область CDR3 с последовательностью SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 представляет собой любую аминокислоту. В некоторых воплощениях указанное антитело дополнительно содержит легкую цепь антитела.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 представляет собой N, T или S; аминокислотную последовательность, представленную в SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; в которой Y110 представляет собой Y, K, S, R или T. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; и в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 представляет собой любую аминокислоту. В других воплощениях указанный полипептид содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 представляет собой любую аминокислоту. В некоторых воплощениях указанное антитело дополнительно содержит вариабельную область легкой цепи антитела.

В другом аспекте указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; аминокислотную последовательность, представленную в SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой любую аминокислоту; T93 представляет собой любую аминокислоту; и в которой Y96 представляет собой Y или R. В некоторых воплощениях указанное антитело дополнительно содержит вариабельную область тяжелой цепи антитела.

В другом аспекте указанное антитело содержит (a) аминокислотную последовательность, представленную в SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 представляет собой N, T или S; аминокислотную последовательность, представленную в SEQ ID NO: 10, в которой M50 представляет собой M, I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; и в которой Y110 представляет собой Y, K, S, R или T; и (b) аминокислотную последовательность, представленную в SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; аминокислотную последовательность, представленную в SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой любую аминокислоту; T93 представляет собой любую аминокислоту; и в которой Y96 представляет собой Y или R. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; в которой Y110 представляет собой любую аминокислоту. В других воплощениях указанный полипептид содержит аминокислотную последовательность, представленную в SEQ ID NO: 11, в которой G98 представляет собой G, S, A, C, V, N, D или T; в которой G99 представляет собой G, S, A, C, V, N, D или T; в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой S, A, C, G, D, N, T или G; и в которой Y110 представляет собой любую аминокислоту. В некоторых воплощениях указанное антитело дополнительно содержит вариабельную область легкой цепи антитела.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую (a) область CDR1 с последовательностью SEQ ID NO: 9, в которой I34 представляет собой S, L, V, A или I; и N35 является замещенным N, T или S; (b) область CDR2 с последовательностью SEQ ID NO: 10, в которой M50 представляет собой I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и (c) область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; и в которой Y110 представляет собой Y, K, S, R или T; при этом указанное антитело связывается с ФРН.

В другом аспекте указанное антитело содержит вариабельную область легкой цепи, содержащую (a) область CDR1 с последовательностью SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; (b) область CDR2 с последовательностью SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и (c) область CDR3 с последовательностью SEQ ID NO: 14, в которой K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R; при этом указанное антитело связывается с ФРН.

В другом аспекте указанное антитело содержит вариабельную область тяжелой цепи, содержащую (a) область CDR1 с последовательностью SEQ ID NO: 9, в которой I34 является замещенным S, L, V, A или I; и N35 является замещенным N, T или S; (ii) область CDR2 с последовательностью SEQ ID NO: 10, в которой M50 представляет собой I, G, Q, S или L; A62 представляет собой A или S; и L63 представляет собой L или V; и (iii) область CDR3 с последовательностью SEQ ID NO: 11, в которой Y100 представляет собой Y, L или R; в которой Y101 представляет собой Y или W; в которой G103 представляет собой G, A или S; в которой T104 представляет собой T или S; в которой S105 представляет собой S, A или T; в которой Y106 представляет собой Y, R, T или M; в которой Y107 представляет собой Y или F; в которой F108 представляет собой F или W; в которой D109 представляет собой D, N или G; в которой Y110 представляет собой Y, K, S, R или T; и (b) вариабельную область легкой цепи, содержащую (i) область CDR1 с последовательностью SEQ ID NO: 12, в которой S26 представляет собой S или F; D28 представляет собой D, S, A или Y; и H32 представляет собой H, N или Q; (ii) область CDR2 с последовательностью SEQ ID NO: 13, в которой I51 представляет собой I, T, V или A; и S56 представляет собой S или T; и (iii) область CDR3 с последовательностью SEQ ID NO: 14, в которой S91 представляет собой S или E; K92 представляет собой K, H, R или S; и в которой Y96 представляет собой Y или R; при этом указанное антитело связывается с ФРН.

Если не указано иначе, выбор (например, замена) аминокислоты, находящейся в одном локусе, не зависит от выбора аминокислоты, находящейся в каком-либо другом локусе.

В некоторых воплощениях указанные антитела содержат любую из описанных здесь конфигураций CDR (включая комбинации, вариации и т.д.).

Как очевидно из приведенного здесь описания, используемая здесь нумерация вариабельной области является последовательной нумерацией. Специалисту в данной области хорошо известно, что существует целый ряд систем нумерации антитела (таких как нумерация Чата и Кабат), также как известно и то, как преобразовать последовательную нумерацию в другую систему нумерации, такую как нумерация Кабат или нумерация Чата.

В другом аспекте указанное антитело содержит аминокислотную последовательность (такую как последовательность CDR3), выбранную из SEQ ID NO: 46 или 50. В некоторых других аспектах указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 3, 4, 5, 6, 7 и 8. В некоторых других аспектах указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 9, 10, 11, 12, 13, 14 и 15.

В другом аспекте указанное антитело содержит аминокислотную последовательность (такую как последовательность области CDR, такую как область CDR H1 и/или CDR H2), выбранную из (a) SEQ ID NO: 28 и/или 29; (b) SEQ ID NO: 30 и/или 31; (c) SEQ ID NO: 32 и/или 33; (d) SEQ ID NO: 34 и/или 35; (e) SEQ ID NO: 36 и/или 37; (f) SEQ ID NO: 38 и/или 39; и (g) SEQ ID NO: 40 и 41. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность (такую как область CDR H1), выбранную из SEQ ID NO: 28, 30, 32, 34, 36, 38 и 40. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность (такую как область CDR H2), выбранную из SEQ ID NO: 29, 31, 33, 35, 37, 39 и 41. В некоторых других воплощениях указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 3, 4, 5, 6, 7 и 8. В некоторых других воплощениях указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 9, 10, 11, 12, 13, 14 и 15.

В другом аспекте указанное антитело содержит аминокислотную последовательность (такую как последовательность области CDR, такую как область CDR L1 и/или CDR L2), выбранную из (a) SEQ ID NO: 18 и/или 19; (b) SEQ ID NO: 20 и/или 21; и (c) SEQ ID NO: 22 и/или 23. В некоторых воплощениях указанный полипептид содержит аминокислотную последовательность (такую как последовательность области CDR L1), выбранную из SEQ ID NO: 18, 20 и 22. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность (такую как область CDR L2), выбранную из SEQ ID NO: 19, 21 и 23. В некоторых других аспектах указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 3, 4, 5, 6, 7 и 8. В некоторых других аспектах указанное антитело дополнительно содержит одну или более аминокислотных последовательностей, представленных в SEQ ID NO: 9, 10, 11, 12, 13, 14 и 15.

В другом аспекте указанное антитело содержит аминокислотную последовательность (такую как последовательность области CDR, такую как область CDR L3 и/или CDR H3), выбранную из (a) SEQ ID NO: 51 и/или 52; (b) SEQ ID NO: 55 и/или 56; (c) SEQ ID NO: 57 и/или 58; (c) SEQ ID NO: 59 и/или 60; (d) SEQ ID NO: 61 и/или 62; (e) SEQ ID NO: 63 и/или 64. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность (такую как последовательность области CDR L3), выбранную из SEQ ID NO: 51, 55, 57, 59, 61 и 63. В некоторых воплощениях указанное антитело содержит аминокислотную последовательность (такую как область CDR H3), выбранную из SEQ ID NO: 52, 56, 58, 60, 62 и 64. В некоторых других аспектах указанное антитело дополнительно содержит аминокислотную последовательность, представленную в одной или более из последовательностей SEQ ID NO: 18, 19, 30 и 31. В некоторых других аспектах указанное антитело дополнительно содержит одну или более из аминокислотных последовательностей, представленных в SEQ ID NO: 3, 4, 5, 6, 7 и 8. В некоторых других аспектах указанное антитело дополнительно содержит одну или более из аминокислотных последовательностей, представленных в SEQ ID NO: 9, 10, 11, 12, 13, 14 и 15.

В другом аспекте указанное антитело может содержать

(a) вариабельную область тяжелой цепи, содержащую

(i) область CDR1 с последовательностью SEQ ID NO: 30;

(ii) область CDR2, содержащую последовательность SEQ ID NO: 31;

(iii) область CDR3, выбранную из группы, состоящей из SEQ ID NO: 11, 56, 58, 60, 62 и 64; и

(b) вариабельную область легкой цепи, содержащую

(i) область CDR1 с последовательностью SEQ ID NO: 18;

(ii) область CDR2 с последовательностью SEQ ID NO: 19;

(iii) область CDR3, выбранную из группы, состоящей из SEQ ID NO: 14, 55, 57, 59, 61 и 63.

В другом аспекте антитело содержит одну или более из аминокислотных последовательностей (таких как область CDR), представленных в SEQ ID NO: 61, 63, 18, 19, 30 и 31.

В другом аспекте антитело может быть выбрано из анти-ФРН-антитела, известного в данной области, такого как антитела, описанные в международной заявке WO 2005019266 (включая антитела 4D4, 14D10, 6G9, 7H2, 14F11 и 4G6) или WO 2006131951 (включая антитело Hu-αD11). Указанное антитело может связываться с тем же самым эпитопом ФРН, в частности, человеческого ФРН, что и известное в данной области анти-ФРН-антитело, такое как антитела, описанные в международной заявке WO 2005019266 (включая антитела 4D4, 14D10, 6G9, 7H2, 14F11 и 4G6) или WO 2006131951 (включая антитело Hu-αD11), или определяемое здесь антитело, и/или оно может конкурировать с таким антителом за связывание с ФРН.

В некоторых воплощениях C-концевой лизин тяжелой цепи любого из описанных здесь анти-NGF-антител отщеплен. В различных случаях тяжелая и легкая цепи анти-NGF-антител могут необязательно включать в себя сигнальную последовательность.

В одном из аспектов указанное антитело представляет собой антагонистическое антитело против ФРН, которое с высокой аффинностью связывается с ФРН (таким как человеческий ФРН). В некоторых воплощениях под высокой аффинностью подразумевается (a) связывание ФРН с KD, составляющей менее приблизительно 2 нМ (например, приблизительно 1 нМ, 800 пМ, 600 пМ, 400 пМ, 200 пМ, 100 пМ, 90 пМ, 80 пМ, 70 пМ, 60 пМ, 50 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ или менее), и/или с koff менее приблизительно 6×10-5 с-1); и/или (b) ингибирование (уменьшение и/или блокирование) зависимой от человеческого ФРН выживаемости тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 15 пМ ФРН), приблизительно соответствующей любому из следующих значений: 200 пМ, 150 пМ, 100 пМ, 80 пМ, 60 пМ, 40 пМ, 20 пМ, 10 пМ или менее; и/или (c) ингибирование (уменьшение и/или блокирование) зависимой от человеческого ФРН выживаемости тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 1,5 пМ ФРН), приблизительно соответствующей любому из следующих значений: 50 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ, 2 пМ, 1 пМ или менее; и/или (d) ингибирование (уменьшение и/или блокирование) зависимой от крысиного ФРН выживаемости тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 15 пМ ФРН), приблизительно соответствующей любому из следующих значений: 150 пМ, 125 пМ, 100 пМ, 80 пМ, 60 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ или менее; и/или (e) ингибирование (уменьшение и/или блокирование) зависимой от крысиного ФРН выживаемости тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 1,5 пМ ФРН), приблизительно соответствующей любому из следующих значений: 30 пМ, 25 пМ, 20 пМ, 15 пМ, 10 пМ, 5 пМ, 4 пМ, 3 пМ, 2 пМ, 1 пМ или менее; и/или (f) связывание ФРН с более высокой аффинностью, чем рецептор trkA.

В другом аспекте указанные антитела (a) связываются с ФРН (таким как человеческий ФРН) с KD, составляющей менее приблизительно 2 нМ (например, приблизительно 1 нМ, 800 пМ, 600 пМ, 400 пМ, 200 пМ, 100 пМ, 90 пМ, 80 пМ, 70 пМ, 60 пМ, 50 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ или менее), и/или с koff менее приблизительно 6×10-5 с-1); и/или (b) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 15 пМ ФРН), приблизительно соответствующей любому из следующих значений: 200 пМ, 150 пМ, 100 пМ, 80 пМ, 60 пМ, 40 пМ, 20 пМ, 10 пМ или менее; и/или (c) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 1,5 пМ ФРН), приблизительно соответствующей любому из следующих значений: 50 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ, 2 пМ, 1 пМ или менее; и/или (f) связываются с ФРН с более высокой аффинностью, чем рецептор trkA. В некоторых воплощениях указанные антитела (a) связываются с ФРН с KD, составляющей менее приблизительно 2 нМ; и/или (b) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 100 пМ или менее, где указанную IC50 измеряют в присутствии приблизительно 15 пМ ФРН; и/или (c) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 10 пМ или менее, где указанную IC50 измеряют в присутствии приблизительно 1,5 пМ ФРН. В некоторых воплощениях указанные антитела (a) связываются с ФРН с KD, составляющей менее приблизительно 100 пМ; и/или (b) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 20 пМ или менее, где указанную IC50 измеряют в присутствии приблизительно 15 пМ ФРН; и/или (c) ингибируют зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 2 пМ или менее, где указанную IC50 измеряют в присутствии приблизительно 1,5 пМ ФРН.

В некоторых воплощениях указанные выше антитела являются изолированными. В некоторых воплощениях указанное антитело является по существу очищенным. В некоторых других аспектах указанное антитело является антителом со зрелой аффинностью. В некоторых воплощениях указанное антитело содержит последовательности человеческой рамки считывания. В некоторых других аспектах указанное антитело содержит один или более остатков не из человеческой рамки считывания. В некоторых воплощениях указанное антитело связывается с ФРН (таким как человеческий ФРН) с KD, составляющей 2 нМ или менее. В некоторых воплощениях указанное антитело содержит одну или более (например, 2, 3, 4, 5, 6, 7, 8 или более) замен человеческих аминокислот по сравнению с не являющейся человеческой аминокислотной последовательностью (например, последовательностью вариабельной области, такой как последовательность CDR, например, последовательность рамки считывания). В некоторых воплощениях указанное антитело содержит по меньшей мере 1, по меньшей мере 2 или более, например, по меньшей мере 3, 4, 5, 6 или более аминокислотных замен по сравнению с аминокислотной последовательностью родительского полипептида (например, аминокислотная последовательность антитела 911, любая одна или более из последовательностей SEQ ID NO: 9-14). В некоторых воплощениях аффинность связывания антитела изменена (в некоторых воплощениях повышена) по сравнению с аффинностью родительского антитела (такого как Mab 911). В некоторых других воплощениях аффинность связывания антитела ниже, чем аффинность связывания рецептора trkA с ФРН (таким как человеческий ФРН). В некоторых воплощениях указанные антитела являются человеческими антителами. В других воплощениях указанные антитела являются гуманизированными антителами. В некоторых других аспектах указанные антитела являются моноклональными антителами. В некоторых воплощениях указанное антитело является антителом со зрелой аффинностью.

В настоящем изобретении используются полинуклеотиды (включая изолированные полинуклеотиды), включающие в себя полинуклеотиды, кодирующие любое из антител, описанных в любом из приведенных выше воплощений.

В другом аспекте настоящее изобретение связано с выделенным полинуклеотидом, содержащим полинуклеотид, кодирующий фрагмент или область антитела E3 (здесь взаимозаменяемо называемый также "E3"). В одном из воплощений указанный фрагмент представляет собой легкую цепь антитела E3, как показано на фиг.1B в международной заявке WO 2004/058184. В другом воплощении указанный фрагмент представляет собой тяжелую цепь антитела E3, как показано на фиг.1А в международной заявке WO 2004/058184. Еще в одном из воплощений указанный фрагмент содержит одну или более вариабельных областей из легкой цепи и/или тяжелой цепи антитела E3. Еще в одном из воплощений указанный фрагмент содержит одну или более определяющих комплементарность областей (области CDR) из легкой цепи и/или тяжелой цепи антитела E3, как показано на фиг.1А и 1B в международной заявке WO 2004/058184.

В другом аспекте настоящее изобретение связано с выделенным полинуклеотидом, содержащим полинуклеотид, который кодирует антитело E3. В некоторых воплощениях указанный полинуклеотид содержит один из полинуклеотидов, представленных на фиг.2 и 3 в международной заявке WO 2004/058184, или же оба этих полинуклеотида.

В другом аспекте в настоящем изобретении используется выделенный полинуклеотид, который кодирует легкую цепь антитела E3 с номером депозита ATCC № PTA-4893 или ATCC № PTA-4894. В другом аспекте настоящее изобретение связано с выделенным полинуклеотидом, который кодирует тяжелую цепь антитела E3 с номером депозита ATCC № PTA-4895. Еще в одном аспекте изобретения выделенный полинуклеотид содержит (a) вариабельную область, кодируемую в полинуклеотиде с номером депозита ATCC № PTA-4893 или PTA-4894, и (b) вариабельную область, кодируемую в полинуклеотиде с номером депозита ATCC № PTA-4895. В другом аспекте выделенный полинуклеотид содержит (a) одну или более областей CDR, кодируемых в полинуклеотиде с номером депозита ATCC № PTA-4893 или PTA-4894; и/или (b) одну или более областей CDR, кодируемых в полинуклеотиде с номером депозита ATCC № PTA-4895.

Еще в одном аспекте в настоящем изобретении используются полинуклеотиды, которые кодируют любое из указанных антител (включая фрагменты антител), или описанные здесь полипептиды.

В другом аспекте в настоящем изобретении используются векторы (включая экспрессирующие и клонирующие векторы) и клетки-хозяева, содержащие любой из указанных здесь полинуклеотидов.

В другом аспекте в настоящем изобретении используется клетка-хозяин, содержащая полинуклеотид, кодирующий легкую цепь антитела E3, и полинуклеотид, кодирующий тяжелую цепь антитела E3, причем указанный полинуклеотид(ы), кодирующий легкую цепь антитела E3, имеет депозитарный номер ATCC № PTA-4893 и/или ATCC № PTA-4894, а полинуклеотид, кодирующий тяжелую цепь антитела E3, имеет депозитарный номер ATCC № PTA-4895. В некоторых воплощениях клетка-хозяин содержит полинуклеотид, включающий в себя (a) вариабельную область, кодируемую в полинуклеотиде с депозитарным номером ATCC № PTA-4893 или PTA-4894, и/или (b) вариабельную область, кодируемую в полинуклеотиде с депозитарным номером ATCC № PTA-4895. В некоторых воплощениях указанная клетка-хозяин содержит полинуклеотид, кодирующий (a) одну или более областей CDR, кодируемых в полинуклеотиде с депозитарным номером ATCC № PTA-4893 или PTA-4894; и/или (b) одну или более областей CDR, кодируемых в полинуклеотиде с депозитарным номером ATCC № PTA-4895. В некоторых воплощениях указанная клетка-хозяин является клеткой млекопитающего.

В другом аспекте настоящее изобретение связано с антагонистическим антителом против ФРН для его использовании в целях лечения или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдром мочевого пузыря. Антагонистическое антитело против ФРН может быть таким, как описано в настоящей заявке.

Другой аспект настоящего изобретения связан с применением антагонистического антитела против ФРН для его использовании в изготовлении лекарственного средства для лечения или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдром мочевого пузыря. Антагонистическое антитело против ФРН может быть таким, как описано в настоящей заявке.

В другом аспекте настоящее изобретение связано с фармацевтической композицией для применения при лечении или профилактике боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдром мочевого пузыря, содержащей любой из описанных здесь полипептидов (включая такие антитела как антитело E3), полинуклеотидов или векторов, например, фармацевтические композиции, содержащие антитело E3 или фрагмент антитела E3 и фармацевтически приемлемый носитель.

В другом аспекте настоящее изобретение связано с наборами и композициями, содержащими любую одну или более из описанных здесь композиций. Указанные наборы, обычно подходящим образом упакованные и содержащие соответствующие инструкции, применимы в любом из описанных здесь способов.

Настоящее изобретение связано также с любой из описанных здесь композиций и наборов для любого описанного здесь применения, будь то применение в контексте использования в качестве лекарственного средства и/или применение для изготовления лекарственного средства.

Предпочтительные признаки каждого из аспектов настоящего изобретения в равной степени приложимы к любому другому аспекту данного изобретения, и наоборот.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

В описанном здесь изобретении предложены способы лечения или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдром мочевого пузыря у индивида путем введения терапевтически эффективного количества антагонистического антитела против ФРН.

В описанном здесь изобретении предложено также антагонистическое антитело против ФРН для его применения для лечения или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдром мочевого пузыря. Помимо указанного, предложено также применение антагонистического антитела против ФРН в изготовлении лекарственного средства для лечения или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдром мочевого пузыря.

В описанном здесь изобретении предложено также применение антагонистических антител против ФРН, которые с высокой аффинностью связываются с ФРН (таким как человеческий ФРН). В некоторых воплощениях настоящего изобретения используется гуманизированное антитело, E3, которое связывается с ФРН. В данном изобретении используются также полипептиды E3 (включая антитела), которые связываются с ФРН, и полипептиды, кодирующие антитело и/или полипептид E3. Кроме того, данное изобретение связано с применением антител и полипептидов, полученных из E3, которые связываются с ФРН.

Основные технологии

В практике настоящего изобретения будут использованы, если не указано иное, технологии, являющиеся общепринятыми в молекулярной биологии (включая рекомбинантную технологию), микробиологии, клеточной биологии, биохимии и иммунологии, которыми владеют специалисты в данной области. Такие технологии полностью описаны в литературе, например: Molecular Cloning: A Laboratory Manual, second edition (Sambrook et al., 1989) Cold Spring Harbor Press; Oligonucleotide Synthesis (MJ. Gait, ed., 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. CeIMs, ed., 1998) Academic Press; Animal Cell Culture (R.I. Freshney, ed., 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds., 1993-1998) J. Wiley and Sons; Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and CC. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987); PCR: The Polymerase Chain Reaction, (MuIMs et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991 ); Short Protocols in Molecular Biology (Wiley and Sons, 1999); lmmunobiology (CA. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practical approach (D. Catty., ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds., Harwood Academic Publishers, 1995); and Cancer: Principles and Practice of Oncology (VT. DeVita et al., eds., J. B. Lippincott Company, 1993).

Определения

"Антитело" представляет собой молекулу иммуноглобулина, способную специфически связываться с мишенью, такой как углевод, полинуклеотид, липид, полипептид и т.д., постредством по меньшей мере одного сайта узнавания антигена, находящегося в вариабельной области иммуноглобулиновой молекулы. В настоящем описании указанный термин охватывает не только интактные поликлональные или моноклональные антитела, но также и их фрагменты (такие как Fab, Fab', F(ab')2, Fv, dAb), одноцепочечные антитела (ScFv), их мутанты, химерные антитела, диатела, слитые белки, содержащие часть антитела, а также любую другую конфигурауию иммуноглобулиновой молекулы, которая содержит сайт узнавания антигена. Антитело включает в себя антитело любого класса, такое как IgG, IgA или IgM (или их подкласса), и указанное антитело не должно относиться к какому-либо определенному классу. В зависимости от аминокислотной последовательности константного домена тяжелых цепей указанного антитела, иммуноглобулины могут быть отнесены к различным классам. Существует пять основных классов иммуноглобулинов: IgA, IgD, IgE, IgG и IgM, и некоторые из них могут быть дополнительно подразделены на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, которые соответствуют разным классам иммуноглобулинов, называются, соответственно, альфа, дельта, эпсилон, гамма и мю. Субъединичные структуры и трехмерные конфигурации различных классов иммуноглобулинов хорошо известны.

Термин "вариабельная область" антитела относится к вариабельной области легкой цепи антитела или к вариабельной области тяжелой цепи антитела, как отдельно, так и в сочетании друг с другом. Каждая из вариабельных областей тяжелой и легкой цепей состоит из четырех областей рамки считывания (FR, framework regions), связанных тремя определяющими комплементарность областями (CDR), известными также как гипервариабельные области. Области CDR в каждой цепи посредством FR удерживаются в непосредственной близости друг от друга и, совместно с областями CDR из другой цепи, вносят свой вклад в антиген-связывающий сайт антител. Для определения областей CDR существует по меньшей мере две технологии: (1) подход, основанный на вариабельности последовательностей при межвидовом скрещивании (т.е. Kabat et al. Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda MD)); и (2) подход, основанный на кристаллографических исследованиях комплексов антиген-антитело (Chothia et al. (1989) Nature 342:877; Al-lazikani et al (1997) J. Molec. Biol. 273:927-948)). В настоящем описании CDR может относиться к областям CDR, определяемым с помощью любого из указанных подходов или же путем сочетания обоих подходов.

"Константная область" относится к константной области легкой цепи антитела или к константной области тяжелой цепи антитела, взятыми отдельно или в сочетании друг с другом. "Fv" представляет собой фрагмент антитела, который содержит полный антиген-распознающий и антиген-связывающий сайт. У видов с двухцепочечным Fv-фрагментом эта область состоит из димера с одним вариабельным доменом тяжелой цепи и с одним вариабельным доменом легкой цепи, находящимися в тесной нековалентной ассоциации друг с другом. У видов с одноцепочечным Fv-фрагментом один вариабельный домен тяжелой цепи и один вариабельный домен легкой цепи могут быть ковалентно связаны гибким пептидным линкером, таким, чтобы легкая и тяжелая цепи могли ассоциировать в димерной структуре аналогично тому, как это происходит у видов с двухцепочечным Fv-фрагментом. Это как раз та конфигурация, в которой три участка CDR каждого из вариабельных доменов взаимодействуют, определяя антиген-связывающую специфичность на поверхности VH-VL-димера. Однако даже одноцепочечный вариабельный домен (или половина Fv, содержащая только 3 участка CDR, специфичных в отношении антигена) обладает способностью распознавать антиген и связываться с ним, хоть обычно и с более низкой аффинностью, чем полноразмерный связывающий сайт.

Fab-фрагмент содержит также константный домен легкой цепи и первый константный домен (CH1) тяжелой цепи. Fab'-фрагменты отличаются от Fab-фрагментов тем, что в них добавлено несколько остатков на карбокси-конце CH1-домена тяжелой цепи, включая один или более цистеиновых остатков из шарнирных участков антитела. F(ab)2-фрагмент является бивалентным фрагментом, содержащим два Fab-фрагмента, соединенных дисульфидным мостиком на шарнирном участке.

Одноцепочечное антитело (scFc) представляет собой антитело, в котором участки VL и VH спарены, с образованием моновалентной молекулы, через искусственный линкер, который позволяет им пребывать в виде одноцепочечной белковой цепи (Bird et al Science, 242:423-426 (1988) и Huston et al., Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988)).

Диатела являются двухвалентными, биспецифическими антителами, в которых VH- и VL-домены экспрессированы на единственной полипептидной цепи, однако с помощью линкера, который слишком короток для спаривания между двумя доменами на одной и той же цепи, поэтому указанные домены вынуждены спариваться с комплементарными доменами другой цепи и образовывать, таким образом, два антиген-связывающих сайта.

Антитело может иметь один или более связывающих сайтов. В случае, если связывающих сайтов больше одного, такие связывающие сайты могут быть идентичными или могут отличаться друг от друга. Например, иммуноглобулин природного происхождения имеет два идентичных связывающих сайта, одноцепочечное антитело или Fab-фрагмент имеет один связывающий сайт, в то время как "биспецифическое", или "бифункциональное", антитело (диатело) имеет два различных связывающих сайта.

"Изолированное антитело" представляет собой антитело, которое (1) не является ассоциированным с природно-ассоциированными компонентами, включая другие природно-ассоциированные антитела, которые сопровождают его в его нативном состоянии, (2) является свободным от других белков того же самого вида, (3) экспрессируется клеткой из другого вида или (4) не встречается в природе.

"Моноклональное антитело" относится к гомогенной популяции антител, в которой моноклональное антитело состоит из аминокислот (возникающих природным путем и образующихся неприродным путем), которые участвуют в селективном связывании антигена. Популяция моноклональных антител является высокоспецифичной, направленной на единственный антигенный сайт. Термин "моноклональное антитело" охватывает не только интактные моноклональные антитела и полноразмерные моноклональные антитела, но также и их фрагменты (такие как Fab, Fab', F(ab')2, Fv), одиночную цепь (ScFv), их мутанты, слитые белки, содержащие часть антитела, а также любую другую модифицированную конфигурацию молекулы, которая содержит сайт распознавания антигена требуемой специфичности и способна связываться с антигеном. Подразумевается, что указанное понятие не является ограниченным в том, что касается источника антитела или способа его получения (например, с помощью гибридомы, фаговой селекции, рекомбинантной экспрессии, трансгенных животных и т.д.).

В данном описании под "человеческим антителом" подразумевается антитело, имеющее аминокислотную последовательность, соответствующую таковой антитела, продуцируемого человеком и/или полученного с использованием любой известной в данной области или описанной здесь технологии получения человеческих антител. Данное определение человеческого антитела включает в себя антитела, содержащие по меньшей мере один полипептид человеческой тяжелой цепи или по меньшей мере один полипептид человеческой легкой цепи. Одним из таких примеров является антитело, содержащее полипептиды мышиной легкой цепи и человеческой тяжелой цепи. Человеческие антитела могут быть продуцированы с помощью различных известных в данной области технологий. В одном из аспектов такое человеческое антитело выбрано из фаговой библиотеки, где указанная фаговая библиотека экспрессирует человеческие антитела (Vaughan et al., 1996, Nature Biotechnology, 14:309-314; Sheets et al., 1998, PNAS, (USA) 95:6157-6162; Hoogenboom and Winter, 1991, J. Mol. Biol., 227:381; Marks et al., 1991, J. Mol. Biol., 222:581). Человеческие антитела могут быть получены также путем введения локусов человеческого иммуноглобулина в организм трансгенных животных, например, мышей, у которых гены эндогенного иммуноглобулина частично или полностью инактивированы. Такой подход описан в патентах США №№ 5545807, 5545806, 5569825, 5625126, 5633425 и 5661016. Альтернативно, такое человеческое антитело может быть получено путем иммортализации человеческих B-лимфоцитов, которые продуцируют антитело, направленное против антигена-мишени (такие B-лимфоциты могут быть получены из индивидуального организма, или же их можно иммунизировать in vitro). См., например, Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., 1991, J. Immunol., 147 (1):86-95; и патент США № 5750373.

"Химерные антитела" относятся к таким антителам, в которых одна часть каждой из аминокислотных последовательностей тяжелой и легкой цепей гомологична соответствующим последовательностям в антителах, полученных из конкретных видов или принадлежащих конкретному классу, тогда как оставшийся сегмент цепей гомологичен соответствующим последовательностям в антителах другого вида или класса. Обычно в таких химерных антителах вариабельная область обеих, легких и тяжелых, цепей имитирует вариабельные области антител, полученных из одного вида животных, тогда как константные области гомологичны последовательностям в антителах, полученных из другого вида. Одним из бесспорных преимуществ таких химерных форм является, например, то, что их вариабельные области удобно получать из известных в настоящее время источников с использованием легкодоступных гибридом или B-клеток из организмов-хозяевов, отличных от человеческого, в сочетании с константными областями, полученными, например, из препаратов человеческих клеток. В этом случае вариабельные области имеют то преимущество, что их легко получать, тогда как их специфичность не зависит от источника, в то же время константная область имеет человеческую природу, поэтому вероятность инициации иммунного ответа при инъецировании таких антител в человеческий организм меньше, чем в случае, если бы константная область была получена из другого источника, не являющегося человеческим организмом. Однако приведенное здесь определение не следует считать ограниченным конкретным указанным примером.

"Функциональная Fc-область" обладает по меньшей мере одной эффекторной функцией нативной последовательности Fc-области. Примеры "эффекторных функций" включают в себя связывание C1q; комплемент-зависимую цитотоксичность (CDC); связывание Fc-рецептора; антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC); фагоцитоз; понижающую регуляцию рецепторов клеточной поверхности (например, B-клеточного рецептора; BCR), и т.д. Такие эффекторные функции обычно требуют комбинации Fc-области со связывающим доменом (например, вариабельным доменом антитела), и они могут быть определены с помощью различных методов анализа, известных в данной области, для оценки эффекторных функций антитела.

"Нативная последовательность Fc-области" содержит аминокислотную последовательность, идентичную аминокислотной последовательности Fc-области, обнаруживаемой в природе. "Вариантная Fc-область" содержит аминокислотную последовательность, которая отличается от таковой нативной последовательности Fc-области в силу модификации по меньшей мере одной аминокислоты, но при этом она все еще сохраняет по меньшей мере одну эффекторную функцию нативной последовательности Fc-области. Предпочтительно, чтобы вариантная Fc-область имела по меньшей мере одну аминокислотную замену по сравнению с нативной последовательностью Fc-области или с Fc-областью родительского полипептида, например, от приблизительно одной и до приблизительно десяти аминокислотных замен, и предпочтительно, от приблизительно одной и до приблизительно пяти аминокислотных замен в нативной последовательности Fc-области или в Fc-области родительского полипептида. Здесь вариантная Fc-область предпочтительно будет иметь по меньшей мере приблизительно 80%-ую степень идентичности последовательности при ее сопоставлении с нативной последовательностью Fc-области и/или с Fc-областью родительского полипептида, и, наиболее предпочтительно, по меньшей мере приблизительно 90%-ую степень идентичности указанным последовательностям, более предпочтительно, по меньшей мере приблизительно 95%-ую степень идентичности указанным последовательностям.

Здесь "антитело-зависимая клеточно-опосредованная цитотоксичность" и "ADCC" относятся к клеточно-опосредованной реакции, в которой неспецифические цитотоксические клетки, которые экспрессируют Fc-рецепторы (FcR) (например, клетки-природные киллеры (NK), нейтрофилы и макрофаги), распознают связанный антиген на клетке-мишени и впоследствии вызывают лизис клетки-мишени. Активность представляющей интерес молекулы, связанная с ADCC, может быть установлена с помощью анализа ADCC in vitro, такого, какой описан в патенте США № 5500362 или 5821337. Полезные для таких анализов эффекторные клетки включают в себя мононуклеарные клетки периферической крови (PBMC) и NK-клетки. Альтернативно или дополнительно, активность представляющей интерес молекулы, связанная с ADCC, может быть установлена in vivo, например, на такой животной модели, которая описана Clynes et al., 1998, PNAS (USA), 95:652-656.

Здесь "Fc-рецептор" и "FcR" относятся к рецептору, который связывается с Fc-областью антитела. Предпочтительным FcR является нативная последовательность человеческого FcR. Кроме того, предпочтительным FcR является такой FcR, который связывается с IgG-антителом (гамма-рецептор) и включает в себя рецепторы подклассов FcγRI, FcγRII и FcγRIII, включая аллельные варианты и формы альтернативного сплайсинга этих рецепторов. Рецепторы FcγRII включают в себя FcγRIIA ("активирующий рецептор") и FcγRIIB ("ингибирующий рецептор"), которые имеют сходные аминокислотные последовательности, которые прежде всего отличаются на уровне их цитоплазматических доменов. Обзор рецепторов FcR можно найти в публикациях Ravetch and Kinet, 1991, Ann. Rev. Immunol., 9:457-92; Capel et al., 1994, Immunomethods, 4:25-34; и de Haas et al., 1995, J. Lab. Clin. Med., 126:330-41. "FcR" включает в себя также неонатальный рецептор, FcRn, который ответственен за перенос материнских IgG плоду (Guyer et al., 1976, J. Immunol., 117:587; и Kim et al., 1994, J. Immunol., 24:249).

"Комплемент-зависимая цитотоксичность", или "CDC", относится к лизису мишени в присутствии комплемента. Путь активации комплемента инициирован связыванием первого компонента системы комплемента (C1q) с молекулой (например, антителом), образующей комплекс с узнаваемым антигеном. Для оценки активации комплемента может быть предпринят анализ CDC, например, описанный у Gazzano-Santoro et al., J. Immunol. Methods, 202:163 (1996).

Здесь термины "E3", "3E" и "антитело E3" используются взаимозаменяемым образом для обозначения антитела, содержащего аминокислотные последовательности вариабельных областей тяжелой цепи и легкой цепи, представленные, соответственно, в SEQ ID NO: 1 и SEQ ID NO: 2 (фиг.1A и 1B в международной заявке WO 2004/058184). CDR-части антитела E3 (включая области CDR Чата и Кабат) приведены в виде диаграммы на фиг.1A и 1B в международной заявке WO 2004/058184. На фиг.2 и 3 в указанной заявке WO 2004/058184 показаны полипептиды, кодирующие тяжелую и легкую цепи, соответственно, содержащие вариабельные области тяжелой и легкой цепи, представленные, соответственно, на фиг.1A и 1B. Получение и характеристические свойства E3 описаны в примерах международной заявки WO 2004/058184, полное содержание которой включено в настоящее описание в виде ссылки. С антителом E3 ассоциированы различные биологические функции, включая, но не ограничиваясь перечисленным, способность к связыванию с ФРН и ингибирование биологической активности ФРН и/или низлежащего пути (путей), опосредованного сигнальной системой ФРН; и способность к ингибированию ФРН-зависимой выживаемости тригеминальных нейронов мыши E13.5. Как обсуждается в настоящем описании, антитела для применения в настоящем изобретении могут иметь одну или более из указанных здесь характеристик. В некоторых воплощениях термин "E3" относится к иммуноглобулину, кодируемому (a) полинуклеотидом, кодирующим легкую цепь E3, которая имеет депозитарный номер ATCC № PTA-4893 или ATCC № PTA-4894, и (b) полинуклеотидом, кодирующим тяжелую цепь E3, которая имеет депозитарный номер ATCC № PTA-4895.

Здесь "иммуноспецифическое" связывание антител относится к антиген-специфическому взаимодействию связывания, которое имеет место между соединяющимся с антигеном сайтом антитела и специфическим антигеном, распознаваемым данным антителом (то есть антитело в тесте ELISA или в каком-нибудь другом иммуноанализе реагирует с конкретным белком и регистрируемым образом не реагирует с неродственными белками).

Эпитоп, который "специфически связывается", или "предпочтительно связывается" (используются здесь взаимозаменяемым образом), с антителом или полипептидом, является термином, хорошо знакомым специалистам в данной области, и способы определения такого специфического или предпочтительного связывания также хорошо известны специалистам в данной области. Говорят, что молекула проявляет активность "специфического связывания" или "предпочтительного связывания", если она чаще, быстрее, более продолжительное время и/или с большей аффинностью реагирует или ассоциируется с конкретной клеткой или веществом, чем с альтернативными клетками или веществами. Антитело "специфически связывается" или "предпочтительно связывается" с мишенью, если оно связывается с ней с большей аффинностью, авидностью, более охотно и/или более продолжительно, чем оно связывается с другими веществами. Например, антитело, которое специфически или предпочтительно связывается с эпитопом ФРН, является антителом, которое связывает указанный эпитоп с большей аффинностью, авидностью, более охотно и/или более продолжительно, чем оно связывается с другими эпитопами ФРН или эпитопами не-ФРН. Из этого определения становится также понятно, например, и то, что антитело (или его фрагмент или эпитоп), которое специфически или предпочтительно связывается с первой мишенью, может или не может специфически или предпочтительно связываться со второй мишенью. Как таковое, "специфическое связывание" или "предпочтительное связывание" необязательно требует (хотя оно может и включать в себя) исключительное связывание. Обычно, но не обязательно, указание на связывание означает предпочтительное связывание.

Термины "полипептид", "олигопептид", "пептид" и "белок" используются здесь взаимозаменяемым образом в отношении полимеров аминокислот любой длины. Такой полимер может быть линейным или разветвленным, он может содержать модифицированные аминокислоты, и он может перемежаться с не-аминокислотами. Указанные термины охватывают также аминокислотный полимер, который модифицирован природно или же модифицирован искусственным образом; например, образование дисульфидной связи, гликозилирование, липидизация, ацетилирование, фосфорилирование или любая другая манипуляция или модификация, такая как конъюгация с маркирующим компонентом. В это определение включены также, например, полипептиды, содержащие один или более аналогов аминокислот (включая, например, неприродные аминокислоты, и т.д.), а также другие модификации, известные в данной области. Понятно также и то, что, в силу того, что полипептиды согласно изобретению основаны на антителах, указанные полипептиды могут быть представлены в виде одиночных цепей или ассоциированных цепей.

"Полинуклеотид", или "нуклеиновая кислота", используемые здесь взаимозаменяемым образом, относится к полимерам нуклеотидов любой длины и включает в себя ДНК и РНК. Нуклеотиды могут быть дезоксирибонуклеотидами, рибонуклеотидами, модифицированными нуклеотидами или основаниями, и/или их аналогами, или любым субстратом, который может быть включен в полимер посредством ДНК- или РНК-полимеразы. Полинуклеотид может содержать модифицированные нуклеотиды, такие как метилированные нуклеотиды и их аналоги. Модификация, если она присутствует, может быть придана нуклеотидной структуре до или после сборки полимера. Последовательность нуклеотида может быть прервана не-нуклеотидными компонентами. Полинуклеотид может быть дополнительно модифицирован после полимеризации, например, путем конъюгации с маркирующим компонентом. Другие типы модификаций включают в себя, например, "кэпы", замещение одного или более из природно образующихся нуклеотидов аналогом, интернуклеотидные модификации, такие, например, как модификации незаряженными мостиками (например, метилфосфонаты, сложные фосфотриэфиры, фосфоамидаты, кабаматы и т.д.) и заряженными мостиками (например, фосфоротиоаты, фосфородитиоаты и т.д.), модификации, содержащие подвесные фрагменты, такие, например, как белки (например, нуклеазы, токсины, антитела, сигнальные пептиды, поли-L-лизин и т.д.), модификации интеркаляторами (например, акридин, псорален и т.д.), модификации, содержащие хелаторы (например, металлы, радиоактивные металлы, бор, окислительные металлы и т.д.), модификации, содержащие алкиляторы, модификации модифицирующими мостиками (например, альфа-аномерные нуклеиновые кислоты и т.д.), а также немодифицированные формы полинуклеотида(ов). Кроме того, любая из гидроксильных групп, обычно присутствующих в сахарах, может быть заменена, например, фосфонатными группами, фосфатными группами, защищена стандартными протективными группами или же активирована, с получением дополнительных мостиков к добавочным нуклеотидам, или же может быть конъюгирована с твердыми носителями. 5'- и 3'-концевая группа OH может быть фосфорилирована или замещена аминами или органическими кэппинг-группами с 1-20 атомами углерода. Другие гидроксилы также могут быть дериватизированы до стандартных защитных групп. Полинуклеотиды могут также содержать формы-аналоги сахаров рибозы и дезоксирибозы, которые в общем известны в данной области, включая, например, 2'-O-метил-, 2'-O-аллил, 2'-фтор- или 2'-азидо-рибозу, карбоциклические аналоги сахаров, α-аномерные формы сахара, эпимерные формы сахара, такие как арабиноза, ксилозы или ликсозы, пиранозные формы сахаров, фуранозные формы сахаров, седогептулозы, ациклические аналоги и нуклеозидные аналоги с удаленными азотистыми основаниями, такие как метилрибозид. Один или более фосфодиэфирных мостиков могут быть заменены альтернативными связывающими группами. Указанные альтернативные связывающие группы включают в себя, не ограничиваясь перечисленным, воплощения, в которых фосфат заменен на P(О)S("тиоат"), P(S)S ("дитиоат"), "(O)NR2 ("амидат"), P(O)R, P(O)OR', CO или CH2 ("формацетат"), в которых каждый R или R' независимо представляет собой H или замещенный или незамещенный алкил (1-20 C), необязательно содержащий эфирную (-O-) связь, арил, алкенил, циклоалкил, циклоалкенил или аралкил. Не все связи в полинуклеотиде должны быть идентичными. Предшествующее описание применимо ко всем упомянутым здесь полинуклеотидам, включая РНК и ДНК.

Термин "идентичность" относится к проценту, или степени, "идентичности" двух аминокислотный последовательностей или двух последовательностей нуклеиновых кислот. Процент идентичности обычно определяется путем выравнивания последовательностей в целях их оптимального сравнения (например, в первую последовательность могут быть включены гэпы для наилучшего выравнивания со второй последовательностью) и сравнения аминокислотных остатков или нуклеотидов в соответствующих положениях. "Наилучшее выравнивание" представляет собой выравнивание двух последовательностей, при котором получается наивысший процент идентичности. Указанный процент идентичности определяется путем сравнения числа идентичных аминокислотных остатков или нуклеотидов в последовательностях (то есть % идентичности = число идентичных положений/общее число положений × 100).

Определение процента идентичности между двумя последовательностями может быть достигнуто с помощью математического алгоритма, известного специалистам в данной области. Примером математического алгоритма для сравнения двух последовательностей является алгоритм Karlin и Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268, модифицированный, как описано Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. В программы NBLAST и XBLAST, предложенные Altschul, et al. (1990) J. Mol. Biol. 215:403-410, включен такой алгоритм. Программа BLAST для исследования нуклеотидов может быть использована с программой LAST, оценка в баллах = 100, длина слова = 12, для получения нуклеотидных последовательностей, гомологичных молекулам нуклеиновой кислоты согласно изобретению. Программа BLAST для исследования белков может быть использована с программой XBLAST, оценка в баллах = 50, длина слова = 3, для получения аминокислотных последовательностей, гомологичных белковым молекулам согласно изобретению. Чтобы в сравнительных целях получить выравнивание с пробелами, можно использовать программу Gapped BLAST, как описано Altschul et al. (1997) Nucliec Acids Res. 25:3389-3402. Альтернативно, для проведения итеративного исследования, позволяющего определять дистантные соотношения между молекулами, можно использовать программу PSI-Blast (Id.).

При пользовании программами BLAST, Gapped BLAST и PSI-Blast могут быть использованы параметры дефолта соответствующих программ (например, XBLAST и NBLAST). См. http://www.ncbi.nlm.nih.gov. Другим примером математического алгоритма, используемого для сравнения последовательностей, является алгоритм Myers и Miller, CABIOS (1989). Программа ALIGN (версия 2.0), которая является частью пакета программ выравнивания GCG-последовательности, включает в себя такой алгоритм. Другие известные в данной области алгоритмы для анализа последовательностей включают в себя ADVANCE и ADAM, как описано Torellis and Robotti (1994) Comput. Appl. Biosci., 10: 3-5; и FASTA, описанный Pearson и Lipman (1988) Proc. Natl. Acad. Sci. 85:2444-8. Среди FASTA, ktup является контрольной опцией, которая определяет чувствительность и скорость поиска.

Здесь термин "фактор роста нервов" и "ФРН" относится к фактору роста нервов и его вариантам, которые сохраняют по меньшей мере часть биологической активности ФРН. Здесь ФРН включает в себя нативную последовательность ФРН всех видов млекопитающих, включая человека, собаку, кошку, лошадь или быка.

"Рецептор ФРН" относится к полипептиду, который связывается или инактивируется ФРН. Рецепторы ФРН включают в себя рецептор TrkA и рецептор p75 млекопитающих любого вида, включая, но не ограничиваясь перечисленным, человека, собаку, кошку, лошадь, примата или быка.

Здесь "антагонистическое антитело против ФРН" (взаимозаменяемым образом называемое также "анти-ФРН-антителом") относится к антителу, которое способно связываться с ФРН и ингибировать биологическую активность ФРН и/или низлежащего пути (путей), опосредованного сигнальной системой ФРН. Антагонистическое антитело против ФРН охватывает антитела, которые блокируют, вызывают антагонизм, супрессию или снижение (включая значительное) биологической активности ФРН, включая низлежащие пути, опосредованные сигнальной системой ФРН, такие как связывание рецептора и/или получение клеточного ответа на ФРН. В связи с настоящим изобретением должно быть однозначно уяснено, что термин "антагонистическое антитело против ФРН" охватывает все термины, названия и функциональные состояния и характеристики, которые были определены ранее, и, в соответствии с этим, в результате их действия ФРН как таковой, его биологическая активность (включая, но не ограничиваясь его способностью участвовать в качестве посредника в любом аспекте, связанном с послеоперационной болью) или последствия его биологической активности аннулируются, существенно понижаются или нейтрализуются в любой какой-либо значимой степени. В некоторых воплощениях антагонистическое антитело против ФРН связывается с ФРН и предупреждает димеризацию ФРН и/или его связывание с рецептором ФРН (таким как p75 и/или trkA). В других воплощениях анти-ФРН-антитело связывается с ФРН и предупреждает димеризацию рецептора trkA и/или аутофосфорилирование trkA. Примеры антагонистических антител против ФРН приведены в настоящем описании.

"Биологическая активность" ФРН обычно относится к его способности связываться с рецепторами ФРН и/или активировать сигнальную систему рецепторов ФРН. Не ограничиваясь перечисленным, биологическая активность включает в себя одно или более из следующих свойств: способность связываться с рецептором ФРН (таким как p75 и/или trkA); способность стимулировать димеризацию и/или аутофосфорилирование рецептора trkA; способность активировать сигнальную систему рецептора ФРН; способность стимулировать клеточную дифференцировку, пролиферацию, выживаемость, рост и другие изменения в клеточной физиологии, включая (в случае нейронов включая периферический и центральный нейрон) изменение в морфологии нейрона, синаптогенезе, синаптической функции, выделение нейротрансмиттера и/или нейропептида и регенерацию после повреждения; способность стимулировать выживаемость тригеминальных нейронов мыши E13.5; и способность к опосредованию боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом, и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря.

Здесь термин "по существу чистый" относится к материалу, который является чистым (то есть свободным от примесей) по меньшей мере на 50%, предпочтительнее, по меньшей мере на 90% чистым, более предпочтительно, по меньшей мере на 95% чистым, еще более предпочтительно, по меньшей мере на 98% чистым, и еще более предпочтительно, чистым по меньшей мере на 99%.

"Клетка-хозяин" включает в себя индивидуальную клетку или клеточную культуру, которая может быть или которая была реципиентом вектора (векторов) для включения полинуклеотидных вставок. Клетки-хозяева включают в себя предшественника индивидуальной клетки-хозяина, причем указанный предшественник необязательно должен быть полностью идентичен (морфологически или на уровне комплементарной геномной ДНК) исходной родительской клетке, в силу природной, случайной или преднамеренной мутации. Клетка-хозяин включает в себя клетки, трансфицированные in vivo полинуклеотидом(полинуклеотидами) согласно изобретению.

Здесь под "лечением" подразумевается подход с целью получения благотворных или клинически желательных результатов. В настоящем изобретении благотворные или клинически желательные результаты включают в себя, но не ограничиваются перечисленным, одно или более из следующих признаков: улучшение или облегчение любого из аспектов боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря. В рамках настоящего изобретения благотворные или клинически желательные результаты включают в себя, но не ограничиваются перечисленным, одно или более из следующих признаков: уменьшение тяжести, облегчение боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, включая любой из аспектов боли (таких как уменьшение продолжительности боли, снижение болевой чувствительности или болевых ощущений).

Под "эффективным количеством" лекарственного средства, соединения или фармацевтической композиции подразумевается количество, достаточное для осуществления благотворных или клинически желательных результатов, таких как облегчение боли или снижение болевых ощущений. Эффективное количество может быть введено в составе одного или более введений. В терминологии настоящего изобретения эффективным количеством лекарственного средства, соединения или фармацевтической композиции является количество, достаточное для лечения, облегчения, уменьшения интенсивности и/или предотвращения боли или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря. В некоторых воплощениях "эффективное количество" может уменьшать боль неподвижного состояния (боль в состоянии покоя) или механически индуцированную боль (включая боль, сопровождающую движения), или же и ту, и другую боль, и оно может быть введено до, в процессе воздействия или же после вызывающего боль раздражителя. Из клинического контекста должно быть понятно, что эффективное количество лекарственного средства, соединения или фармацевтической композиции может быть достигнуто либо в сочетании с другим лекарственным средством, соединением или фармацевтической композицией, либо без них. Таким образом, вопрос об "эффективном количестве" может быть решен в контексте введения одного или более терапевтических средств, и можно считать, что единственное терапевтическое средство может быть введено в эффективном количестве, если в сочетании с одним или несколькими другими средствами может быть достигнут или же достигается требуемый результат.

"Уменьшение частоты возникновения" боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря, означает какое бы то ни было уменьшение тяжести (что может включать в себя снижение количества и/или уменьшение потребности (например, в воздействии) в других лекарственных средствах и/или терапевтических мерах, обычно используемых при таких состояниях, включая, например, опиаты), длительности и/или частоты (включая, например, запаздывание или увеличение отсрочки в наступлении боли у индивида). Как хорошо известно специалистам в данной области, отдельные индивидуумы могут отличаться по их реакции на лечение, и как таковой, например, "способ уменьшения частоты возникновения боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря, у индивида" отражает введение антагонистического антитела против ФРН на основе вполне обоснованного ожидания того, что указанное введение может, вероятно, вызвать такое снижение частоты конкретно у данного индивида.

"Улучшение" в отношении боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря, означает ослабление или положительную динамику одного или более симптомов боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря, по сравнению с тем, когда не вводят антагонистическое антитело против ФРН. "Улучшение" включает в себя также укорочение или уменьшение длительности симптома.

"Временное облегчение" боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря, означает уменьшение степени одной или более нежелательных клинических манифестаций и/или симптомов со стороны нижних мочевыводящих путей у индивида или в популяции индивидов.

Здесь под "отсрочкой" развития боли подразумевается задержка, торможение, замедление, запаздывание, стабилизация и/или отдаление прогрессирования боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря. Такая отсрочка может иметь различную продолжительность, в зависимости от истории болезни и/или особенностей подвергающегося лечению индивида. Как очевидно специалистам в данной области, достаточное или значительное отсрочивание боли может, в сущности, охватывать и случаи предотвращения боли у тех индивидов, у которых боль обычно не развивается. Способ, который "отсрочивает" развитие такого симптома, является способом, который снижает вероятность развития этого симптома в определенных временных рамках и/или уменьшает распространенность симптомов в определенных временных рамках, по сравнению с тем, когда указанный способ не используется. Такие сравнения обычно основаны на клинических исследованиях, в которых использовано статистически значимое число субъектов.

"Боль" используется здесь в отношении боли любой этиологии, включая острую и хроническую боль, а также любую боль с воспалительным компонентом. Здесь понятие "боль" включает в себя ноцицепцию и ощущение боли, и боль может быть установлена объективно и субъективно, с использованием болевой шкалы и других хорошо известных в данной области способов. Как хорошо известно в данной области, боль может быть первичной или вторичной болью.

"Боль, ассоциированная с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря", относится здесь к боли в нижнем брюшном (тазовом) отделе; к боли, связанной с мочевым пузырем; к боли в надлобковой области; к вагинальной боль; боли в пенисе, яичке, в мошонке и в промежности; к боли в уретре; диспареунии; к боли, давлению или дискомфорту, которые могут нарастать при наполнении мочевого пузыря.

"Симптомы со стороны нижних мочевыводящих путей, ассоциированные с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря", относятся здесь к трем группам симптомов мочевыводящей системы, которые можно определить как симптомы накопления (раздражение), симптомы опорожнения (непроходимость) и постмочеиспускательные симптомы. Симптомы, связанные с накоплением, включают в себя неотложность позывов к мочеиспусканию, их частоту, ночные позывы (ноктурию), императивное недержание и недержание мочи при напряжении, которые могут быть ассоциированы с гиперактивностью мочевого пузыря (ГАМП) и доброкачественной гиперплазией предстательной железы (ДГПЖ). Симптомы, связанные с опорожнением, включают в себя затрудненное начало мочеиспускания, недостаточность струи, прерывистость, растянутость и расстройство мочеиспускания. Постмочеиспускательные симптомы включают в себя отхождение мочи по каплям в конце акта мочеиспускания, отхождение мочи по каплям после мочеиспускания и ощущение неполного опорожнения.

«Гиперактивность мочевого пузыря (ГАМП)» определяется как императивность позывав к мочеиспусканию в сочетании с императивным недержанием или без него, обычно с повышенной частотой мочеиспускания и ноктурией [Abrams et al., Neurourology and Urodynamics 21:167-178 (2002)]. Распространенность ГАМП у мужчин и женщин сходна, при этом в США от этого состояния страдает приблизительно 16% популяции [Stewart et al, Prevalence of Overactive Bladder in the United States: Results from the NOBLE Program; Abstract Presented at the 2nd International Consultation on Incontinence, July 2001, Paris, France].

Термины мокрая и сухая ГАМП относятся, соответственно, к ГАМП у пациентов с наличием или отсутствием недержания мочи. Раньше кардинальным симптомом ГАМП считалось недержание мочи. Однако с появлением новых терминов это не имеет никакого смысла для большого числа страдающих этим заболеванием, у которых нет недержания (т.е. для пациентов с сухой ГАМП). Таким образом, в исследовании, проведенном в 2001 году Liberman et al. ['Health Related Quality of Life Among Adults with Symptoms of Overactive Bladder: Results From A US Community-Based Survey'; Urology 57(6), 1044-1050, 2001], изучали влияние всех симптомов ГАМП на качество жизни на примере местного населения в популяции США. Данное исследование показало, что у индивидов, страдающих от ГАМП без какого-либо заметного непроизвольного мочеиспускания, качество жизни ухудшено по сравнению с контролем.

ДГПЖ является хронически прогрессирующим заболеванием, которое может привести к таким осложнениям как острая задержка мочи, возвратная инфекция мочевыводящих путей, камни в мочевом пузыре и почечная дисфункция. Большая частота встречаемости и средняя степень тяжести LUTS, ассоциированного с ДГПЖ, у мужчин с возрастом повышается. ДГПЖ приводит к увеличению объема предстательной железы, вызывая обструкцию выходного потока из уретры и мочевого пузыря, а также вторичные изменения функции мочевого пузыря. Эти эффекты обнаружены как на уровне симптомов накопления (симптомы раздражения), так и на уровне симптомов опорожнения (симптомы непроходимости).

Термин "биологическая проба" охватывает полученные у индивидов пробы разных типов, которые могут быть использованы в диагностических анализах или при мониторинге. Указанное определение распространяется на образцы крови и других жидкостей биологической природы, на образцы солидных тканей, таких как биопсийные пробы или тканевые культуры, или полученные из них клетки и их предшественники. Указанное определение включает в себя также такие пробы, которые после их взятия подвергают каким-либо манипуляциям, например, путем обработки реагентами, путем солюбилизации или обогащения определенными компонентами, такими как белки или полинуклеотиды, или же путем погружения их в полутвердый или твердый матрикс для приготовления срезов. Термин "биологическая проба" включает в себя клинический образец, а также включает в себя клетки в культуре, клеточные супернатанты, клеточные лизаты, сыворотку, плазму, биологическую жидкость и образцы тканей.

"Индивид", или "субъект", является позвоночным, предпочтительно, млекопитающим, более предпочтительно, человеком. Млекопитающие включают в себя, не ограничиваясь перечисленным, сельскохозяйственных животных (таких как коровы), спортивных животных, домашних животных (таких как кошки, собаки и лошади), приматов, мышей и крыс.

Здесь "вектор" означает конструкцию, которая способна доставлять и, предпочтительно, экспрессировать один или более из представляющих интерес генов или последовательностей в клетку-хозяина. Примеры векторов включают в себя, не ограничиваясь перечисленным, вирусные векторы, векторы, экспрессирующие голую ДНК или РНК, плазмиды, космидные или фаговые векторы, ДНК- или РНК-экспрессирующие векторы, ассоциированные с катионными конденсирующими агентами, ДНК- или РНК-экспрессирующие векторы, инкапсулированные в липосомы, и определенные эукариотические клетки, такие как клетки-продуценты.

Здесь "контролирующая экспрессию последовательность" означает последовательность нуклеиновой кислоты, которая направляет транскрипцию нуклеиновой кислоты. Контролирующая экспрессию последовательность может быть промотором, таким как конститутивный или индуцибельный промотор, или энхансером. Контролирующая экспрессию последовательность оперативно связана с последовательностью нуклеиновой кислоты, подлежащей транскрипции.

Здесь "фармацевтически приемлемый носитель" включает в себя любой материал, который, при его комбинировании с активным ингредиентом, позволяет указанному ингредиенту сохранять его биологическую активность и который является ареактивным в отношении иммунной системы субъекта. Примеры включают в себя, не ограничиваясь перечисленным, любой из стандартных фармацевтически приемлемых носителей, таких как забуференный фосфатом физиологический раствор, вода, эмульсии, такие как эмульсия масло-в-воде, и увлажняющие агенты разных типов. Предпочтительными разбавителями для аэрозольного или парентерального введения являются забуференный фосфатом физиологический раствор или нормальный (0,9%) физиологический раствор. Композиции, содержащие такие носители, составляют хорошо известными общепринятыми способами (см., например, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, PA, 1990; и Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000).

Используемый здесь термин "Koff" предназначен для обозначения константы скорости диссоциации антитела при взаимодействии антиген-антитело. Термин "Kon" предназначен для обозначения константы скорости ассоциации при конкретном взаимодействии антиген-антитело. Используемый здесь термин "KD" предназначен для обозначения константы диссоциации при взаимодействии антиген-антитело, которую получают как отношение Koff к Kon и выражают в виде молярной концентрации (M). Значения KD для антител могут быть определены с помощью методов, хорошо известных в данной области. Одним из методов определения KD антитела является метод с использованием поверхностного плазмонного резонанса, обычно с помощью биосенсорной системы, такой как система Biacore®.

Способы применения антагонистического антитела против ФРН для лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря

В настоящем изобретении предложены способы лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у индивидов, включая млекопитающих, как являющихся, так и не являющихся человеком. Соответственно, в одном из аспектов изобретение связано со способами лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у индивида, предусматривающими введение эффективного количества антагонистического антитела против ФРН. Подходящими антагонистическими антителами против ФРН являются описанные здесь антитела.

В другом аспекте настоящее изобретение связано со способами уменьшения случаев возникновения, способами облегчения, супрессии, временного облегчения и/или отсрочивания появления, развития или прогрессии боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у индивида. Таким образом, в некоторых воплощениях антагонистическое антитело против ФРН вводят до развития боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированного с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у индивида с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Антагонистическое антитело против ФРН можно вводить индивиду любым подходящим путем. Примеры различных путей введения описаны в настоящей заявке.

В некоторых воплощениях антагонистическое антитело против ФРН вводят один раз в неделю, один раз в две недели, один раз в три недели, один раз в четыре недели, один раз в пять недель, один раз в шесть недель, один раз в семь недель, один раз в восемь недель, один раз в девять недель, один раз в десять недель, один раз в пятнадцать недель, один раз в двадцать недель, один раз в двадцать пять недель или один раз в двадцать шесть недель. В некоторых воплощениях антагонистическое антитело против ФРН вводят один раз в месяц, один раз в два месяца, один раз в три месяца, один раз в четыре месяца, один раз в пять месяцев или один раз в шесть месяцев.

Облегчение боли или облегчение при симптомах со стороны нижних мочевыводящих путей может быть охарактеризовано временным периодом облегчения. Соответственно, в некоторых воплощениях облегчение наблюдается в течение приблизительно 24 часов после введения антагонистического антитела против ФРН. В других воплощениях облегчение наблюдается в течение приблизительно 36, 48, 60, 72 часов или 4 дней после введения антагонистического антитела против ФРН. В некоторых воплощениях частота и/или интенсивность боли и/или симптома со стороны нижних мочевыводящих путей уменьшается, и/или улучшается качество жизни страдающих указанным заболеванием. В некоторых воплощениях обеспечивается облегчение боли в течение периода продолжительностью по меньшей мере приблизительно 7 дней, по меньшей мере приблизительно 14 дней, по меньшей мере приблизительно 21 дней, по меньшей мере приблизительно 28 дней, по меньшей мере приблизительно 35 дней, по меньшей мере приблизительно 42 дней, по меньшей мере приблизительно 49 дней, по меньшей мере приблизительно 56 дней, по меньшей мере приблизительно 63 дней, по меньшей мере приблизительно 70 дней, по меньшей мере приблизительно 77 дней, по меньшей мере приблизительно 84 дней, по меньшей мере приблизительно 180 или более дней после однократной дозы антагонистического антитела против ФРН.

Облегчение боли или облегчение при симптомах со стороны нижних мочевыводящих путей может быть охарактеризовано изменением в числовой оценочной шкале боли (NRS, numerical rating scale), изменением в показателе выраженности симптомов интерстициального цистита O'Leary-Sant (ICSI, Interstitial Cystitis Symptom Index), изменением в показателе проблемности интерстициального цистита (ICPI) O'Leary-Sant, изменением тазовой боли и изменением в показателе пиковой скорости (по шкале симптомов неотложности/частоты) мочеиспускания (PUF), и/или изменениями в переменных признаках процесса мочеиспускания, включая, помимо прочего, частоту мочеиспускания, частоту мочеиспускания в ночное время, частоту эпизодического недержания мочи, средний объем выделения при мочеиспускании, среднюю тяжесть боли при интерстициальном цистите, частоту эпизодов неотложных позывов, среднее число эпизодов нарушения сна, средний показатель боли по болевой шкале, ассоциированной с половой активностью, общую оценку ответа на лечение, оценку пациентом влияния лечения, неудачную попытку лечения, биомаркеры, границы безопасности и/или фармакокинетические характеристики. Биомаркеры могут включать в себя ФРН, гликопротеин-51 (GP-51), антипролиферативный фактор (APF) и HB-эпидермальный фактор роста (HB-EGF).

Примерами анти-ФРН-антител для применения в способах согласно изобретению (в связи с болью и/или симптомами со стороны нижних мочевыводящих путей, ассоциированными с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря) являются антагонистические антитела против ФРН, к числу которых относится любое антитело, которое блокирует, вызывает супрессию или снижает (включая значительное снижение) биологическую активность ФРН, включая низлежащие пути, опосредованные сигнальной системой ФРН, такие как связывание с рецептором и/или получение клеточного ответа на ФРН. Под термином "антагонист" не подразумевается наличие специфического механизма какой бы то ни было биологической активности, и считается, что он безусловно включает в себя и охватывает все возможные фармакологические, физиологические и биохимические взаимодействия с ФРН и его последствия, которые могут быть достигнуты путем варьирования разных и химически дивергентных композиций. В связи с настоящим изобретением должен быть однозначно усвоено, что термин "антагонист" охватывает все идентифицированные ранее термины, названия и функциональные состояния и характеристики, и, в соответствии с этим, в результате действия указанного антагониста ФРН как таковой, биологическая активность ФРН (включая, но не ограничиваясь его способностью участвовать в качестве посредника в любом аспекте в связи с послеоперационной болью) или последствия его биологической активности аннулируются, существенно снижаются или нейтрализуются в любой сколько-нибудь значимой степени. В некоторых воплощениях антагонистическое антитело против ФРН связывается (физически взаимодействует) с ФРН, связывается с рецептором ФРН (таким как рецептор trkA и/или рецептор p75) и/или ослабляет (задерживает и/или блокирует) низлежащие пути передачи сигнала от рецептора ФРН. В одном из воплощений антагонистическое антитело против ФРН связывается с ФРН (таким как чФРН) и не не связывается в значительной мере с родственным нейротрофинами, такими как NT-3, NT4/5 и/или BDNF. В некоторых других аспектах анти-ФРН-антитело является гуманизированным (таким, как описанное здесь антитело E3). В некоторых воплощениях анти-ФРН-антитело является (как здесь описано) антителом E3. В других воплощениях анти-ФРН-антитело содержит одну или более областей CDR антитела E3 (например, одну, две, три, четыре или, в некоторых воплощениях, все шесть областей CDR из E3). В других воплощениях указанное антитело является человеческим. В некоторых других аспектах анти-ФРН-антитело содержит аминокислотную последовательность вариабельной области тяжелой цепи, представленную в SEQ ID NO: 1 (фиг.1A в международной заявке WO 2004/058184), и/или последовательность вариабельной области тяжелой цепи, представленную в SEQ ID NO: 2 (Figure 1B в международной заявке WO 2004/058184). В некоторых других аспектах указанное антитело содержит модифицированную константную область, такую как константная область, которая является иммунологически инертной, например, не является триггером опосредованного комплементом лизиса, или которая не стимулирует антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC). В других воплощениях константная область является модифицированной, как описано в публикациях Eur. J. Immunol. (1999) 29:2613-2624; PCT WO 9958572.

Антитела для применения в способах согласно изобретению характеризуются любыми (одной или более) из следующих характеристик: (a) способностью связываться с ФРН; (b) способностью ослаблять и/или ингибировать биологическую активность ФРН и/или низлежащий путь (пути), опосредованный сигнальной системой ФРН; (c) способностью к ослаблению и/или ингибированию ФРН-зависимой выживаемости тригеминальных нейронов мыши E13.5; (d) отсутствие сколько-нибудь значительной перекрестной реактивности с NT3, NT4/5 и/или BDNF; (e) способностью к лечению и/или предотвращению боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря; (f) способностью повышать клиренс ФРН; (g) способностью к ослаблению и/или ингибированию активации рецептора trkA, как было обнаружено, например, с помощью анализа активации рецептора киназы (KIRA) (см. патент США № 6027927).

Согласно настоящему изобретению указанное антитело реагирует с ФРН таким образом, что ингибирует ФРН и/или низлежащие пути, опосредованные функцией сигнальной системы ФРН. В некоторых воплощениях антагонистическое антитело против ФРН распознает человеческий ФРН. В других воплощениях антагонистическое антитело против ФРН специфически связывается с человеческим ФРН. В одном из воплощений антагонистическое антитело против ФРН не имеет значительного сродства к нейротрофинам, таким как NT-3, NT4/5 и/или BDNF. В некоторых других воплощениях анти-ФРН-антитело способно связываться с ФРН и эффективно ингибировать связывание ФРН с его рецептором TrkA и/или p75 in vivo и/или эффективно ингибировать связывание ФРН с его рецептором TrkA и/или p75, предотвращая активацию его рецептора. В некоторых других аспектах антагонистическое антитело против ФРН является моноклональным антителом. В некоторых других аспектах антагонистическое антитело против ФРН является гуманизированным (таким как описанное здесь антитело E3). В некоторых воплощениях анти-ФРН-антитело является антителом человека. См., например, WO 2005/019266, где описаны антитела 4D4, 14D10, 6G9, 7H2, 14F11 и 4G6. В одном из воплощений указанное антитело является человеческим антителом, которое распознает один или более эпитопов на человеческом ФРН. В другом воплощении указанное антитело является мышиным или крысиным антителом, которое распознает один или более эпитопов на человеческом ФРН. В другом воплощении указанное антитело распознает один или более эпитопов на ФРН, выбранных из группы, состоящей из примата, собаки, кошки, лошади и быка. В других дополнительных воплощениях антагонистическое антитело против ФРН связывается в основном с тем же самым эпитопом ФРН, что и антитело, выбранное из любого одного или более из следующих антител: MAb 911, MAb 912 и MAb 938 (см. Hongo, et al., Hybridoma 19:215-227 (2000)); антитело, определяемое в настоящем описании (такое как антитело E3); и/или антитело, описанное в международной заявке WO20050019266 (включая антитела 4D4, 14D10, 6G9, 7H2, 14F11 и 4G6) или WO2006131951 (включая антитело Hu-αD11). В других воплощениях указанное антитело связывается с тем же самым эпитопом, что и антитело Mab 911. В другом воплощении указанное антитело содержит константную область, которая является иммунологически инертной (которая, например, не является триггером опосредованного комплементом лизиса или антитело-зависимой клеточно-опосредованной цитотоксичности (ADCC)). Активность ADCC может быть установлена с помощью методов, описанных в патенте США № 5500362. В некоторых воплощениях константная область является модифицированной, как описано в публикациях Eur. J. Immunol. (1999) 29:2613-2624; PCT WO9958752.

В некоторых воплощениях антагонистическое антитело против ФРН является гуманизированным мышиным моноклональным антителом против ФРН, обозначаемым как "E3", или любым из описанных здесь антител, родственных антителу E3, или любым их фрагментом.

Связывающие свойства антитела E3, которое связывает ФРН с высокой аффинностью и медленной кинетикой диссоциации по сравнению с родительским мышиным моноклональным анти-ФРН-антителом 911, суммированы ниже. E3 связывается с человеческим ФРН с аффинностью связывания, которая в приблизительно 50 раз выше, чем аффинность связывания родительского мышиного антитела 911.

Антитело kD Koff Kon
911 (Fab) 3,7 нМ 9×10-5 с-1 2,2×104 M-1·с-1
E3 (Fab) 0,07 нМ <4×10-5 с-1 6×105 M-1·с-1

Антитело E3 и родственные антитела также проявляют сильную антагонистическую активность в отношении человеческого ФРН, что было установлено в анализах in vitro, описанных в примерах 2 и 3 международной заявки WO 2004/058184, содержание которой включено в настоящее описание в виде ссылки. Например, антитело E3 проявляет антагонистическую активность в отношении ФРН-зависимой выживаемости тригеминальных нейронов мыши E13 с IC50, составляющей приблизительно 21 пМ в присутствии 15 пМ человеческого ФРН, и приблизительно 1,2 пМ в присутствии 1,5 пМ человеческого ФРН.

Соответственно, в другом аспекте антитела и полипептиды согласно изобретению могут быть дополнительно идентифицированы и охарактеризованы посредством (h) высокой аффинности связывания с человеческим ФРН с низкой кинетикой диссоциации (в некоторых воплощениях с KD менее приблизительно 2 нМ, и/или с koff медленнее приблизительно 6×10-5 с-1) и/или (i) способности ингибировать (блокировать) ФРН-зависимую выживаемость тригеминальных нейронов мыши E13.5 с IC50, составляющей приблизительно 100 пМ или менее при приблизительно 15 пМ ФРН (в некоторых воплощениях человеческого ФРН) и/или с IC50, составляющей приблизительно 20 пМ или менее при приблизительно 1,5 пМ ФРН.

Антитела, применимые в настоящем изобретении, могут охватывать моноклональные антитела, фрагменты антитела (например, Fab, Fab', F(ab')2, Fv, Fc и т.д.), химерые антитела, биспецифические антитела, гетеросопряженные антитела, одноцепочечные антитела (ScFv), их мутанты, слитые белки, содержащие часть антитела, гуманизированные антитела, человеческие антитела и любую другую модифицированную конфигурацию иммуноглобулиновой молекулы, которая содержит сайт распознавания антигена требуемой специфичности, включая варианты гликозилирования антител, варианты аминокислотных последовательностей антител и ковалентно модифицированные антитела. Антитела могут быть мышиными, крысиными, человеческими или же любой другой природы (включая химерные или гуманизированные антитела).

В некоторых воплощениях в настоящем изобретении используется антитело, содержащее легкую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита ATCC № PTA-4893 или ATCC № PTA-4894. В другом аспекте антитело содержит тяжелую цепь, которая кодируется полинуклеотидом, который продуцируется клеткой-хозяином с номером депозита ATCC № PTA-4895. В настоящем изобретении используются также различные композиции E3 и эквивалентных фрагментов антитела (например, Fab, Fab', F(ab')2, Fv, Fc и т.д.), одноцепочечные антитела (ScFv), их мутанты, слитые белки, содержащие часть антитела, и любая другая модифицированная конфигурация E3, которая содержит сайт распознавания антигена (ФРН) требуемой специфичности. Антитела, эквивалентные E3, которые включают в себя антитело и полипептидные фрагменты (которые могут быть антителами или могут не быть антителами) E3 и полипептиды, содержащие полипептидные фрагменты E3, идентифицированы и охарактеризованы любым (одним или более) из описанных выше критериев.

Соответственно, в настоящем изобретении используется любое из нижеперечисленного или же композиции (включая фармацевтические композиции), содержащие любое из нижеперечисленного: (a) антитело E3; (b) фрагмент или область антитела E3; (c) легкую цепь антитела E3, приведенную в SEQ ID NO: 17 (фиг.1B в международной заявке WO 2004/058184); (c) тяжелую цепь антитела E3, приведенную в SEQ ID NO: 16 (фиг.1A в международной заявке WO 2004/058184); (d) одну или более вариабельных областей из легкой цепи и/или тяжелой цепи антитела E3; (e) одну или более областей CDR (одну, две, три, четыре, пять или шесть областей CDR) антитела E3, приведенных в SEQ ID NO: 3-8 (фиг.1A и 1B в международной заявке WO 2004/058184); (f) область CDR H3 из тяжелой цепи антитела E3, представленную в SEQ ID NO: 5 (фиг.1A в международной заявке WO 2004/058184); (g) область CDR L3 из легкой цепи антитела E3, представленную в SEQ ID NO: 8 (фиг.1B в международной заявке WO 2004/058184); (h) три области CDR из легкой цепи антитела E3, представленные в SEQ ID NO: 6-8 (фиг.1B в международной заявке WO 2004/058184); (i) три области CDR из тяжелой цепи антитела E3, представленные в SEQ ID NO: 3-5 (фиг.1A в международной заявке WO 2004/058184); (j) три области CDR из легкой цепи и три области CDR из тяжелой цепи антитела E3, представленные в SEQ ID NO: 3-8 (фиг.1A и 1B в международной заявке WO 2004/058184); и (k) антитело, содержащее любой один из объектов, перечисленных в подпунктах (b)-(j). Области CDR антитела E3 (включая CDR Чата и Кабат) представлены в виде диаграммы на фиг.1A и 1B в международной заявке WO 2004/058184) и состоят из следующих аминокислотных последовательностей:

(a) тяжелой цепи CDR1 ("CDR H1") GFSLIGYDLN (SEQ ID NO: 3);

(b) тяжелой цепи CDR2 ("CDR H2") IIWGDGTTDYNSAVKS (SEQ ID NO: 4);

(C) тяжелой цепи CDR3 ("CDR H3") GGYWYATSYYFDY (SEQ ID NO: 5);

(d) легкой цепи CDR1 ("CDR L1") RASQSISNNLN (SEQ ID NO: 6);

(e) легкой цепи CDR2 ("CDR L2") YTSRFHS (SEQ ID NO: 7); и

(f) легкой цепи CDR3 ("CDR L3") QQEHTLPYT (SEQ ID NO: 8).

Определение областей CDR хорошо известно специалистам в данной области. Следует иметь в виду, что в некоторых воплощениях области CDR могут представлять собой комбинацию областей CDR Чата и Кабат (называемых также "комбинированными CDR" или "удлиненными CDR"). В некоторых воплощениях области CDR содержат области CDR по Кабату. В других воплощениях области CDR содержат области CDR по Чату.

В некоторых воплощениях антитело содержит по меньшей мере одну область CDR, которая существенно гомологична по меньшей мере одной области CDR, по меньшей мере двум, по меньшей мере трем, по меньшей мере четырем, по меньшей мере пяти областям CDR антитела E3 (или, в некоторых воплощениях, существенно гомологична всем 6 областям антитела E3, или же получена из E3). Другие воплощения включают в себя антитела, которые имеют по меньшей мере две, три, четыре, пять или шесть областей CDR, которые существенно гомологичны по меньшей мере двум, по меньшей мере трем, по меньшей мере четырем, по меньшей мере пяти или по меньшей мере шести областям CDR антитела E3 или областям CDR, полученным из антитела E3. Следует иметь в виду, что в настоящем изобретении специфичность связывания и/или совокупная активность (которая может быть выражена в терминах лечения и/или предотвращения боли или ингибирования ФРН-зависимой выживаемости тригеминальных нейронов мыши E13.5) обычно сохраняется, хотя уровень активности может варьировать по сравнению с E3 (может быть выше или ниже).

В некоторых воплощениях антитело может содержать аминокислотную последовательность антитела E3, которая имеет любой из следующих вариантов: по меньшей мере 5 смежных аминокислот, по меньшей мере 8 смежных аминокислот, по меньшей мере приблизительно 10 смежных аминокислот, по меньшей мере приблизительно 15 смежных аминокислот, по меньшей мере приблизительно 20 смежных аминокислот, по меньшей мере приблизительно 25 смежных аминокислот, по меньшей мере приблизительно 30 смежных аминокислот последовательности антитела E3, в которой по меньшей мере 3 аминокислоты происходят из вариабельной области антитела E3. Удлиненные CDR-последовательности моноклонального антитела Mab 911 представлены на фиг.1A и 1B международной заявки WO 2004/058184, а также здесь в последовательностях SEQ ID NO: 9-14. В одном из аспектов вариабельная область происходит из легкой цепи антитела E3. В другом воплощении вариабельная область происходит из тяжелой цепи антитела E3. В другом воплощении 5 (или более) смежных аминокислот происходит из определяющей комплементарность области (CDR) антитела E3, представленной в SEQ ID NO: 3-8 (фиг.1A и 1B в международной заявке WO 2004/058184).

В другом воплощении указанное антитело содержит аминокислотную последовательность антитела E3, которая имеет любой из следующих вариантов: по меньшей мере 5 смежных аминокислот, по меньшей мере 8 смежных аминокислот, по меньшей мере приблизительно 10 смежных аминокислот, по меньшей мере приблизительно 15 смежных аминокислот, по меньшей мере приблизительно 20 смежных аминокислот, по меньшей мере приблизительно 25 смежных аминокислот, по меньшей мере приблизительно 30 смежных аминокислот последовательности антитела E3, при этом последовательность E3 содержит любой один или более из следующих вариантов: аминокислотный остаток L29 области CDR H1, I50 области CDR H2, W101 области CDR H3 и/или A103 области CDR H3; и/или аминокислотный остаток S28 области CDR L1, N32 области CDR L1, T51 области CDR L2, 91E области CDR L3 и/или H92 области CDR L3.

Как очевидно из настоящего описания, используемая здесь схема нумерации последовательности аминокислотных остатков обычно относится к аминокислотным остаткам в вариабельных областях (то есть аминокислотные остатки в каждой вариабельной области пронумерованы в последовательность). Как хорошо известно в данной области, системы нумерации Кабат и/или Чата используются при сравнении двух антител или полипептидов, таких как антитело E3 и вариант E3 (или полипептидов, являющихся, по предположению, вариантом E3). Специалистам в данной области известно, как, в случае необходимости, конвертировать нумерацию последовательности в нумерацию Чата и/или Кабат, например, для использования при сравнении E3 и другого полипептида. На фиг.23 международной заявки WO 2004/058184 приведены вариабельные области E3, последовательности которых пронумерованы в соответствии с нумерацией Чата и Кабат. Кроме того, для облегчения сравнения обычно подразумевается, что обычно, хоть и не всегда, остатки в рамке считывания имеют приблизительно одинаковый номер. Однако области CDR могут варьировать по размеру (то есть они могут иметь вставки и/или делеции одного или более аминокислотных остатков). При сравнении антитела E3 и антитела-кандидата в качестве варианта E3 (например, в случае области CDR из последовательности-кандидата, которая длиннее в последовательности антитела E3, по отношению к которой проводят выравнивание), можно придерживаться следующих стадий (хотя в данной области известны и другие способы). Проводят выравнивание последовательности антитела-кандидата с вариабельными областями тяжелой цепи и легкой цепи антитела E3. Выравнивание может производиться вручную или же на компьютере с использованием общепринятых компьютерных программ. Выравнивание можно облегчить, используя некоторые аминокислотные остатки, которые являются общими для всех Fab-последовательностей. Например, каждая из легких цепей и тяжелых цепей обычно содержит два цистеина, которые часто находятся в консервативном положении. Понятно, что аминокислотная последовательность варианта-кандидата антитела может быть длиннее (т.е. иметь встроенные аминокислотные остатки) или короче (иметь исключенные аминокислотные остатки). К номеру остатка может быть добавлен нижний индекс, указывая на то, что встроены дополнительные остатки, например, остаток 34 abc. Для последовательностей-кандидатов, которые, например, выравнивают с последовательностью E3, например, по остаткам 33 и 35, но которые не содержат между ними остатка для выравнивания с остатком 35, остаток 35 просто исключают из рассмотрения. При другом подходе при сравнении областей CDR различной длины обычно хорошо известно, что сравнение может проводиться между структурно эквивалентными (например, занимающими одно и то же положение в комплексе антиген-антитело) аминокислотами. Например, в нумерации Чата (Al-Lazikani et al, выше) обычно (но не во всех случаях) вставки и делеции помещают в структурно корректные положения. Структурная эквивалентность также может быть выведена дедуктивно или продемонстрирована с помощью кристаллографии рентгеновских лучей или циклического анализа двойных мутантов (см. Pons et al. (1999) Prot. Sci. 8:958-968).

Аффинность связывания анти-ФРН-антитела с ФРН (таким как чФРН) может, в терминах KD, составлять от приблизительно 0,10 до приблизительно 0,80 нМ, от приблизительно 0,15 до приблизительно 0,75 нМ и от приблизительно 0,18 до приблизительно 0,72 нМ. В некоторых воплощениях KD составляет приблизительно 2 пМ, приблизительно 5 пМ, приблизительно 10 пМ, приблизительно 15 пМ, приблизительно 20 пМ, приблизительно 40 пМ или более приблизительно 40 пМ. В одном из аспектов KD составляет от приблизительно 2 пМ до 22 пМ. В других воплощениях KD составляет менее приблизительно 10 нМ, приблизительно 5 нМ, приблизительно 4 нМ, приблизительно 3,5 нМ, приблизительно 3 нМ, приблизительно 2,5 нМ, приблизительно 2 нМ, приблизительно 1,5 нМ, приблизительно 1 нМ, приблизительно 900 пМ, приблизительно 800 пМ, приблизительно 700 пМ, приблизительно 600 пМ, приблизительно 500 пМ, приблизительно 400 пМ, приблизительно 300 пМ, приблизительно 200 пМ, приблизительно 150 пМ, приблизительно 100 пМ, приблизительно 90 пМ, приблизительно 80 пМ, приблизительно 70 пМ, приблизительно 60 пМ, приблизительно 50 пМ, приблизительно 40 пМ, приблизительно 30 пМ, приблизительно 10 пМ, приблизительно 5 пМ. В некоторых воплощениях KD составляет приблизительно 10 нМ. В других воплощениях KD составляет менее приблизительно 10 нМ. В других воплощениях KD составляет приблизительно 0,1 нМ или приблизительно 0,07 нМ. В других воплощениях KD составляет менее приблизительно 0,1 нМ или менее приблизительно 0,07 нМ. В других воплощениях KD представляет собой какое-либо из следующих значений, составляющих приблизительно 10 нМ, приблизительно 5 нМ, приблизительно 4 нМ, приблизительно 3,5 нМ, приблизительно 3 нМ, приблизительно 2,5 нМ, приблизительно 2 нМ, приблизительно 1,5 нМ, приблизительно 1 нМ, приблизительно 900 пМ, приблизительно 800 пМ, приблизительно 700 пМ, приблизительно 600 пМ, приблизительно 500 пМ, приблизительно 400 пМ, приблизительно 300 пМ, приблизительно 200 пМ, приблизительно 150 пМ, приблизительно 100 пМ, приблизительно 90 пМ, приблизительно 80 пМ, приблизительно 70 пМ, приблизительно 60 пМ, приблизительно 50 пМ, приблизительно 40 пМ, приблизительно 30 пМ, приблизительно 10 пМ, до какого-нибудь из значений, составляющих приблизительно 2 пМ, приблизительно 5 пМ, приблизительно 10 пМ, приблизительно 15 пМ, приблизительно 20 пМ или приблизительно 40 пМ. В некоторых воплощениях KD представляет собой какое-либо из следующих значений, составляющих приблизительно 10 нМ, приблизительно 5 нМ, приблизительно 4 нМ, приблизительно 3,5 нМ, приблизительно 3 нМ, приблизительно 2,5 нМ, приблизительно 2 нМ, приблизительно 1,5 нМ, приблизительно 1 нМ, приблизительно 900 пМ, приблизительно 800 пМ, приблизительно 700 пМ, приблизительно 600 пМ, приблизительно 500 пМ, приблизительно 400 пМ, приблизительно 300 пМ, приблизительно 200 пМ, приблизительно 150 пМ, приблизительно 100 пМ, приблизительно 90 пМ, приблизительно 80 пМ, приблизительно 70 пМ, приблизительно 60 пМ, приблизительно 50 пМ, приблизительно 40 пМ, приблизительно 30 пМ, приблизительно 10 пМ. В некоторых других аспектах KD составляет приблизительно 2 пМ, приблизительно 5 пМ, приблизительно 10 пМ, приблизительно 15 пМ, приблизительно 20 пМ, приблизительно 40 пМ или более приблизительно 40 пМ.

Аффинность связывания антитела против ФРН может быть определена с помощью методов, хорошо известных в данной области. Одним из путей определения аффинности связывания антител с ФРН является измерение аффинности связывания монофункциональных Fab-фрагментов этого антитела. Для получения монофункциональных Fab-фрагментов антитело (например, IgG) можно расщепить папином или экспрессировать рекомбинантным путем. Аффинность Fab-фрагмента антитела против ФРН может быть определена методом поверхностного плазмонного резонанса (система BIAcore3000TM поверхностного плазмонного резонанса (SPR), BIAcore, INC, Piscaway NJ). Чипы CM5 могут быть активированы N-этил-N'-(3-диметиламинопропил)-карбодиимидгидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) в соответствии с прилагаемыми инструкциями. Человеческий ФРН (или любой другой ФРН) может быть разбавлен 10 мМ ацетатом натрия, pH 4,0, и инъецирован поверх активированного чипа в концентрации 0,005 мг/мл. Используя варьируемые времена протекания через каналы индивидуального чипа, можно достичь двух областей плотности антигена: 100-200 единиц ответа (RU, response units) для подробного изучения кинетики и 500-600 RU для скрининговых исследований. Такой чип можно блокировать этаноламином. Исследования регенерации показали, что смесь буфера для элюции компании Pierce (Продукт № 21004, Pierce Biotechnology, Rockford IL) и 4 M NaCl (2:1) эффективно удаляет связанный Fab, при этом сохраняя активность чФРН на чипе более, чем на период 200 инъекций. Буфер HBS-EP (0,01 M HEPES, pH 7,4, 0,15 NaCl, 3 мМ ЭДТА, 0,005% сурфактанта P29) используют в качестве проточного буфера для BIAcore-анализов. Серийные разведения (KD по подсчету 0,1-10×) очищенных образцов Fab инъецировали в течение 1 мин при 100 мкл/мин, и дозволенные времена диссоциации составляли вплоть до 2 ч. Концентрации белков Fab определяли методом ELISA и/или методом ДСН-ПААГ-электрофореза, используя в качестве стандарта Fab в известной концентрации (определяемой по аминокислотному анализу). Динамические скорости ассоциации (kon) и скорости диссоциации (koff) получали одновременно путем аппроксимации данных к соотношению 1:1 в модели связывания Langmuir (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzymology 6. 99-110) с помощью программы BIAevaluation. Значения константы равновесной диссоциации (KD) вычисляли как koff/kon. Такая методика является подходящей для ее применения при определении аффинности антитела в отношении любого ФРН, включая человеческий ФРН, ФРН другого позвоночного (в некоторых воплощениях, млекопитающего) (такой как ФРН мыши, ФРН крысы, ФРН примата), а также для ее применения в отношении других нейротрофинов, таких как родственные нейротрофины NT3, NT4/5 и/или BDNF.

В некоторых воплощениях указанное антитело связывается с человеческим ФРН, но не связывается в сколько-нибудь значительной степени с ФРН из позвоночных других видов (в некотором воплощении, из млекопитающего). В некоторых воплощениях указанное антитело связывается с человеческим ФРН, а также с одним или более ФРН из позвоночных других видов (в некоторых воплощениях, из млекопитающего). В некоторых других аспектах указанное антитело связывается с ФРН, но не проявляет сколько-нибудь значительной перекрестной реакции с другими нейротрофинами (такими как родственные нейротрофины, NT3, NT4/5 и/или BDNF). В некоторых воплощениях указанное антитело связывается с ФРН, а также по меньшей мере с еще одним другим нейротрофином. В некоторых воплощениях указанное антитело связывается с ФРН некоторых видов млекопитающих, таких как лошадь или собака, но не обнаруживает существенного связывания с ФРН из других видов млекопитающих.

Эпитоп(эпитопы) может быть непрерывным или дискретным. В одном из аспектов указанное антитело в основном связывается с теми же самыми эпитопами человеческого ФРН, что и антитело, выбранное из группы, состоящей из MAb 911, MAb 912 и MAb 938, как описано у Hongo et al., Hybridoma, 19:215-227 (2000); антитело, определяемое в настоящем описании (такое как антитело E3); и/или антитело, описанное в международных заявках WO 2005019266 (включая антитела 4D4, 14D10, 6G9, 7H2, 14F11 и 4G6) или WO 2006131951 (включая антитело Hu-αD11), содержание которых в полном объеме включено в настоящее описание в виде ссылок. В другом воплощении указанное антитело в основном связывается с тем же самым эпитопом чФРН, что и MAb 911. Еще в одном воплощении указанное антитело в основном связывается с тем же самым эпитопом чФРН, что и MAb 909. Hongo et al., выше. Например, эпитоп может содержать один или более из следующих остатков: остатки K32, K34 и E35 в пределах вариабельной области 1 (аминокислоты 23-35) человеческого ФРН (чФРН); остатки F79 и T81 в пределах вариабельной области 4 (аминокислоты 81-88) чФРН; остатки H84 и K88 в пределах вариабельной области 4; остаток R103 между вариабельной областью 5 (аминокислоты 94-98) чФРН и C-концом (аминокислоты 111-118) чФРН; остаток E11 в пределах пре-вариабельной области 1 (аминокислоты 10-23) чФРН; Y52 между вариабельной областью 2 (аминокислоты 40-49) чФРН и вариабельной областью 3 (аминокислоты 59-66) чФРН; остатки L112 и S113 в пределах C-концевого участка чФРН; остатки R59 и R69 в пределах вариабельной области 3 чФРН; или остатки V18, V20 и G23 в пределах пре-вариабельной области 1 чФРН. Кроме того, эпитоп может содержать одно или более из следующего: вариабельную область 1, вариабельную область 3, вариабельную область 4, вариабельную область 5, N-концевую область и/или C-концевую область чФРН. В еще одном воплощении указанное антитело значительно снижает доступность остатка R103 чФРН для растворителя. Очевидно, что несмотря на то, что описанные выше эпитопы родственны человеческому ФРН, специалисту в данной области под силу провести выравнивание человеческого ФРН с ФРН из другого вида и идентифицировать эквиваленты, соответствующие этим эпитопам.

В некоторых воплощениях указанные антитела для применения в настоящем изобретении могут ингибировать (тормозить и/или блокировать) зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 15 пМ ФРН), приблизительно имеющей одно из следующих значений: 200 пМ, 150 пМ, 100 пМ, 80 пМ, 60 пМ, 40 пМ, 20 пМ, 10 пМ или менее. В некоторых воплощениях указанные антитела или пептиды согласно изобретению могут ингибировать (тормозить и/или блокировать) зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 1,5 пМ ФРН), приблизительно имеющей одно из следующих значений: 50 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ, 2 пМ, 1 пМ или менее. В некоторых воплощениях указанные антитела или пептиды согласно изобретению могут ингибировать (тормозить и/или блокировать) зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 15 пМ ФРН), приблизительно имеющей одно из следующих значений: 150 пМ, 125 пМ, 100 пМ, 80 пМ, 60 пМ, 40 пМ, 30 пМ, 20 пМ, 10 пМ, 5 пМ или менее. В некоторых воплощениях указанные антитела или пептиды согласно изобретению могут ингибировать (тормозить и/или блокировать) зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши E13.5 с IC50 (в присутствии приблизительно 1,5 пМ ФРН), приблизительно имеющей одно из следующих значений: 30 пМ, 25 пМ, 20 пМ, 15 пМ, 10 пМ, 5 пМ, 4 пМ, 3 пМ, 2 пМ, 1 пМ или менее. Способы измерения ФРН-зависимой выживаемости тригеминальных нейронов мыши E13 известны в данной области и описаны, например, в примере 2 в международной заявке WO 2004/058184.

Идентификация антагонистических антител против ФРН

Антагонистические антитела против ФРН для их применения в настоящем изобретении могут быть идентифицированы или охарактеризованы с помощью известных в данной области методов, с помощью которых осуществляют детектирование и/или измерение снижения, улучшения или нейтрализации биологической активности ФРН. Можно использовать способы, описанные в заявке PCT WO 04/065560. Другой способ, например, анализ активации рецептора киназы (KIRA), описанный в патентах США №№ 5766863 и 5891650, может быть использован для идентификации средств против ФНО. Такой анализ, подобный ELISA, подходит для качественного или количественного определения активации киназы путем измерения аутофосфорилирования киназного домена рецепторной протеин-тирозинкиназы (в дальнейшем "rPTK"), например, рецептора TrkA, а также для идентификации и характеристики потенциальных антагонистов селективной rPTK, например, TrkA. Первая стадия анализа включает в себя фосфорилирование киназного домена киназного рецептора, например, рецептора TrkA, где указанный рецептор присутствует в клеточной мембране эукариотической клетки.

Указанный рецептор может быть эндогенным рецептором, или же нуклеиновая кислота, кодирующая указанный рецептор или рецепторный конструкт, может быть трансформирована в клетку. Обычно первую твердую фазу (например, лунку планшета в анализе на первой фазе) покрывают существенно гомогенной популяцией таких клеток (обычно линией клеток млекопитающего), так, чтобы указанные клетки прилипали к твердой фазе. Часто такие клетки являются прилипающими (адгезивными) клетками и поэтому естественным образом прилипают к первой твердой фазе. Если используется "рецепторный конструкт", он обычно содержит слияние киназного рецептора и полипептидной метки. Полипептидная метка распознается захватывающим агентом, часто захватывающим антителом, в той части анализа, которая связана с ELISA. Затем анализируемый материал, кандидат в антагонисты ФРН (включая антагонистическое антитело против ФРН), добавляют вместе с ФРН в лунки, содержащие прилипающие клетки, таким образом, чтобы тирозинкиназный рецептор (например, рецептор TrkA) был доступен ФРН и анализируемому материалу (или контактировал с ним). Такой анализ позволяет идентифицировать антагонисты (включая антитела), которые ингибируют активацию TrkA посредством их лиганда ФРН. После совместного экспонирования ФРН и анализируемого материала прилипающие клетки солюбилизировали, используя лизисный буфер (который содержит солюбилизирующий детергент), и осторожно перемешивали, высвобождая таким образом клеточный лизат, который напрямую, без необходимости концентрирования или очистки клеточного лизата, может быть подвергнут той части анализа, которая связана с ELISA.

Приготовленный таким образом клеточный лизат готов к тому, чтобы быть подвергнутым дальнейшей стадии анализа методом ELISA. Также как и на первом этапе стадии ELISA, вторую твердую фазу (обычно лунку микротитрационного планшета ELISA) покрывают захватывающим агентом (часто захватывающим антителом), который специфически связывается с тирозинкиназным рецептором или, в случае рецепторного конструкта, с полипептидной меткой. Покрытие второй твердой фазы производят таким образом, чтобы происходила адгезия захватывающего агента на второй твердой фазе. Указанным захватывающим агентом обычно является моноклональное антитело, но, как описано здесь в примерах, могут быть использованы также и поликлональные антитела.

Приготовленный таким образом клеточный лизат подвергают действию адгезивного захватывающего агента или приводят в контакт с таким агентом, таким образом, чтобы происходила адгезия (или захват) рецептора или рецепторного конструкта на второй твердой фазе. Затем производят стадию промывания, таким образом, чтобы удалить несвязанный клеточный лизат, оставляя захваченный рецептор или рецепторный конструкт. Затем прилипший или захваченный рецептор или рецепторный конструкт подвергают действию анти-фосфотирозинового антитела, или приводят в контакт с таким антителом, которое идентифицирует фосфорилированные остатки тирозина в тирозинкиназном рецепторе. В одном из аспектов указанное антифосфотирозиновое антитело подвергают конъюгации (непосредственной или непрямой) с ферментом, который катализирует изменение цвета нерадиоактивного цветного реагента. Соответственно, фосфорилирование рецептора может быть измерено по последующему изменению цвета указанного реагента. Указанный фермент может быть связан с анти-фосфотирозиновым антителом напрямую, или же конъюгирующая молекула (например, биотин) может быть конъюгирована с анти-фосфотирозиновым антителом, и затем указанный фермент может быть связан с анти-фосфотирозиновым антителом посредством конъюгирующей молекулы. Наконец, измеряют связывание антифосфотирозинового антитела с захваченным рецептором или рецепторным конструктом, например, по изменению цвета цветного реагента.

Антагонистические антитела против ФРН можно идентифицировать путем инкубации агента-кандидата с ФРН и мониторинга любой одной или более из следующих характеристик: (a) связывания с ФРН и ингибирования биологической активности ФРН или низлежащих путей сигнальной функции, опосредованной ФРН; (b) ингибирования, блокирования или снижения активации рецептора ФРН (включая димеризацию и/или аутофосфорилирование TrkA); (c) увеличения клиренса ФРН; (d) лечения или предотвращения любого аспекта боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря; (e) ингибирования (снижения) синтеза, продуцирования или высвобождения ФРН. В некоторых воплощениях антагонист ФРН (например, антагонистическое антитело против ФРН) идентифицируют путем инкубации агента-кандидата с ФРН и мониторинга связывания и/или сопровождающего его снижения или нейтрализации биологической активности ФРН. Анализ связывания может быть предпринят с очищенным полипептидом(полипептидами) ФРН или с клетками, природно экспрессирующими или трансфицированными с той целью, чтобы они экспрессировали полипептид(полипептиды) ФРН. В одном из аспектов анализ связывания представляет собой конкурентный анализ связывания, в котором оценивается способность агента-кандидата (такого как антитело) конкурировать с известным антагонистическим антителом против ФРН за связывание с ФРН. Такой анализ может быть предпринят в различных форматах, включая формат ELISA. В других воплощениях антагонист ФРН (такой как антагонистическое антитело против ФРН) идентифицируют путем инкубации агента-кандидата с ФРН и мониторинга связывания и сопровождающего его ингибирования димеризации и/или аутофосфорилирования рецептора trkA.

После первоначальной идентификации активность кандидата на антагонистическое антитело против ФРН может быть дополнительно подтверждена и уточнена посредством биоанализов, существующих для проверки направленных биологических активностей. Альтернативно, биоанализы могут быть использованы для прямого скрининга указанных кандидатов. Например, ФРН вызывает в чувствительных клетках ряд морфологически распознаваемых изменений. Такие изменения включают в себя, не ограничиваясь перечисленным, стимуляцию дифференцировки клеток PC12 и усиление роста нейритов из указанных клеток (Greene et al., Proc Natl Acad Sci USA. 73(7):2424-8, 1976), стимуляцию прорастания нейритов из эксплантатов чувствительных клеток и симпатических ганглиев (Levi-Montalcini, R. and Angeletti, P. Nerve growth factor. Physiol. Rev. 48:534-569, 1968), а также стимуляцию выживаемости ФРН-зависимых нейронов, таких как нейроны эмбриональных ганглиев заднего корешка спинного мозга, тригеминальных ганглиев или симпатических ганглиев (см., например, Chun & Patterson, Dev. Biol. 75:705-711, (1977); Buchman & Davies, Development 118:989-1001 (1993). Таким образом, анализ ингибирования биологической активности ФРН включает в себя культивирование чувствительных к ФРН клеток в присутствии ФРН и анализируемого материала, такого как кандидат-антагонист ФРН (включая антагонистическое антитело против ФРН). Через соответствующий отрезок времени производят анализ клеточного ответа (клеточной дифференцировки, прорастания нейритов или выживаемости клеток).

Способность кандидата-антагонистического антитела против ФРН блокировать или нейтрализовать биологическую активность ФРН также может быть установлена путем мониторинга способности агента-кандидата ингибировать опосредованную ФРН выживаемость эмбриональных ганглиев заднего корешка спинного мозга крыс, как описано у Hongo et al., Hybridoma 19:215-227 (2000).

Антитела для применения в настоящем изобретении могут быть получены с использованием методик, известных в данной области, некоторые из которых проиллюстрированы примерами из международной заявки WO 2004/058184. Указанные антитела могут быть получены путем протеолитического или иного вызывающего деградацию воздействия на антитела, с помощью рекомбинантных технологий (то есть отдельных или слитых полипептидов), как описано в международной заявке WO 2004/058184, или же путем химического синтеза. Полипептиды антител, в частности, более короткие полипептиды, насчитывающие вплоть до приблизительно 50 аминокислот, обычно получают путем химического синтеза. Методы химического синтеза известны в данной области и являются коммерчески доступными. Например, антитело E3 может быть получено с помощью автоматизированного синтезатора полипептидов с использованием твердофазного метода. См. также патенты США №№ 5807715, 4816567 и 6331415. Химерные или гибридные антитела могут быть получены также in vitro с использованием известных методик химического синтеза белков, включая методики, предусматривающие перекрестно-связывающие агенты. Например, иммунотоксины могут быть сконструированы с помощью реакции дисульфидных обменов или путем образования тиоэфирной связи. Примеры подходящих для таких целей реагентов включают в себя иминотиолат и метил-4-меркаптобутиримидат.

В качестве другой альтернативы, указанные антитела могут быть получены рекомбинантным путем с помощью приемов, которые хорошо известны в данной области. В одном из аспектов полинуклеотид, содержащий последовательность, кодирующую вариабельную область и область легкой цепи антитела E3, клонировали в вектор для экспрессии или размножения в клетке-хозяине (например, в клетках CHO). В другом воплощении полипептидные последовательности, представленные на фиг.2 и 3 в международной заявке WO 2004/058184, клонировали в один или более векторов для экспрессии или размножения. Последовательность, кодирующая представляющее интерес антитело, может быть сохранена в составе вектора в клетке-хозяине, и затем клетка-хозяин может быть размножена и подвергнута замораживанию, вплоть до ее дальнейшего использования. Векторы (включая экспрессирующие векторы) и клетки-хозяева описаны здесь дополнительно. Описаны способы экспрессии рекомбинантных антител в растениях и в молоке. См., например, Peeters et al. (2001) Vaccine 19:2756; Lonberg, N. and D. Huszar (1995) Int. Rev. Immunol 13:65; а также Pollock et al. (1999) J Immunol Methods 231:147. Способы получения производных антител, например, гуманизированных, одноцепочечных и т.д., хорошо известны в данной области.

Настоящее изобретение охватывает также одноцепочечные фрагменты вариабельной области ("scFv") антител согласно изобретению, таких как E3. Одноцепочечные фрагменты вариабельной области получены путем связывания вариабельных областей легкой и/или тяжелой цепей с помощью короткого связывающего пептида. Bird et al. (1988) Science 242:423-426. Примером связывающего пептида является пептид (GGGGS)3 (SEQ ID NO: 15), который образует мостик в приблизительно 3,5 нМ между карбокси-концом одной вариабельной области и амино-концом другой вариабельной области. Созданы и используются линкеры и с другими последовательностями (Bird et al. (1988)). Линкеры могут, в свою очередь, быть модифицированы и для дополнительных функций, таких как прикрепление лекарственных средств или прикрепление к твердым подложкам. Одноцепочечные варианты могут быть получены либо рекомбинантным, либо синтетическим путем. Для получения scFv синтетическим путем может быть использован автоматизированный синтезатор. Для получения scFv рекомбинантным путем можно подходящую плазмиду, содержащую полинуклеотид, который кодирует scFv, ввести в соответствующую клетку-хозяина, либо эукариотическую, такую как дрожжевая, растительная клетка, клетка насекомого или клетка млекопитающего, либо прокариотическую, такую как E. coli. Полинуклеотиды, кодирующие представляющий интерес scFv, могут быть получены рутинными методами, такими как лигирование полинуклеотидов. Полученный в результате scFv может быть выделен в результате использования стандарной технологии очистки белков, известной в данной области.

Здесь охвачены также и другие формы одноцепочечных антител, таких как диатела. Диатела являются двухвалентными биспецифическими антителами, в которых VH- и VL-домены экспрессированы на одной полипептидной цепи, но используется линкер, который является слишком коротким, чтобы возможно было спаривание между указанными двумя доменами на одной и той же цепи, что и вынуждает указанные домены спариваться с комплементарными доменами другой цепи, с образованием двух антиген-связывающих участков (см., например, Holliger, P., et al. (1993) Proc. Natl. Acad Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123).

Указанное антитело может быть биспецифическим антителом, моноклональным антителом, которое обладает специфичностями связывания в отношении по меньшей мере двух разных антигенов. Биспецифическое антитело может быть получено с использованием описанных здесь антител. Способы получения биспецифических антител известны в данной области (см., например, Suresh et al., 1986, Methods in Enzymology 121:210). Традиционно рекомбинантная продукция биспецифических антител была основана на совместной экспрессии двух пар, тяжелая цепь иммуноглобулина - легкая цепь иммуноглобулина, с двумя тяжелыми цепями, имеющими различные специфичности (Millstein and Cuello, 1983, Nature 305, 537-539).

В соответствии с одним из подходов для получения биспецифических антител, вариабельные домены антитела с требуемыми специфичностями связывания (участками связывания антиген-антитело) сливают с последовательностями константного домена иммуноглобулина. Слияние предпочтительно производят с константным доменом тяжелой цепи иммуноглобулина, содержащим по меньшей мере часть шарнирной области, CH2- и CH3-областей. Предпочтительно, чтобы константная область первой тяжелой цепи (CH1) содержала участок, необходимый для связывания легкой цепи, присутствующий по меньшей мере в одном из слияний. ДНК, кодирующие слияния тяжелой цепи иммуноглобулина и, если нужно, легкой цепи иммуноглобулина, встраивают в отдельные экспрессирующие векторы и осуществляют ихко-трансфекцию в организм соответствующего хозяина. Это обеспечивает идеальную гибкость при доведении соответственных взаимных пропорций трех полипептидных фрагментов в тех воплощениях, когда неравные соотношения указанных трех полипептидных цепей, используемые в конструкции, обеспечивают оптимальный выход. Можно, однако, встроить кодирующие последовательности для двух или всех трех полипептидных цепей в один экспрессирующий вектор, когда экспрессия по меньшей мере двух полипептидных цепей в равных отношениях приводит к высокому выходу или когда указанные отношения не имеют особого значения.

В одном из подходов биспецифические антитела составлены из гибридной иммуноглобулиновой тяжелой цепи с первой специфичностью связывания на одном плече, и гибридной иммуноглобулиновой пары тяжелая цепь-легкая цепь (обеспечивающей вторую специфичность связывания) на другом плече. Такая асимметричная структура с легкой цепью иммуноглобулина только в одной половине биспецифической молекулы облегчает отделение требуемого биспецифического соединения от нежелательных комбинаций иммуноглобулиновых цепей. Такой подход описан в публикации PCT № WO 94/04690, опубликованной 3 марта 1994 года.

«Гетероконъюгатные» антитела, содержащие два ковалентно связанных антитела, также входят в объем, охватываемый настоящим изобретением. Такие антитела используются для нацеливания иммунных клеток на нежелательные клетки (патент США № 4676980) и для лечения ВИЧ-инфекции (публикации заявок PCT № WO 91/00360 и WO 92/200373; EP 03089). «Гетероконъюгатные» антитела могут быть сконструированы с помощью любых удобных поперечно-сшивающих методов. Подходящие поперечно-сшивающие агенты и технологии хорошо известны в данной области и описаны в патенте США № 4676980.

Указанное антитело может быть гуманизированным антителом, например, как известно в данной области и как описано в настоящей заявке.

Настоящее изобретение включает в себя модификации антитела E3, включая функционально эквивалентные антитела, которые существенно не влияют на их свойства, и варианты, которые имеют повышенную или пониженную активность. Модификация полипептидов является в данной области рутинной практикой, и она дополнительно проиллюстрирована в примерах. Примеры модифицированных пептидов включают в себя полипептиды с заменами (включая консервативные замены) аминокислотных остатков, с одной или более делециями или добавками аминокислот, которые не вызывают значительных пагубных изменений в функциональной активности, или же полипептиды, полученные с применением химических аналогов.

Здесь "вариант" полипептида является полипептидом, который отличается от нативного белка одной или более заменами, делециями, добавками и/или вставками, такими, чтобы иммунореактивность полипептида не была существенно снижена. Иными словами, способность варианта специфически связывать антиген может быть усилена или может оставаться неизменной по сравнению с нативным белком, или же она может быть уменьшена менее чем на 50%, а предпочтительно, менее чем на 20%, по сравнению с нативным белком. Варианты полипептидов предпочтительно имеют по меньшей мере приблизительно 80%, более предпочтительно, по меньшей мере приблизительно 90%, а наиболее предпочтительно, по меньшей мере приблизительно 95%-ую степень идентичности (определяемую так, как здесь описано) идентифицированным полипептидам.

Варианты аминокислотной последовательности антител могут быть получены путем введения соответственных нуклеотидных замен в ДНК антитела или путем пептидного синтеза. Такие варианты включают в себя, например, делеции и/или вставки, и/или замены остатков в описанных здесь аминокислотных последовательностях SEQ ID NO: 1 или 2. Любую комбинацию из делеции, вставки и замены производят для достижения конечной конструкции, при условии, что конечная конструкция обладает требуемыми характеристиками. Аминокислотные замены изменяют посттрансляционный процессинг антитела, вызывая, например, изменение числа или положения гликозилированных участков.

Эффективный способ идентификации определенных остатков или областей антитела, которые имеют локализацию, предпочтительную для мутагенеза или модификации, называется "мутагенезом аланинового сканирования" и описан Cunningham и Wells, 1989, Science, 244:1081-1085. Идентифицируют остаток или группу остатков-мишеней (например, заряженные остатки, такие как arg, asp, his, lys и glu) и заменяют их нейтральной или отрицательно заряженной аминокислотой (наиболее предпочтительно, аланином или полиаланином), чтобы воздействовать на взаимодействие аминокислот с антигеном. Затем те места локализации аминокислот, которые отражают функциональную чувствительность к заменам, подвергают изменению путем введения дополнительных или других вариантов вблизи или на месте замененных участков. Таким образом, в то время как участок введения измененной аминокислотной последовательности предопределен, нет необходимости в предварительном установлении природы мутации как таковой. Например, для изучения характеристик мутации в положении кодона-мишени или вокруг этого положения проводят мутагенез аланинового сканирования или неспецифический мутагенез, и экспрессируемые варианты антитела подвергают скринингу для подбора искомой активности. Для идентификации в антителе мест локализации, которые являются предпочтительными для мутагенеза или модификации, может быть использован метод мутагенеза сканирования библиотек, как описано выше.

Аминокислотные вставки включают в себя амино- и/или карбокси-концевые слияния, варьирующие по длине от одного остатка до полипептидов, содержащих сотню или более остатков, а также вставки единственного остатка или множества аминокислотных остатков внутри последовательности. Примеры концевых вставок включают в себя антитело с N-концевым метиониновым остатком или антитело, слитое с эпитопной меткой. Другие вставочные варианты молекулы антитела включают в себя слияние фермента или полинуклеотида, который увеличивает время полужизни антитела в сыворотке, с N- или C-концом антитела.

Варианты замены связаны с удалением по меньшей мере одного аминокислотного остатка в молекуле антитела и вставкой на его место различных остатков. Участки, представляющие наибольший интерес для заместительного мутагенеза, включают в себя гипервариабельные участки, но рассматриваются также и изменения в области FR область рамки считывания, или каркасный участок. Консервативные замены приведены в таблице 1 под заголовком "консервативные замены". Если такие замены приводят к изменению биологической активности, тогда могут быть введены более существенные изменения, обозначенные в таблице 1 как "иллюстративные замены" или дополнительно описанные ниже в связи с классами аминокислот, и полученные продукты подвергают скринингу.

Таблица 1
Аминокислотные замены
Исходный остаток Консервативные замены Иллюстративные замены
Ala (A) Val Val; Leu; Ile
Arg (R) Lys Lys; Gln; Asn
Asn (N) Gln Gln; His; Asp, Lys; Arg
Asp (D) Glu Glu; Asn
Cys (C) Ser Ser; Ala
Gln (Q) Asn Asn; Glu
Glu (E) Asp Asp; Gln
Gly (G) Ala Ala
His (H) Arg Asn; Gln; Lys; Arg
Ile (I) Leu Leu; Val; Met; Ala; Phe; норлейцин
Leu (L) Ile Норлейцин; Ile; Val; Met; Ala; Phe
Lys (K) Arg Arg; Gln; Asn
Met (M) Leu Leu; Phe; Ile
Phe (F) Tyr Leu; Val; Ile; Ala; Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Ser Ser
Trp (W) Tyr Tyr; Phe
Tyr (Y) Phe Trp; Phe; Thr; Ser
Val (V) Leu Ile; Leu; Met; Phe; Ala; норлейцин

Существенные модификации в биологических свойствах антитела вызывают путем селекции замен, которые значительно отличаются их влиянием на поддержание (a) структуры остова полипептидной цепи в области замены, например, такой как складчатая структура или спиральная конформация, (b) заряда или гидрофобности молекулы в области участка-мишени или (c) размера боковой цепи. Природно образующиеся остатки делятся на группы на основе общности свойств их боковых цепей:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофобные: Cys, Ser, Thr;

(3) кислотные: Asp, Glu;

(4) основные: Asn, Gln, His, Lys, Arg;

(5) остатки, которые влияют на ориентацию цепи: Gly, Pro; и

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены производятся путем замены члена одного из указанных классов членом из другого класса.

Любой цистеиновый остаток, не участвующий в поддержании характерной конформации антитела, также может быть заменен, обычно серином, для улучшения окислительной стабильности молекулы и предотвращения аберрантного поперечного связывания. И наоборот, цистеиновая связь (связи) может быть добавлена к антителу для улучшения его стабильности, в особенности тогда, когда антитело представляет собой фрагмент антитела, такой как Fv-фрагмент.

Аминокислотные модификации могут колебаться от замены или модификации одного или более аминокислотных остатков до полного реконструирования области, такой как вариабельная область. Изменения в вариабельной области могут изменить аффинность и/или специфичность связывания. В одном из воплощений внутри CDR-домена производят не более чем от одной до пяти консервативных аминокислотных замен. В других воплощениях не более чем от одной до трех консервативных аминокислотных замен производят внутри CDR3-домена. В некоторых других аспектах CDR-домен представляет собой CDR H3 и/или CDR L3.

Модификации включают в себя также гликозилированные и негликозилированные полипептиды, а также полипептиды с другими посттрансляционными модификациями, такими, например, как гликозилирование различными сахарами, ацетилирование и фосфорилирование. Антитела гликозилированы в консервативных положениях их константных областей (Jeffehs and Lund, 1997, Chem. Immunol. 65:111-128; Wright and Morrison, 1997, TibTECH 15:26-32). Олигосахаридные боковые цепи иммуноглобулинов влияют на функцию этих белков (Boyd et al., 1996, Mol. Immunol. 32:1311-1318; Wittwe and Howard, 1990, Biochem. 29:4175-4180) и внутримолекулярное взаимодействие между частями гликопротеина, которое может влиять на конформацию и имеющуюся картину трехмерной поверхности гликопротеина (Heffehs and Lund, выше; Wyss and Wagner, 1996, Current Opin. Biotech. 7:409-416). Олигосахариды могут также служить мишенью в виде данного гликопротеина для определенных молекул на основе структур специфического распознавания. Сообщалось также, что гликозилирование антител влияет на антитело-зависимую клеточную цитотоксичность (ADCC). В частности, сообщалось, что клетки CHO с тетрациклин-регулируемой экспрессией β(1,4)-N-ацетилглюкозаминилтрансферазы III (GnTIII), с катализируемым гликозилтрансферазой гидролизом GlcNAc, обладают улучшенной ADCC-активностью (Umana et al., 1999, Mature Biotech. 17:176-180).

Гликозилирование антител бывает обычно либо N-связанным, либо O-связанным. N-связанное гликозилирование относится к присоединению углеводного фрагмента к боковой цепи аспарагинового остатка. Трипептидные последовательности аспарагин-X-серин и аспарагин-X-треонин, в которых X является любой аминокислотой, за исключением пролина, являются последовательностями, распознаваемыми при ферментативном прикреплении углеводного фрагмента к боковой цепи аспарагина. Таким образом, присутствие в полипептиде любой из указанных трипептидных последовательностей создает потенциальный участок гликозилирования. O-связанное гликозилирование относится к присоединению одного из сахаров, N-ацетилгалактозамина, галактозы или ксилозы, к гидроксиаминокислоте, чаще всего к серину или треонину, хотя могут быть использованы также и 5-гидроксипролин или 5-гидроксилизин.

Добавление к антителу участков гликозилирования удобно производить путем изменения аминокислотной последовательности, так, чтобы она содержала одну или более из описанных выше трипептидных последовательностей (для участков N-связанного гликозилирования). Изменение может быть произведено также путем добавления или замены одного или более сериновых или треониновых остатков в последовательности исходного антитела (для участков O-связанного гликозилирования). Характер гликозилирования антител может быть изменен также и без изменения лежащей в основе нуклеотидной последовательности. Гликозилирование в большой степени зависит от клетки-хозяина, используемой для экспрессии антитела. Поскольку клетки, используемые для экспрессии рекомбинантных гликопротеинов, например, антител, в качестве потенциальных терапевтических средств, редко бывают нативными клетками, можно ожидать появления вариаций в характере гликозилирования антител (см., например, Hse et al., 1997, J. Biol. Chem. 272:9062-9070).

Помимо выбора клеток-хозяев, факторы, которые влияют на гликозилирование в процессе рекомбинантной продукции антител, включают в себя характер роста, состав среды, плотность культуры, оксигенацию, pH, схемы очистки и т.д. Были предложены различные методы для изменения характера гликозилирования, достигаемого в организмах конкретных клеток-хозяев, включая введение или повышенную экспрессию определенных ферментов, участвующих в продуцировании олигосахаридов (патенты США №№ 5047335, 5510261 и 5278299). Гликозилирование, или определенные типы гликозилирования, может быть ферментативным путем удалено из гликопротеина, например, с помощью эндогликозидазы H (Endo H). Кроме того, рекомбинантная клетка-хозяин может быть генетически изменена с помощью генной инженерии таким образом, чтобы она стала дефективной в отношении процессинга полисахаридов определенного типа. Эти и подобные им технологии хорошо известны в данной области.

Другие способы модификации включают в себя применение известной в данной области техники спаривания, включая, но не ограничиваясь ферментативными средствами, окислительным замещением и хелатообразованием. Модификации могут быть использованы, например, для прикрепления меток для иммуноанализа. Модифицированные полипептиды E3 получены с помощью привычных в данной области процедур и могут быть подвергнуты скринингу с использованием стандартных анализов, известных в данной области, некоторые из которых описаны ниже в примерах.

Другие модификации антител связаны с модификациями, описанными в публикации PCT № WO 99/58572, опубликованной 18 ноября 1999 года. Такие антитела содержат, помимо связывающего домена, направленного на молекулу-мишень, эффекторный домен, имеющий аминокислотную последовательность, существенно гомологичную полному константному домену человеческой тяжелой цепи иммуноглобулина или его части. Такие антитела способны связываться с молекулой-мишенью без запуска значительного комплемент-зависимого лизиса или клеточно-опосредованной деструкции мишени. В некоторых воплощениях эффекторный домен способен к специфическому связыванию FcRn и/или FcγRIIb. Это обычно основано на химерных доменах, полученных из двух или более CH2-доменов тяжелой цепи человеческого иммуноглобулина. Полученные таким образом антитела особенно удобны для применения в хронической антителотерапии, что помогает избежать воспаления и других неблагоприятных реакций в ответ на обычно практикуемую антителотерапию.

В данном изобретении используются также слитые белки, содержащие один или более фрагментов или областей из антител или полипептидов согласно изобретению. В одном из аспектов получен слитый полипептид, который содержит по меньшей мере 10 смежных аминокислот вариабельной области легкой цепи, представленных в SEQ ID NO: 2 (фиг.1B в международной заявке WO 2004/058184) и/или по меньшей мере 10 аминокислот вариабельной области тяжелой цепи, представленных в SEQ ID NO: 1 (фиг.1A в международной заявке WO 2004/058184). В другом воплощении слитый полипептид содержит вариабельную область легкой цепи и/или вариабельную область тяжелой цепи антитела E3, как показано в последовательностях SEQ ID NO: 1 и 2 (фиг.1A и 1B в международной заявке WO 2004/058184). В другом воплощении слитый полипептид содержит одну или более областей CDR антитела E3. В некоторых других аспектах слитый полипептид содержит область CDR H3 и/или CDR L3 антитела E3. В другом воплощении слитый полипептид содержит любой один или более из следующих элементов: аминокислотный остаток L29 из области CDR H1, I50 из CDR H2, W101 из CDR H3 и/или A103 из CDR H3; и/или аминокислотный остаток S28 из области CDR L1, N32 из CDR L1, T51 из CDR L2, 91E из CDR L3 и/или H92 из CDR L3. Для целей, связанных с настоящим изобретением, слитый белок E3 содержит один или более антител E3 и другую аминокислотную последовательность, к которой они не прикреплены в нативной молекуле, например, гетерологичную последовательность или гомологичную последовательность из другой области. Примеры гетерологичных последовательностей включают в себя, но не ограничиваются "меткой", такой как метка FLAG или метка 6His. Такие метки хорошо известны в данной области.

Слитый полипептид E3 может быть создан посредством способов, известных в данной области, например, синтетическим или рекомбинантным путями. Обычно слитые белки E3 создают посредством получения экспрессирующего полипептида, кодирующего их в результате использования описанных здесь рекомбинантных методов, хотя они могут быть получены и другими известными в данной области средствами, включая, например, методы химического синтеза.

Такая способность антител и полипептидов согласно изобретению, как связывание ФРН; уменьшение или ингибирование биологической активности ФРН; уменьшение и/или блокирование ФРН-индуцированной выживаемости тригеминальных нейронов мыши E13.5, может быть тестирована с помощью методов, известных в данной области, некоторые из которых описаны в примерах в международной заявке WO 2004/058184, в частности, в примерах 2 и 3 в публикации WO 2004/058184.

В данном изобретении используются также композиции (включая фармацевтические композиции) и наборы, содержащие антитело E3, и, как разъясняется в настоящем описании, любое или все из описанных здесь антител и/или полипептидов. Такие композиции и наборы могут быть полезны для применения при лечении и/или профилактике у индивида одного или более типов боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Полинуклеотиды, векторы и клетки-хозяева

Настоящее изобретение связано также с изолированными полинуклеотидами, кодирующими антитела и полипептиды согласно изобретению (включая антитело, содержащее полипептидные последовательности вариабельных областей легкой цепи и тяжелой цепи, представленных на фиг.1A и 1B в международной заявке WO 2004058184), а также векторы и клетки-хозяева, содержащие указанные полинуклеотиды, для применения в способах согласно изобретению.

Соответственно, указанные полинуклеотиды (или композиции, включая фармацевтические композиции), могут содержать полинуклеотиды, кодирующие любой из следующих элементов: (a) антитело E3; (b) фрагмент или область антитела E3; (c) легкую цепь антитела E3, приведенную в SEQ ID NO: 17 (фиг.1B в международной заявке WO 2004/058184); (d) тяжелую цепь антитела E3, приведенную в SEQ ID NO: 16 (фиг.1A в международной заявке WO 2004/058184); (e) одну или более из вариабельных областей легкой цепи и/или тяжелой цепи антитела E3; (f) одну или более из областей CDR (одну, две, три, четыре, пять или шесть областей CDR) антитела E3, представленных в SEQ ID NO: 3-8 (фиг.1A и 1B в международной заявке WO 2004/058184); (g) область CDR H3 из тяжелой цепи антитела E3, представленную в SEQ ID NO: 5 (фиг.1A в документе WO 2004/058184); (h) область CDR L3 из легкой цепи антитела E3, представленную в SEQ ID NO: 8 (фиг.1B в документе WO 2004/058184); (i) три области CDR из легкой цепи антитела E3, представленные в SEQ ID NO: 6-8 (фиг.1B в документе WO 2004/058184); G) три области CDR из тяжелой цепи антитела E3, представленные в SEQ ID NO: 3-5 (фиг.1A в документе WO 2004/058184); (k) три области CDR из легкой цепи и три области CDR из тяжелой цепи антитела E3, представленные в SEQ ID NO: 3-8 (фиг.1A и 1B в международной заявке WO 2004/058184); или (l) антитело, содержащее любой элемент от (b) до (k). В некоторых воплощениях указанный полинуклеотид содержит какой-либо один или оба полинуклеотида, представленных в SEQ ID NO: 76 и 77 (фиг.2 и 3 в документе WO 2004/058184).

В другом аспекте в настоящем изобретении используется изолированный полинуклеотид, который кодирует легкую цепь антитела E3 с номером депозита ATCC № PTA-4893 или ATCC № PTA-4894. В другом аспекте в настоящем изобретении используется изолированный полинуклеотид, который кодирует тяжелую цепь антитела E3 с номером депозита ATCC № PTA-4895. В еще одном аспекте в настоящем изобретении используется изолированный полинуклеотид, содержащий (a) вариабельную область, кодируемую полинуклеотидом, имеющим номер депозита ATCC № PTA-4894, и (b) вариабельную область, кодируемую полинуклеотидом, имеющим номер депозита ATCC № PTA-4895. В другом аспекте в настоящем изобретении используется изолированный полинуклеотид, содержащий (a) одну или более областей CDR, кодируемых полинуклеотидом, имеющим номер депозита ATCC № PTA-4894; и/или (b) одну или более областей CDR, кодируемых полинуклеотидом, имеющим номер депозита ATCC № PTA-4895. Депозиты в ATCC с номерами доступа № PTA-4893, PTA-4894 и PTA-4895 описаны в международной заявке WO 2004/058184, содержание которой в полном объеме включено в настоящее описание в виде ссылки.

Полинуклеотид, кодирующий любое из описанных здесь антител (включая фрагменты антитела) и полипептидов, могут быть получены способами, известными в данной области.

В другом аспекте настоящее изобретение связано с композициями (такими как фармацевтические композиции), содержащими любой из полинуклеотидов согласно изобретению для применения при лечении или профилактике боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря. В некоторых воплощениях указанная композиция содержит экспрессирующий вектор, содержащий полинуклеотид, кодирующий антитело E3, как описано в настоящей заявке. В другом воплощении указанная композиция содержит экспрессирующий вектор, содержащий полинуклеотид, кодирующий любое из описанных здесь антител или полипептидов. В некоторых других аспектах указанная композиция содержит какой-нибудь один или оба полинуклеотида, приведенных на фиг.2 и 3 в международной заявке WO 2004/058184. Экспрессирующие векторы, а также введение полинуклеотидных композиций описано здесь дополнительно.

В другом аспекте настоящее изобретение связано со способом получения любого из описанных здесь полинуклеотидов для применения в способах лечения или профилактики боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Полинуклеотиды, комплементарные любой такой последовательности, также считаются включенными в объем, охватываемый настоящим изобретением. Полинуклеотиды могут быть одноцепочечными (кодирующая или антисмысловая цепи) или двухцепочечными и могут представлять собой молекулы ДНК (геномную, кДНК или синтетическую) или РНК. Молекулы РНК включают в себя молекулы гяРНК [гетерогенная ядерная РНК], которые содержат интроны и один-в-один соответствуют молекуле ДНК, и молекулы мРНК, которые не содержат интроны. Дополнительные кодирующие или некодирующие последовательности могут, но необязательно, быть представлены в полинуклеотиде согласно изобретению, а сам полинуклеотид может быть, но необязательно, связан с другими молекулами и/или материалом подложки.

Полинуклеотиды могут содержать нативную последовательность (то есть эндогенную последовательность, которая кодирует антитело или его часть) или могут содержать вариант такой последовательности. Полинуклеотидные варианты содержат одну или более замен, добавок, делеций и/или вставок, таких, чтобы иммунореактивность кодируемого полипептида не уменьшалась по сравнению с иммунореактивностью нативной молекулы. Влияние на иммунореактивность кодируемого полипептида обычно может быть установлена, как описано в настоящем документе. Варианты предпочтительно проявляют по меньшей мере приблизительно 70% степень идентичности, более предпочтительно, по меньшей мере приблизительно 80% степень идентичности, и наиболее предпочтительно, по меньшей мере приблизительно 90% степень идентичности полинуклеотидной последовательности, которая кодирует нативное антитело или его часть.

Два полипептида или полипептидных последовательности называются "идентичными", если последовательность нуклеотидов или аминокислот в этих двух последовательностях является одинаковой при выравнивании для максимального соответствия, как описано ниже. Сравнения между двумя последовательностями обычно предпринимают путем сравнения последовательностей в выбранном окне сравнения для идентификации и сравнения локальных областей со сходной последовательностью. Здесь "окно сравнения" относится к сегменту, насчитывающему по меньшей мере приблизительно 20 смежных положений, обычно от 30 до приблизительно 75, от 40 до приблизительно 50, в котором последовательность можно сравнивать со ссылочной (стандартной) последовательностью с одинаковым количеством смежных положений после оптимального выравнивания последовательностей.

Оптимальное выравнивание последовательностей для сравнения может быть проведено с помощью программы Megalign в наборе программ Lasergene программного обеспечения по биоинформатике (DNASTAR, Inc., Madison, Wl), с использованием параметров дефолта. Указанная программа включает в себя несколько схем выравнивания, описанных в следующих публикациях: Dayhoff, M. O. (1978) A model of evolutionary change in proteins - Matrices for detecting distant relationships. Dayhoff, M. O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington DC Vol. 5, Suppl. 3, pp. 345-358; Hein J., 1990, Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in Enzymology vol. 183, Academic Press, Inc., San Diego, CA; Higgins, D.G. and Sharp, P.M., 1989, CABIOS 5: 151-153; Myers, E.W. and Muller W., 1988, CABIOS 4:11-17; Robinson, E. D., 1971, Comb. Theor. 11: 105; Santou, N., Nes, M., 1987, Mol. Biol. Evol. 4:406-425; Sneath, P.H.A. and Sokal, R.R., 1973, Numerical Taxonomy the Principles and Practice of Numerical Taxonomy, Freeman Press, San Francisco, CA; Wilbur, W.J. and Lipman, D.J., 1983, Proc. Natl. Acad. Sci. USA 80:726-730.

Для оптимального выравнивания двух последовательностей предпочтительно, чтобы "степень (процент) идентичности последовательностей" определялась путем сравнения двух оптимальным образом выровненных последовательностей в выбранном окне сравнения, насчитывающем по меньшей мере 20 положений, где часть полинуклеотидной или полипептидной последовательности в окне сравнения может содержать добавки или делеции (т.е. гэпы), составляющие порядка 20 процентов или менее, обычно от 5 до 15 процентов или от 10 до 12 процентов, по сравнению со ссылочными последовательностями (которые не содержат добавок или делеций). Указанный процент рассчитывают путем определения числа положений, в которых обнаруживаются идентичные основания нуклеиновых кислот или аминокислотные остатки в обеих последовательностях, чтобы определить количество совпадений, деленное на общее число положений в ссылочной последовательности (т.е. размер окна) и умноженное на 100, с получением степени (процента) идентичности последовательностей.

Варианты могут также, или альтернативно, быть существенно гомологичными нативному гену или его части, или его комплементарной цепи. Такие варианты полинуклеотидов способны к гибридизации в умеренно жестких условиях с природным путем возникшей последовательностью ДНК, кодирующей нативное антитело (или ее комплементарной последовательностью).

Подходящие "умеренно жесткие условия" включают в себя предварительное промывание в растворе 5×SSC, 0,5% SDS, 1,0 мМ ЭДТА (pH 8,0); гибридазацию при 50-65°C, 5×SSC, в течение ночи; с последующим двукратным промыванием при 65°C в течение 20 минут каждым из растворов 2×, 0,5× и 0,2×SSC, содержащих 0,1% SDS.

Здесь "очень жестие условия", или "условия высокой жесткости", означают условия, при которых (1) используют низкую ионную силу и высокую температуру при промывке, например, 0,015 M хлорид натрия/0,0015 M цитрат натрия/0,1% додецилсульфат натрия при 50°C; (2) в процессе гибридазации используют денатурирующий агент, такой как формамид, например, 50% (об./об.) формамида с 0,1% бычьим сывороточным альбумином/0,1% фиколлом/0,1% поливинилпирролидоном/50 мМ натрий-фосфатным буфером при pH 6,5, с 750 мМ хлорида натрия, 75 мМ цитрата натрия при 42°C; или (3) используют 50% формамид, 5×SSC (0,75 M NaCl, 0,075 M цитрат натрия), 50 мМ фосфат натрия (pH 6,8), 0,1% пирофосфат натрия, 5×раствор Денхардта, обработанную ультразвуком ДНК спермы лосося (50 мкг/мл), 0,1% SDS и 10% декстрансульфат при 42°C, с промывками при 42°C в 0,2×SSC (хлорид натрия/цитрат натрия) и 50% формамиде при 55°C, с последующей промывкой в очень жестких условиях 0,1×SSC, содержащем ЭДТА, при 55°C. Специалисты в данной области хорошо себе представляют, как довести температуру, ионную силу и т.д., а также то, как необходимо привести в соответствие такие факторы как длина зонда и т.п.

Специалисты в данной области хорошо себе представляют, что в результате вырожденности генетического кода существует много нуклеотидных последовательностей, которые кодируют описанный здесь полипептид. Некоторые из этих полинуклеотидов несут минимальную степень гомологии с нуклеотидной последовательностью любого нативного гена. Тем не менее, полинуклеотиды, которые отличаются в силу различий в частоте использования кодонов, являются особенно предусмотренными настоящим изобретением. Кроме того, аллели этих генов, содержащие рассматриваемые здесь полинуклеотидные последовательности, входят в объем защиты настоящего изобретения. Аллели являются эндогенными генами, которые изменены в результате одной или более мутаций, таких как делеции, добавки и/или замены нуклеотидов. Полученные в результате мРНК и белок могут, но необязательно, иметь измененную структуру или функцию. Аллели могут быть идентифицированы с помощью стандартных технологий (таких как гибридизация, амплификация и/или сравнение последовательностей базы данных).

Полинуклеотиды для применения в настоящем изобретении могут быть получены с помощью методов химического синтеза, рекомбинантных методов или ПЦР. Методы химического синтеза полинуклеотидов хорошо известны в данной области, и нет нужды в их подробном описании в рамках настоящей заявки. Специалист в данной области может использовать представленные здесь последовательности и коммерческий ДНК-синтезатор для продуцирования требуемой последовательности ДНК.

Для получения полинуклеотидов с помощью рекомбинантных методов можно полинуклеотид, содержащий требуемую последовательность, встроить в подходящий вектор, а указанный вектор, в свою очередь, встроить в подходящую клетку-хозяина для их репликации и амплификации, как будет обсуждаться позже. Полинуклеотиды могут быть встроены в клетки-хозяева с помощью любых известных в данной области приемов. Клетки трансформируют путем введения экзогенного полинуклеотида путем прямого поглощения, эндоцитоза, трансфекции, F-спаривания или электропорации. Будучи введенным, указанный экзогенный полинуклеотид может быть сохранен внутри клетки в виде неинтегрированного вектора (такого как плазмида) или может быть интегрирован в геном клетки-хозяина. Указанный полинуклеотид, амплифицированный таким образом, может быть изолирован из клетки-хозяина методами, хорошо известными в данной области. См., например, Sambrook et al. (1989).

Альтернативно, с помощью ПЦР можно репродуцировать ДНК-последовательности. Технология ПЦР хорошо известна в данной области и описана в патентах США №№ 4683195, 4800159, 4754065 и 4683202, а также в следующей публикации: PCR: The Polymerase Chain Reaction, Mullis et al. eds., Birkauswer Press, Boston (1994).

РНК может быть получена с помощью изолированной ДНК, помещенной в соответствующий вектор, с последующим встраиванием в подходящую клетку-хозяина. При репликации данной клетки и транскрипции ДНК в РНК, указанную РНК можно затем изолировать, используя методы, хорошо известные в данной области, например, как описано Sambrook et al., (1989).

Подходящие клонирующие векторы могут быть сконструированы в соответствии со стандартными технологиями или же могут быть отобраны из большого числа клонирующих векторов, доступных в данной области. Хотя отобранные клонирующие векторы и могут варьировать в зависимости от того, какую клетку-хозяин предполагается использовать, применяемые клонирующие векторы обычно должны обладать способностью к саморепликации, могут располагать единственной мишенью для конкретной рестрикционной эндонуклеазы и/или могут нести гены, которые можно использовать при селекции клонов, содержащих указанный вектор. Подходящие примеры включают в себя плазмиды и бактериальные вирусы, например, pUC18, pUC19, Bluescript (например, pBS SK+) и их производные, mp18, mp19, pBR322, pMB9, ColE1, pCR1, RP4, фаговые ДНК и челночные векторы, такие как pSA3 и pAT28. Эти и многие другие клонирующие векторы доступны из коммерческих источников, таких как Biorad, Strategene и Invitrogen.

Обычно экспрессирующие векторы представляют собой реплицируемые полинуклеотидные конструкции, которые содержат полинуклеотид согласно изобретению. Это означает, что экспрессирующий вектор должен реплицироваться в клетке-хозяине либо в виде эписом, либо как интегральная часть хромосомной ДНК. Подходящие экспрессирующие векторы включают в себя, но не ограничиваются плазмидами, вирусными векторами, включая аденовирусы, адено-ассоциированные вирусы, ретровирусы, космиды и экспрессирующий вектор (векторы), описанный в публикации PCT № WO 87/04462. Обычно компоненты вектора могут включать в себя, не ограничиваясь перечисленным, один или более из следующих компонентов: сигнальную последовательность; ориджин репликации; один или несколько маркерных генов; соответствующие элементы, осуществляющие контроль транскрипции (такие как промоторы, энхансеры и терминатор). Для экспрессии (то есть трансляции) обычно требуется также один или несколько элементов, осуществляющих контроль трансляции, таких как участки связывания с рибосомами, участки инициации трансляции и стоп-кодоны.

Векторы, содержащие представляющие интерес нуклеотиды, могут быть встроены в клетку-хозяин любым из целого ряда подходящих способов, включая электропорацию, трансфекцию с использованием хлористого кальция, хлористого рубидия, фосфата кальция, DEAE-декстрана или других веществ; бомбардировку микрочастицами; липофекцию и инфицирование (например, в случае, когда вектор является инфицирующим агентом, таким как вирус коровьей оспы). Выбор вводимых векторов или полинуклеотидов будет зачастую зависеть от особенностей клетки-хозяина.

В настоящем изобретении используются также любые из описанных здесь полинуклеотидов. Любые клетки-хозяева, способные к повышенной экспрессии гетерологичных ДНК, могут быть использованы для выделения генов, кодирующих представляющие интерес антитело, полипептид или белок. Неограничивающие примеры клеток-хозяев млекопитающих включают в себя, но не ограничиваются клетками COS, HeLa и CHO. См. также публикацию PCT № WO 87/04462. Подходящие клетки-хозяева, не относящиеся к млекопитающим, включают в себя прокариотические клетки (такие как E. coli или B. subtillis), и клетки дрожжей (такие как S. cerevisae, S. pombe; или K. lactis). Предпочтительно, чтобы клетки-хозяева экспрессировали кДНК на уровне, в приблизительно 5 раз более высоком, более предпочтительно, в 10 раз более высоком, еще более предпочтительно, в 20 раз более высоком, чем уровень, соответствующий экспрессии в клетке-хозяине представляющего интерес эндогенного антитела или белка, в случае их наличия. Скрининг клеток-хозяев на предмет их специфического связывания с ФРН производят методом иммуноанализа или FACS-анализа. Таким образом может быть идентифицирована клетка, в повышенных количествах экспрессирующая представляющие интерес антитело или белок.

Композиции для применения в способах согласно изобретению

Композиции для применения в способах согласно изобретению (относящихся к боли и/или симптомам со стороны нижних мочевыводящих путей, ассоциированным с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря) включают в себя эффективное количество антагонистического антитела против ФРН и, в некоторых воплощениях, дополнительно включают в себя фармацевтически приемлемый носитель. Примеры таких композиций, а также способов их составления представлены в настоящем описании. В некоторых воплощениях антагонистическое антитело против ФРН связывается с ФРН и в незначительной степени перекрестно реагирует с родственными нейротрофинами (такими как NT3, NT4/5 и/или BDNF). В некоторых воплощениях антагонистическое антитело против ФРН не ассоциировано с нежелательным иммунным ответом. В других воплощениях анти-ФРН-антитело распознает человеческий ФРН. В некоторых воплощениях анти-ФРН-антитело является человеческим. В некоторых других аспектах анти-ФРН-антитело является гуманизированным (например, описанное здесь антитело E3). В другом воплощении анти-ФРН-антитело содержит константную область, которая не запускает нежелательный или ненужный иммунный ответ, такой как опосредованный антителом лизис или ADCC. В других воплощениях анти-ФРН-антитело содержит одну или несколько областей CDR антитела E3 (например, одну, две, три, четыре, пять или, в некоторых воплощениях, все шесть областей CDR из антитела E3).

Разумеется, указанные композиции могут содержать более одного антагониста ФРН. Например, композиция может содержать более одного члена класса антагонистов ФРН (например, смесь анти-ФРН-антител, которые распознают разные эпитопы ФРН), а также члены из разных классов антагонистов ФРН (например, анти-ФРН-антитело и ингибирующее ФРН соединение). Другие примеры композиций включают в себя более одного анти-ФРН-антитела, которые распознают один и тот же эпитоп(эпитопы), разные виды анти-ФРН-антител, которые связываются с разными эпитопами ФРН или разными ингибирующими ФРН соединениями.

Композиция, используемая в настоящем изобретении, может дополнительно включать в себя фармацевтически приемлемые носители, наполнители или стабилизаторы (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.) в виде лиофилизированных композиций или водных растворов. Фармацевтически приемлемые наполнители описаны здесь дополнительно.

Антагонистическое антитело против ФРН и содержащие его композиции могут быть использованы также в сочетании с другими агентами, которые служат для усиления и/или дополнения указанных агентов, например, с агентами, используемыми при лечении или профилактике боли и/или симптомов со стороны нижних мочевыводящих путей. Антагонистическое антитело против ФРН можно вводить одновременно, последовательно или раздельно, в сочетании с одним или несколькими такого рода агентами.

Анти-ФРН-антитело может быть введено в сочетании с одним или несколькими другими средствами (или в виде любого их сочетания). Анти-ФРН-антитело может быть полезно объединить с другим фармацевтически активным соединением или с двумя или несколькими другими фармацевтически активными соединениями для лечения боли и/или симптома со стороны нижних мочевыводящих путей (LUTS), ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря. Например, как было сказано выше, анти-ФРН-антитело может быть введено одновременно, последовательно или раздельно, в сочетании с одним или несколькими агентами, выбранными из следующих средств:

- опиоидного анальгетика, например, морфина, героина, гидроморфона, оксиморфона, леворфанола, леваллорфана, метадона, меперидина, фентанила, кокаина, кодеина, дигидрокодеина, оксикодона, гилрокодона, пропоксифена, налмефена, налорфина, налоксона, налтрексона, бупренорфина, буторфанола, налбуфина или пентазоцина;

- нестероидного противовоспалительного средства (NSAID), например, аспирина, диклофенака, дифлузинала, этодолака, фенбуфена, фенопрофена, флуфенизала, флурбипрофена, ибупрофена, индометацина, кетопрофена, кеторолака, меклофенаминовой кислоты, мефенаминовой кислоты, мелоксикама, набуметона, напроксена, нимесулида, нитрофлурбипрофена, олсалазина, оксапрозина, фенилбутазона, пироксикама, сульфазалазина, сулиндака, толметина или зомепирака;

- барбитуратного седативного средства, например, амобарбитала, апробарбитала бутабарбитала, бутабитала, мефобарбитала, метарбитала, метогекситала, пентобарбитала, фенобарбитала, секобарбитала, талбутала, теамилала или тиопентала;

- бензодиазепина, обладающего седативным действием, например, хлордиазепоксида, клоразепата, диазепама, флуразепама, лоразепама, оксазепама, темазепама или тиазолама;

- H1-антагониста, обладающего седативным действием, например, дифенгидрамина, пиламина, прометазина, хлорфенирамина или хлорциклизина;

- седативного средства, такого как глутетимид, мепробамат, метахалон или дихлоралфеназон;

- релаксанта скелетных мышц, например, баклофена, каризопродола, хлорзоксазона, циклобензаприна, метокарбамола или орфренадина;

- антагониста рецептора HMDA, например, декстрометорфан ((+)-3-гидрокси-N-метилморфинан) или его метаболита ((+)-3-гидрокси-N-метилморфинан), кетамина, мемантина, пирролохинолинхинина, цис-4-(фосфонометил)-2-пиперидинкарбоновой кислоты, будипина, EN-3231 (MorphiDex®, комбинации композиции морфина и декстрометорфана), топирамата, нерамексана или перцинфотеля, включая антагонист NR2B, например, ифенпродила, траксопродила или (-)-(R)-6-{2-[4-(3-фторфенил)-4-гидрокси-1-пиперидинил]-1-гидроксиэтил-3,4-дигидро-2(1H)-хинолинона;

- альфа-адренергического средства, например, доксазозина, тамсулозина, клонидина, гуанфацина, дексметатомидина, модафинила, теразозина, индорамина, алфузозина, силодозина или 4-амино-6,7-диметокси-2-(5-метан-сульфонамидо-1,2,3,4-тетрагидроизохинол-2- ил)-5-(2-пиридил)хиназолина; празозина;

- трициклического антидепрессанта, например, дезипрамина, имипрамина, амитриптилина или нортриптилина;

- противоконвульсивного средства, например, карбамазепина, ламотриджина, топиратмата или валпроата;

- антагониста тахикинина (NK), в частности, антагониста NK-3, NK-2 или NK-1, например, (αR,9R)-7-[3,5-бис(трифторметил)бензил]-8,9,10,11-тетрагидро-9-метил-5-(4- метилфенил)-7H-[1,4]диазоцино[2,1-g][1,7]-нафтиридин-6-13-диона (TAK-637), 5-[[(2R,3S)-2-[(1R)-1-[3,5-бис(трифторметил)фенил]этокси-3-(4-фторфенил)-4-морфолинил]-метил]-1,2-дигидро-3H-1,2,4-тиазол-3-она (MK-869), апрепитанта, ланепитанта, дапитанта или 3-[[2-метокси-5-(трифторметокси)фенил]-метиламино]-2-фенилпиперидин (2S,3S);

- мускаринового антагониста, например, оксибутинина, толтеродина, фезотеродина, 5-гидроксиметилтолтеродина, пропиверина, троспиума хлорида, дарифенацина, солифенацина, темиверина и ипратропиума;

- селективного ингибитора COX-2, например, целекоксиба, рофекоксиба, парекоксиба, валдекоксиба, деракоксиба, эторикоксиба или лумиракоксиба;

- дегтевого анальгетика, в частности, ацетаминофена/парацетамола;

- нейролептика, такого как дроперидол, хлорпромазин, галоперидон, перфеназин, тиоридазин, мезоридазин, трифторперазин, флуфеназин, клозапин, оланзапин, ривперидон, зипразидон, кветиапин, сертиндол, арипипразол, сонепипразол, блонансерин, илоперидон, пероспирон, раклоприд, зотепин, бифепрунокс, азенапин, луразидон, амисульприд, балаперидон, палиндор, эпливансерин, озанетант, римонабант, меклинертант, мираксион® или саризотан;

- агониста ваниллоидного рецептора (например, резинфератоксина) или антагониста (например, капсазепина);

- бета-адреноблокаторов, таких как пропранолол;

- локального анестетика, такого как мексилетин;

- кортикостероида, такого как дексаметазон;

- агониста 5-HT-рецептора или антагониста (например, пизотифена), и, в частности, агониста 5-HT1B/1D, такого как элетрипан, суматрипан, наратрипан, золмитрипан или ризатрипан;

- антагониста 5-HT2A-рецептора, такого как R(+)-альфа-(2,3-диметоксифенил)-1-[2-(4-фторфенилэтил)]-4-пиперидинметанол (MDL-100907);

- холинэргический (никотиновый) анальгетик, такой как изпрониклин (TC-1734), (E)-N-метил-4-(3-пиридил)-3-бутен-1-амин (RJR-2403), (R)-5-(2-азетидинилметокси)-2-хлорпиридин (ABT-594) или никотин;

- трамадол (торговая марка);

- ингибитор PDE-5, такой как 5-[2-этокси-5-(4-метил-1-пиперазинил- сульфонил)фенил]-1-метил-3-н-пропил-1,6-дигидро-7H-пиразоло[4,3-d]пиримидин-7-он (силденафил), (6R,12aR)-2,3,6,7,12,12a-гексагидро-2-метил-6-(3,4-метилендиоксифенил)-пиразино[2',1':6,1]-пиридо[3,4-b]индол-1,4-дион (IC-351 или тадалафил), 2-[2-этокси-5-(4-этил-пиперазин-1-ил-1-сульфонил)-фенил]-5-метил-7-пропил-3H-имидазо[5,1-f][1,2,4]триазин-4-он (варденафил), 5-(5-ацетил-2-бутокси-3-пиридинил)-3-этил-2-(1-этил-3-азетидинил)-2,6-дигидро-7Н-пиразоло[4,3-d]пиримидин-7-он, 5-(5-ацетил-2-пропокси-3-пиридинил)-3-этил-2-(1-изопропил-3-азетидинил)-2,6-дигидро-7Н-пиразоло[4,3-d]пиримидин-7-он, 5-[2-этокси-5-(4-этилпиперазин-1-илсульфонил)пиридин-3-ил]-3-этил-2-[2-метоксиэтил]-2,6-дигбензил)амино]-2-[(2S)-2- (гидроксиметил)пирролидин-1-ил]-N-(пиримидин-2-илметил)пиримидин-5-карбоксамид, 3-(1-метил-7-оксо-3-пропил-6,7-дигидро-1H-пиразоло[4,3-d]пиримидин-5-ил)-N-[2-(1-метилпирролидин-2-ил)этил]-4-пропоксибензолсульфонамид;

- альфа-2-дельта-лиганда, такого как габапентин, прегабалин, 3-метилгабапентин, (1α,3α,5α)(3-амино-метил-бицикло[3.2.0]гепт-3-ил)-уксусная кислота, (3S,5R)-3-аминометил-5-метил-гептановая кислота, (3S,5R)-3-амино-5-метил-гептановая кислота, (3S,5R)-3-амино-5-метил-октановая кислота, (2S,4S)-4-(3- хлорфенокси)пролин, (2S,4S)-4-(3-фторбензил)-пролин, [(1R,5R,6S)-6-(аминометил)бицикло[3.2.0]гепт-6-ил]уксусная кислота, 3-(1-аминометил-циклогексилметил)-4H-[1,2,4]оксадиазол-5-он, C-[1-(1H-тетразол-5-илметил)-циклогептил]-метиламин, (3S,4S)-(1-аминометил-3,4-диметил-циклопентил)-уксусная кислота, (3S,5R)-3-амино-5-метил-нонановая кислота, (3R,4R,5R)-3-амино-4,5-диметил-гептановая кислота и (3R,4R,5R)-3-амино-4,5-диметил-октановая кислота; (3S,5R)-3-аминометил-5-метилоктановая кислота;

- каннабиноида;

- антагониста метаботропного рецептора глутамата подтипа 1 (mGluR1);

- ингибитора обратного захвата серотонина, такого как сертралин, сертралиновый метаболит десметилсертралин, флуоксетин, норфлуоксетин (десметиловый метаболит флуоксетина), флувоксамин, пароксетин, циталопрам, метаболит циталопрама десметилциталопрам, эсциталопрам, d,l-фенфлурамин, фемоксетин, ифоксетин, цианодотиепин, литоксетин, дапоксетин, нефазодон, церикламин и тразодон;

- ингибитора обратного захвата норадреналина (норэпинефрина), такого как мапротилин, лофепрамин, миртазепин, оксапротилин, фезоламин, томоксетин, мианзерин, бупрофон, метаболит бупрофона гидроксибупрофон, номифензин и вилоксазин (вивалан®), в частности, селективного ингибитора обратного захвата норадреналина, такого как ребоксетин, в частности, (S,S)-ребоксетин;

- двойного ингибитора обратного захвата серотонина-норадреналина, такого как венлафаксин, метаболит венлафаксина O-десметилвенлафаксин, кломипрамин, метаболит кломипрамина демметилкломипрамин, дулоксетин, милнаципран и имипрамин;

- индуцибельного ингибитора синтазы окиси азота (iNOS), такого как S-[2-[(1-иминоэтил)амино]этил]-L-гомоцистеин, S-[2-[(1-иминоэтил)-амино]этил]-4,4-диоксо-L-цистеин, S-[2-[(1-иминоэтил)амино]этил]-2-метил-L-цистеин, (2S,5Z)-2-амино-2-метил-7-[(1-иминоэтил)амино]-5-гепьеновая кислота, 2-[[(1R,3S)-3-амино-4-гидрокси-1-(5-тиазолил)-бутил]тио]-5-хлор-3-пиридинкарбонитрил; 2-[[(1R,3S)-3-амино-4-гидрокси-1-(5-тиазолил)бутил]тио]-4-хлорбензогнитрил, (2S,4R)-2-амино-4-[[2-хлор-5-(трифторметил)фенил]тио]-5-триазолебутанол, 2-[[(1R,3S)-3-амино-4-гидрокси-1-(5-тиазолил)бутил]тио]-6-(трифторметил)-3-пиридинкарбонитрил, 2-[[(1R,3S)-3-амино-4-гидрокси-1-(5-тиазолил)бутил]тио]-5-хлорбензонитрил, N-[4-[2-(3-хлорбензиламино)этил]фенил]тиофен-2-карбоксамидин или гуанидиноэтилдисульфид;

- ингибитора ацетилхолинэстеразы, такого как донепезил;

- антагониста простагландина E2 подтипа 4 (EP4), такого как N-[({2-[4-(2-этил-4,6-диметил-1H-имидазо[4,5-c]пиридин-1-ил)фенил]этил}амино)-карбонил]-4-метилбензолсульфонамид или 4-[(1S)-1-({[5-хлор-2-(3-фторфенокси)пиридин-3-ил]карбонил}амино)этил]бензойная кислота;

- антагониста лейкотриена B4, такого как 1-(3-бифенил-4-илметил-4-гидрокси-хроман-7-ил)-циклопентанкарбоновая кислота (CP-105696), 5-[2-(2-карбоксиэтил)-3-[6-(4-метоксифенил)-5E- гексенил]оксифенокси]-валериановая кислота (ONO-4057) или DPC-11870;

- ингибитора 5-липоксигеназы, такого как зилейтон, 6-[(3-фтор-5-[4-метокси-3,4,5,6-тетрагидро-2H-пиран-4-ил])фенокси-метил]-1-метил-2-хинолон (ZD-2138) или 2,3,5-триметил-6-(3-пиридилметил),1,4-бензохинон(CV-6504);

- блокатора натриевых каналов, такого как лидокаин или бупивикаин;

- антагониста 5-HT3, такого как ондансетрон;

- заменителя гликозаминогликанового слоя и противовоспалительного агента, такого как пентозанполисульфат (элмирон - торговая марка);

- бета-3-агониста, такого как YM-178 (мирабегрон или 2-амино-N-[4-[2-[[(2R)-2-гидрокси-2-фенилэтил]амино]этил]фенил]-4- тиазолацетамид), золабегрон, KUC-7483 (ритобегрон или 2-[4-[2-[[(1S,2R)-2-гидрокси-2-(4-гидроксифенил)-1-метилэтил]амино]этил]-2,5-диметилфенокси]-уксусная кислота) или AK-134;

- антигистамина, такого как гидроксизин;

- H2-антагониста, такого как циметидин или ранитидин;

- нитрата серебра;

- стероида;

- доксорубицина;

- хондроитинсульфата;

- динатрия хромогликата;

- оксихлорозена (клорпактин - торговая марка); и

- иммуносупрессанта, такого как циклоспорин;

и их фармацевтически приемлемых солей и сольватов.

Введение антагонистического антитела против ФРН

Антагонистическое антитело против ФРН может быть введено индивидууму (в случае боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря) подходящим путем. Специалисту в данной области должно быть очевидно, что описанные здесь примеры предназначены не для ограничения объема данного изобретения, а лишь для иллюстрации доступных технологий. Соответственно, в некоторых воплощениях антагонистическое антитело против ФРН вводят индивидууму в соответствии с известными способами, такими как внутривенное введение, например, в виде болюса или путем непрерывной инфузии в течение определенного периода, внутримышечным путем, внутрибрюшинным, интрацереброспинальным, подкожным, внутрисуставным путями, сублингвально, интрасиновиально, путем инсуффляции, интратекальным, оральным, ингаляционным, трансдермальным или топическим путями. Введение может быть системным, например, внутривенным введением, или локализованным. Для введения пригодны коммерчески доступные небулайзеры для жидких композиций, включая струйные небулайзеры и ультразвуковые небулайзеры. Жидкие композиции могут быть непосредственно введены через небулайзер, и лиофилизироаванные композиции могут быть введены через небулайзер после их восстановления. Альтернативно, антагонистическое антитело против ФРН можно составить в виде аэрозольной композиции, используя фторзамещенный углеводород и ингалятор с дозатором, или же можно вводить через ингалятор в виде лиофилизироаванного и измельченного порошка.

В одном из аспектов антагонистическое антитело против ФРН вводят, используя сайт-специфическую технику, или технологию локально направленной доставки. Примеры сайт-специфической техники, или технологии локально направленной доставки, включают в себя различные имплантируемые системы депонирования антагонистического антитела против ФРН или катетеры локальной доставки, такие как инфузионные катетеры, постоянный катетер или игольчатый катетер, искусственные трансплантаты, адвентициальные обертывания, шунты и стенты или другие имплантируемые устройства, сайт-специфические носители, прямую инъекцию или прямую аппликацию. См., например, публикацию PCT № WO 00/53211 и патент США № 5981568.

Различные композиции антител, таких как E3 или его фрагменты (например, Fab, Fab', F(ab')2, Fv, Fc и т.д.), таких как одноцепочечный фрагмент (ScFv), его мутанты, слитые белки, содержщие часть антитела, и любые другие модифицированные конфигурации, которые содержат сайт распознавания антигена ФРН требуемой специфичности, могут быть использованы для введения. В некоторых воплощениях антагонистическое антитело против ФРН может быть введено в чистом виде. В некоторых воплощениях антагонистическое антитело против ФРН и фармацевтически приемлемый наполнитель могут быть представлены в различных композициях. Фармацевтически приемлемые наполнители известны в данной области и являются относительно инертными веществами, которые облегчают введение фармакологически эффективного вещества. Например, наполнитель может придавать форму или консистенцию, или же действовать в качестве разбавителя. Подходящие наполнители включают в себя, но не ограничены стабилизирующими агентами, увлажняющими и эмульгирующими агентами, солями для варьирования осмолярности, инкапсулирующими агентами, буферами и усилителями проникновения через кожу. Наполнители, также как и композиции для парентеральной и непарентеральной доставки лекарственных средств приведены в справочнике Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).

В некоторых воплощениях указанные агенты составлены в композиции для введения путем инъекции (например, внутрибрюшинной, внутривенной, подкожной, внутримышечной и т.д.). Соответственно, указанные агенты можно комбинировать с фармацевтически приемлемыми носителями, такими как физиологический раствор, раствор Рингера, раствор декстрозы и т.п. Конкретный режим дозирования, то есть величина дозы, время введения и повторность будут зависеть от конкретного индивида и истории болезни указанного индивида.

Анти-ФРН-антитело может быть введено любым подходящим способом, включая инъекционный путь введения (например, внутрибрюшинный, внутривенный, подкожный, внутримышечный и т.д.). Анти-ФРН-антитела могут быть введены, как описано выше, также путем ингаляции или другими путями введения (например, оральным, через слизистую, подъязычным путем). Обычно для введения анти-ФРН-антител первоначальная рекомендуемая дозировка может составлять приблизительно 2 мг/кг.

В предпочтительном воплощении концентрация антитела, которое предполагается вводить, может варьировать от приблизительно 0,1 до приблизительно 200 мг/мл. Предпочтительно, чтобы концентрация антитела составляла приблизительно 0,5 мг/мл, приблизительно 1 мг/мл, приблизительно 2 мг/мл, приблизительно 3 мг/мл, приблизительно 4 мг/мл, приблизительно 5 мг/мл, приблизительно 6 мг/мл, приблизительно 7 мг/мл, приблизительно 8 мг/мл, приблизительно 9 мг/мл, приблизительно 10 мг/мл, приблизительно 11 мг/мл, приблизительно 12 мг/мл, приблизительно 13 мг/мл, приблизительно 14 мг/мл, приблизительно 15 мг/мл, приблизительно 16 мг/мл, приблизительно 17 мг/мл, приблизительно 18 мг/мл, приблизительно 19 мг/мл, приблизительно 20 мг/мл, приблизительно 21 мг/мл, приблизительно 22 мг/мл, приблизительно 23 мг/мл, приблизительно 24 мг/мл, приблизительно 25 мг/мл, приблизительно 26 мг/мл, приблизительно 27 мг/мл, приблизительно 28 мг/мл, приблизительно 29 мг/мл, приблизительно 30 мг/мл, приблизительно 31 мг/мл, приблизительно 32 мг/мл, приблизительно 33 мг/мл, приблизительно 34 мг/мл, приблизительно 35 мг/мл, приблизительно 36 мг/мл, приблизительно 37 мг/мл, приблизительно 38 мг/мл, приблизительно 39 мг/мл, приблизительно 40 мг/мл, приблизительно 41 мг/мл, приблизительно 42 мг/мл, приблизительно 43 мг/мл, приблизительно 44 мг/мл, приблизительно 45 мг/мл, приблизительно 46 мг/мл, приблизительно 47 мг/мл, приблизительно 48 мг/мл, приблизительно 49 мг/мл, приблизительно 50 мг/мл, приблизительно 51 мг/мл, приблизительно 52 мг/мл, приблизительно 53 мг/мл, приблизительно 54 мг/мл, приблизительно 55 мг/мл, приблизительно 56 мг/мл, приблизительно 57 мг/мл, приблизительно 58 мг/мл, приблизительно 59 мг/мл, приблизительно 60 мг/мл, приблизительно 70 мг/мл, приблизительно 80 мг/мл, приблизительно 90 мг/мл, приблизительно 100 мг/мл или приблизительно 110 мг/мл. Наиболее предпочтительно, чтобы концентрация антитела была выбрана из группы, содержащей приблизительно 2 мг/мл, приблизительно 2,5 мг/мл, приблизительно 5 мг/мл, приблизительно 10 мг/мл, приблизительно 20 мг/мл, приблизительно 22 мг/мл и приблизительно 50 мг/мл.

В некоторых воплощениях характер введения анти-ФРН-антитела включает в себя еженедельное введение дозы, введение дозы один раз в 2 недели, в каждые 3 недели, каждые 4 недели, каждые 5 недель, каждые 6 недель, каждые 7 недель, каждые 8 недель, каждые 9 недель, каждые 10 недель, каждые 15 недель, каждые 20 недель, каждые 25 или более недель. В некоторых воплощениях указанное антитело вводят 1 раз каждый месяц, каждые 2 месяца, каждые 3 месяца, каждые 4 месяца, каждые 5 месяцев, каждые 6 или более месяцев. Наиболее предпочтительно, чтобы анти-ФРН-антитело вводилось один раз каждые 8 недель. Мониторинг эффективности такой терапии можно осуществлять, используя общеприменимые технологии и методы анализа. Режим дозирования (включая используемый антагонист (антагонисты) ФРН) можно в течение времени варьировать.

В некоторых воплощениях объем дозы меньше или равен приблизительно 20 мл, приблизительно 15 мл, приблизительно 10 мл, приблизительно 5 мл, приблизительно 2,5 мл, приблизительно 1,5 мл, приблизительно 1,0 мл, приблизительно 0,75 мл, приблизительно 0,5 мл, приблизительно 0,25 мл или приблизительно 0,01 мл. В некоторых воплощениях объем дозы составляет приблизительно 20 мл, приблизительно 19 мл, приблизительно 18 мл, приблизительно 17 мл, приблизительно 16 мл, приблизительно 15 мл, приблизительно 14 мл, приблизительно 13 мл, приблизительно 12 мл, приблизительно 11 мл, приблизительно 10 мл, приблизительно 9 мл, приблизительно 8 мл, приблизительно 7 мл, приблизительно 6 мл, приблизительно 5 мл, приблизительно 4 мл, приблизительно 3 мл, приблизительно 2 мл или приблизительно 1 мл. Альтернативно, приблизительно 20,5 мл, приблизительно 19,5 мл, приблизительно 18,5 мл, приблизительно 17,5 мл, приблизительно 16,5 мл, приблизительно 15,5 мл, приблизительно 14,5 мл, приблизительно 13,5 мл, приблизительно 12,5 мл, приблизительно 11,5 мл, приблизительно 10,5 мл, приблизительно 9,5 мл, приблизительно 8,5 мл, приблизительно 7,5 мл, приблизительно 6,5 мл, приблизительно 5,5 мл, приблизительно 4,5 мл, приблизительно 3,5 мл, приблизительно 2,5 мл, приблизительно 1,5 мл или приблизительно 0,5 мл. Альтернативно, приблизительно 900 мкл, приблизительно 800 мкл, приблизительно 700 мкл, приблизительно 600 мкл, приблизительно 500 мкл, приблизительно 400 мкл, приблизительно 300 мкл, приблизительно 200 мкл или приблизительно 100 мкл, альтернативно, приблизительно 950 мкл, приблизительно 850 мкл, приблизительно 750 мкл, приблизительно 650 мкл, приблизительно 550 мкл, приблизительно 450 мкл, приблизительно 350 мкл, приблизительно 250 мкл, приблизительно 150 мкл или приблизительно 50 мкл. Наиболее предпочтительным объемом дозы является объем, меньший или равный приблизительно 2,5 мл.

В соответствии с предпочтительным воплощением, доза содержит количество, меньшее или равное приблизительно 0,5 мг, приблизительно 1 мг, приблизительно 2 мг, приблизительно 3 мг, приблизительно 4 мг, приблизительно 5 мг, приблизительно 6 мг, приблизительно 7 мг, приблизительно 8 мг, приблизительно 9 мг, приблизительно 10 мг, приблизительно 11 мг, приблизительно 12 мг, приблизительно 13 мг, приблизительно 14 мг, приблизительно 15 мг, приблизительно 16 мг, приблизительно 17 мг, приблизительно 18 мг, приблизительно 19 мг, приблизительно 20 мг, приблизительно 21 мг, приблизительно 22 мг, приблизительно 23 мг, приблизительно 24 мг, приблизительно 25 мг, приблизительно 26 мг, приблизительно 27 мг, приблизительно 28 мг, приблизительно 29 мг, приблизительно 30 мг, приблизительно 31 мг, приблизительно 32 мг, приблизительно 33 мг, приблизительно 34 мг, приблизительно 35 мг, приблизительно 36 мг, приблизительно 37 мг, приблизительно 38 мг, приблизительно 39 мг, приблизительно 40 мг, приблизительно 41 мг, приблизительно 42 мг, приблизительно 43 мг, приблизительно 44 мг, приблизительно 45 мг, приблизительно 46 мг, приблизительно 47 мг, приблизительно 48 мг, приблизительно 49 мг, приблизительно 50 мг, приблизительно 51 мг, приблизительно 52 мг, приблизительно 53 мг, приблизительно 54 мг, приблизительно 55 мг, приблизительно 56 мг, приблизительно 57 мг, приблизительно 58 мг, приблизительно 59 мг, приблизительно 60 мг, приблизительно 70 мг, приблизительно 80 мг, приблизительно 90 мг, приблизительно 100 мг или приблизительно 110 мг антитела. Наиболее предпочтительно, чтобы доза содержала количество, меньшее или равное приблизительно 50 мг антитела.

В соответствии с предпочтительным воплощением, доза содержит количество антитела, которое меньше или равно приблизительно 1 мкг/кг, приблизительно 10 мкг/кг, приблизительно 20 мкг/кг, приблизительно 50 мкг/кг, приблизительно 100 мкг/кг, приблизительно 200 мкг/кг, приблизительно 500 мкг/кг, приблизительно 1 мг/кг, приблизительно 2 мг/кг, приблизительно 3 мг/кг, приблизительно 4 мг/кг, приблизительно 5 мг/кг, приблизительно 6 мг/кг, приблизительно 7 мг/кг, приблизительно 8 мг/кг, приблизительно 9 мг/кг, приблизительно 10 мг/кг или приблизительно 11 мг/кг (массы млекопитающего, которому предполагается вводить указанную дозу).

При повторных введениях в течение нескольких дней или более длительного срока, в зависимости от состояния, лечение продолжают до тех пор, пока не будет достигнута требуемая супрессия симптомов или до тех пор, пока не будут достигнуты удовлетворительные терапевтические уровни ослабления боли. В одном из воплощений режим дозирования может включать в себя введение первоначальной дозы, составляющей приблизительно 2 мг/кг, затем, через неделю, поддерживающей дозы, составляющей приблизительно 1 мг/кг анти-ФРН-антитела, или с последующей поддерживающей дозой, составляющей приблизительно 1 мг/кг каждую неделю. Однако могут быть использованы и другие схемы дозирования, в зависимости от характера фармакокинетики, которой, по мнению лечащего врача, следует достичь. Например, в некоторых воплощениях предлагается режим дозирования от одного до четырех раз в неделю. Может быть использована даже схема с менее частыми введениями.

Для целей, связанных с настоящим изобретением, подходящий характер дозирования антагонистического антитела против ФРН будет зависеть от используемого антитела (или его композиций), типа и степени тяжести подвергаемых лечению боли или симптома со стороны нижних мочевыводящих путей, от того, назначается ли средство превентивно или в терапевтических целях, от предшествующей терапии, от истории болезни пациента и от его реакции на указанное средство, а также от решения лечащего врача. Обычно врач назначает введение антагонистического антитела против ФРН до тех пор, пока не будет достигнут требуемый результат. Доза и/или частота введения в процессе курса лечения могут варьировать.

Обычно при определении дозировок должны приниматься во внимание и эмпирические расчеты, такие как время полужизни. Например, антитела, которые соответствуют иммунной системе человека, такие как гуманизированные антитела или полностью человеческие антитела, могут быть использованы для пролонгирования времени полужизни антитела и для предотвращения атаки указанного антитела со стороны иммунной системы хозяина. Частота введения может быть определена и пересмотрена в течение курса лечения, и обычно, но необязательно, основана на результатах лечения и/или супрессии, и/или облегчения, и/или задержке боли. Альтернативно, может оказаться целесообразным непрерывное продолжительное высвобождение композиций антагонистических антител против ФРН. Различные композиции и устройства для достижения непрерывного высвобождения известны в данной области.

Некоторым индивидам может потребоваться более одной дозы. Частота введения может быть определена и пересмотрена в течение курса лечения. Например, частота введения может быть определена или пересмотрена на основе типа и степени тяжести подвергаемых лечению боли или симптома со стороны нижних мочевыводящих путей, от того, назначается ли средство для превентивных или терапевтических целей, от предшествующей терапии, от истории болезни пациента и от его реакции на указанное средство, а также от решения лечащего врача. Обычно врач назначает введение антагонистического антитела против ФРН (такого как E3) до тех пор, пока не будет достигнут требуемый результат. В некоторых случаях может оказаться целесообразным непрерывное продолжительное высвобождение композиций антител Е3. Различные композиции и устройства для достижения непрерывного высвобождения известны в данной области.

В одном из воплощений дозировки антагонистического антитела против ФРН могут быть определены эмпирически для индивидов, которым однократно или большее количество раз вводили антагонист ФРН. Индивидам вводят постепенно возрастающие дозы антагонистического антитела против ФРН. Для установления эффективности антагонистического антитела против ФРН можно отслеживать индикацию боли или симптомов со стороны нижних мочевыводящих путей, например, изменение по количественной оценочной шкале боли (NRS), изменение в показателе выраженности симптомов интерстициального цистита (ICSI), т.е. индексе O'Leary-Sant, изменение в показателе O'Leary-Sant выраженности проблем интерстициального цистита (ICPI), изменение в оценке тазовой боли и симптома императивности/частоты (PUF) и/или изменения в отклонениях, связанных с мочеиспусканием, включая частоту мочеиспусканий, частоту ночных позывов, частоту эпизодов недержания мочи, средний объем выделения при мочеиспускании, среднюю тяжесть боли при интерстициальном цистите, частоту эпизодов неотложных позывов, среднее число эпизодов нарушения сна, средний показатель боли по болевой шкале, ассоциированной с половой активностью, общую оценку ответа на лечение, оценку пациентом влияния лечения, неудачную попытку лечения, биомаркеры, границы безопасности и/или фармакокинетические характеристики. Биомаркеры могут включать в себя, помимо прочего, ФРН, гликопротеин-51 (GP-51), антипролиферативный фактор (APF) и HB-эпидермальный фактор роста (HB-EGF).

Введение антагонистического антитела против ФРН в соответствии со способом согласно изобретению может быть непрерывным или прерывистым, в зависимости, например, от физиологического состояния пациента, от того, преследует ли введение препарата терапевтическую или профилактическую цель, а также от других факторов, известных практикующим специалистам в данной области. Введение антагонистического антитела против ФРН может быть по существу непрерывным в течение предопределенного периода или может состоять из серийных введений раздельных доз, например, либо до, либо в процессе, либо после развития боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря; до; в процессе; до и после; в процессе и после; до и в процессе; или до, в процессе и после развития боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Терапевтические композиции антагонистического антитела против ФРН, используемые в соответствии с настоящим изобретением, получают в виде препарата для хранения путем смешивания антитела, имеющего требуемую степень чистоты, с необязательными фармацевтически приемлемыми носителями, наполнителями или стабилизаторами (Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000)), в виде лиофилизированных или водных растворов. В некоторых воплощениях может быть представлено более одного антагонистического антитела против ФРН. Может быть представлено по меньшей мере одно, по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять или более разных антагонистических антител против ФРН. Обычно те антагонистические антитела против ФРН проявляют дополнительную активность, которые не оказывают неблагоприятного влияния друг на друга. Антагонисты ФРН могут быть использованы также в сочетании с другими средствами, которые служат для усиления и/или дополнения эффективности указанных средств.

Фармацевтически приемлемые носители включают в себя любой и все растворители, дисперсионные среды, покрытия, антибактериальные и противогрибковые агенты, изотонические и препятствующие абсорбции агенты и т.п., которые являются физиологически совместимыми. Обычно носитель является подходящим для внутривенного, внутримышечного, подкожного, парентерального, спинального или эпидермального введения (например, путем инъекции или инфузии). В зависимости от пути введения, активное соединение, то есть антитело, его антиген-связывающая часть, иммуноконъюгат или биспецифическая молекула могут быть покрыты веществом для защиты соединения от действия кислот или других естественных условий, которые могут инактивировать указанное соединение.

Приемлемыми носителями, наполнителями или стабилизаторами являются такие, которые не токсичны для реципиентов в используемых дозах и концентрациях, и они могут включать в себя буферы, такие как фосфатный, цитратный, ацетатный и другие буферы органических кислот, включая аминокислотные буферы; соли, такие как хлорид натрия; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как октадецилдиметилбензилхлорид аммония; гексаметонийхлорид; бензалконийхлорид, бензэтонийхлорид; феноловый, бутиловый или бензиловый спирт; алкилпарабены, такие как метилпарабен или пропилпарабен; катехин; резорцин; циклогексанол; 3-пентанол; и m-крезол); низкомолекулярные (менее чем из приблизительно 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатобразующие агенты, такие как ЭДТА; сахара, такие как сахароза, маннит, трегалоза или сорбит; солеобразующие противоионы, такие как натрий; комплексы металлов (например, Zn-белковые комплексы); и/или неионные поверхностно-активные вещества, такие как полисорбат, TweenTM, PLURONICSTM или полиэтиленгликоль (ПЭГ).

В определенных воплощениях антитела согласно изобретению могут быть представлены в нейтральной форме (включая цвиттерионные формы) или в виде положительно или отрицательно заряженных частиц. В некоторых случаях указанные антитела могут быть представлены в комплексе с противоионом, с образованием фармацевтически приемлемой соли. Таким образом, фармацевтические соединения согласно изобретению могут включать в себя одну или несколько фармацевтически приемлемых солей.

"Фармацевтически приемлемая соль" относится к соли, которая поддерживает требуемую биологическую активность родительского соединения (например, антитела) и не вызывает нежелательных токсикологических эффектов (см., например, Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Например, термин "фармацевтически приемлемая соль" включает в себя комплекс, содержащий одно или более антител и один или более противоионов, где указанные противоионы получены из фармацевтически приемлемых неорганических и органических кислот и оснований.

Примеры таких солей включают в себя соли присоединения кислот и соли присоединения оснований. Соли присоединения кислот включают в себя такие соли, которые получены из нетоксичных неорганических кислот, таких как соляная, азотная, фосфорная, серная, бромистоводородная, йодистоводородная, фосфорная и т.п., а также из нетоксичных органических кислот, таких как алифатические моно- и дикарбоновые кислоты, фенил-замещенные алкановые кислоты, гидрокси-алкановые кислоты, ароматические кислоты, алифатические и ароматические сульфоновые кислоты и т.п. Соли присоединения оснований включают в себя такие основания, которые получены из щелочноземельных металлов, таких как натрий, калий, магний, кальций и т.п., а также из нетоксичных органических аминов, таких как N,N'-дибензилэтилендиамин, N-метилглюкамин, хлорпрокаин, холин, диэтаноламин, этилендиамин, прокаин и т.п.

Кроме того, фармацевтически приемлемые неорганические основания включают в себя ионы металлов. Ионы металлов включают в себя, но не ограничиваются перечисленными, подходящие соли щелочных металлов, соли щелочноземельных металлов и другие физиологически приемлемые ионы металлов. Соли, полученные из неорганических оснований, включают в себя алюминий, аммоний, кальций, кобальт, никель, молибден, ванадий, марганец, хром, селен, олово, медь, железо, двухвалентное железо, литий, магний, соли трехвалентного марганца, двухвалентный марганец, калий, рубидий, натрий и цинк, и в их обычных валентностях.

Фармацевтически приемлемые соли присоединения кислот антител согласно изобретению могут быть получены из следующих кислот, включая, но не ограничиваясь перечисленным, муравьиную, уксусную, ацетамидобензойную, адипиновую, аскорбиновую, борную, пропионовую, бензойную, камфорную, угольную, цикламовую, дегидрохолевую, малоновую, этилендиаминтетрауксусную, этил-серную, кислоту fendizoic, метафосфорную, янтарную, гликолевую, глюконовую, молочную, оксиянтарную, виннокаменную, дубильную, лимонную, азотную, аскорбиновую, глюкуроновую, малеиновую, фолиевую, фумаровую, пропионовую, пировиноградную, аспарагиновую, глутаминовую, бензойную, соляную, бромистоводородную, йодистоводородную, лизиновую, изолимонную, трифторуксусную, памовую, пропионовую, аминобензойную, мезиловую, оротовую, щавелевую, щавелевоуксусную, олеиновую, стеариновую, салициловую, аминосалициловую, кремневую, пара-гидроксибензойную, никотиновую, фенилуксусную, миндальную, эмбоновую, сульфоновую, метансульфоновую, фосфорную, фосфоновую, этансульфоновую, этандисульфоновую, аммониевую, бензолсульфоновую, пантотеновую, нафталинсульфоновую, толуолсульфоновую, 2-гидроксиэтансульфоновую, сульфаниловую, серную, азотную, азотистую кислоты, монометиловый эфир серной кислоты, циклогексиламиносульфоновую, β-гидроксимасляную, глициновую, глицилглициловую, глутаминовую, какодилатную, диаминогексановую, камфорсульфоновую, глюконовую, тиоциановую, оксоглутаровую, пиридоксаль-5-фосфат, хлорфеноксиуксусную, ундекановую, N-ацетил-L-аспарагиновую, галактаровую и галактуроновую кислоты.

Фармацевтически приемлемые органические основания включают в себя триметиламин, диэтиламин, N,N'-дибензилэтилендиамин, хлорпрокаин, холин, дибензиламин, диэтаноламин, этилендиамин, меглумин (N-метилглюкамин), прокаин, циклические амины, катионы четвертичного аммония, аргинин, бетаин, кофеин, клемизол, 2-этиламиноэтанол, 2-диэтиламиноэтанол, 2-диметиламиноэтанол, этандиамин, бутиламин, этаноламин, этилендиамин, N-этилморфолин, N-этилпиперидин, этилглукамин, глукамин, глюкозамин, гистидин, гидрабамин, имидазол, изопропиламин, метилглюкамин, морфолин, пиперазин, пиридин, пиридоксин, неодимий, пиперидин, полиаминовые смолы, прокаин, пурины, теобромин, триэтиламин, трипропиламин, триэтаноламин, трометамин, метиламин, таурин, холат, 6-амино-2-метил-2-гептанол, 2-амино-2-метил-1,3-пропандиол, 2-амино-2-метил-1-пропанол, алифатические моно- и дикарбоновые кислоты, фенил-замещенные алкановые кислоты, гидрокси-алкановые кислоты, ароматические кислоты, алифатические и ароматические сульфоновые кислоты, стронций, трицин, гидразин, фенилциклогексиламин, 2-(N-морфолино)этансульфоновая кислота, бис(2-гидроксиэтил)амино-трис(гидроксиметил)метан, N-(2-ацетамидо)-2-аминоэтансульфоновая кислота, 1,4-пиперазиндиэтансульфоновая кислота, 3-морфолино-2-гидроксипропансульфоновая кислота, 1,3- бис[трис(гидроксиметил)метиламино]пропан, 4-морфолинпропансульфоновая кислота, 4-(2-гидроксиэтил)пиперазин-1-этансульфоновая кислота, 2-[(2-гидрокси-1,1- бис(гидроксиметил)этил)амино]этансульфоновая кислота, N,N-бис(2-гидроксиэтил)-2-аминоэтансульфоновая кислота, 4-(N-морфолино)бутансульфоновая кислота, 3-(N,N-бис[2- гидроксиэтил]амино)-2-гидроксипропансульфоновая кислота, 2-гидрокси-3-[трис(гидроксиметил)метиламино]-1-пропансульфоновая кислота, 4-(2-гидроксиэтил)пиперазин-1-(2-гидроксипропансульфоновая кислота), пиперазин-1,4-бис(2-гидроксипансульфоновой кислоты) дигидрат, 4-(2-гидроксиэтил)-1 -пиперазинпропансульфоновая кислота, N,N-бис(2- гидроксиэтил)глицин, N-(2-гидроксиэтил)пиперазин-N'-(4-бутансульфоновая кислота), N-[трис(гидроксиметил)метил]-3-аминопропансульфоновая кислота, N-трис(гидроксиметил)метил-4- аминобутансульфоновая кислота, N-(1,1-диметил-2-гидроксиэтил)-3-амино-2-гидроксипропансульфоновая кислота, 2-(циклогексиламино)этансульфоновая кислота, 3-(циклогексиламино)- 2-гидрокси-1-пропансульфоновая кислота, 3-(циклогексиламино)-1- пропансульфоновая кислота, N-(2-ацетамидо)иминодиацетилуксусная кислота, 4-(циклогексиламино)-1-бутансульфоновая кислота, N- [трис(гидроксиметил)метил]глицин, 2-амино-2-(гидроксиметил)-1,3-пропандиол и трометамол.

Другие композиции включают в себя удобные для доставки формы, известные в данной области, включая, но не ограничиваясь ими, такие носители как липосомы. См., например, Mahato et al. (1997) Pharm. Res. 14:853-859. Липосомные препараты включают в себя, не ограничиваясь ими, цитофектины, мультиламеллярные везикулы и униламеллярные везикулы.

Липосомы, содержащие антагонистическое антитело против ФРН, получают способами, известными в данной области, такими, которые описаны у Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl Acad. Sci. USA 77:4030 (1980); и в патентах США №№ 4485045 и 4544545. Липосомы с увеличенным временем циркуляции описаны в патенте США № 5013556. Особенно полезные липосомы могут быть получены методом обращенно-фазового выпаривания с липидной композицией, содержащей фосфатидилхолин, холестерин и ПЭГ-дериватизированный фосфатидилэтаноламин (PEG-PE). Липосомы экструдируют через фильтры с определенным размером пор, с получением липосом требуемого диаметра.

Активные ингредиенты могут также быть захвачены в микрокапсулы, полученные, например, с помощью коацервативной технологии или путем межфазной полимеризации, например, гидроксиметилцеллюлозные или желатиновые микрокапсулы и поли-(метилметакрилатные) микрокапсулы, соответственно, в коллоидных системах доставки лекарственных средств (например, липосомах, альбуминовых микросхемах, микроэмульсиях, нано-частицах и нано-капсулах) или в макроэмульсиях. Такие технологии описаны в справочнике Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).

Могут быть получены лекарственные средства с непрерывным высвобождением. Подходящие примеры лекарственных средств с непрерывным высвобождением включают в себя полупроницаемые матрицы твердых гидрофобных полимеров, содержащих антагонист (такой как антитело), причем указанные матрицы представлены в виде профилированных изделий, например, пленок или микрокапсул. Примеры матриц с непрерывным высвобождением включают в себя сложные полиэфиры, гидрогели (например, поли(2-гидроксиэтил-метакрилат) или поли(виниловый спирт)), полилактиды (патент США № 3773919), сополимеры L-глутаминовой кислоты и 7-этил-L-глутамата, недеградируемый этилен-винилацетат, деградируемые сополимеры молочной кислоты и гликолевой кислоты, такие как LUPRON DEPOT TM (инъецируемые микросферы, состоящие из сополимера молочная кислота-гликолевая кислота и лейпролидацетата), изобутиратацетат сахарозы и поли-D-(-)-3-гидроксимасляную кислоту.

Композиции, используемые для введения in vivo, должны быть стерильны. Этого легко достичь, например, путем фильтрации через стерильные фильтровальные мембраны.

Терапевтические композиции антагонистического антитела против ФРН обычно помещают в контейнер, имеющий стерильное впускное отверстие, например, мешок для внутривенного раствора или ампула, имеющая пробку, протыкаемую иглой для подкожной инъекции.

Терапевтические композиции могут быть введены с помощью медицинских устройств, известных в данной области. Например, терапевтическая композиция согласно изобретению может быть введена с помощью безыгольного устройства для подкожных инъекций, таких как устройства, описанные в патентах США №№ 5399163, 5383851, 5312335, 5064413, 4941880, 4790824 или 4596556. Примеры хорошо известных имплантатов и модулей, используемых в описании настоящего изобретения, включают в себя имплантируемый микроинфузионный насос для распределения лекарственного средства с контролируемой скоростью, описанный в патенте США № 4,487,603; терапевтическое устройство для введения лекарственного средства через кожу, описанное в патенте США № 4486194; медикаментозный инфузионный насос для доставки лекарственного средства со строго определенной скоростью, описанный в патенте США № 4447233; имплантируемый инфузионный аппарат с переменным объемом подачи жидкости для непрерывной доставки лекарственного средства, описанный в патенте США № 4447224; осмотическую систему доставки лекарственного средства, снабженную мультикамерными компартментами, описанную в патенте США № 4439196; и осмотическую систему доставки лекарственного средства, описанную в патенте США № 4475196. Специалистам в данной области известны также и многие другие имплантируемые устройства, системы доставки и модули.

Композиции согласно изобретению может быть представлены в виде единичных дозированных лекарственных форм, таких как таблетки, пилюли, капсулы, порошки, гранулы, растворы или суспензии, или же суппозитории, для орального, парентерального или ректального введения, или введения путем ингаляции или инсуффляции.

Для получения твердых композиций, таких как таблетки, действующее активное начало смешивают с фармацевтически приемлемым носителем, например, с ингредиентами, обычно используемыми в изготовлении таблеток, такими как кукурузный крахмал, лактоза, сахароза, сорбит, тальк, стеариновая кислота, стеарат магния, дикальция фосфат или смолы, а также другими фармацевтическими разбавителями, например, водой, с получением предварительно составленной твердой композиции, содержащей гомогенную смесь соединения согласно изобретению или его нетоксичную фармацевтически приемлемую соль. Отмечая, что указанные предварительно составленные композиции являются гомогенными, подразумевают, что активный ингредиент равномерно распределен по всему объему композиции, так, чтобы указанную композицию легко можно было бы разделить на одинаково эффективные единичные дозированные лекарственные формы, такие как таблетки, пилюли и капсулы. Затем указанную твердую предварительно составленную композицию подразделяют на единичные дозированные лекарственные формы такого типа, как описано выше, содержащие от 0,1 до приблизительно 500 мг активного ингредиента согласно изобретению. Таблетки или пилюли вновь полученной композиции могут быть покрыты или иным способом компаундированы, с получением дозированной формы, обладающей преимуществом пролонгированного действия. Например, таблетка или пилюля может содержать внутреннюю дозировку и внешний дозированный компонент, который представлен в виде оболочки поверх внутреннего слоя. Этих два компонента могут быть разделены энтерическим слоем, который служит для повышения устойчивости против дезинтеграции в желудке и позволяет внутреннему компоненту в интактном виде достичь двенадцптиперстной кишки или способствует его отсроченному высвобождению. Для указанных энтерических слоев или покрытий могут быть использованы различные материалы, и такие материалы включают в себя целый ряд полимерных кислот и смесей полимерных кислот с такими материалами как шеллак, цетиловый спирт и ацетат целлюлозы.

Подходящие поверхностно-активные вещества, в частности, неионные агенты, такие как полиоксиэтиленсорбитаны (например, TweenTM 20, 40, 60, 80 или 85) и другие сорбитаны (например, SpanTM 20, 40, 60, 80 или 85). Композиции с поверхностно-активным веществом будут, как обычно, содержать поверхностно-активного вещества от 0,05 до 5% или же от 0,1 до 2,5%. Очевидно, что в случае необходимости могут быть добавлены и другие ингредиенты, например, маннит или другие фармацевтически приемлемые носители.

Подходящие эмульсии могут быть получены с использованием коммерчески доступных жировых эмульсий, таких как интралипидTM, липозинTM, инфонутролTM, липофундинTM и липифизанTM. Активный ингредиент может быть либо растворен в предварительно смешанной эмульсионной композиции, либо, альтернативно, он может быть растворен в масле (например, в масле из соевых бобов, в подсолнечном масле, в масле из семян хлопка, в кунжутном масле, кукурузном масле или миндальном масле), с последующим образованием эмульсии путем смешивания с фосфолипидом (например, яичные фосфолипиды, фосфолипиды из соевых бобов или лецитин из соевых бобов) и водой. Очевидно, что для доведения необходимой тоничности эмульсии могут быть добавлены и другие ингредиенты, например, глицерин или глюкоза. Подходящие эмульсии обычно содержат вплоть до 20% масла, например, от 5 до 20%. Указанные масляные эмульсии могут содержать жировые капли от 0,1 до 1,0 lm, в частности, от 0,1 до 0,5 lm, и имеют pH в области от 5,5 до 8,0.

Эмульсионные композиции могут быть композициями, полученными путем смешивания анти-ФРН-антитела с интралипидомTM или его компонентами (маслом из соевых бобов, яичными фосфолипидами, глицерином и водой).

Композиции для ингаляции или инсуффляции включают в себя растворы и суспензии в фармацевтически приемлемых водных или органических растворах или их смесях, а также порошки. Жидкие или твердые композиции могут содержать подходящие фармацевтически приемлемые наполнители, как было изложено выше. В некоторых воплощениях указанные композиции вводят оральным или назальным дыхательными путями для локального или системного действия. Композиции предпочтительно в стерильных фармацевтически приемлемых растворителях могут быть распылены с помощью газов. Распыляемые растворы можно непосредственно вдыхать через устройство-небулайзер, или же указанное устройство-небулайзер может быть подсоединено к лицевой маске или к прибору для вентиляции легких с положительным перемежающимся давлением. Раствор, суспензия или порошковая композиция могут быть введены предпочтительно оральным или назальным путями, из устройств, которые доставляют композицию надлежащим образом.

Эффективность лечения может быть установлена способами, хорошо известными в данной области.

Полинуклеотид, кодирующий любое из антител или полипептидов согласно изобретению (таких как антитело E3), также может быть использован для доставки и экспрессии любого из антител или полипептидов согласно изобретению (таких как антитело E3) в требуемой клетке. Очевидно, что экспрессирующий вектор может быть использован для прямой экспрессии антитела E3 или полипептида. Экспрессирующий вектор может быть введен любым способом, известным в данной области, таким как внутрибрюшинный, внутривенный, внутримышечный, подкожный, интратекальный, интравентрикулярный, оральный, энтеральный, парентеральный, интраназальный, дермальный, подъязычный способы или путем ингаляции. Например, введение экспрессирующих векторов включает в себя локальное или системное введение, включая инъекцию, оральное введение, генную пушку или введение через катетер и местное введение. Специалисту в данной области хорошо знакомо введение экспрессирующих векторов, с получением экспрессии экзогенного белка in vivo. См., например, патенты США № 6436908, 6413942 и 6376471.

Может быть использована также адресная доставка терапевтических композиций, содержащих полинуклеотид, кодирующий любое из антител или полипептидов согласно изобретению (таких как антитело E3). Техника рецептор-опосредованной доставки ДНК описана, например, Findeis et al., Trends Biotechnol. (1993) 11:202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J.A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem. (1988) 263:621; Wu et al., J. Biol. Chem. (1994) 269:542; Zenke et al., Proc. Natl. Acad. Sci. (USA) (1990) 87:3655; Wu et al., J. Biol. Chem. (1991) 266:338. Терапевтические композиции, содержащие полинуклеотид, в протоколе генной терапии вводят в интервале от приблизительно 100 нг до приблизительно 200 мг ДНК для локального введения. В процессе выполнения методики генной терапии могут быть использованы также области концентрации от приблизительно 500 нг до приблизительно 50 мг, от приблизительно 1 мкг до приблизительно 2 мг, от приблизительно 5 мкг до приблизительно 500 мкг, и от приблизительно 20 мкг до приблизительно 100 мкг ДНК. Терапевтические полинуклеотиды и полипептиды согласно изобретению могут быть доставлены с помощью носителей для доставки генов. Носители для доставки генов могут быть вирусной или невирусной природы (в общем см. Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; и Kaplitt, Nature Genetics (1994) 6:148). Экспрессия таких кодирующих последовательностей может быть индуцирована с использованием эндогенных промоторов млекопитающего или гетерогенных промоторов. Экспрессия кодирующей последовательности может быть либо конститутивной, либо регулируемой.

Векторы на основе вируса, используемые для доставки требуемого полинуклеотида и экспрессии в требуемой клетке, хорошо известны в данной области. Примеры носителей на основе вируса включают в себя, но ими не ограничиваются, рекомбинантные ретровирусы (см., например, публикации PCT №№ WO 90/07936, WO 94/03622, WO 93/25698, WO 93/25234, WO 93/11230, WO 93/10218, WO 91/02805; патенты США №№ 5219740, 4777127; патент Великобритании № 2200651; и европейский патент № 0345242), на основе альфа-вирусных векторов (например, векторы вируса Синдбис, вируса леса семлики (ATCC VR-67; ATCC VR-1247), вируса реки Росс (ATCC VR-373; ATCC VR-1246) и вируса венесуэльского энцефалита лошадей (ATCC VR-923; ATCC VR-1250; ATCC VR-1249; ATCC VR-532)), и векторов адено-ассоциированного вируса (AAV) (см., например, публикации PCT №№ WO 94/12649, WO 93/03769, WO 93/19191, WO 94/28938, WO 95/11984 и WO 95/00655). Может быть использовано также введение ДНК, связанной с убитым аденовирусом, как описано у Curiel, Hum. Gene Ther. (1992) 3:147.

Могут быть использованы также способы и носители для невирусной доставки, включая, но не ограничиваясь перечисленным, поликатионную конденсированную ДНК, связанную или не связанную только с убитым аденовирусом (см., например, Curiel, Hum. Gene Ther. (1992) 3:147); лиганд-связанную ДНК (см., например, Wu, J. Biol. Chem. (1989) 264:16985); клетки-носители для доставки в эукариотические клетки (см., например, патент США № 5814482; публикации PCT №№ WO 95/07994, WO 96/17072, WO 95/30763 и WO 97/42338) и нейтрализацию нуклеинового заряда или слияние с клеточными мембранами. Может быть использована также голая ДНК. Примеры способов введения голой ДНК описаны в публикации PCT № WO 90/11092 и в патенте США № 5580859. Липосомы, которые могут действовать в качестве носителей для доставки генов, описаны в патенте США № 5422120; в публикациях PCT №№ WO 95/13796, WO 94/23697, WO 91/14445; и в европейском патенте № 0524968. Дополнительные подходы описаны у Philip, Mol. Cell Biol. (1994) 14:2411 и у Woffendin, Proc. Natl. Acad. Sci. (1994) 91:1581.

Диагностические методы и применение

Описанные здесь антитела могут быть использованы также при детектировании, диагностике и мониторинге боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, ассоциированных с измененной или аберрантной экспрессией ФРН (в некоторых воплощениях с повышенной или пониженной экспрессией ФРН (по сравнению с нормальным образцом), и/или с нежелательной экспрессией, такой как наличие экспрессии в ткани (тканях) и/или клетке (клетках), в которых в норме экспрессия ФРН отсутствует, или с отсутствием экспрессии ФРН в ткани (тканях) и/или клетке (клетках), в которых в норме экспрессия ФРН имеет место. В некоторых воплощениях экспрессия ФРН обнаруживается в образце, взятом у индивида, у которого предполагается наличие боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Таким образом, в некоторых воплощениях настоящее изобретение связано со способами, предусматривающими осуществление контакта пробы (образца), взятой у индивида, у которого предполагается наличие измененной или аберрантной экспрессии ФРН, с антителом или полипептидом согласно изобретению, и определением того, отличается ли уровень ФРН от уровня в контрольной пробе или в пробе, которая предназначена для сравнения.

В других воплощениях настоящее изобретение связано со способами, предусматривающими осуществление контакта пробы (образца), взятой у индивида, и определение уровня экспрессии ФРН. В некоторых воплощениях у индивида предполагается наличие боли и/или симптома со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

Обычно для диагностических применений указанное антитело метят детектируемым фрагментом, включающим в себя, но не ограниченным радиоактивными изотопами, флуоресцентными метками и различными фермент-субстратными метками. Способы конъюгации меток с антителом известны в данной области. В других воплощениях настоящего изобретения нет необходимости метить антитела согласно изобретению, и их присутствие можно обнаружить с помощью меченого антитела, которое связывается с антителами согласно изобретению.

Антитела согласно настоящему изобретению могут быть использованы в любом известном способе анализа, таком как анализы конкурентного связывания, прямой и непрямой сэндвич-анализы, а также в анализах иммунопреципитации. Zola, Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press, Inc. 1987).

Указанные антитела могут быть использованы также в диагностических анализах in vivo, таких как визуализация in vivo. Обычно указанное антитело метят радионуклидом (таким как 111In, 99Tc, 14C, 131I, 125I или 3H), так, чтобы представляющие интерес клетки или ткани можно было локализовать с помощью иммуносцинтиографии.

Указанное антитело может быть использовано также в качестве окрашивающего агента при патологии, согласно технологиям, хорошо известным в данной области.

В отношении всех описанных здесь способов следует отметить, что упоминание антагонистических антител против ФРН подразумевает также включение композиций, содержащих один или несколько из таких агентов. Указанные композиции могут дополнительно включать в себя подходящие наполнители, такие как фармацевтически приемлемые наполнители, включая буферы, которые хорошо известны в данной области. Настоящее изобретение может быть использовано отдельно или в сочетании с другими общепринятыми способами лечения.

Наборы, содержащие антагонистические антитела против ФРН, для применения в целях детектирования и/или терапии

Настоящее изобретение связано также с наборами, содержащими антитела для их применения в целях детектирования и/или терапии. Соответственно, в некоторых воплощениях указанные наборы содержат антитело E3. В некоторых воплощениях указанный набор содержит любое описанное здесь антитело или полипептид. В других аспектах указанные наборы могут быть использованы для осуществления любого из описанных здесь способов, включая, например, лечение индивида с болью и/или симптомом со стороны нижних мочевыводящих путей, ассоциированными с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря. Наборы согласно изобретению соответствующим образом упакованы и могут, хоть и необязательно, содержать дополнительные компоненты, такие как буферы и инструкции для применения антитела в любом из описанных здесь способов. В некоторых воплощениях указанные наборы включают в себя инструкции для лечения боли или симптомов со стороны нижних мочевыводящих путей. В некоторых воплощениях указанные наборы содержат описанное здесь антагонистическое антитело против ФРН и инструкции для лечения и/или профилактики боли и/или симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или с болевым синдромом мочевого пузыря у индивида. В некоторых воплощениях антагонистическое антитело против ФРН представляет собой антитело E3.

В другом аспекте настоящее изобретение связано с наборами, содержащими полинуклеотид, кодирующий полипептид E3, как описано в данной заявке. В некоторых воплощениях указанные наборы дополнительно содержат инструкции для применения полинуклеотида в любом из описанных здесь способов.

Следующие далее примеры приведены здесь для иллюстрации настоящего изобретения, но ни в коем случае не для ограничения его объема. Примеры, представленные в международной заявке WO 2004/058184, служат для иллюстрации антител для применения в настоящем изобретении. Полное содержание документа WO 2004/058184 включено в настоящее описание в виде ссылки.

ПРИМЕРЫ

ПРИМЕР 1: Гуманизирование и созревание аффинности мышиного антагонистического антитела 911 против ФРН

A. Общие методы

В настоящем примере были использованы общие методы, указанные ниже.

Получение библиотек

Библиотеки были получены с использованием кассетного ПЦР-мутагенеза с вырожденными олигонуклеотидами, как описано в руководстве Kay et al. (1996), Phage display of peptides and proteins: a laboratory manual, San Diego, Academic Press (см. pages 277-291). Метод «doping codon NNK» был использован для рандомизации одного аминокислотного положения с включением 20 возможных аминокислот. Для рандомизации одного аминокислотного положения для включения только подгруппы аминокислот со специфическими свойствами были использованы допинг-кодоны, как описано у Balint et al., (1993) Gene 137(1): 109-18). Был предпринят сайт-направленный мутагенез с использованием рекомбинантной ПЦР, как описано у Innis et al., (1990) PCR protocols: A guide to methods and applications (см. pp. 177-183).

Низкомасштабное получение Fab-фрагментов

Низкомасштабную экспрессию в 96-луночных планшетах оптимизировали для скрининга библиотек Fab-фрагментов. Начиная с E. coli, трансформированной библиотекой Fab-фрагментов, выбирали колонии для инокуляции как шаблонного планшета (агар LB+ампициллин (50 мкг/мл)+2% глюкозы), так и рабочего планшета (2 мл/лунку, 96 лунок/планшет, содержащий 1,5 мл LB+ампициллин (50 мкг/мл)+2% глюкозы). Оба планшета инкубировали при 30°C в течение 8-12 часов. Шаблонный планшет хранили при 4°C, а клетки из рабочего планшета осаждали при 5000 об/мин и ресуспендировали в 1 мл LB+ампициллин (50 мкг/мл)+1 мМ IPTG для индукции экспрессии Fab-фрагментов. Клетки собирали путем центрифугирования после 5-часового периода экспрессии при 30°C, затем ресуспендировали в 500 мкл буфера HBS-EP (100 мМ буфер HEPES, pH 7,4, 150 мМ NaCl, 0,005% P20, 3 мМ ЭДТА). Лизис клеток, ресуспендированных в HBS-EP, производили в результате одного цикла замораживания (-80°C), затем оттаивания при 37°C. Клеточные лизаты центрифугировали при 5000 об/мин в течение 30 минут для отделения клеточного дебриса от супернатантов, содержащих Fab-фрагменты. Затем указанные супернатанты инъецировали в аппарат BIAcore для плазмонного резонанса с целью получения информации об аффинности для каждого Fab-фрагмента. Клоны, экспрессирующие Fab-фрагменты, извлекали из шаблонного планшета для дальнейшего секвенирования ДНК и для крупномасштабной продукции Fab-фрагментов и подробного определения характеристик, как описано ниже.

Широкомасштабное получение Fab-фрагментов

Для получения подробных кинетических параметров Fab-фрагменты экспрессировали и очищали из крупномасштабных культур. Конические колбы Эрленмейера, содержащие 200 мл LB+ампициллина (50 мкг/мл)+2% глюкозы, инокулировали 5 мл культивируемой в течение ночи культуры из отобранного клона E. coli, экспрессирующего Fab-фрагмент. Клоны инкубировали при 30°C до тех пор, пока не достигалась оптическая плотность OD550 нм, составляющая 1,0, а затем индуцировали путем замены среды на 200 мл LB+ампициллина (50 мкг/мл)+1 мМ IPTG. После 5-часового периода экспрессии при 30°C клетки осаждали путем центрифугирования, затем повторно суспендировали в 10 мл PBS (pH 8). Лизис полученных клеток производили в результате двух циклов замораживания/оттаивания (соответственно, при -80°C и 37°C). Супернатант клеточных лизатов наносили на колонку с Ni-NTA сефарозой superflow (Qiagen, Valencia. CA), уравновешенную PBS, pH 8, затем промывали 5 объемами колонки раствора PBS, pH 8. Индивидуальные Fab-фрагменты элюировали в различных фракциях с помощью PBS (pH 8)+300 мМ имидазола. Фракции, содержащие Fab-фрагменты, собирали и подвергали диализу в PBS, затем производили их количественное определение с помощью ELISA перед определением характеристик их аффинности.

Получение целого антитела

Для экспрессии полноразмерных антител вариабельные области тяжелой цепи и легкой цепи клонировали в два экспрессирующих вектора млекопитающих (Eb.911.E3 или Eb.pur.911.3E для легкой цепи и Db.911.3E для описанной здесь тяжелой цепи) и трансфицировали, используя липофектамин, в клетки HEK 293 для транзитной экспрессии. Антитела очищали с помощью протеина A с использованием стандартных методов.

Biacore-анализ

Аффинности Fab-фрагментов и моноклональных антител против ФРН определяли, используя систему BIAcore3000TM для поверхностного плазмонного резонанса (SPR) (BIAcore, INC, Piscaway NJ). Чипы CM5 активировали N-этил-N'-(3-диметиламинопропил)-карбодиимидгидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS), согласно инструкциям производителя. Человеческий ФРН разводили в 10 мМ ацетате натрия, pH 4,0, и инъецировали поверх активированного чипа в концентрации 0,005 мг/мл. Используя варьируемые времена протекания через каналы индивидуального чипа, получали два интервала областей плотности антигена: 100-200 единиц ответа (RU) для подробного изучения кинетики и 500-600 RU для скрининговых исследований. Такой чип был блокирован этаноламином. Исследования регенерации показали, что смесь буфера для элюции марки Pierce (Продукт № 21004, Pierce Biotechnology, Rockford IL) и 4 M NaCl (2:1) эффективно удаляет связанный Fab-фрагмент, при этом сохраняя активность чФРН на чипе более чем на период 200 инъекций. Буфер HBS-EP (0,01 M HEPES, pH 7,4, 0,15 NaCl, 3 мМ ЭДТА, 0,005% сурфактанта P29) использовали в качестве проточного буфера для всех BIAcore-анализов.

Скрининг-анализ

Скрининговый BIAcore-анализ был оптимизирован для определения аффинности клонов Fab из библиотек. Супернатанты лизатов малых культур инъецировали при 50 мкл/мин в течение 2 минут. Времена диссоциации от 10 до 15 минут были использованы для определения индивидуальной экспоненциальной скорости диссоциации (koff) с помощью программного обеспечения BIAevaluation. Образцы, которые соответствовали скоростям koff в той же области, что и матрица, используемая для создания библиотеки (клон 8L2-6D5, koff 1×10-3 с-1), инъецировали для подтверждения, и были дозволены времена диссоциации вплоть до 45 мин для получения лучших значений koff. Клоны, у которых наблюдались улучшенные (более медленные) значения koff, были экспрессированы в крупном масштабе, и полные кинетические параметры, kon и koff, определяли на очищенном белке. Данный анализ давал возможность детектировать различия в аффинности, которые были приблизительно 2-кратными или выше.

Анализ по определению аффинности

Серийные разведения (оценку KD производили в интервале 0,1-10×) очищенных образцов Fab инъецировали в течение 1 мин при 100 мкл/мин, и были дозволены времена диссоциации, составлявшие вплоть до 2 ч. Концентрации белков Fab определяли методом ELISA и/или методом ДСН-ПААГ-электрофореза, используя в качестве стандарта Fab в известной концентрации (определяемой по аминокислотному анализу). Динамические скорости ассоциации (kon) и скорости диссоциации (koff) получали одновременно, путем аппроксимации данных к соотношению 1:1 в модели связывания Langmuir (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzymology 6. 99-110) с помощью программы BIAevaluation. Значения константы равновесной диссоциации (KD) вычисляли как koff/kon.

B. Гуманизирование и созревание аффинности мышиного антагонистического антитела 911 против ФРН

Мышиное антагонистическое анти-ФРН-антитело, 911 (см. Hongo et al., (2000) Hybhdoma 19(3):215-227), было отобрано для гуманизирования и созревания аффинности. Mab 911 связывает человеческий и крысиный ФРН с высокой аффинностью и не обнаруживает значительной перекрестной реактивности с нейротрофинами NT3, NT4/5 или BDNF. См. Hongo, там же. Аффинность расщепленного папаином Fab-фрагмента мышиного Mab 911 определяли с помощью BIAcore-анализа, как описано выше. Расщепленный папаином Fab-фрагмент мышиного Mab 911 связывал человеческий ФРН с KD, составляющей приблизительно 10 нМ.

Гуманизацию и созревание аффинности проводили в несколько стадий следующим образом:

(1) Получение CDR-привитой матрицы. Удлиненные области CDR легких цепей антитела 911 (то есть включающие в себя области CDR и Чата, и Кабат) прививали в акцепторные последовательности человеческой зародышевой линии О8 с помощью JK2, а удлиненные области CDR тяжелых цепей антитела 911 прививали в акцепторные последовательности человеческой зародышевой линии VH4-59 с помощью JH4. Аминокислотные последовательности акцепторных последовательностей человеческой зародышевой линии приведены на фиг.1A и 1B в международной заявке WO 2004/058184. Нумерация аминокислот является последовательной. С использованием белковых рамок считывания были созданы последовательности ДНК для искусственных генов, кодирующих человеческую рамку считывания с мышиными областями CDR. Такие гуманизированные вариабельные домены тяжелой и легкой цепей были названы, соответственно, hVH и hVL. Кодоны были оптимизированы для использования в клетках E. coli и клетках хомяка. Несколько перекрывающихся олигонуклеотидов (69-90 оснований в длину), удлиняющих общую длину hVL и hVH на два коротких фланкирующих праймера для каждой цепи, были использованы для отдельного синтеза двух указанных генов с помощью рекурсивной ПЦР, в основном так, как описано у Prodromou et al., (1992) Protein Eng 5(8):827-9. Затем полученные в результате фрагменты ДНК правильной длины были очищены в геле, а затем клонированы в бицистронную экспрессирующую плазмиду E. coli (резистентную к ампициллину). Экспрессия антитела была под контролем IPTG индуцибельного промотора lacZ, сходного с таковым, описанным у Barbas (2001) Phage display: a laboratory manual, Cold Spring Harbor, NY, Cold Spring Harbor Laboratory Press (см. Vector pComb3X, на стр. 2.10), однако модификации включали в себя добавку и экспрессию следующих дополнительных доменов: человеческого константного домена легкой каппа-цепи (см. в банке генов под номером доступа № CAA09181) и константного домена CHI человеческого иммуноглобулина IgG2a (в банке генов под номером доступа № P01859).

Аминокислотные последовательности вариабельных областей CDR-привитого антитела (называемого также "матрицей"), обозначенного 8L2-4D5, представлены на фиг.1A и 1B в международной заявке WO 2004/058184. Аффинность 8L2-4D5 была определена с помощью BIAcore-анализа, как описано выше. 8L2-4D5 связывалось с человеческим ФРН с KD, составляющей приблизительно 38 нМ.

(2) Введение точковой мутации в последовательность рамки считывания. Замену V71K вводили в CDR-привитую тяжелую цепь с помощью сайт-направленный мутагенез на основе рекомбинантной ПЦР, как описано у Innis et al., (1995) PCR strategies, San Diego, Academic Press. В результате указанной замены остаток в человеческой рамке считывания заменен соответствующим остатком в мышиной рамке считывания. Полученное в результате антитело было названо 8L2-6D5, и аминокислотная последовательность вариабельной области тяжелой цепи антитела 8L2-6D5 представлена на фиг.1A в международной заявке WO 2004/058184. Аффинность антитела 8L2-6D5 была определена с помощью BIAcore-анализа, как описано выше. Fab-фрагмент антитела 8L2-6D5 связывалось с человеческим ФРН с KD, составляющей приблизительно 15 нМ. Антитело 8L2-6D5 было выбрано в качестве матрицы для созревания аффинности.

(3) Гуманизирование и созревание аффинности областей CDR L1, L2, H1 и H2. Области CDR L1, L2, H1 и H2 были подвергнуты гуманизации и созреванию аффинности. В CDR-областях L1, L2, H1 и H2 были идентифицированы аминокислотные положения, которые, исходя из канонической структуры Чата, не важны для структуры областей CDR (см. Al-Lazikani et al. (1997) J. Mol. Biol. 273(4): 927-48); и подвергнуты рандомизации следующим образом. Получали две библиотеки, содержащие мутации легкой цепи или мутации тяжелой цепи, приведенные в таблице 2, и привитую (мышиную) область CDR L3 или CDR H3, соответственно, с помощью кассетного мутагенеза на основе ПЦР с вырожденными олигонуклеотидами, как описано у Kay et al. (1996), Phage display of peptides and proteins: a laboratory manual, San Diego, Academic Press, с помощью допинг-кодонов, как описано у Balint et al., (1993) Gene 137(1):109-18). Обычно аминокислотные остатки заменяли на остатки, которые более распространены в человеческих антителах, исходя из выравниваний аминокислотных последовательностей легкой цепи и тяжелой цепи антитела 911 с последовательностями антитела человеческой зародышевой линии. Аминокислотные остатки дикого типа (незамещенные) также были представлены в библиотеке, за исключением остатка метионина в положении 50 в CDR H2, в котором метионин дикого типа в указанной библиотеке представлен не был. Метиониновые остатки являются предметом окисления; таким образом, можно было ожидать, что замена такого остатка улучшит стабильность оставшегося антитела. Библиотеки Fab-фрагментов были клонированы в вектор pComb3X плюс человеческие CH1- и Cκ-области, как описано выше.

Таблица 2
1. Библиотека тяжелых цепей H1/H2:
CDR H1
I34 был заменен на F, L, V, S, P, T, A или I
N35 был заменен на N, T, S или Y
CDR H2
M50 был заменен всеми 20 природными аминокислотами
A62 был заменен на A или S
L63 был заменен на L или V
2. Библиотека легких цепей L1/L2
CDR L1
S26 был заменен на S, A, V или F
D28 был заменен на D, A, S или Y
H32 был заменен на H, N, K, D, E, Q или Y
CDR L2
Y50 был заменен на Y, D, A или S
I51 был заменен на I, T, A или V
F54 был заменен на F или L
S56 был заменен на S и T

Для проведения экспериментов по скринингу на предмет определения аффинности каждую библиотеку дополнительно спаривали с соответствующей CDR-примированной легкой или тяжелой цепью (например, библиотеку H1/H2 спаривали с CDR-примированной легкой цепью), экспрессировали антитело, и скрининг индивидуальных клонов на предмет определения аффинности антитела в отношении человеческого ФРН осуществляли с помощью системы BIACORE поверхностного плазмонного резонанса (SPR) (BIAcore, Inc. Piscataway, NJ) в соответствии с инструкциями производителя и так, как описано в настоящей заявке. Определяли koff, kon и KD. Клоны антител ранжировали на основе коэффициентов koff, поскольку обычно наибольшие изменения в аффинности просматриваются на уровне коэффициентов koff, а кроме того, потому, что коэффициенты koff не зависят от концентрации антитела.

Была определена аминокислотная последовательность клонов, которые связываются, и указанная последовательность клонов, которые связываются, представлена в таблице 3.

Таблица 3
Аминокислотные последовательности L1 и L2, аминокислотные последовательности H1 и H2 и кинетические данные для клонов, которые связываются после скрининга библиотеки клонов H1/H2 или L1/L2 на предмет определения аффинности
Мутанты CDR 1-2
кинетические данные
Библиотека клонов легких цепей, спаренных с тяжелой цепью 8L2 CDR L1
АА-последовательность
CDR L2
АА-последовательность
koff
-1)
*KD
(нМ)
8L2-6D5
(контроль)
RASQDISNHLN
(SEQ ID NO: 12)
YISRFHS
(SEQ ID NO: 13)
**1e-3 25
L129 RASQSISNNLN
(SEQ ID NO: 18)
YTSRFHS
(SEQ ID NO: 19)
4,5e-4 11
L208 RASQYISNHLN
(SEQ ID NO: 20)
YTSRFHS
(SEQ ID NO: 21)
4,6e-4 11
L97 RASQSISNQLN
(SEQ ID NO: 22)
YVSRFHS
(SEQ ID NO: 23)
5,6e-4 14
L81 RAFQAISNQLN
(SEQ ID NO: 24)
YISRFHT
(SEQ ID NO: 25)
7,4e-4 18
L6 RAFQSISNQLN
(SEQ ID NO: 26)
YASRFHS
(SEQ ID NO: 27)
8,2e-4 20
Библиотека клонов тяжелых цепей, спаренных с легкой цепью 6D5 CDR H1
АА-последовательность
CDR H2
АА-последовательность
koff
-1)
*KD
(нМ)
8L2-6D5
(контроль)
GFSLIGYDIN
(SEQ ID NO: 9)
MIWGDGTTDYNSAL
(SEQ ID NO: 10)
1e-3 25
H109 GFSLIGYDSN
(SEQ ID NO: 28)
IIWGDGTTDYNSAL
(SEQ ID NO: 29)
1,6e-4 4
H19 GFSLIGYDLN
(SEQ ID NO: 30)
IIWGDGTTDYNSAV
(SEQ ID NO: 31)
2,4e-4 6
H222 GFSLIGYDVT
(SEQ ID NO: 32)
GIWGDGTTDYNSAV
(SEQ ID NO: 33)
3,8e-4 9,5
H225 GFSLIGYDVT
(SEQ ID NO: 34)
GIWGDGTTDYNSSV
(SEQ ID NO: 35)
3,8e-4 9,5
H18 GFSLIGYDAT
(SEQ ID NO: 36)
GIWGDGTTDYNSAV
(SEQ ID NO: 37)
4,2e-4 10,5
H9 GFSLIGYDVS
(SEQ ID NO: 38)
IIWGDGTTDYNSSV
(SEQ ID NO: 39)
4,1e-4 10,2
H227 GFSLIGYDIS
(SEQ ID NO: 40)
QIWGDGTTDYNSSV
(SEQ ID NO: 41)
5,4e-4 13,5
H17 GFSLIGYDAS
(SEQ ID NO: 42)
GIWGDGTTDYNSSV
(SEQ ID NO: 43)
6,1e-4 15,2
H28 GFSLIGYDST
(SEQ ID NO: 44)
SIWGDGTTDYNSAL
(SEQ ID NO: 45)
7,5e-4 18,7
AA, выделенные жирным шрифтом, были рандомизированы, как указано выше
*KD вычисляли с помощью kon 4e4 M-1·с-1
**Здесь, для удобства, "e" означает "×10". Таким образом, 4e4 взаимозаменяемым образом означает 4×104.

Связывание сохранялось в областях CDR, содержащих следующие замены:

CDR H1

I34: связываются S, L, V, I и A.

N35: связываются N, T и S.

CDR H2

M50: связываются M, I, G, Q, S и L.

A62: связываются A и S.

L63: связываются L и V.

CDR L1

S26: связываются S и F.

D28: связываются D, S, A и Y.

H32: связываются H, N и Q.

CDR L2

Y50: связывается Y.

I51: связываются I, T, V и A.

F54: связывается F.

S56: связываются S и T.

Области CDR, содержащие следующие замены, отбирали в общем на основе их аффинности связывания и комбинировали в составе единственного клона, названного H19-L129:

CDR H1: I34L; N35N (без изменений)

CDR H2: M50I; A62A (без изменений); L63V

CDR L1: S26S (без изменений); D28S; H32N

CDR L2: Y50Y (без изменений); I51T; F54F (без изменений); S56S (без изменений)

Указанные мутации комбинировали (путем амплификации H- и L-цепей посредством ПЦР, расщепления указанных продуктов ПЦР и вектора (pRN8) рестрикционным ферментом и осуществления лигирования 3 фрагментов) в составе единственного клона, названного H19-L129, который также включал в себя примированные области CDR H3 и L3. Последовательность вариабельных областей тяжелой цепи и легкой цепи H19-L129 представлена на фиг.1A и 1B в международной заявке WO 2004/058184, а в таблице 4 показана аминокислотная последовательность областей CDR L1, L2, H1 и H2. H19-L129 связывается с ФРН с KD, составляющей приблизительно 1 нМ, что определяли посредством BIAcore-анализа, как было описано выше.

Таблица 4
Аминокислотная последовательность областей CDR H1, H2, L1 и L2 и кинетические данные для комбинированного клона H19-L129
Комбинированный клон: мутации в областях CDR H1, H2, L1, L2 CDR L1
CDR H1
АА-последовательность
CDR L2
CDR H2
АА-последовательность
koff
-1)
*KD
(нМ)
H19-L129 CDR L1:
RASQSISNNLN
(SEQ ID NO: 18)
CDR H1:
GFSLIGYDLN
(SEQ ID NO: 30)
CDR L2:
YTSRFHS
(SEQ ID NO: 19)
CDR H2:
IIWGDGTTDYNSAV
(SEQ ID NO: 31)
1,1e-4 3,5
*KD вычисляли с помощью kon 4e4 M-1·с-1

(4) Созревание аффинности областей CDR H3 и L3. Созревание аффинности областей CDR H3 и L3 проводили в две стадии. Сначала в процессе, названном "сканирующим мутагенезом библиотеки", каждый аминокислотный остаток в H3 и L3 был индивидуально подвергнут предварительному скринингу с целью идентификации аминокислотных положений, в которых мутация приводит к повышенной аффинности связывания с человеческим ФРН. На основе полученных результатов сканирующего мутагенеза библиотеки (также называемого "анализ рандомизации малой библиотеки") отбирали подруппу аминокислотных положений в H3 и L3 для получения библиотеки созревания аффинности, и проводили скрининг библиотеки созревания аффинности в отношении человеческого ФРН, используя BIAcore-анализ, как описано в настоящей заявке. Признано, что эти технологии могут быть использованы в большинстве случаев.

(a) Сканирующий мутагенез библиотеки

Аминокислотные остатки в каждом положении в CDR H3 и L3 были индивидуально подвергнуты предварительному скринингу на предмет отбора замен, которые приводят к повышению аффинности связывания с человеческим ФРН. Частота аминокислотных замен в любом данном положении, которые приводят к улучшенному связыванию, такому же связыванию или ухудшенному связыванию или же к отсутствию связывания, дает информацию о положениях в областях CDR, которые могут быть заменены многими разными аминокислотами (включая все 20 аминокислот), и положений в областях CDR, которые не могут быть заменены или которые могут быть заменены лишь небольшим количеством аминокислот. Идентифицировали также и аминокислотные замены, которые в результате приводят к повышенной аффинности связывания. На основе результатов такого скрининга отбирали подруппу аминокислотных положений в областях CDR H3 и L3 для получения библиотеки созревания аффинности, и проводили скрининг библиотеки созревания аффинности.

Были получены индивидуальные библиотеки Fab-фрагментов, в которых каждая аминокислота в областях CDR L3 и H3 поочередно была рандомизирована по всем 20 аминокислотам, что приводило в результате к образованию нескольких малых библиотек (5 библиотек для легкой цепи и 13 библиотек для тяжелой цепи), каждая из которых имеет сложность, составляющую 20 возможных вариантов аминокислот в каждом аминокислотном положении. Во всех случаях нативная (то есть неизмененная) аминокислота в библиотеке была представлена. Библиотеки были получены путем кассетного мутагенеза на основе ПЦР с вырожденными олигонуклеотидами, как описано у Kay et al. (1996), Phage display of Peptides and Proteins: a laboratory manual, San Diego, Academic Press, с помощью допинг-кодонной NNK, чтобы рандомизировать одно аминокислотное положение с включением 20 возможных аминокислот. Антитело 8L2-6D5 (CDR-привитое антитело, имеющее мутацию V71K в области рамки считывания) служило матрицей для построения библиотеки, поскольку более низкая аффинность CDR-привитого антитела позволяла легче детектировать различия в аффинности у мутантов H3 и L3 в процессе скрининга. Таким образом, каждый член библиотеки содержал области CDR3 (либо H3-области, либо L3-области) с одной аминокислотной заменой и 5 примированных областей CDR.

20-80 клонов из каждой малой библиотеки были подвергнуты скринингу с помощью BIAcore-анализа, как описано в настоящей заявке. Образцы одновременно изучали методом BIAcore-анализа на предмет аффинности связывания с ФРН в одном канале BIAcore-чипа и на присутствие Fab-фрагмента путем связывания антитела с пента-гистидиновой меткой в другом канале сенсорного чипа, чтобы обнаружить гистидиновую метку на C-конце тяжелой цепи. Клоны, которые экспрессировали белок, были классифицированы как клоны, имеющие такую же аффинность, худшую аффинность, лучшую аффинность или отсутствие связывания, с использованием для классификации koff: Результаты указанного анализа представлены в таблице 5.

Таблица 5
Клоны, которые экспрессировали белок, были на основе koff классифицированы как имеющие такую же аффинность, худшую аффинность, лучшую аффинность или отсутствие связывания
Мутация Лучше 1e-3< Такая же
≥1e-3,
2e-3<
Хуже
≥2e-3
Нет связывания Процент АА, которые сохраняют способность связывания
Легкая цепь
L_S91X 13% 40% 20% 26% 50%
L_K92X 100% ~100%
L_T93X 93% 7% 93%
L_L94X 40% 60% 40%
L_Y96X 13% 80% 7% 13%
Тяжелая цепь
H_G98X 50% 37% 13% 50%
H_G99X 46% 54% 46%
H_Y100X 26% 73% 26%
H_Y101X 6% 12% 82% 6%
H_Y102X 7% 25% 68% 7%
H_G103X 4% 21% 16% 58% 25%
H_T104X 20% 30% 50% 20%
H_S105X 10% 25% 26% 39% 35%
H_Y106X 75% 25% 75%
H_Y107X 8% 46% 46% 8%
H_F108X 23% 27% 50% 23%
H_D109X 29% 46% 25% 29%
H_Y110X 90% 5% 5% 90%

Была определена последовательность всех клонов с улучшенной аффинностью, выявлены частота и идентичность аминокислотных замен, которые привели к повышению аффинности. Кроме того, из каждой библиотеки было отобрано несколько клонов, которые сохранили аффинность, сходную с таковой у клона 8I2-6D5, с тем, чтобы уточнить замены аминокислотной последовательности, которые были дозволены в данном положении, даже несмотря на то, что такие замены необязательно увеличивают аффинность связывания. Результаты указанного анализа суммированы в таблице 6.

Таблица 6
Мутации CDR H3
(матрица 8L2-6D5, включающая в себя аминокислотную последовательность антитела 911 CDR H3: GGYYYGTSYYFDY (SEQ ID NO: 11)
koff-1)
1E-3
KD* (нМ) 25
Y100L 1,2E-3 30
Y100R 1,1E-3 27
Y101W 5,6E-4 14
G103A 1,6E-4 4
T104S 2,2E-3 55
S105A 5,1E-4 13
S105T 6,4E-4 16
Y106R 1,6E-3 40
Y106T 2,0E-3 50
Y106M 2,7E-3 67
Y107F 1,4E-3 35
F108W 1,22E-3 30
D109N 1,5E-3 37
D109G 1E-3 25
Y110K 1,4E-3 35
Y110S 1,5E-3 37
Y110R 1,6E-3 40
Y110T 1,7E-3 42
Мутации CDR L3
(матрица 8L2-6D5, включающая в себя аминокислотную последовательность CDR L3 дикого типа (незамещенную): QQSKTLPYT (SEQ ID NO: 14)
koff-1)
1E-3
KD* (нМ) 25
S91E 2,5E-4 6
Y96R 1,7E-3 42
*KD вычисляли с помощью kon 4e4 M-1·с-1

Несколько мутаций приводило к повышению аффинности связывания. По меньшей мере следующие мутации приводили к значительному повышению аффинности связывания по сравнению с матрицей 8L2-6D5: (H_Y101W (CDR-последовательность GGYWYGTSYYFDY (SEQ ID NO: 46)); H_S105A (CDR-последовательность GGYYYGTAYYFDY (SEQ ID NO: 47)); H_S105T (CDR-последовательность GGYYYGTTYYFDY (SEQ ID NO: 48)); H_G103A (CDR-последовательность GGYYYATSYYFDY (SEQ ID NO: 49); и L_S91E (CDR-последовательность QQEKTLPYT (SEQ ID NO: 50)).

Результаты указанного эксперимента были использованы в качестве руководящего принципа для селекции аминокислотных положений при получении библиотек созревания аффинности.

Указанный эксперимент также обеспечивает информацию относительно частоты аминокислотных замен в любом данном положении, которые приводят к улучшенному связыванию, такому же связыванию или ухудшенному связыванию, или же к отсутствию связывания, как показано в таблице 5. Такая информация позволяет идентифицировать положения аминокислот в областях CDR, которые могут быть заменены многими разными аминокислотами (включая все 20 аминокислот), и положения в областях CDR, которые не могут быть заменены или которые могут быть заменены лишь небольшим количеством аминокислот или же очень малым количеством аминокислот (в некоторых воплощениях, не могут быть заменены никакими аминокислотами). Полученные результаты позволили также выявить и аминокислотные замены, которые приводят к повышению аффинности связывания.

(b) Созревание аффинности

Далее, результаты анализа рандомизации малой библиотеки (см. выше) были использованы для отбора остатков для получения библиотек H3 и L3 для созревания аффинности областей CDR H3 и L3. Остатки Y101 и G103 области CDR H3 и остатки S91 и K92 области CDR L3 были отобраны для получения библиотек H3 и L3 для созревания аффинности областей CDR H3 и L3.

Данная библиотека позволяет скомбинировать мутации в H3 и L3 одновременно в CDR-примированном клоне 8L2-6D5 и отдельно в исходном H19-L129, при этом разнообразие библиотеки составляет порядка 80 различных клонов. В таблице 7 приведены аминокислотные остатки, выбранные для замены, а также аминокислотные остатки, которые были замещены в каждом из положений.

Таблица 7
Аминокислотные остатки в H3 и L3, выбранные для замены, и аминокислотные остатки, которые были замещены в каждом из положений
CDR H3:
Y101 был заменен на Y и W, C. (Отметим, что C был включен потому, что использование кодона TRS в одном вырожденном олигонуклеотиде приводило также к выработке кодона C).
G103 был заменен на A, P, S
CDR L3:
S91 был заменен на E.
K92 был заменен всеми двадцатью аминокислотами. A, R, K и H связываются.

Каждый полипептид был экспрессирован в виде Fab-фрагмента, и аффинность индивидуальных клонов в отношении человеческого ФРН была определена для каждой из библиотек в результате скрининга с использованием BIACORE-анализа согласно инструкциям производителя, а также в соответствии с тем, как описано выше. Результаты такого анализа приведены в таблице 8.

Таблица 8
Комбинация мутаций в областях CDR L3 H3
(матрица 8L2-6D5)
koff-1)
1E-3
KD* (нМ)
25
L_S91E; L_K92A
(CDR-последовательность QQEATLPYT (SEQ ID NO: 51))
H_Y101W; H_G103A
(CDR-последовательность GGYWYATSYYFDY (SEQ ID NO: 52))
5,5E-4 13
L_S91E; L_K92R
(CDR-последовательность QQERTLPYT (SEQ ID NO: 53))
H_Y101W; H_G103A
(CDR-последовательность GGYWYATSYYFDY (SEQ ID NO: 54))
1,0E-4 25
Комбинация мутаций в областях CDR L3 H3
(матрица H19-L129, мутант H1H2L1L2)
koff-1)
1,1e-4
KD* (нМ)
L_S91E; L_K92H
(CDR-последовательность QQEHTLPYT (SEQ ID NO: 55))
H_Y101W; H_G103A
(CDR-последовательность GGYWYATSYYFDY (SEQ ID NO: 56))
(клон Е3)
1,2E-5 0,3
L_S91E; L_K92S
(CDR-последовательность QQESTLPYT (SEQ ID NO: 57))
H_Y101W; H_G103S
(CDR-последовательность GGYWYSTSYYFDY (SEQ ID NO: 58))
4,7E-5 1,1
L_S91E; L_K92K
(CDR-последовательность QQEKTLPYT (SEQ ID NO: 59))
H_Y101Y; H_G103A
(CDR-последовательность GGYYYATSYYFDY (SEQ ID NO: 60))
2E-5 0,5
L_S91E; L_K92R
(CDR-последовательность QQERTLPYT (SEQ ID NO: 61))
H_Y101W; H_G103A
(CDR-последовательность GGYWYATSYYFDY (SEQ ID NO: 62))
(клон 3C)
1,4E-5 0,35
L_S91E; L_K92R
(CDR-последовательность QQERTLPYT (SEQ ID NO: 63))
H_Y101Y; H_G103A
(CDR-последовательность GGYYYATSYYFDY (SEQ ID NO: 64))
1,5E-5 0,37
*KD вычисляли с помощью kon 4e4 M-1·с-1

Исходя из аффинности связывания, для дальнейшего изучения были выбраны наилучшие клоны, E3 (взаимозаменяемым образом называемый "3E") и 3C. Клон E3 содержал следующие CDR-замены: CDR H3: Y101W, G103A; и CDR L3: S91E, K92H, которые были объединены в одном клоне, который включал в себя также следующие мутации в L1, L2, H1 и H2:

CDR H1: I34L;

CDR H2: M50I; L63V;

CDR L1: D28S; H32N;

CDR L2: I51T.

Последовательность вариабельных областей тяжелой цепи и легкой цепи антитела E3 приведена в SEQ ID NO: 1 и 2 (см. также фиг.1A и 1B в международной заявке WO 2004/058184). Клон 3C содержал следующие CDR-замены: CDR L3: S91E; K92R; CDR H3: Y101W, G103A, которые были объединены в одном клоне, который включал в себя также мутации в L1, L2, H1 и H2, описанные для клона 3E.

Последовательности 3E и 3C были клонированы в экспрессирующий вектор млекопитающего для продуцирования Fab-фрагмента и полноразмерного антитела и экспрессированы в клетках HEK293 и очищены с помощью Ni-NTA или протеин A-хроматографии. Чистый белок был подвергнут тщательному количественному анализу на основе аминокислотного анализа.

Аффинности связывания Fab-фрагментов E3 и 3C с человеческим ФРН измеряли с помощью BIAcore-анализа согласно инструкциям производителя и приведенному здесь описанию, за исключением того, что на чип использовали 100 RU ФРН, с тем, чтобы избежать эффекта нарушения связи (диссоциации). Вкратце, несколько концентраций антител (Fab-фрагментов) инъецировали в течение 2 минут поверх чипа CM5 со 100 RU иммобилизованного на нем человеческого ФРН, и интервал в 1800 секунд предоставляли для процесса диссоциации. Мышиное антитело 911 (Fab) анализировали в качестве контроля. Данные анализировали с помощью программного обеспечения BIAevaluation согласно инструкциям производителя. Результаты анализа антитела E3 и 911 представлены на фиг.9 и 10 в международной заявке WO 2004/058184. Антитело E3 связывалось с человеческим ФРН с KD, составляющим приблизительно 0,07 нМ (и с kon, составляющим приблизительно 6,0e5 M-1·с-1, и с koff, составляющим приблизительно 4,2e-5 с-1). Антитело 3C связывалось с человеческим ФРН с KD, составляющим приблизительно 0,35 нМ (с koff, составляющим приблизительно 1,4E-5). В отличие от этого, мышиное антитело 911 связывалось с ФРН с KD порядка 3,7 нМ, с koff порядка 8,4×10-5 с-1 и с kon порядка 2,2×104 M-1·с-1.

Антитело E3 (взаимозаменяемым образом называемое также 3E) было выбрано для дальнейших анализов на основе его высокой аффинности связывания. Чтобы проверить способность E3 предотвращать взаимодействие ФРН с рецепторами ФРН trkA и p75, 2,5 нМ человеческого ФРН предварительно смешивали и инкубировали в течение одного часа с 0-50 нМ антитела E3 (Fab). После инкубации образцы со скоростью 10 мкл/минуту инъецировали на чип CM5 производства BIAcore, содержащий 260 RU рецептора p75 (канал 2) и 600 RU рецептора trkA (канал 3), и определяли процент связывания. Результаты указанного анализа приведены на фиг.11 в международной заявке WO 2004/058184. Повышенные концентрации Fab E3 блокировали взаимодействие ФРН как с p75, так и с trkA, что было выявлено по уменьшению сигнала (измеренного в RU), указывающему на то, что Fab E3 блокирует взаимодействие человеческого ФРН как с trkA, так и с p75. Когда концентрация антитела E3 (Fab) достигала концентрации ФРН (при концентрации ФРН, составляющей приблизительно 2,5 нМ), связывания с ФРН не наблюдали (что продемонстрировано нулевым сигналом). Тот факт, что ноль процентов связывания ФРН-рецептора наступает тогда, когда концентрация ФРН становится равной концентрации антитела 3E, предполагает, что 2,5 нМ ФРН составляет по меньшей мере в десять раз больше, чем KD для E3 в отношении ФРН в состоянии равновесия.

ПРИМЕР 2: Оценка ФРН-блокирующей способности анти-ФРН-антител с помощью анализа выживаемости тригеминальных нейронов мыши E13.5

Способность Fab E3 или полного антитела E3 блокировать активность ФРН оценивали путем измерения способности указанного антитела ингибировать ФРН-зависимую выживаемость тригеминальных нейронов мыши E13.5 in vitro. Тригеминальный ганглий состоит из кожных сенсорных нейронов, которые иннервируют лицевую область. Выживаемость тригеминальных нейронов мыши E13.5 представляет собой чувствительный метод оценки ФРН-блокирующей активности анти-ФРН-антагонистических антител, поскольку ФРН необходим для поддержания жизнеобеспечения этих нейронов. Например, при насыщающих концентрациях ФРН такая выживаемость приближается к 100% сроком до 48 часов в культуре. В отличие от этого, менее 5% нейронов выживает к 48-часовому сроку культивирования в отсутствие ФРН.

Изучение выживаемости проводили следующим образом: беременных мышей-самок Swiss Webster, находящихся на одной и той же стадии беременности, подвергали эйтаназии с применением ингаляции CO2. Рога матки удаляли, а эмбрионов на эмбриональной стадии E13.5 извлекали и подвергали декапитации. Тригеминальные ганглии рассекали с помощью электролитически заточенных вольфрамовых игл. Затем ганглии подвергали действию трипсина, механически разделяли и высевали с плотностью 200-300 клеток на лунку в определенной, бессывороточной среде в 96-луночных планшетах, покрытых поли-L-орнитином и ламинином.

Блокирующую активность анти-ФРН-Fab-фрагментов или антител устанавливали путем добавления к тригеминальным нейронам варьирующих количеств анти-ФРН-антител Mab 911 (Fab), 8L2-6D5; H19-L129; E3 и 3C; и человеческого или крысиного ФРН в следующих концентрациях: 0,4 нг/мл (~15 пМ; такая концентрация является насыщающей концентрацией ФРН для выживания) и 0,04 нг/мл (~1,5 пМ; эта концентрация составляет приблизительно IC50). Через 48 часов культивирования клеток их подвергали автоматизированному иммуноцитохимическому протоколированию, предпринятому на управляемом жидкостном дисплейном терминале Biomek FX (Beckman Coulter) следующим образом: фиксацией с помощью 4% формальдегида, 5% сахарозы и PBS; пермеабилизацией с помощью 0,3% Triton X-100 в PBS); блокированием неспецифических связывающих сайтов с помощью 5% нормальной козьей сыворотки, 0,11% БСА в PBS; и последовательной инкубацией с первичным и вторичным антителами для детектирования нейронов. Первичным антителом было поликлональное антитело против продукта гена, белка 89.5 (PGP9.5, Chemicon), установленного фенотипического нейронального маркера. Вторичным антителом было козье противокроличье антитело Alexa Fluor 488 (Molecular Probes), в сочетании с ядерным красителем Hoechst 33342 (Molecular Probes) для маркировки ядер всех клеток, присутствующих в культуре. Картина поглощения и анализ изображения были предприняты на установке Discovery-I/Genll Imager (Universal Imaging Corporation). Изображения были автоматически получены при двух длинах волн для Alexa Fluor 488 и Hoechst 33342, с окраской ядра, используемой в качестве отправной точки для системы автофокусирования изображения указанной установки, поскольку окраска ядер имеет место во всех лунках. Были выбраны соответствующие показатели и число визуализированных сайтов на лунку, с тем, чтобы поверхность каждой лунки полностью покрывалась. Автоматизированный анализ изображений производился для подсчета числа нейронов, присутствующих в каждой лунке через 48 часов культивирования, на основе их специфического окрашивания анти-PGP9.5-антителом. Тщательная обработка изображения и применение морфологии и селективного фильтра на основе интенсивности флуоресценции привело к точному подсчету количества нейронов на лунку.

Результаты такого эксперимента показали, что Fab E3 с высокой аффинностью блокирует активность ФРН. Указанные результаты представлены на фиг.4-6 в международной заявке WO 2004/058184 и в таблице 9.

Фиг.4 в документе WO 2004/058184 представляет собой график, демонстрирующий ФРН-зависимую выживаемость нейронов E13.5 в присутствии различных концентраций человеческого и крысиного ФРН.

Фиг.5 в документе WO 2004/058184 представляет собой график сравнения ФРН-блокирующего эффекта различных Fab-фрагментов в присутствии либо 0,04 нг/мл человеческого ФРН (приблизительно 1,5 пМ; показано на нижней панели) либо 0,4 нг/мл человеческого ФРН (приблизительно 15 пМ; показано на верхней панели). 1,5 пМ ФРН соответствовало концентрации приблизительно EC50 ФРН, способствующей выживанию, тогда как 15 пМ являлось насыщающей концентрацией ФРН. Выживаемость тригеминальных нейронов мыши E13.5 при различных концентрациях Fab E3, мышиного 911 Fab, и Fab H19-L129 и Fab 8L2-6D5 была установлена, как описано выше. Значения IC50 (в пМ) вычисляли для каждого Fab при каждой концентрации ФРН, и эти значения представлены в таблице 9. Fab E3 строго блокировал зависимую от человеческого ФРН выживаемость тригеминальных нейронов, с IC50, составляющей приблизительно 21 пМ в присутствии 15 пМ человеческого ФРН, и с IC50, составляющей приблизительно 1,2 пМ в присутствии 1,5 пМ человеческого ФРН. Fab-фрагменты 3C и H19-L129 также строго блокировали зависимую от человеческого ФРН выживаемость тригеминальных нейронов.

Фиг.6 представляет собой график сравнения ФРН-блокирующего эффекта различных Fab-фрагментов в присутствии либо 0,04 нг/мл крысиного ФРН (приблизительно 1,5 пМ; показано на нижней панели) либо 0,4 нг/мл крысиного ФРН (приблизительно 15 пМ; показано на верхней панели). 1,5 пМ ФРН составляло концентрацию приблизительно EC50 ФРН, в то время как 15 пМ являлось насыщающей концентрацией ФРН. Выживаемость тригеминальных нейронов мыши E13.5 при различных концентрациях Fab E3, мышиного Fab 911, а также Fab H19-L129 и Fab 8L2-6D5 была установлена, как описано выше. Значения EC50 (в пМ) вычисляли для каждого Fab при каждой концентрации ФРН, и эти значения представлены в таблице 9. Fab E3 строго блокировал зависимую от человеческого ФРН выживаемость тригеминальных нейронов, с IC50, составляющей приблизительно 31,6 пМ в присутствии 15 пМ человеческого ФРН, и с IC50, составляющей приблизительно 1,3 пМ в присутствии 1,5 пМ человеческого ФРН. Fab-фрагменты 3C и H19-L129 также строго блокировали зависимую от человеческого ФРН выживаемость тригеминальных нейронов.

Таблица 9
Человеческий ФРН IC50 (в присутствии 15 пМ ФРН) IC50 (в присутствии 1,5 пМ ФРН)
пМ пМ
8L2-6D5 Fab 1580,5 461,8
H19-L129 Fab 60,1 9,6
3E Fab <21,0 <1,2
3C Fab 80,9 5,6
911 Fab 322,3 63,5
Крысиный ФРН IC50 (15 пМ ФРН) IC50 (1,5 пМ ФРН)
пМ пМ
8L2-6D5 Fab 730,3 169,4
H19-L129 Fab 31,0 6,0
3E Fab <8,3 <1,3
3C Fab 31,6 6,0
911 Fab 161,0 34,6

В различных экспериментах авторы изобретения сравнивали способность полного антитела E3 и Fab-фрагмента 3E ингибировать ФРН-зависимую выживаемость нейронов E13.5 в присутствии 0,4 нг/мл (насыщающая концентрация) человеческого ФРН. Результаты анализов представлены на фиг.10 в документе WO 2004/058184. Полное антитело E3 и Fab-фрагмент 3E проявляли сходные уровни ингибирования ФРН-зависимой выживаемости, когда концентрации полного антитела и Fab-фрагмента были нормализованы к числу ФРН-связывающих сайтов (Fab-фрагмент имеет один связывающий сайт, а полное антитело имеет два связывающих сайта). Эти результаты показали, что эффект авидности за счет связывания полным антителом димера ФРН отсутствует.

В других экспериментах авторы изобретения сравнивали способность различных концентраций (20, 4, 0,8, 0,16, 0,032, 0,0064, 0,00128 и 0,0 нМ) антитела E3, антитела 911 и рецептора trkA иммунадгезина (состоящего из внеклеточного домена рецептора trkA ФРН, слитого с иммуноглобулиновым Fc-доменом, CH2-CH3) ингибировать ФРН-зависимую выживаемость нейронов E13.5 в присутствии 0,4 нг/мл (насыщающие концентрации). Эти результаты представлены на фиг.11 в документе WO 2004/058184. Указанные результаты свидетельствуют о том, что антитело E3 блокирует ФРН лучше, чем антитело 911 или иммуноадгезин trkA.

ПРИМЕР 3: Оценка специфичности анти-ФРН-антитела E3 с помощью анализов выживаемости мышиных тригеминального и нодозного нейронов

Способность антитела E3 специфически блокировать активность ФРН оценивали путем измерения способности указанного антитела к ингибированию in vitro выживаемости тригеминальных нейронов мыши E17/18 в присутствии насыщающих концентраций ФРН, ФРН-зависимого нейротрофина NT3 или неродственного ФРН нейротрофического фактора, макрофаг-стимулирующего белка (MSP). Выживаемость тригеминальных нейронов мыши E17/18 является чувствительным анализом для оценки ФРН-блокирующей активности антагонистических антител против ФРН, поскольку ФРН необходим для поддержания жизнеспособности указанных нейронов в концентрациях, больших, чем уровень ФРН, необходимый для поддержания выживаемости нейронов E13.5 TG. Выживаемость указанных нейронов поддерживается также в присутствии NT3 или MSP; следовательно, выживаемость указанных нейронов также является чувствительным анализом для оценки того, блокирует ли антагонистическое антитело против ФРН также и NT3 или MSP.

Способность антитела E3 специфически блокировать активность ФРН была оценена также путем измерения способности указанного антитела ингибировать выживаемость нодозных нейронов мыши E17 в присутствии насыщающих концентраций BDNF или NT4/5. Выживаемость нодозных нейронов поддерживается BDNF или NT4/5; следовательно, выживаемость указанных нейронов является чувствительным анализом для оценки BDNF- или NT4/5-блокирующей активности антагонистического антитела против ФРН.

Анализ выживаемости проводили следующим образом: беременных мышей-самок Swiss Webster, находящихся на одной и той же стадии беременности, подвергали эйтаназии с применением ингаляции CO2. Рога матки удаляли, а эмбрионов (на 17 или 18 дни эмбриональной стадии) извлекали и подвергали декапитации. Тригеминальные и нодозные ганглии рассекали и подвергали очистке. Затем ганглии подвергали действию трипсина, механически разделяли и высевали с плотностью 100-300 клеток на лунку в определенной, бессывороточной среде в 4-луночных планшетах (Greiner), покрытых поли-L-орнитином и ламинином.

Тригенинальные нейроны E17/18 выращивали либо без добавления нейротрофных факторов (отрицательный контроль), либо в присутствии насыщающих концентраций человеческого ФРН (400 пМ и 15 пМ) (положительный контроль); NT3 (400 пМ); или MSP (600 пМ). Устанавливали дубликаты культур, которые включали в себя в различных концентрациях Fab-фрагменты и полные антитела E3 и 911. Концентрация Fab-фрагмента и полных антител была указана в соответствии с количеством связывающих сайтов (например, полное антитело содержит два связывающих сайта, тогда как Fab-фрагмент содержит один связывающий сайт).

Нодозные нейроны E17 выращивали либо в отсутствие добавленных нейротрофных факторов (отрицательный контроль), либо в присутствии насыщающих концентраций BDNF (400 пМ) (положительный контроль) или NT4/5 (400 пМ), или неродственного ФРН фактора роста ILF (интерлейкин ингибирующий фактор). Были использованы высокие концентрации нейротрофинов, поскольку целью этого эксперимента было проверить специфичность указанных антител. Были установлены дубликаты культур, которые опять содержали различные концентрации, с добавлением или без добавления антител E3 и 911. Через 48 часов культивирования клеток общее количество нейронов, выживших в каждой лунке в конкретных условиях, устанавливали путем подсчета вручную с использованием фазово-контрастного микроскопа.

Результаты этих экспериментов показали, что антитела E3 и 911 полностью блокировали стимулирующие эффекты выживаемости, оказываемые ФРН в отношении тригеминальных нейронов E18. В отличие от этого, антитела E3 и 911 не влияли на выживаемость тригеминальных нейронов, стимулируемых NT3 или MSP, или на выживаемость нодозных нейронов, стимулируемых BDNF или NT4/5, или LIF. Эти результаты показали, что антитело E3 обладает селективной специфичностью в отношении ФРН, поскольку никакого детектируемого взаимодействия между указанными антителами и другими родственными ФРН нейротрофинами (NT3, NT4/5, BDNF) в концентрациях, 1000-кратно - 10000-кратно превышающих эффективную для блокирования ФРН концентрацию, обнаружено не было. Кроме того, эти результаты продемонстрировали, что гибель нейронов, наблюдаемая в ФРН-обогащенных культурах ФРН-зависимых нейронов при добавлении антитела или Fab E3, происходила в результате специфического взаимодействия между указанными антителами и ФРН, а не за счет вырабатываемого токсического эффекта. Мышиное антагонистическое антитело против ФРН, 911, также было тестировано, и был получен сходный результат. Следует учесть, что благодаря высоким концентрациям используемых нейротрофинов оба антитела, E3 и 911, очень близки к их титрационным условиям, и ожидалось, что они будут связываться с ФРН в сходной степени, поскольку в таких условиях различия в аффинности связывания указанных антител с ФРН будут менее заметны.

Результаты этих экспериментов представлены на фиг.12, 13, 14 и 15 в документе WO 2004/058184. Представленные данные отражают средний процент выживаемости через 48 часов пребывания в культуре (±стандартная ошибка среднего, n=3 для каждой полученной точки) по отношению к выживаемости, наблюдаемой в положительном контроле для каждого эксперимента (например, 100% выживаемости тригеминальных нейронов, растущих в присутствии насыщающей концентрации ФРН и 100% выживаемости нодозных нейронов, растущих в присутствии насыщающей концентрации BDNF, соответственно). Фиг.12-13 в документе WO 2004/058184 представляют собой графики, показывающие, что антагонистическое антитело против ФРН, E3 или Fab-фрагмент E3 не ингибируют выживаемость, стимулируемую NT3 и MSP, даже при такой высокой концентрации антитела как 200 нМ. В отличие от этого, 20 нМ антитела E3 или Fab-фрагмента 3E, а также Fab-фрагмента 911 полностью блокировали выживаемость, достигаемую под действием ФРН. Тестировали также и мышиное антагонистическое антитело против ФРН, 911, и наблюдаемые результаты оказались сходными. В частности, на фиг.12 в документе WO 2004/058184 представлены графики, изображающие сравнительные эффекты различных концентраций (20 нМ, 2 нМ или 0,2 нМ) антитела E3 Fab (обозначенного на этой фигуре как "3E") и мышиного антитела 911 Fab в отношении выживаемости тригеминальных нейронов E18 в присутствии или в отсутствие нейротрофина (обозначенного как "контроль"), 400 пМ ФРН (обозначенных как "NGF-400pM"), 10 нМ NT3 (обозначенных как "NT3-10nM") или 600 пМ MSP (обозначенных как "MSP-600pM"). Фиг.13 в документе WO 2004/058184 представляет собой график, изображающий сравнительные эффекты различных концентраций (200 нМ и 80 нМ) Fab-фрагмента E3 и полного антитела, а также полного мышиного антитела 911 и его Fab-фрагмента в отношении выживаемости тригеминальных нейронов E17 в присутствии или в отсутствие нейротрофинов (обозначено как "no factor"), 400 пМ ФРН (обозначено как "NGF-400pM"), 10 нМ NT3 (обозначено как "NT3-10nM") или 600 пМ MSP (обозначено как "MSP-600pM").

Фиг.14-15 в документе WO 2004/058184 представляют собой графики, показывающие, что антагонистическое антитело против ФРН, E3 или Fab-фрагмент E3 не ингибируют выживаемость нодозных нейронов E17, стимулируемую BDNF, NT4/5 или LIF. Тестировали также и мышиное антагонистическое антитело против ФРН, 911, и наблюдаемые результаты оказались сходными. В частности, на фиг.14 в документе WO 2004/058184 представлен график, на котором изображены сравнительные эффекты различных концентраций (200 нМ или 80 нМ) полного антитела E3 (обозначенного на этой фигуре как "3E"), Fab-фрагмента E3, полного антитела 911 или Fab-фрагмента 911 в отношении выживаемости нодозных нейронов E17 в присутствии добавленных нейротрофинов (обозначено как "no factors"), 400 пМ BDNF (обозначено как "BDNF-400pM"), 400 пМ NT4/5 (обозначено как "NT4/5-400pM") или 2,5 нМ LIF (обозначено как "LIP-2.5nM"). На фиг.15 в документе WO 2004/058184 представлен график, на котором изображено сравнение эффектов различных концентраций (200 нМ, 20 нМ, 2 нМ) Fab-фрагмента E3 (обозначенного на этой фигуре как "3E"), или Fab-фрагмента 911 в отношении выживаемости нодозных нейронов E17 в присутствии не добавленных нейротрофинов (обозначено как "control"), 400 пМ BDNF (обозначено как "BDNF-400pM"), 400 пМ NT4/5 (обозначено как "NT4/5-400pM") или 2,5 нМ LIF (обозначено как "LIP-2.5нМ").

ПРИМЕР 4: Получение экспрессирующих векторов млекопитающего и экспрессии антитела E3 в клетках млекопитающих

Три экспрессирующих вектора млекопитающих были спроектированы и сконструированы для применения при экспрессии антитела E3 в клетках млекопитающих.

Вектор Db.911.3E является экспрессирующим вектором, который содержит вариабельную область тяжелой цепи антитела E3 и константную область человеческого IgG2a, и который является подходящим для транзитной или стабильной экспрессии тяжелой цепи. Вектор Db.911.3E состоит из нуклеотидных последовательностей, соответствующих следующим областям: области промотора мышиного цитомегаловируса (нуклеотиды 1-612); области искусственного интрона (нуклеотиды 619-1507); области, кодирующей DHFR (нуклеотиды 707-1267); области сигнального пептида гормона роста человека (нуклеотиды 1525-1602); вариабельной области тяжелой цепи антитела 3E (нуклеотиды 1603-1965); константной области тяжелой цепи человеческого IgG2a, содержащей следующие мутации: от A330P331 до S330S331 (нумерация аминокислот соответствует последовательности IgG2a дикого типа; см. Eur. J. Immunol. (1999) 29: 2613-2624); области позднего сигнала полиаденилирования SV40 (нуклеотиды 2974-3217); области энхансера SV40 (нуклеотиды 3218-3463); области фага f1 (нуклеотиды 3551-4006) и области, кодирующей бета-лактамазу (AmpR) (нуклеотиды 4443-5300). Вектор Db.911.3E был депонирован в ATCC 8 января 2003 года, и ему в ATCC был присвоен номер доступа № PTA-4895.

Вектор Eb.911.3E является экспрессирующим вектором, который содержит вариабельную область легкой цепи антитела E3 и константную область человеческой каппа-цепи, и который является подходящим для транзитной экспрессии легкой цепи. Вектор Eb.911.3E состоит из нуклеотидных последовательностей, соответствующих следующим областям: области промотора мышиного цитомегаловируса (нуклеотиды 1-612); области интрона EF-1 человека (нуклеотиды 619-1142); области сигнального пептида гормона роста человека (нуклеотиды 1173-1150); вариабельной области легкой цепи антитела E3 (нуклеотиды 1251-1571); константной области человеческой каппа-цепи (нуклеотиды 1572-1892); области позднего сигнала полиаденилирования SV40 (нуклеотиды 1910-2153); области энхансера SV40 (нуклеотиды 2154-2399); области фага f1 (нуклеотиды 2487-2942) и области, кодирующей бета-лактамазу (AmpR) (нуклеотиды 3379-4236). Вектор Eb.911.3E был депонирован в ATCC 8 января 2003 года, и ему в ATCC был присвоен номер доступа № PTA-4893.

Вектор Eb.pur.911.3E является экспрессирующим вектором, который содержит вариабельную область легкой цепи антитела E3 и константную область человеческой каппа-цепи, и который является подходящим для стабильной экспрессии легкой цепи. Вектор Eb.pur.911.3E состоит из нуклеотидных последовательностей, соответствующих следующим областям: области промотора мышиного цитомегаловируса (нуклеотиды 1-612); области интрона EF-1 человека (нуклеотиды 619-1758); области, кодирующей ген pac (пуромицина R) (нуклеотиды 739-1235); области 5'UTR человеческого hsp70 (нуклеотиды 1771-1973); области сигнального пептида гормона роста человека (нуклеотиды 1985-2062); вариабельной области легкой цепи антитела E3 (нуклеотиды 2063-2383); константной области человеческой каппа-цепи (нуклеотиды 2384-2704); области позднего сигнала полиаденилирования SV40 (нуклеотиды 2722-2965); области энхансера SV40 (нуклеотиды 2966-3211); области фага f1 (нуклеотиды 3299-3654) и области, кодирующей бета-лактамазу (AmpR) (нуклеотиды 4191-5048). Вектор Eb.pur.911.3E был депонирован в ATCC 8 января 2003 года, и ему в ATCC был присвоен номер доступа № PTA-4894.

Транзитную клеточную экспрессию предпринимали следующим образом: клетки CHO и HEK293T в 150-мм чашках транзитно ко-трансфицировали 25 мкг каждой из плазмид (то есть одной плазмидой, содержащей тяжелую цепь, и одной плазмидой, содержащей легкую цепь). ДНК смешивали со 100 мкл липофектамина-2000 (Invitrogen), в соответствии с инструкциями производителя. Осуществляли контактирование ДНК-липидных комплексов с клетками в среде DMEM/F12 без содержания сыворотки или антибиотиков в течение 5 часов. После такой инкубации среду заменяли средой для экспрессии, Opti-MEM (Invitrogen), без каких-либо добавок, и инкубировали в течение двух дней. Клеточные супернатанты, содержащие антитело, последовательно собирали вплоть до четвертой смены среды. Супернатанты очищали методом аффинной хроматографии с использованием смолы протеин A MapSelect (Amersham biosciences 17-5199-02). Антитело связывалось со смолой протеин A в буфере, содержащем 0,3 M глицин, 0,6 M NaCl, при pH 8, затем его элюировали 0,1 M цитратным буфером при pH 3. Фракции, содержащие антитело, немедленно нейтрализовывали 1 M Трис-буфером при pH 8,0. Затем фпакции с антителом диализовали и концентрировали в PBS.

ПРИМЕР 5: Клиническое испытание

Пациентов с клиническим диагнозом интерстициального цистита лечили антагонистическим антителом E3 против ФРН с целью подтверждения безопасности и эффективности анти-ФРН-антитела E3 при лечении одного или более из следующих признаков: боли и симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря. Пациенты, которых предполагалось лечить, имели от умеренной до тяжелой формы интерстициального цистита, что было определено на основе боли в тазовой области и по шкале симптомов неотложности/частоты мочеиспускания (PUF - Parsons et al. Urology 2002; 60:573-578)), соответствующих по меньшей мере значению 16, а также по показателю выраженности симптомов интерстициального цистита O'Leary-Sant (ICSI - O'Leary et al. Urology 1997; 49(Suppl 5A):58-63), соответствующему по меньшей мере значению 8 при скрининге, предварявшем лечение. Остальные включенные критерии также находились в полном соответствии. Пациентов, которые не соответствовали всем включенным критериям или которые соответствовали по одному или нескольким исключающим критериям, при скрининге определяли как неподходящих и не включали в число лиц, проходящих данное испытание.

Оценивали эффективность единственной дозы антитела, вводимой путем инфузии, по сравнению с плацебо, при лечении боли и симптомов со стороны нижних мочевыводящих путей, ассоциированных с интерстициальным циститом и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря. Антитело E3 вводили пациентам внутривенно в дозе 200 мкг/кг. Помимо эффективности, сравнивали величину эффекта лечения с плацебо, ответ биомаркеров интерстициального цистита на лечение антителом, и, помимо других измерений, оценивали скорость ответа на лечение. Биомаркеры, помимо прочего, включали в себя ФРН, гликопротеин-51 (GP-51), антипролиферативный фактор (APF) и HB-эпидермальный фактор роста (HB-EGF).

Первичную конечную точку оценки эффективности терапии анализировали через 6 недель после внутривенной инфузии единственной дозы антитела E3. Оценки, проводимые на 2, 10 и 16 неделях после введения дозы, относили ко вторичным конечным точкам оценки эффективности терапии. Первичная конечная точка оценки эффективности терапии будет соответствовать изменению в числовой 11-балльной оценочной шкале боли (NRS). В качестве вторичной конечной точки оценки эффективности терапии использовали шкалу оценки по показателю выраженности симптомов интерстициального цистита O'Leary-Sant (ICSI). Другие вторичные конечные точки оценки включали в себя показатель проблемности интерстициального цистита (ICPI) O'Leary-Sant (ICPI - O'Leary et al. Urology 1997; 49(Suppl 5A):58-63), ICSI плюс ICPI, боль в тазовой области и неотложность/частоту мочеиспускания (PUF), среднюю боль количество приступов боли в дневное время, изменения в переменных процесса мочеиспускания, отмечаемые в дневнике пациента в течение периода испытаний, включая частоту мочеиспусканий, частоту мочеиспусканий в ночное время, частоту эпизодов недержания мочи, частоту эпизодов неотложных позывов, средний объем выделения при мочеиспускании, среднюю тяжесть боли при интерстициальном цистите, частоту срочных эпизодов мочеиспускания, среднее число эпизодов нарушения сна, средний показатель боли по болевой шкале, ассоциированной с половой активностью, общую оценку ответа на лечение, оценку пациентом влияния лечения, неудачную попытку лечения, биомаркеры, границы безопасности и/или фармакокинетические показатели. Биомаркеры, помимо прочего, могут включать в себя ФРН, гликопротеин-51 (GP-51), антипролиферативный фактор (APF) и HB-эпидермальный фактор роста (HB-EGF).

Следующие данные получены на основании промежуточного анализа продолжающегося в настоящее время клинического испытания с использованием описанного выше протокола для оценки безопасности и эффективности у пациента с интерстициальным циститом/синдромом раздраженного мочевого пузыря/болевым синдромом мочевого пузыря (ИЦ/СРМП/БСМП). В промежуточном анализе были использованы данные по 24 пациентам. Явное улучшение (снижение) наблюдалось как в отношении оценки боли NRS, так и в отношении оценки ICSI. Улучшение, наблюдаемое у пациентов, получавших антитело E3, превосходило то, которое наблюдалось у пациентов, получавших плацебо. Полученные данные подтверждают тот факт, что антитело E3 может быть эффективным в лечении боли и других симптомов со стороны нижних мочевыводящих путей (LUTS), ассоциированных с ИЦ/СРМП/БСМП. Однако окончательные результаты указанного исследования еще предстоит оценить.

Антитело Е3 200 мкг/кг Плацебо
Изменение в средней интенсивности боли к 6-ой неделе по сравнению с исходным уровнем
N 13 11
LS-среднее* (90% CI) -1,6 (-5,1, 1,8) -0,9 (-4,1, 2,2)
Отличие от плацебо* -0,7 (-2,3, 0,9)
Изменение в показателе ICSI по полной шкале к 6-ой неделе по сравнению с исходным уровнем
N 11 9
LS-среднее* (90% CI) -3,9 (-11,5, 3,6) -2,0 (-8,9, 4,9)
Отличие от плацебо* -1,9 (-5,6, 1,7)
Боль оценивали по 11-балльной (0-10) числовой оценочной шкале боли (NRS). Эта шкала ратифицирована и широко используется в оценке лечения и отражает характер боли.

Показатель выраженности симптомов интерстициального цистита (ICSI) позволяет установить глобальную степень тяжести симптомов ИЦ, со шкалой переменных от 0 до 20. Это основано на 4 вопросах, связанных с болью и LUTS, ассоциированных с ИЦ/СРМП/БСМП. Последние включают в себя оценку степени тяжести дневных и ночных частоты и неотложности мочеиспусканий, а также боль в мочевом пузыре свыше 4 предшествующих недель.

Депонирование биологического материала

В американском коллекторе типовых культур (ATCC), 10801 University Boulevard, Manassas, Virginia, USA, были депонированы следующие материалы:

Материал № доступа в ATCC Дата депонирования
Eb.911.3E Легкая цепь E3 PTA-4893 8 января, 2003 года
Eb.pur.911.3E Легкая цепь E3 PTA-4894 8 января, 2003 года
Db.911.3E Тяжелая цепь E3 PTA-4895 8 января, 2003 года

Подробности, касающиеся указанных депозитов, можно найти в документе WO 2004058184, содержание которого в полном объеме включено в настоящее описание в виде ссылки.

Последовательности антител

Вариабельная область тяжелой цепи (области CDR согласно Кабат подчеркнуты; области CDR согласно Чату ВЫДЕЛЕНЫ ЖИРНЫМ ШРИФТОМ И КУРСИВОМ )

QVQLQESGPGLVKPSETLSLTCTVSGFSLI G YDLN WIRQPPGKGLEWIG IIWGDGTTDYNSAVKS RVTISKDTSKNQFSLKLSSVTAADTAVYYCAR GGYWYATSYYFDY WGQGTLVTVS (SEQ ID NO: 1)

Вариабельная область легкой цепи (области CDR согласно Кабат подчеркнуты; области CDR согласно Чату ВЫДЕЛЕНЫ ЖИРНЫМ ШРИФТОМ И КУРСИВОМ )

DIQMTQSPSSLSASVGDRVTITC RASQSISNNLN WYQQKPGKAPKLLIY YRSRFHS GVPSRFSGSGSGTDFTFTISSLQPEDIATYYC QQEHTLPYT FGQGTKLEIKRT (SEQ ID NO: 2)

Удлиненные области CDR тяжелой цепи E3

CDR H1: GFSLIGYDLN (SEQ ID NO: 3)

CDR H2: IIWGDGTTDYNSAVKS (SEQ ID NO: 4)

CDR H3: GGYWYATSYYFDY (SEQ ID NO: 5)

Удлиненные области CDR легкой цепи E3

CDR L1: RASQSISNNLN (SEQ ID NO: 6)

CDR L2: YTSRFHS (SEQ ID NO: 7)

CDR L3: QQEHTLPYT (SEQ ID NO: 8)

Удлиненные области CDR мышиного моноклонального антитела 911

Удлиненные области CDR тяжелой цепи 911

CDR H1: GFSLIGYDIN (SEQ ID NO: 9)

CDR H2: MIWGDGTTDYNSALKS (SEQ ID NO: 10)

CDR H3: GGYYYGTSYYFDY (SEQ ID NO: 11)

Удлиненные области CDR легкой цепи 911

CDR L1: RASQDISNHLN (SEQ ID NO: 12)

CDR L2: YISRFHS (SEQ ID NO: 13)

CDR L3: QQSKTLPYT (SEQ ID NO: 14)

Аминокислотная последовательность тяжелой цепи E3 (полная)

QVQLQESGPGLVKPSETLSLTCTVSGFSLIGYDLNWIRQPPGKGLEWIGIIWGDGTTDYNSAVKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCARGGYWYATSYYFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRWSVLTWHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMЛDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID N0: 16)

Аминокислотная последовательность легкой цепи 3E (полного антитела)

DIQMTQSPSSLSASVGDRVTITCRASQSISNNLNWYQQKPGKAPKLLIYYTSRFHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQEHTLPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NО: 17)

Нуклеотидная последовательность тяжелой цепи 3E (полного антитела)

CAGGTGCAGCTGCAGGAGTCTGGCCCAGGACTGGTGAAGCCTTCCGAGACCCTGTCCCTCACCTGCACTGTCTCTGGGTTCTCACTTATCGGCTATGATCTTAACTGGATCCGACAGCCTCCAGGGAAGGGACTGGAGTGGATTGGGATTATCTGGGGTGATGGAACCACAGACTATAATTCAGCTGTCAAATCCCGCGTCACCATCTCAAAAGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGGAGGTTATTGGTACGCCACTAGCTACTACTTTGACTACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCAGCCTCCACCAAGGGCCCATCTGTCTTCCCACTGGCCCCATGCTCCCGCAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCAGAACCTGTGACCGTGTCCTGGAACTCTGGCGCTCTGACCAGCGGCGTGCACACCTTCCCAGCTGTCCTGCAGTCCTCAGGTCTCTACTCCCTCAGCAGCGTGGTGACCGTGCCATCCAGCAACTTCGGCACCCAGACCTACACCTGCAACGTAGATCACAAGCCAAGCAACACCAAGGTCGACAAGACCGTGGAGAGAAAGTGTTGTGTGGAGTGTCCACCTTGTCCAGCCCCTCCAGTGGCCGGACCATCCGTGTTCCTGTTCCCTCCAAAGCCAAAGGACACCCTGATGATCTCCAGAACCCCAGAGGTGACCTGTGTGGTGGTGGACGTGTCCCACGAGGACCCAGAGGTGCAGTTCAACTGGTATGTGGACGGAGTGGAGGTGCACAACGCCAAGACCAAGCCAAGAGAGGAGCAGTTCAACTCCACCTTCAGAGTGGTGAGCGTGCTGACCGTGGTGCACCAGGACTGGCTGAACGGAAAGGAGTATAAGTGTAAGGTGTCCAACAAGGGACTGCCATCCAGCATCGAGAAGACCATCTCCAAGACCAAGGGACAGCCAAGAGAGCCACAGGTGTATACCCTGCCACCATCCAGAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAGGGATTCTATCCATCCGACATCGCCGTGGAGTGGGAGTCCAACGGACAGCCAGAGAACAACTATAAGACCACCCCTCCAATGCTGGACTCCGACGGATCCTTCTTCCTGTATTCCAAGCTGACCGTGGACAAGTCCAGATGGCAGCAGGGAAACGTGTTCTCTTGTTCCGTGATGCACGAGGCCCTGCACAACCACTATACCCAGAAGAGCCTGTCCCTGTCTCCAGGAAAGTAA (SEQ ID NO: 65)

Нуклеотидная последовательность вариабельного домена тяжелой цепи 3E

CAGGTGCAGCTGCAGGAGTCTGGCCCAGGACTGGTGAAGCCTTCCGAGACCCTGTCCCTCACCTGCACTGTCTCTGGGTTCTCACTTATCGGCTATGATCTTAACTGGATCCGACAGCCTCCAGGGAAGGGACTGGAGTGGATTGGGATTATCTGGGGTGATGGAACCACAGACTATAATTCAGCTGTCAAATCCCGCGTCACCATCTCAAAAGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGGAGGTTATTGGTACGCCACTAGCTACTACTTTGACTACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA (SEQ ID NO: 66)

Нуклеотидная последовательность вариабельного домена легкой цепи 3E (полного антитела)

GATATCCAGATGACACAGTCCCCATCCTCCCTGTCTGCCTCTGTGGGTGACCGCGTCACCATCACCTGCCGCGCATCTCAGTCCATTAGCAATAATCTGAACTGGTATCAGCAGAAGCCAGGCAAAGCCCCAAAACTCCTGATCTACTACACCTCACGCTTCCACTCAGGTGTCCCATCACGCTTCAGTGGCAGTGGCTCTGGTACAGATTTCACCTTCACCATTAGCAGCCTGCAACCAGAAGATATTGCCACTTATTACTGCCAACAGGAGCATACCCTTCCATATACCTTCGGTCAAGGCACCAAGCTGGAGATCAAACGCACTGTGGCTGCACCATCTGTCTTCATCTTTCCTCCATCTGATGAGCAGTTGAAATCCGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCACGCGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCCGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACCCTGAGCAAAGCAGACTACGAGAAACACMAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGTTCTCCAGTCACAAAGAGCTTCAACCGCGGTGAGTGCTAA (SEQ ID NO: 67)

Нуклеотидная последовательность вариабельного домена легкой цепи 3E

GATATCCAGATGACACAGTCCCCATCCTCCCTGTCTGCCTCTGTGGGTGACCGCGTCACCATCACCTGCCGCGCATCTCAGTCCATTAGCAATAATCTGAACTGGTATCAGCAGAAGCCAGGCAAAGCCCCAAAACTCCTGATCTACTACACCTCACGCTTCCACTCAGGTGTCCCATCACGCTTCAGTGGCAGTGGCTCTGGTACAGATTTCACCTTCACCATTAGCAGCCTGCAACCAGAAGATATTGCCACTTATTACTGCCAACAGGAGCATACCCTTCCATATACCTTCGGTCAAGGCACCAAGCTGGAGATCAAACGC (SEQ ID NO: 68)

Указанные выше последовательности и другие описанные здесь последовательности приведены в прилагаемом списке последовательностей.

Список последовательностей нестандартного формата (на естественном языке)

Последовательности, идентифицируемые как SEQ ID NO: 1-8, 15-68, 70-72, 74-77 в прилагаемом списке последовательностей, имеют нестандартный формат, отмеченный как "синтетическая конструкция".

Очевидно, что описанные здесь примеры и воплощения приведены исключительно в целях иллюстрации данного изобретения, и что в их свете специалистами в данной области будут предложены различные модификации или изменения, которые, разумеется, будут рассматриваться как находящиеся в рамках концепции данного изобретения и входящие в объем, охватываемый настоящей заявкой.

1. Применение антагонистического антитела против ФРН в лечении или профилактике неотложных позывов к мочеиспусканию, ассоциированных с интерстициальным циститом, и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, у субъекта, где указанное антагонистическое антитело против ФРН:
a) конкурирует за связывание с ФРН человека с антителом, содержащим аминокислотные последовательности SEQ ID NO: 1 и 2;
b) связывается с тем же самым эпитопом ФРН человека, что и антитело, содержащее аминокислотные последовательности SEQ ID NO: 1 и 2;
c) содержит три CDR из вариабельной области тяжелой цепи с SEQ ID NO: 1 и три CDR из вариабельной области легкой цепи с SEQ ID NO: 2; и/или
d) содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность SEQ ID NO: 1, и вариабельную область легкой цепи, содержащую аминокислотную последовательность SEQ ID NO: 2,
где применение указанного антитела приводит к снижению показателя оценки боли (NRS) и показателя выраженности симптомов интерстициального цистита (ICSI).

2. Применение антагонистического антитела против ФРН по п.1, где указанное антитело против ФРН:
(a) связывается с ФРН с KD, составляющей меньше приблизительно 2 нМ;
(b) ингибирует зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши Е13.5 с IC50, составляющей приблизительно 100 пМ или менее, где IC50 измеряют в присутствии приблизительно 15 пМ человеческого ФРН; и
(c) ингибирует зависимую от человеческого ФРН выживаемость тригеминальных нейронов мыши Е13.5 с IC50, составляющей приблизительно 10 пМ или менее, где IC50 измеряют в присутствии приблизительно 1,5 пМ ФРН.

3. Применение антагонистического антитела против ФРН по п.1 или 2, где указанным субъектом является человек.

4. Применение антагонистического антитела против ФРН по п.1 или 2, где указанное антитело представляет собой моноклональное антитело.

5. Применение антагонистического антитела против ФРН по п.1 или 2, где указанное антитело является гуманизированным антителом.

6. Применение антагонистического антитела против ФРН по п.1 или 2, где указанное антитело связывается с человеческим ФРН.

7. Применение антагонистического антитела против ФРН по п.1 или 2, где антитело далее предназначено для применения в лечении или профилактике боли, ассоциированной с интерстициальным циститом, и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря.

8. Применение антагонистического антитела против ФРН по п.7, где боль, ассоциированная с интерстициальным циститом, и/или синдромом раздраженного мочевого пузыря, и/или болевым синдромом мочевого пузыря, выбрана из группы, включающей в себя боль в нижней (тазовой) области живота; боль в мочевом пузыре; надлобковую боль; вагинальную боль; боль в пенисе, яичках, мошонке и в промежности; боль в уретре; диспареунию; боль, давление или дискомфорт, которые могут нарастать при наполнении мочевого пузыря.

9. Применение антагонистического антитела против ФРН по п.1 или 2, где указанное антитело содержит вариабельную область тяжелой цепи, содержащую:
(a) область CDR1, представленную в SEQ ID NO: 3;
(b) область CDR2, представленную в SEQ ID NO: 4; и
(c) область CDR3, представленную в SEQ ID NO: 5, и вариабельную область легкой цепи, содержащую:
(a) область CDR1, представленную в SEQ ID NO: 6;
(b) область CDR2, представленную в SEQ ID NO: 7; и
(c) область CDR3, представленную в SEQ ID NO: 8,
где указанное антитело специфически связывается с ФРН.

10. Применение антагонистического антитела против ФРН по п.1 или 2, где указанное антитело содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, по меньшей мере, на 80% идентичную аминокислотной последовательности SEQ ID NO: 1, и вариабельную область легкой цепи, содержащую аминокислотную последовательность, по меньшей мере, на 80% идентичную аминокислотной последовательности SEQ ID NO: 2, где указанное антитело специфически связывается с ФРН.

11. Применение антагонистического антитела против ФРН по п.10, где указанное антагонистическое антитело против ФРН содержит аминокислотные последовательности, представленные в SEQ ID NO: 1 и 2.

12. Применение антагонистического антитела против ФРН по п.11, где указанное антагонистическое антитело против ФРН содержит аминокислотные последовательности, представленные в SEQ ID NO: 16 и 17.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к антителам против ангиопоэтина-2 человека, кодирующим их нуклеиновым кислотам и клеткам-хозяевам, а также к применению антител для получения лекарственного средства для предупреждения метастазирования, лечения рака или сосудистых заболеваний.

Изобретение относится к области биохимии, в частности к антителам против ангиопоэтина-2 человека, кодирующим их нуклеиновым кислотам и клеткам-хозяевам. Антитело отличается тем, что не связывается с ангиопоэтином-1 человека.

Изобретение относится к биохимии. Описаны выделенные антитела человека, или гуманизированные антитела, или их антигенсвязывающие фрагменты, которые специфически связываются с фактором 8 роста и дифференциации (GDF8) и блокируют активность GDF8.

Изобретения относятся к области биотехнологии. Предложены: варианты моноклонального антитела против VEGF или его антигенсвязывающего фрагмента, которые характеризуются тем, что содержат 6 CDR и при этом возможно замену Т51А в CDR-L2, а также имеют одну или комбинацию замен по сравнению с антителом бевацизумабом, а именно: 1.

Изобретение относится к области биохимии, в частности к ανβ8 антагонистам. Заявлено анти-ανβ8-антитело для уменьшения активации TGFβ у индивида.

Изобретение относится к биохимии. Описаны рекомбинантные антитела человека, которые распознают фактор роста эндотелия сосудов человека (VEGF-A), блокируют его взаимодействие с рецептором VEGFR2, и препятствуют его пролиферативному эффекту в условиях in vitro и проангиогенному эффекту в условиях in vivo.

Изобретение относится к области биотехнологии, конкретно к ингибиторам сигнального пути AXL, и может быть использовано в медицине. Получают растворимый вариант полипептида AXL без трансмембранного домена AXL, который содержит по меньшей мере одну модификацию аминокислоты в положении номер n, где n выбран из 32, 72, 87, 92 или 127 или их сочетание, где n+7 соответствует нумерации SEQ ID NO: 1 - последовательности AXL дикого типа, в котором указанная модификация повышает сродство связывания полипептида AXL со специфически задерживающим рост белком 6 (GAS6), которое, по меньшей мере, примерно в 2 раза сильнее, чем сродство полипептида AXL дикого типа.

Настоящее изобретение относится к области иммунологии. Предложено полностью человеческое моноклональное антитело, которое связывает инсулиноподобный фактор роста-II (IGF-II) и имеет перекрестную реактивность к IGF-I, а также его антигенсвязывающий фрагмент.

Настоящее изобретение относится к биотехнологии и представляет собой антитела против фактора роста нервов (ФРН). Настоящее изобретение также раскрывает фармацевтическую композицию для облегчения боли, ассоциированной с заболеванием или состоянием, при котором развитие или сохранение боли опосредовано ФРН, содержащую указанные антитела, а также набор для лечения связанного с ФРН заболевания, такого как, например, остеоартрит, нуклеиновые кислоты, кодирующие тяжелую или легкую цепь антитела, вектор экспрессии, клетку-хозяина для получения указанных антител, способ экспрессии указанных антител против ФРН, а также применение указанных антител в способе лечения боли и для получения лекарственного средства для лечения боли, ассоциированной с заболеванием или состоянием, при котором развитие или сохранение боли опосредовано ФРН.

Изобретение относится к области биотехнологии, конкретно к биспецифическим антителам, и может быть использовано в медицине. Конструируют антитело, содержащее одну из следующих групп из шести последовательностей гипервариабельной области (HVR): (a) HVR-L1, включающую последовательность NIAKTISGY; (b) HVR-L2, содержащую последовательность WGSFLY; (c) HVR-L3, содержащую последовательность HYSSPP; (d) HVR-H1, содержащую последовательность NIKDTY; (e) HVR-H2, содержащую последовательность RIYPTNGYTR; и (f) HVR-Н3, содержащую последовательность WGGDGFYAMD; или (a) HVR-L1, включающую последовательность NIAKTISGY; (b) HVR-L2, содержащую последовательность WGSFLY; (c) HVR-L3, содержащую последовательность HYSSPP; (d) HVR-H1, содержащую последовательность NISGTY; (e) HVR-H2, содержащую последовательность RIYPSEGYTR; и (f) HVR-Н3, содержащую последовательность WVGVGFYAMD.

Изобретение относится к соединениям формулы (VIII) и их фармацевтически приемлемым солям. Соединения изобретения обладают антагонистическим эффектом в отношении P2X3 и/или P2X2/3 рецептора. В формуле (VIII) Z1 и Z2, каждый независимо, представляют собой атом кислорода или атом серы; кольцо D представляет собой бензольное кольцо, пиридиновое кольцо, пиримидиновое кольцо, пиразиновое кольцо или пиридазиновое кольцо; кольцо В представляет собой 6-членное ароматическое гетероциклическое кольцо с 1-3 атомами азота, 5-членное ароматическое гетероциклическое кольцо с одним атомом азота и одним атомом кислорода, одним атомом серы, одним атомом азота и одним атомом серы, одним атомом кислорода, двумя атомами азота, одним атомом кислорода и двумя атомами азота, одним атомом серы и двумя атомами азота, четырьмя атомами азота или тремя атомами азота, или незамещенное 9-членное конденсированное ароматическое гетероциклическое кольцо с одним атомом азота и одним атомом кислорода или двумя атомами азота.
Изобретение относится к медицине, а именно к ветеринарной хирургии и акушерству, и может быть использовано для трансфеморальной блокады нервов мочевого пузыря у мелких животных.
Изобретение относится к медицине, а именно к урологии, и может быть использовано для лечения лучевого и интерстициального цистита. Для этого проводят инсталляцию гелевого препарата «Колегель-АДЛ» с 1 по 20 день через день, а затем «Колегель-ДНК-Л» с 21 по 56 день по два раза в неделю.

Изобретение относится к фармацевтической композиции для лечения рака мочевого пузыря. Указанная композиция содержит эффективное количество валрубицина и диметилсульфоксида, а также полиэтоксилированное касторовое масло или одно или более веществ, выбранных из триметилхитозана, моно-N-карбоксиметилхитозана, N-диэтилметилхитозана, натрий каприновокислого, цитохалазина В, IL-1, поликарбофила, карбопола 934Р, N-сульфат-N,O-карбоксиметилхитозана, токсина Zonula occludens, 1-пальмитоил-2-глутароил-sn-глицеро-3-фосфохолина, и представлена в дозированной форме для внутрипузырного введения путем инстилляции.
Изобретение относится к медицине, а именно к педиатрии, рефлексотерапии. Способ включает воздействие на биологически активные точки (БАТ), прием настоев трав, разрешение имеющихся конфликтных ситуаций, соблюдение режимов сна.

Изобретение относится к соединению, представленному формулой (I), где представляет собой α-конфигурацию; представляет собой β-конфигурацию; и представляет собой α-конфигурацию, β-конфигурацию или их произвольную смесь, его соль, или его смесь с диастереомером в произвольном соотношении, или его циклодекстриновый клатрат.
Изобретение относится к медицине и представляет собой лекарственную композицию для лечения цистита. Композиция содержит 0,8-2,0% мас.

Изобретение относится к медицине, а именно к андрологии и неврологии, и может быть использовано для дифференциальной диагностики генеза гиперактивности мочевого пузыря у мужчин с урологической и неврологической патологией.

Фармацевтическая композиция для модифицированного высвобождения содержит (1) анилид (R)-2-(2-аминотиазол-4-ил)-4'-[2-[(2-гидрокси-2-фенилэтил)амино]этил]уксусной кислоты или его фармацевтически приемлемую соль, (2) по меньшей мере, одну добавку, которая обеспечивает проникновение воды в фармацевтическую композицию и которая имеет растворимость, такую что объем воды, требуемой для растворения 1 г добавки, равен 10 мл или меньше, и (3) гидрогель-образующий полимер, имеющий среднюю молекулярную массу приблизительно 100000 или более, или вязкость 12 мПа·с или более в 5% водном растворе при 25°С.
Изобретение относится к медицине, а именно к урологии и неврологии, и может быть использовано для выбора препарата для лечения гиперактивности мочевого пузыря у мужчин.

Изобретение относится к области биохимии, в частности к антигенсвязывающей молекуле (АСМ), которая специфически связывает связанный с мембраной человеческий карциноэмбриональный антиген (CEA).
Наверх