Ингибиторы апоптоза и их применение



Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение
Ингибиторы апоптоза и их применение

 


Владельцы патента RU 2582247:

ЮНИВЕРСИТЕ ДЕ МОНПЕЛЬЕ 1 (FR)
САНТР НАСЬОНАЛЬ ДЕ ЛЯ РЕШЕРШ СЬЕНТИФИК (FR)
ЮНИВЕРСИТЕ ДЕ МОНПЕЛЬЕ 2-СЬЯНС Э ТЕКНИК (FR)

Изобретение относится к области биотехнологии, конкретно к получению антиапоптозных фрагментов белка DAXX, и может быть использовано в медицине для лечения острого инфаркта миокарда (AMI), церебрального инфаркта, при трансплантации органов, операциях на сердце, острых нарушениях кровообращения, реперфузионных повреждениях и ишемии. Получают биологически активные фрагменты из 17-24 последовательных аминокислот белка DAXX, включающих KKSRKEKKQTGSGPLG, а также их пептидомиметики и конъюгаты с проникающим в клетки пептидом. Изобретение позволяет эффективно ингибировать апоптоз клеток, в частности апоптоз клеток, опосредованный рецептором Fas. 12 н. и 10 з.п. ф-лы, 17 ил., 4 табл., 1 пр.

 

Родственная заявка

Настоящая патентная заявка претендует на приоритет по Международной патентной заявке №PCT/IB2010/003158, поданной 18 ноября 2010 г., которая включена сюда путем ссылки во всей полноте.

Область техники, к которой относится изобретение

Изобретение имеет отношение к ингибиторам апоптоза и их применению, в частности в медицине.

Уровень техники

Коронарная болезнь сердца является ведущей причиной смертности во всем мире, что составляет 3,8 млн смертей у мужчин и 3,4 млн смертей у женщин в год. По мере старения популяции и распространения сопутствующих заболеваний (например, ожирения и метаболического синдрома), как в последние годы, огромное бремя для общественного здравоохранения, обусловленное ишемической болезнью сердца, вероятно будет еще больше возрастать (см. обзор в Yellon et al., N Engl J Med, 2007, 357: 1121-1135).

Коронарная болезнь сердца означает неспособность коронарного кровообращения обеспечить адекватное кровоснабжение сердечной мышцы и окружающей ткани. Наиболее распространенной причиной развития коронарной болезни сердца является скопление атероматозных бляшек (т.е. жировых отложений) в стенках коронарных артерий. Закупорка коронарных артерий ограничивает приток крови к сердцу, вызывает ишемию клеток миокарда (т.е. голодание клеток вследствие отсутствия кислорода) и может привести к гибели клеток миокарда, что называют инфарктом миокарда (MI) или острым инфарктом миокарда (AMI) - широко известным как сердечный приступ. AMI является ведущей причиной смертности как в Европе, так и в США, и остается распространенным (более 1,5 млн новых случаев за год в США) и вызывающим инвалидность (приводящим к сердечной недостаточности) заболеванием. Главным фактором, определяющим восстановление функции миокарда и смертность после AMI, является размер инфаркта. В настоящее время наиболее эффективным способом ограничения размера инфаркта является как можно более быстрая реперфузия пораженного миокарда при помощи коронарной ангиопластики или тромболиза и предотвращение повторной закупорки коронарной артерии с помощью антитромбоцитарной терапии. Реперфузия или восстановление притока крови в ишемический миокард достигается тромболитической терапией, растворяющей тромб, или расширением закупоренной артерии с помощью чрескожной коронарной ангиопластики. Реперфузия необходима для спасения клеток миокарда и сердечной функции в целом. Однако реперфузия запускает каскад событий, вызывающих "реперфузионное повреждение". Оно также возникает при восстановлении от кардиоплегической остановки сердца во время операции шунтирования. Реперфузионное повреждение характеризуется аритмией, дисфункцией эндотелия, вызывающей явление потери кровотока, и оглушением миокарда (обратимой потерей сократимости миокарда).

Кульминацией реперфузионного повреждения является апоптотическая гибель тех сердечных клеток, которые были жизнеспособными непосредственно перед реперфузией миокарда. Участие сильно зарегулированной формы гибели клеток при ишемии/ реперфузии миокарда может привести к появлению новых форм лечебного воздействия в фазе реперфузии. Однако сигнальные пути апоптоза, задействованные при ишемии/реперфузии миокарда, еще не полностью установлены in vivo.

Таким образом, поиск новых способов лечения для ингибирования апоптоза (т.е. "запрограммированной гибели клеток"), в частности для лечения инфаркта миокарда и реперфузионного повреждения, представляет реальный прорыв для защиты функции сердца и спасения жизней.

Сущность изобретения

Изобретение основывается на открытии того, что можно уменьшить апоптоз сердечных клеток после инфаркта миокарда путем ингибирования сигнального пути Fas. Рецептор Fas подвергается тримеризации при связывании с FasL (лигандом Fas) и индуцирует апоптоз через цитоплазматический домен, называемый DD (домен смерти), который взаимодействует с сигнальными адаптерами, такими как FAF-1 (связанный с Fas фактор-1), FADD (связанный с Fas домен смерти), DAXX (связанный с доменом смерти белок), FAP-1, FLASH (связанный с FLICE гигантский белок) и RIP (взаимодействующий с рецептором белок). DAXX и FADD независимо связываются с Fas и активируют различные пути апоптоза. DAXX может усиливать опосредованный Fas апоптоз путем активации каскада киназы JNK, который завершается фосфорилированием и активацией таких факторов транскрипции, как c-Jun. В противоположность этому FADD, через каскад сигнальных каспаз, запускает высвобождение митохондриальных проапоптотических факторов типа CytoC (цитохром-C) и SMAC (второго происходящего из митохондрий активатора каспаз), также называемого Diablo.

Авторы изобретения показали, что ингибирование взаимодействия рецептора Fas с DAXX (SEQ ID NO: 1) или FADD (SEQ ID NO: 8) приводит к сильному снижению апоптоза сердечных клеток после инфаркта миокарда. Кроме того, авторы настоящего изобретения неожиданно обнаружили, что небольшие фрагменты DAXX и FADD сохраняют антиапоптозную способность полных белков DAXX и FADD, соответственно.

Соответственно, настоящее изобретение касается пептидов, содержащих:

- фрагмент из 16, 17, 18, 19, 20, 21, 22, 23 или 24 последовательных аминокислотных остатков белка DAXX по SEQ ID NO: 1, причем данный фрагмент включает аминокислотную последовательность, приведенную в SEQ ID NO: 5, или

- фрагмент из 9, 10, 11, 12, 13, 14, 15, 16 или 17 последовательных аминокислотных остатков белка FADD по SEQ ID NO: 8, причем данный фрагмент включает аминокислотную последовательность, приведенную в SEQ ID NO: 12,

при этом данный пептид способен ингибировать апоптоз клеток.

В некоторых воплощениях антиапоптозный пептид по изобретению представлен фрагментом белка DAXX, состоящим из аминокислотной последовательности, приведенной в SEQ ID NO: 5. В других воплощениях антиапоптозный пептид по изобретению представлен фрагментом белка DAXX, состоящим из аминокислотной последовательности, приведенной в любой из SEQ ID NOs: 21-44.

В других воплощениях антиапоптозный пептид по изобретению представлен фрагментом белка FADD, состоящим из аминокислотной последовательности, приведенной в SEQ ID NO: 12 или SEQ ID NO: 9. В других воплощениях антиапоптозный пептид по изобретению представлен фрагментом белка FADD, состоящим из аминокислотной последовательности, приведенной в любой из SEQ ID NOs: 45-57.

В другом аспекте настоящее изобретение касается пептидомиметиков антиапоптозных пептидов по изобретению.

В следующем аспекте настоящим изобретением предусмотрены конъюгаты, включающие антиапоптозные пептиды или пептидомиметики по изобретению, соединенные с проникающим в клетку пептидом. Проникающий в клетку пептид может быть представлен Tat, RXR, Bpep или Pip2b.

В некоторых воплощениях проникающий в клетку пептид соединяется с пептидом или пептидомемитиком через линкер.

В некоторых воплощениях проникающий в клетку пептид выбирается из группы, состоящей из Tat, RXR, Bpep и Pip2b.

В частности, в некоторых предпочтительных воплощениях конъюгат состоит из аминокислотной последовательности, приведенной в SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60 или SEQ ID NO: 61.

В следующем аспекте настоящее изобретение касается фармацевтических композиций, содержащих по меньшей мере один фармацевтически приемлемый носитель или наполнитель и эффективное количество по меньшей мере одного пептида, или по меньшей мере одного пептидомиметика, или по меньшей мере одного конъюгата по изобретению.

В некоторых воплощениях фармацевтические композиции по изобретению дополнительно содержат по меньшей мере одно дополнительное биологически активное средство. В частности, биологически активное средство может быть выбрано из группы, состоящей из циклоспорина A, BH4 и их комбинаций.

В следующем аспекте настоящим изобретением предусмотрены пептиды, пептидомиметики, конъюгаты и фармацевтические композиции по изобретению для применения в способах лечения людей или животных, в частности для применения в способе ингибирования клеточного апоптоза у человека или животных.

В некоторых воплощениях пептиды, пептидомиметики, конъюгаты и фармацевтические композиции по изобретению применяются в способе лечения острого инфаркта миокарда (AMI), церебрального инфаркта, при трансплантации органов, операциях на сердце (экстракорпоральном кровообращении и временной окклюзии сосудов) или остром нарушении кровообращения (состоянии шока) у человека или животных.

В других воплощениях пептиды, пептидомиметики, конъюгаты и фармацевтические композиции по изобретению применяются в способе лечения ишемии, в частности сердечной ишемии, почечной ишемии, ишемического колита, брыжеечной ишемии, ишемии головного мозга, ишемии конечностей или кожи у человека или животных.

В следующих воплощениях пептиды, пептидомиметики, конъюгаты и фармацевтические композиции по изобретению применяются в способе лечения реперфузионного повреждения у человека или животных.

В родственном аспекте настоящим изобретением также предусмотрен способ лечения заболеваний, связанных с апоптозом у субъекта, который включает стадию: введения данному субъекту эффективного количества по меньшей мере одного пептида, или по меньшей мере одного пептидомиметика, или по меньшей мере одного конъюгата, или по меньшей мере одной фармацевтической композиции по изобретению.

В некоторых воплощениях способ дополнительно включает стадию введения данному субъекту по меньшей мере одного дополнительного биологически активного средства, выбранного из группы, состоящей из циклоспорина A, BH4 и их комбинаций.

Как указано выше, в этих способах лечения заболевание, связанное с апоптозом, может быть выбрано из группы, состоящей из острого инфаркта миокарда (AMI), церебрального инфаркта, трансплантации органов, операций на сердце, острых нарушений кровообращения, реперфузионного повреждения и ишемии.

Эти и другие цели, преимущества и особенности настоящего изобретения станут понятными рядовым специалистам после прочтения следующего подробного описания предпочтительных воплощений.

Краткое описание чертежей

Фиг.1. Определение эпитопа DAXX методом SPOT-синтеза. (А) Аминокислотную последовательность DAXX нарезали на перекрывающиеся наборы пептидов (пепскан; 15-мерные пептиды со сдвигом в 3 аминокислоты) и анализировали методом ферментной блот-гибридизации. Черным прямоугольником выделены четыре наиболее ярких пятна с соответствующими последовательностями эпитопа. Условия инкубации: His-теговый внутриклеточный участок рецептора Fas [10 мкг/мл]; антитела: анти-His-(мышь) (Sigma H1029, 1:6000) / против мыши с HRP (Calbiochem 401207, 1:2000), время обработки: 1 мин. (В) Выравнивание последовательности DAXX человека, содержащей 16-мер KKSRKEKKQTGSGPLG (=DAXXp SEQ ID NO: 5), с последовательностями DAXX из других видов (мышь, крыса, собака (CANFA) и зеленая мартышка (CHLAE)).

Фиг.2. Определение оптимальной длины эпитопа DAXX (=DAXXp) методом SPOT-синтеза. (А) Пептиды DAXXp-211 и DAXXp-209 (SEQ ID NO: 2 и SEQ ID NO: 3, соответственно) последовательно урезали на один аминокислотный остаток с N-конца, C-конца и одновременно с C-конца и N-конца и анализировали методом ферментной блот-гибридизации. Пятна, указанные стрелками, проявляли самые высокие интенсивности сигнала (BLU). Условия инкубации: His-теговый внутриклеточный участок рецептора Fas [10 мкг/мл]; антитела: анти-His-(мышь) (Sigma H1029, 1:6000)/против мыши с HRP (Calbiochem 401207, 1:2000), время обработки: 1 мин. (В) Выравнивание последовательностей двух пептидов DAXXp-211 и DAXXp-209, соответствующих наиболее ярким пятнам, для определения оптимальной последовательности пептидов DAXX.

Фиг.3. Оценка подверженности Tat-DAXXp и Pip2b-DAXXp протеазам. (А) Определение стабильности конъюгатов Tat-DAXXp и Pip2b-DAXXp в эмбриональной бычьей сыворотке (FBS, BioWest) и (В) свежеприготовленной мышиной сыворотке (MS). Пептиды инкубировали с 20% сывороткой при 37°C в течение 0 ч, 1 ч, 2 ч, 4 ч, 8 ч, 24 ч и 48 ч, а затем 50 мкл инкубационной смеси осаждали в 100 мкл 10% дихлоруксусной кислоты (DCA) в H2O/CH3CN (50/50). Образцы смешивали и хранили при -20°C. Осажденные сывороточные белки разделяли центрифугированием (14000 об/мин, 10 мин) и анализировали супернатанты методом обратнофазовой HPLC (измерение площади пиков в mV×сек). При каждой обработке n≥2. После 2 ч инкубации в мышиной сыворотке более 70% пептидов оставались интактными, а через 24 ч все пептиды разлагались.

Фиг.4. Клеточное распределение зависит от времени инкубации. Первичные кардиомиоциты инкубировали с 1 мкМ раствором меченных CF конъюгатов Tat-DAXXp (зеленая флуоресценция) в течение 1 ч, 4 ч или 6 ч. Клеточные ядра окрашивали с помощью красителя Hoechst (синие). Белые полоски - 10 мкм. После 1-часовой инкубации внутриклеточное распределение CF-Tat-DAXXp проявляло точечный профиль в цитозоле (что характерно для эндосомной локализации пептидов после интернализации посредством эндоцитоза), а ядерная локализация не обнаруживалась. После 4-часовой инкубации оказалось, что CF-Tat-DAXXp может высвобождаться из эндосомных пузырьков, что дает более диффузный профиль окрашивания. Кроме того, наблюдалось и накопление в ядре. После более продолжительной инкубации (6 ч) CF-меченный пептид инкапсулировался в большие пузырьки (белые стрелки) и выводился из клеток.

Фиг.5. Оценка антиапоптозной активности CPPs и конъюгатов CPP in vitro. Последовательность операций и количественная оценка фрагментации ДНК в клетках C2C12 (A), первичных кардиомиоцитах (B), клетках H9c2 (С) и клетках NG108-15 (D). Данные нормировали к 100% по STS. Данные представляют средние значения ±SEM при n≥5. Клетки высеивали в 24-луночные планшеты и культивировали в течение ночи. На следующий день клетки инкубировали с STS отдельно или с STS+1 мкМ пептида (в OptiMEM) (концентрация STS и время инкубации для каждых клеток приведены на рисунке). После этого растворы удаляли, заменяли их полной средой и инкубировали еще 40 ч. После фазы регенерации клетки подвергали лизису и определяли фрагментацию ДНК согласно инструкциям производителя (набор для определения гибели клеток Cell Death detection ELISAPLUS kit фирмы Roche Diagnostics).

Фиг.6. Антиапоптозная активность вариантов последовательности Tat-DAXXp на первичных кардиомиоцитах. Как описано в подписи к фиг.5, различные аналоги последовательности DAXXp (см. табл.2) оценивали на антиапоптозные свойства против STS (набор Cell Death detection ELISAPLUS фирмы Roche Diagnostics). Ни один из аналогов не смог защитить первичные кардиомиоциты - факт, который подтверждает, что 16-мер DAXXp имеет оптимальную длину и последовательность для самого сильного кардиопротекторного действия.

Фиг.7. Сравнение DAXXp мыши/крысы с последовательностью DAXXp человека по антиапоптозной активности на клетках C2C12, первичных кардиомиоцитах и H9c2. Последовательность DAXXp мыши, конъюгированного с Tat (Tat-mDAXXp - SEQ ID NO: 61), которая идентична последовательности DAXXp крысы (см. фиг.1B), сравнивали с конструкцией человека (Tat-DAXXp) в отношении антиапоптозных свойств против STS (набор Cell Death detection ELISAPLUS фирмы Roche Diagnostics). Использовали клетки C2C12 и первичные кардиомиоциты мыши и клетки H9c2 крысы. Во всех клетках наблюдалось усиление антиапоптозного действия при использовании последовательности Tat-mDAXXp мыши вследствие мышиного или крысиного типа клеток.

Фиг.8. Определение FADDpl5 и его антиапоптозного действия на кардиомиоцитах. (A) Последовательность белка FADD нарезали на перекрывающиеся комплекты пептидов (пепскан; 15-мерные пептиды со сдвигом в 3 аминокислоты) и анализировали методом ферментной блот-гибридизации. Черным прямоугольником выделены три наиболее ярких пятна, а соответствующие последовательности эпитопа, номера пятен и интенсивности сигнала (BLU) приведены ниже. (B) Последовательность пептида FADDp-11 (=FADDp15=SEQ ID NO: 9) последовательно урезали на один аминокислотный остаток с C-конца, N-конца или одновременно с C-конца и N-конца и анализировали методом ферментной блот-гибридизации. Пятна, указанные стрелками, проявляли самые высокие интенсивности сигнала (BLU). Самый короткий эпитоп FADD (9-мер с последовательностью KRKLERVQS (=FADDp=SEQ ID NO: 12)) соответствовал пятну №24. Условия инкубации: His-теговый внутриклеточный участок рецептора Fas [10 мкг/мл]; антитела: анти-His-(мышь) (Sigma H1029, 1:6000) / против мыши с HRP (Calbiochem 401207, 1:2000), время обработки: 1 мин.

Фиг.9. Сравнение конструкций FADDp с Tat-DAXXp в отношении антиапоптозной активности на первичных кардиомиоцитах и на клетках H9c2. Количественная оценка фрагментации ДНК на первичных кардиомиоцитах (A) и клетках H9c2 (B). Данные нормировали к 100% STS. Данные представляют средние значения ±SEM при n≥5. Клетки высеивали в 24-луночные планшеты и культивировали в течение ночи. На следующий день клетки инкубировали с STS отдельно или с STS+1 мкМ пептида (в OptiMEM) (концентрация STS приведена на рисунке, а время инкубации приведено на фиг.5). После этого растворы удаляли, заменяли их полной средой и инкубировали еще 40 ч. После фазы регенерации клетки подвергали лизису и определяли фрагментацию ДНК согласно инструкциям производителя (набор для определения гибели клеток Cell Death detection ELISAPLUS фирмы Roche Diagnostics). Короткая последовательность Tat-FADDp оказалась менее эффективной, чем Tat-DAXXp, но более длинная Tat-FADDp 15 обладала равным (на H9c2) или более сильным антиапоптозным действием (на первичных кардиомиоцитах).

Фиг.10. Сравнение Tat-DAXXp и Tat-FADDp15 одних или в комбинации на первичных кардиомиоцитах и клетках H9c2. Инкубация с 0,5 мкМ Tat-DAXXp вместе с 0,5 мкМ Tat-FADDp15, как оказалось, дает такой же или даже больший антиапоптозный эффект по сравнению с одним только пептидом при 1 мкМ. Кроме того, инкубация с обоими пептидами при 1 мкМ давала наибольшую защиту при обоих типах клеток, свидетельствуя о том, что комбинация Tat-DAXXp и Tat-FADDp15 может оказаться перспективной для применения.

Фиг.11. Методика экспериментов in vivo. Мышей C57B16 подвергали хирургической операции ишемии миокарда с реперфузией (IR). Черной рамкой представлена продолжительность ишемии, которой подвергались мыши. По окончании операции для каждой методики проводили измерения размера инфаркта или гибели клеток (указано ↑). IR60': 40 мин ишемии, 60 мин реперфузии. IR24h: 40 мин ишемии и 24 ч реперфузии.

Фиг.12. Кардиопротекторные эффекты Tat-DAXXp (1 мг/кг в/в) на мышах, подвергавшихся IR60'. Определяли размер инфаркта (в % от зоны риска AR) и измеряли фрагментацию межнуклеосомной ДНК методом ELISA у мышей, подвергавшихся IR60' и обработанных Tat, Tat-DAXXp или Tat-scrDAXXp (1 мг/кг), а также DAXXp (10 мг/кг) (внутривенное введение (в/в) за 5 мин до реперфузии). Представлены средние значения ±SEM для:(A) площади зоны риска AR/массы LV (левого желудочка), (B) размера инфаркта (в % от площади зоны риска AR) и (C) отношения I/NI, соответствующего соотношению растворимых нуклеосом в ишемической части относительно неишемической части тканей LV. Статистический анализ проводили односторонним методом ANOVA с посткритерием Neuman-Keuls для множественных сравнений (программа GraphPad Prism). Значения P<0,05, P<0,01 и P<0,001 по сравнению с Tat-DAXXp отмечены как *, ** и *** соответственно. P=ns (не значимо, н.з.) для P>0,05.

Фиг.13. Доза-эффект для Tat-DAXXp и DAXXp на мышах, подвергавшихся IR60'. Определяли размер инфаркта (в % от зоны риска AR) и измеряли фрагментацию межнуклеосомной ДНК методом ELISA у мышей, подвергавшихся IR60' и обработанных Tat (1 мг/кг), Tat-DAXXp (0,1, 1 и 10 мг/кг) или DAXXp (0,1, 1 и 10 мг/кг) при внутривенном введении за 5 мин до реперфузии. Представлены средние значения ±SEM для: (A) площади зоны риска AR/массы LV (левого желудочка), (B) размера инфаркта (в % от площади зоны риска AR) и (C) отношения I/NI, соответствующего соотношению растворимых нуклеосом в ишемической части относительно неишемической части тканей LV.

Фиг.14. Кардиопротекторные эффекты Tat-DAXXp (1 мг/кг в/в) на мышах, подвергавшихся IR24h. Определяли размер инфаркта (в % от зоны риска AR) и измеряли фрагментацию межнуклеосомной ДНК методом ELISA у мышей, подвергавшихся IR24h и обработанных Tat, Tat-DAXXp или Tat-scrDAXXp (1 мг/кг), а также DAXXp (10 мг/кг) (в/в введение за 5 мин до реперфузии). Представлены средние значения ±SEM для: (A) площади зоны риска AR/массы LV (левого желудочка), (B) размера инфаркта (в % от площади зоны риска AR) и (C) отношения I/NI, соответствующего соотношению растворимых нуклеосом в ишемической части относительно неишемической части тканей LV. Статистический анализ проводили односторонним методом ANOVA с посткритерием Neuman-Keuls для множественных сравнений (программа GraphPad Prism). Значения P<0,05, P<0,01 и P<0,001 по сравнению с Tat-DAXXp отмечены как *, ** и ***, соответственно. P=ns (не значимо, н.з.) для P>0,05.

Фиг.15. Доза-эффект для Tat-DAXXp и DAXXp на мышах, подвергавшихся IR24h. Измеряли площадь зоны риска и размер инфаркта (в % от зоны риска AR) у мышей, подвергавшихся IR24h и обработанных Tat (1 мг/кг), Tat-DAXXp (0,1, 1 и 10 мг/кг) или DAXXp (0,1, 1 и 10 мг/кг) при внутривенном введении за 5 мин до реперфузии. Представлены средние значения ±SEM для: (А) площади зоны риска AR/массы LV (левого желудочка), (B) размера инфаркта (в % от площади зоны риска AR).

Фиг.16. Визуализация конструкций Tat-DAXXp в миокарде. Мышам во время реперфузии вводили 1 мг/кг конструкции CF-Tat-DAXXp (CF = карбоксифлуоресцеин). Через 2 ч после фиксации параформальдегидом (4% PFA в фосфатном буфере) делали срезы LV (20 мкм) на вибратоме. На конфокальных снимках в 2 мкм четко видно зеленое окрашивание в миоцитах, что свидетельствует о присутствии пептидной конструкции в цитозоле. Кружочками выделено присутствие пептидной конструкции в DAPI-положительном ядре, как это наблюдалось в нескольких случаях (масляная иммерсия, ×40).

Фиг.17. Предварительные данные о повреждении от холодовой ишемии/реперфузии при трансплантации почек. Смерть мозга и длительная холодовая ишемия являются главными причинами неблагоприятного долгосрочного исхода при трансплантации почек от умерших доноров, причем этот эффект еще больше усиливается при использовании растянутых критериев для доноров ("маргинальные органы"). Воздействие на воспаление трансплантатов при вызванном ишемией-реперфузией (IR) повреждении является привлекательной концепцией для улучшения исхода у таких трансплантатов. (A) Последовательность операций холодовой ишемии/реперфузии при трансплантации почек у крыс. После 24-часовой холодовой ишемии трансплантаты почек пересаживали ортотопически самцам-реципиентам LEW с использованием стандартных методов микрохирургии. Пептиды вводили сразу после реперфузии в виде одной в/в инъекции в дозе 1 мг/кг. Через три дня после трансплантации трансплантаты извлекали для анализа методом RT-ПЦР (n=3). (B) Тотальный препарат РНК подвергали обратной транскрипции в кДНК и проводили количественную RT-ПЦР в реальном времени на установке GeneAmp 5700 Sequence Detection System (Applied Biosystems, Weiterstadt, Германия). Реакции Taqman-ПЦР для ICAM-1, IFN-γ, TNF-α, интерлейкина (IL)-6 и bcl-2 (синтезирован на фирме Metabion, Martinsried, Германия) проводили в конечном объеме 25 мкл. Эти предварительные данные свидетельствуют, что в присутствии Tat-DAXXp происходит снижение экспрессии мРНК IFN-γ и ICAM-1 в трансплантатах почек через 3 дня после трансплантации.

Определения

По всему описанию используются некоторые термины, которые определены в следующих параграфах.

Термины "белок", "полипептид" и "пептид" в настоящем изобретении используются взаимозаменяемым образом и относятся к аминокислотным последовательностям различной длины либо в нейтральной форме (незаряженные), либо в виде солей, а также либо немодифицированные, либо модифицированные посредством гликозилирования, окисления боковых цепей или форфорилирования. В некоторых воплощениях аминокислотная последовательность представлена полноразмерным нативным белком. Однако в предпочтительных воплощениях аминокислотная последовательность представлена фрагментом полноразмерного белка. В других воплощениях аминокислотная последовательность модифицирована дополнительными заместителями, присоединенными к боковым цепям аминокислот, такими как гликозильные звенья, липиды или такие неорганические ионы, как фосфаты, а также модификации, связанные с химическим преобразованием цепей, как то: окислением сульфгидрильных групп. Таким образом, термин "белок" (или эквивалентные ему термины) охватывает аминокислотные последовательности полноразмерного нативного белка или его фрагмента при условии, что эти модификации существенно не изменяют его специфические свойства. В частности, термин "белок" охватывает изоформы белка, т.е. варианты, которые кодируются одним и тем же геном, но различаются по значениям pI, или м.в., или того и другого. Такие изоформы могут отличаться по аминокислотной последовательности (например, в результате альтернативного сплайсинга или ограниченного протеолиза) или же могут возникать при дифференциальной посттрансляционной модификации (например, гликозилировании, ацилировании, фосфорилировании).

Термин "аналог" в применении к белку или полипептиду означает такой пептид, который обладает сходной или идентичной функцией, что и белок или полипептид, но необязательно имеет аминокислотную последовательность, сходную или идентичную аминокислотной последовательности белка или полипептида, либо структуру, сходную или идентичную таковой у белка или полипептида. Предпочтительно, в контексте настоящего изобретения, аналог имеет аминокислотную последовательность, которая по меньшей мере на 30%, более предпочтительно по меньшей мере на 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% или 99% идентична аминокислотной последовательности белка или полипептида. В некоторых предпочтительных воплощениях аналог белка имеет аминокислотную последовательность, которая по меньшей мере на 80% или по меньшей мере на 85%, предпочтительно по меньшей мере на 90% или наиболее предпочтительно по меньшей мере на 95% идентична аминокислотной последовательности белка.

Термин "фрагмент" в применении к белку или полипептиду означает такой пептид, который имеет аминокислотную последовательность из не менее 5 последовательных аминокислотных остатков и не более 30 последовательных аминокислотных остатков белка или полипептида, к примеру, из 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25 последовательных аминокислотных остатков белка или полипептида, предпочтительно из 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 последовательных аминокислотных остатков белка или полипептида, более предпочтительно из 9, 10, 11, 12, 13, 14, 15, 16 или 17 последовательных аминокислотных остатков белка или полипептида. В контексте настоящего изобретения фрагмент белка или полипептида сохраняет функциональную активность полноразмерного белка или полипептида.

Термин "гомологичный" (или "гомологичность") в настоящем изобретении является синонимом термину "идентичность" и означает сходство последовательности между двумя полипептидными молекулами. Если какое-то положение в обеих сравниваемых последовательностях занимает один и тот же аминокислотный остаток, то соответствующие молекулы являются гомологичными по этому положению. В настоящем изобретении степень идентичности последовательностей означает сравнение между аминокислотными последовательностями и определяется путем сравнения двух оптимально выровненных последовательностей в окне сравнения, при этом часть аминокислотной последовательности в окне сравнения может содержать вставки или делеции (т.е. пробелы) в сравнении с контрольной последовательностью (не содержащей вставок или делеции) для оптимально выравнивания двух последовательностей. Степень можно рассчитать путем определения числа положений, по которым в обеих последовательностях находятся идентичные аминокислотные остатки, получая число совпадающих положений, деления числа совпадающих положений на общее число положений в окне сравнения и умножения результата на 100, получая степень идентичности последовательностей в процентах. С другой стороны, степень можно рассчитать путем определения числа положений, по которым в обеих последовательностях либо находятся идентичные аминокислотные остатки, либо аминокислотные остатки совмещаются с пробелами, получая число совпадающих положений, деления числа совпадающих положений на общее число положений в окне сравнения и умножения результата на 100, получая степень идентичности последовательностей в процентах. Специалистам должно быть известно, что существует много установленных алгоритмов для выравнивания двух последовательностей. Оптимальное выравнивание последовательностей для их сравнения может проводиться, например, с помощью алгоритма локальной гомологии Smith and Waterman, 1981, Adv. Appl. Math. 2:482, с помощью алгоритма выравнивания по гомологии Needleman and Wunsch, 1970, J. Mol. Biol. 48:443 методом поиска сходства Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85:2444, используя компьютерные реализации этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программного обеспечения GCG Wisconsin Software Package) либо путем визуального осмотра (вообще см. Current Protocols in Molecular Biology, F.M. Ausubel et al., eds.. Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc. (1995 Supplement) (Ausubel)). Примерами алгоритмов, подходящих для определения степени идентичности последовательностей, являются алгоритмы BLAST и BLAST 2.0, которые описаны в Altschul et al., 1990, J. Mol. Biol. 215: 403-410; и Altschul et al., 1977, Nucleic Acids Res. 3389-3402; соответственно.

Гомологичные аминокислотные последовательности имеют идентичные или сходные аминокислотные последовательности. В контексте настоящего изобретения сходные остатки представляет собой консервативные замены или "разрешенные точечные мутации" соответствующих аминокислотных остатков в контрольной последовательности. "Консервативные замены" остатков в контрольной последовательности являются такими заменами, которые физически или функционально сходны с соответствующим контрольным остатком, например, имеют сходный размер, форму, электрический заряд, химические свойства, включая способность к образованию ковалентных или водородных связей, и т.п. Особенно предпочтительны такие консервативные замены, которые соответствуют критериям, установленным для "разрешенных точечных мутаций" в Dayhoff et al. ("Atlas of Protein Sequence and Structure", 1978, Nat. Biomed. Res. Foundation, Washington, DC, Suppl. 3, 22: 354-352).

В контексте настоящего изобретения термин "лечение" применяется для характеристики способа, который предназначается для замедления или предупреждения возникновения заболевания, замедления или прекращения прогрессирования, обострения или ухудшения симптомов заболевания, для ослабления симптомов заболевания и/или излечения заболевания. Лечение может проводиться до возникновения заболевания для профилактического или предупреждающего действия. С другой стороны, оно может проводиться после возникновения заболевания для терапевтического действия.

Термин "субъект" в настоящем изобретении относится к людям или животным, в частности млекопитающим (например, приматам, собакам, кошкам, козам, лошадям, свиньям, мышам, крысам, кроликам и др.), которые могут быть поражены заболеванием, связанным с апоптозом, но могут и не страдать этим заболеванием. Во многих воплощениях настоящего изобретения субъектом является человек. В таких воплощениях субъект часто именуется "индивидом". Термин "индивид" не означает какой-то конкретный возраст, поэтому он охватывает детей, подростков и взрослых.

"Фармацевтическая композиция" определяется здесь как содержащая эффективное количество пептида по изобретению и по меньшей мере одного фармацевтически приемлемого носителя или наполнителя.

Термин "эффективное количество" в настоящем изобретении относится к такому количеству пептида, соединения, средства или композиции, которое достаточно для выполнения своего прямого назначения, например требуемого биологического ответа в клетках, ткани, системе или у субъекта. Например, в некоторых воплощениях настоящего изобретения назначением может быть: ингибирование, предотвращение или уменьшение апоптоза, такого, к примеру, как апоптоз, связанный с реперфузионным повреждением или трансплантацией органа; и/или предотвращение или лечение заболеваний, связанных с апоптозом.

Термин "фармацевтически приемлемый носитель или наполнитель" относится к такой среде носителя, которая не влияет на эффективность биологической активности активного ингредиента и практически не токсична для организма в той концентрации, при которой она вводится. Термин охватывает растворители, дисперсионные среды, покрытия, антибактериальные и противогрибковые средства, изотонические средства и вещества, замедляющие всасывание, и др. Применение таких сред и средств для фармацевтически активных субстанций хорошо известно в данной области (например, см. "Remington's Pharmaceutical Sciences", E.W. Martin, 18th Ed., 1990, Mack Publishing Co.: Easton, PA, который включен сюда путем ссылки во всей полноте).

Раскрытие сущности изобретения

Как указано выше, настоящее изобретение имеет отношение к пептидам с антиапоптозными свойствами, которые применимы в качестве терапевтических средств при лечении и/или профилактике большого числа заболеваний, связанных с апоптозом.

Пептиды, ингибирующие апоптоз клеток

Пептиды по изобретению включают фрагменты DAXX и фрагменты FADD, которые проявляют антиапоптозную активность.

Термины "DAXX" и "белок DAXX" применяются здесь взаимозаменяемым образом. Они относятся к белку, который называется связанный со смертью белок 6 и у человека кодируется геном DAXX (RefSeq (mRNA): NM_001141969.1), локализованным в положении 21.3 короткого плеча (p) хромосомы 6. В предпочтительных воплощениях DAXX имеет аминокислотную последовательность, приведенную в SEQ ID NO: 1. Однако белок DAXX может быть представлен изоформой белка DAXX по SEQ ID NO: 1, поэтому он может иметь любую аминокислотную последовательность, кодируемую геном DAXX человека.

Термины "FADD" и "белок FADD" применяются здесь взаимозаменяемым образом. Они относятся к белку, который называется связанный с Fas белок с доменом смерти, который у человека кодируется геном FADD (RefSeq (mRNA): NM_003824.3), локализованным в положении 13.3 длинного плеча (q) хромосомы 11. В предпочтительных воплощениях FADD имеет аминокислотную последовательность, приведенную в SEQ ID NO: 8. Однако белок FADD может быть представлен изоформой белка FADD по SEQ ID NO: 8, поэтому он может иметь любую аминокислотную последовательность, кодируемую геном FADD человека.

Авторы изобретения показали, что пептиды, состоящие из аминокислотной последовательности, приведенной в SEQ ID NO: 5 ("DAXXp"), SEQ ID NO: 6 ("DAXXp-14") или SEQ ID NO: 2 ("DAXXp-15" = "DAXXp-211"), которые все являются фрагментами белка DAXX (SEQ ID NO: 1), взаимодействуют с рецептором Fas, но только DAXXp способен уменьшить клеточный апоптоз. Точно так же авторы изобретения обнаружили, что пептиды, состоящие из аминокислотной последовательности, приведенной в SEQ ID NO: 9 ("FADDp15") и SEQ ID NO: 12 ("FADDp"), которые оба являются фрагментами белка FADD (SEQ ID NO: 8), взаимодействуют с рецептором Fas и уменьшают клеточный апоптоз.

Итак, в одном предпочтительном воплощении антиапоптозный пептид по изобретению представлен фрагментом DAXX из 16 последовательных аминокислотных остатков, входящих в SEQ ID NO: 5. В другом предпочтительном воплощении антиапоптозный пептид по изобретению представлен фрагментом DAXX, состоящим из 17, 18, 19, 20, 21, 22, 23 или 24 последовательных аминокислотных остатков, входящих в аминокислотную последовательность, приведенную в SEQ ID NO: 5. Предпочтительно такой антиапоптозный пептид имеет аминокислотную последовательность, выбранную из группы, состоящей из:

SEQ ID NO: 17 (KKSRKEKKQTGSGPLGN),
SEQ ID NO: 18 (KKSRKEKKQTGSGPLGNS),
SEQ ID NO: 19 (KKSRKEKKQTGSGPLGNSY),
SEQ ID NO: 20 (KKSRKEKKQTGSGPLGNSYV),
SEQ ID NO: 21 (CKKSRKEKKQTGSGPLG),
SEQ ID NO: 22 (PCKKSRKEKKQTGSGPLG),
SEQ ID NO: 23 (PPCKKSRKEKKQTGSGPLG),
SEQ ID NO: 24 (GPPCKKSRKEKKQTGSGPLG),
SEQ ID NO: 25 (SGPPCKKSRKEKKQTGSGPLG),
SEQ ID NO: 26 (CKKSRKEKKQTGSGPLGN),
SEQ ID NO: 27 (CKKSRKEKKQTGSGPLGNS),
SEQ ID NO: 28 (CKKSRKEKKQTGSGPLGNSY),
SEQ ID NO: 29 (CKKSRKEKKQTGSGPLGNSYV),
SEQ ID NO: 30 (PCKKSRKEKKQTGSGPLGN),
SEQ ID NO: 31 (PCKKSRKEKKQTGSGPLGNS),
SEQ ID NO: 32 (PCKKSRKEKKQTGSGPLGNSY),
SEQ ID NO: 33 (PCKKSRKEKKQTGSGPLGNSYV),
SEQ ID NO: 34 (PPCKKSRKEKKQTGSGPLGN),
SEQ ID NO: 35 (PPCKKSRKEKKQTGSGPLGNS),
SEQ ID NO: 36 (PPCKKSRKEKKQTGSGPLGNSY),
SEQ ID NO: 37 (PPCKKSRKEKKQTGSGPLGNSYV),
SEQ ID NO: 38 (GPPCKKSRKEKKQTGSGPLGN),
SEQ ID NO: 39 (GPPCKKSRKEKKQTGSGPLGNS),
SEQ ID NO: 40 (GPPCKKSRKEKKQTGSGPLGNSY),
SEQ ID NO: 41 (GPPCKKSRKEKKQTGSGPLGNSYV),
SEQ ID NO: 42 (SGPPCKKSRKEKKQTGSGPLGN),
SEQ ID NO: 43 (SGPPCKKSRKEKKQTGSGPLGNS), и
SEQ ID NO: 44 (SGPPCKKSRKEKKQTGSGPLGNSY).

В одном предпочтительном воплощении антиапоптозный пептид по изобретению представлен фрагментом FADD из 9 последовательных аминокислотных остатков, входящих в SEQ ID NO: 12. В другом предпочтительном воплощении антиапоптозный пептид по изобретению представлен фрагментом FADD из 15 последовательных аминокислотных остатков, входящих в SEQ ID NO: 9. В следующих предпочтительных воплощениях антиапоптозный пептид по изобретению представлен фрагментом FADD из 9, 10, 11, 12, 13, 14, 15, 16 или 17 последовательных аминокислотных остатков, входящих в SEQ ID NO: 12. Предпочтительно такой антиапоптозный пептид имеет аминокислотную последовательность, выбранную из группы, состоящей из:

SEQ ID NO: 45 (KRKLERVQSG),
SEQ ID NO: 46 (KRKLERVQSGL),
SEQ ID NO: 47 (KRKLERVQSGLD),
SEQ ID NO: 48 (KRKLERVQSGLDL),
SEQ ID NO: 49 (RKRKLERVQS),
SEQ ID NO: 50 KRKRKLERVQS),
SEQ ID NO: 51 (GKRKLERVQSG),
SEQ ID NO: 52 (GKRKLERVQSGL),
SEQ ID NO: 53 (GKRKLERVQSGLD),
SEQ ID NO: 54 (GKRKLERVQSGLDL),
SEQ ID NO: 55 (VGKRKLERVQSG),
SEQ ID NO: 56 (VGKRKLERVQSGL), и
SEQ ID NO: 57 (VGKRKLERVQSGLD).

Как указано выше, в некоторых воплощениях белок DAXX представлен изоформой белка DAXX из SEQ ID NO: 1. В таких воплощениях антиапоптозный белок по изобретению может быть представлен фрагментом DAXX из 16 последовательных аминокислотных остатков, соответствующих фрагменту SEQ ID NO: 5 у белка DAXX из SEQ ID NO: 1.

Точно так же, как указано выше, в некоторых воплощениях белок FADD представлен изоформой белка FADD из SEQ ID NO: 8. В таких воплощениях антиапоптозный белок по изобретению может быть представлен фрагментом FADD из 9 последовательных аминокислотных остатков, соответствующих фрагменту SEQ ID NO: 12 у белка FADD из SEQ ID NO: 8; или же фрагментом FADD из 15 последовательных аминокислотных остатков, соответствующих фрагменту SEQ ID NO: 9 у белка FADD из SEQ ID NO: 8.

Изоформы DAXX и изоформы FADD предпочтительно имеют аминокислотную последовательность, которая по меньшей мере на 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или более 99% идентична SEQ ID NO: 1 и SEQ ID NO: 8, соответственно, более предпочтительно по меньшей мере на 95%, 96%, 97%, 98%, 99% или более 99% идентична SEQ ID NO: 1 и SEQ ID NO: 8, соответственно.

Пептиды по изобретению, а также их производные и конъюгаты (см. ниже) способны ингибировать, предупреждать и/или уменьшать апоптоз клеток, в частности апоптоз кардиомиоцитов. Эту способность можно оценить любым подходящим методом, известным специалистам, как-то, к примеру, с помощью набора для выявления апоптоза клеток. Примером такого набора, подходящего для измерения апоптоза клеток, является Cell Death Detection ELISAPLUS® kit (Cat. No. 11 774 425 001, Roche Applied Science).

Производные пептидов по изобретению

Изобретение также имеет отношение к биологически активным производным пептидов по изобретению. Под "биологически активным производным" подразумеваются любые производные пептидов изобретения, которые сохраняют способность пептидов ингибировать, предотвращать или уменьшать апоптоз клеток.

В некоторых воплощениях биологически активные производные имеют аминокислотную последовательность антиапоптозного пептида изобретения, которая была модифицирована химическим и/или биологическим путем.

Примерами производных являются пептиды по изобретению, у которых:

- по меньшей мере один аминокислотный остаток пептида был заменен или подвергнут делеции,

- был введен по меньшей мере один дополнительный аминокислотный остаток в пептид, и/или

- по меньшей мере один аминокислотный остаток пептида был химически изменен или дериватизирован.

Предпочтительно биологически активные производные по изобретению содержат только одну или только две модификации аминокислотных остатков, выбранные из группы, состоящей из замен, вставок, делеции, изменений и/или дериватизаций. В некоторых предпочтительных воплощениях биологически активные производные содержат одну консервативную замену или две консервативные замены. В некоторых предпочтительных воплощениях производные фрагмента DAXX по изобретению содержат одну или две модификации, которые затрагивают аминокислотные остатки, не входящие в SEQ ID NO: 5 (т.е. они не содержатся в SEQ ID NO: 5); а производные фрагмента FADD по изобретению содержат одну или две модификации, которые затрагивают аминокислотные остатки, не входящие в SEQ ID NO: 12 (т.е. они не содержатся в SEQ ID NO: 12).

Подходящие "химически измененные или дериватизированные" аминокислоты включают, к примеру, производные аминокислот природного происхождения, например, 4-гидроксипролин вместо пролина, 5-гидроксилизин вместо лизина, гомосерин вместо серина, орнитин вместо лизина и др. Другие "химически измененные или дериватизированные" аминокислоты включают аминокислоты, присоединенные, например, к метке, такой как флуоресцеин, тетраметилродамин или цианиновый краситель Cy5.5; либо аминокислотные остатки с одной или несколькими посттрансляционными модификациями, такими как ацетилирование, амидирование, формилирование, гидроксилирование, метилирование, фосфорилирование, сульфатирование, гликозилирование или липидирование. Так, некоторые химические модификации, в частности N-концевое глизилирование, как было показано, увеличивают стабильность пептидов в сыворотке человека (Powell et al., Pharma Res 1993:10:1268-1273). "Химически измененные или дериватизированные" аминокислоты также включают аминокислоты с повышенной мембранной проницаемостью посредством N-миристоилирования (Brand et al., Am J Physiol Cell Physiol 1996; 270: C1362-C1369).

Другими производными пептидов по изобретению являются пептидомиметики данных пептидов. Пептидомиметиками являются такие химические соединения, которые имеют практически такие же структурные и/или функциональные характеристики, что и пептиды по изобретению. Миметики могут полностью состоять из синтетических, не встречающихся в природе аналогов аминокислот, или могут быть химерными молекулами, содержащими одну или несколько природных аминокислот и один или несколько не встречающихся в природе аналогов аминокислот. Миметик может включать в себя любое число консервативных замен природных аминокислот, которые не нарушают активность миметика. Чтобы проверить, обладает ли миметик требуемой активностью, может использоваться обычное тестирование при помощи Теста А по изобретению. Выражение "практически такой же" в применении к миметику или пептидомиметику означает, что миметик или пептидомиметик обладает одной или несколькими активностями или функциями сравниваемой молекулы, в частности ингибирует клеточный апоптоз. Пептидомиметики разрабатываются стандартными методами. Например, пептидные связи можно заменить непептидными связями или не встречающимися в природе аминокислотами, позволяющими пептидомиметику принять аналогичную структуру, а тем самым и биологическую активность природного пептида. Могут проводиться и другие модификации путем замены химических групп аминокислот другими химическими группами сходной структуры. Разработке пептидомиметиков может способствовать определение третичной структуры исходного фрагмента/пептида либо свободного, либо связанного с внутриклеточным участком рецептора Fas, методами ЯМР-спектроскопии, кристаллографии и/или компьютеризированного молекулярного моделирования. После идентификации вероятного соединения-пептидомиметка его можно синтезировать и определить его способность к ингибированию апоптоза клеток.

Пептидомиметики могут содержать любые комбинации не встречающихся в природе компонентов, которые, как правило, входят в три структурные группы: группу связей между остатками, отличающихся от естественной связи через амин ("пептидной связи"); не встречающихся в природе остатков вместо природных аминокислотных остатков; остатков, индуцирующих мимикрию вторичной структуры (например, конформации типа бета-складки, гамма-складки, бета-листа, альфа-спирали); или другие изменения, придающие устойчивость к протеолизу. Например, лизиновые миметики могут быть получены при реакции с ангидридами янтарной или других карбоновых кислот. Миметики лизина и других содержащих альфа-аминогруппу остатков также могут быть получены при реакции с такими имидоэфирами, как метилпиколинимидат, пиридоксальфосфат, пиридоксальхлорборгидрид, тринитробензолсульфоновая кислота, O-метилизомочевина, 2,4-пентандион, и при реакциях с глиоксилатом, катализируемых трансамидазой.

Также можно заменить один или несколько остатков аминокислотой (или остатком-пептидомиметиком) противоположной хиральности. Так, любая аминокислота, которая встречается в природе в L-конфигурации (которая также может относиться к R или S, в зависимости от структуры химической молекулы), может быть заменена такой же аминокислотой или миметиком, но противоположной хиральности, которая именуется D-аминокислотой, но также может именоваться R- или S-формой.

Как должно быть известно специалистам, пептидомиметики настоящего изобретения также могут включать одну или несколько модификаций, описанных здесь для "химически измененных или дериватизированных" аминокислот, например метки либо одну или несколько посттрансляционных модификаций.

Пептиды, производные и пептидомиметики можно получать и выделять любыми методами, известными в данной области. Пептиды моно синтезировать, полностью или частично, используя обычные химические методы. Методы получения библиотек пептидов и пептидомиметиков хорошо известны и включают, к примеру, мультипиновые методы, методы "чайного пакетика", методы типа "расщепить, соединить и смешать" и SPOT-синтеза.

Конъюгаты

Изобретение также имеет отношение к конъюгатам, содержащим пептиды изобретения или их производные, соединенные с проникающим в клетки пептидом или CPP.

Так, для облегчения захвата пептидов по изобретению или их производных через клеточные мембраны, такие как плазматическая мембрана или мембрана клетки, авторы изобретения показали, что очень полезно конъюгировать эти пептиды или их производные с "проникающими в клетку пептидами" (CPPs). CPPs являются хорошо известными пептидами, которые можно конъюгировать с нагрузками, чтобы облегчить их транспорт через мембраны. Например, CPPs хорошо описаны в Lebleu В. et al., Advanced Drug Delivery Reviews 60 (2008) 517-529; и в Said Hassane F. et al., Cell. Mol. Life Sci. (2010) 67: 715-726. Для улучшения цитоплазматической доставки фрагментов или их производных по изобретению можно использовать любые СРР.

Примеры CPPs, которые можно конъюгировать с фрагментами DAXX или FADD либо их производными по изобретению включают, без ограничения:

Название Последовательность
Tat GRKKRRQRRRPPQ
RXR RXRRXRRXRRXR
Врер RXRRBRRXRRBRXB
Pip2b RXRRXRRXRIHILFQNrRMKWHK

где - X = аминогексил, β-аланил, n-аминобензоил, изонипекотил или 4-аминобутирил,

- B = β-аланин,

- строчная буква = D-аминокислота (D-аминокислоты могут быть заменены L-аминокислотами).

Как правило, CPP содержит две или несколько катионных аминокислот с гидрофобными аминокислотами или спейсерными группами, разделяющими некоторые катионные аминокислоты. Например, катионная аминокислота - аргинин (R). Как правило, CPP обычно содержит по меньшей мере 3 или 4 остатка аргинина. В некоторых воплощениях CPP содержит 5, 6 или больше остатков аргинина.

Как правило, CPP соединяется с N-концом или C-концом пептида или его производного по изобретению, предпочтительно с C-концом. Химическое соединение может осуществляться через любую химическую связь, как-то, к примеру, дисульфидную связь, тиоэфирную или тиол-малеимидную связь.

В предпочтительном воплощении пептид или его производное по изобретению соединяется с CPP через линкер. Можно использовать любой тип линкера при условии, что данный линкер также позволяет установить химическую связь пептида или его производного с CPP. Возможны различные линкеры, включая аминокислотные последовательности с остатком цистеина на C-конце, позволяющим образование дисульфидной, тиоэфирной или тиол-малеимидной связи. Другие способы соединения пептида или его производного по изобретению с CPP включают использование C-концевого альдегида с образованием оксима. В других линкерах применяется химия Click.

Примеры подходящих линкеров включают, без ограничения, аминокислоты или последовательности аминокислот, выбранные из группы, состоящей из: C, BC, XC, GC, BBCC, BXCC, XBC, X, XX, B, BB, BX и XB, где

- X = аминогексил, β-аланил, n-аминобензоил, изонипекотил или 4-аминобутирил,

- B = β-аланин.

Применение

Изобретение также имеет отношение к пептидам, их производным и их конъюгатам, как описано здесь, для применения в способах лечения человека или животных и к соответствующим способам лечения. В частности, изобретение касается пептидов, их производных и их конъюгатов, как описано здесь, для применения в способах лечения заболеваний, связанных с апоптозом клеток, и/или способах ингибирования апоптоза клеток у человека или животных. Изобретением также предусмотрены способы лечения заболеваний, связанных с апоптозом клеток, и/или ингибирования апоптоза клеток у нуждающегося в этом субъекта, причем способы включают стадию введения субъекту эффективного количества пептида по изобретению, его производного и/или его конъюгата. В некоторых воплощениях субъекту вводится по меньшей мере один антиапоптозный пептид DAXX по изобретению и по меньшей мере один антиапоптозный пептид FADD по изобретению.

Термин "заболевание, связанное с апоптозом клеток" в настоящем изобретении относится к любым заболеваниям или клиническим состояниям, которые вызваны, приводят к или включают апоптоз клеток. В некоторых воплощениях заболевание связано с опосредованным Fas-рецептором апоптозом клеток. Термин "заболевание или клиническое состояние, связанное с апоптозом клеток" также охватывает любые медицинские процедуры, которые вызывают, приводят к или индуцируют апоптоз клеток и которые выполняются в связи с наличием заболевания или клинического состояния у субъекта.

Таким образом, пептиды, их производные и их конъюгаты, а также способы лечения по настоящему изобретению могут применяться для лечения острого инфаркта миокарда (AMI), церебрального инфаркта или острого нарушения кровообращения (состояния шока) у человека или животных, в особенности для ингибирования или уменьшения апоптоза клеток, связанного с этими заболеваниями. Пептиды, их производные и их конъюгаты, а также способы лечения по настоящему изобретению также могут применяться для лечения субъектов, подвергающихся трансплантации органов (например, трансплантации печени, сердца, почек, островков и кишечника), при операциях на сердце (реперфузионной терапии, экстракорпоральном кровообращении, например, при сердечно-легочном шунтировании и временной окклюзии сосудов), в частности для ингибирования или уменьшения апоптоза клеток, вызванного этими медицинскими процедурами.

Пептиды, их производные и их конъюгаты и способы лечения по настоящему изобретению могут применяться для лечения ишемии, как-то сердечной ишемии, ишемии почек, ишемического колита, брыжеечной ишемии, ишемии головного мозга, ишемии конечностей или ишемии кожи у человека или животных, в частности для ингибирования или уменьшения апоптоза клеток, связанного с ишемией.

Пептиды, их производные и их конъюгаты и способы лечения по настоящему изобретению могут применяться для субъектов, подвергающихся или подвергавшихся реперфузии, в частности для ингибирования или уменьшения апоптоза клеток, связанного с реперфузионным повреждением.

Все пептиды, их производные и их конъюгаты по настоящему изобретению можно вводить до и во время ишемии, до, одновременно с или после реперфузии.

Было показано, что опосредованный Fas-рецептором апоптоз задействован при заболеваниях печени у человека, включая вирусный гепатит, болезнь Вилсона, алкогольный гепатит, холестатическую болезнь печени, и при аутоиммунных заболеваниях (например, см. обзор в Ehrenschwender et al., Adv. Exp.Med. Biol., 2009, 647: 64-93). Таким образом, пептиды, их производные и их конъюгаты и способы лечения по настоящему изобретению также могут применяться и для лечения этих заболеваний.

В способах лечения по настоящему изобретению пептиды, их производные или их конъюгаты можно комбинировать с другими терапевтическими средствами, в частности средствами, применяемыми при лечении апоптоза, ишемии и/или реперфузионного повреждения. В частности, большой интерес представляет комбинированное лечение средствами, направленными на собственный путь апоптоза, т.е. митохондриальный путь. Так, в родственном аспекте настоящим изобретением предусмотрены пептиды, их производные или их конъюгаты в комбинации с другими терапевтическими средствами, в частности средствами, используемыми при лечении апоптоза, ишемии и/или реперфузионного повреждения, для применения в способах лечения по изобретению. В одном воплощении способы лечения по изобретению также включают стадию введения человеку или животным циклоспорина A и/или пептида BH4. В самом деле, было показано, что циклоспорин A ингибирует открывание митохондриального РТР и уменьшает размер инфаркта, как у пациентов, так и у животных, на моделях AMI (Gomez et al., Cardiovasc Res. 2009, 83(2): 226-33; Piot et al., N Engi J Med. 2008, 359(5): 473-81; Mewton et al., J Am Coil Cardiol. 2010, 55(12): 1200-5). BH4, происходящий из антиапоптозного белка Bcl-xl, как сообщалось, эффективно уменьшает апоптоз при ишемии-реперфузии при введении в виде конъюгата с белком Tat во время реперфузии (Ono et al., Eur J Cardiothorac Surg. 2005, 27(1): 117-121; Donnim et al., Cell Cycle 2009, 8(8): 1271-1278; Boisguerin et al., J. Control Release, 2011, doi: 10.1016/j.jconrel.2011.07.037).

В способах лечения по изобретению все соединения (пептиды, производные, конъюгаты, комбинированные продукты) можно вводить любым из целого ряда подходящих способов, включая, без ограничения, внутривенно, парентерально, интраартериально, внутримышечно, перорально или интраназально. Введение пептида по изобретению, его производного или его конъюгата должно осуществляться при такой дозировке, чтобы вводимое количество было эффективным по назначению. Способ введения, композиция (см. ниже) и вводимые дозы зависят от требуемого терапевтического эффекта, тяжести подлежащего лечению заболевания, если таковое уже имеется, наличия любой инфекции, возраста, пола, веса и общего состояния здоровья пациента, а также от силы действия, биодоступности и периода полужизни in vivo используемого пептида, производного или конъюгата, использования (или нет) сопутствующей терапии и других клинических факторов. Эти факторы легко определяются лечащим врачом по ходу лечения.

Лечение по настоящему изобретению может состоять из однократной дозы или многократных доз. Так, введение пептида, его производного или его конъюгата может быть постоянным в течение определенного времени или периодическим через определенные промежутки времени, например, ежечасно, ежедневно, еженедельно (или через другие промежутки в несколько дней) и т.д. С другой стороны, введение может быть непрерывным в течение какого-то времени, например, внутривенно.

Фармацевтические композиции

Как указано выше, пептиды изобретения, их производные либо их конъюгаты могут вводиться сами по себе или в виде фармацевтической композиции. Соответственно, настоящим изобретением предусмотрены фармацевтические композиции, содержащие эффективное количество по меньшей мере одного антиапоптозного пептида изобретения (либо его производного или его конъюгата) и по меньшей мере один фармацевтически приемлемый носитель или наполнитель. В некоторых воплощениях композиция дополнительно содержит по меньшей мере одно дополнительное биологически активное средство. В некоторых воплощениях фармацевтическая композиция содержит по меньшей мере один антиапоптозный пептид DAXX по изобретению и по меньшей мере один антиапоптозный пептид FADD по изобретению.

Фармацевтическая композиция по изобретению может вводиться в любом количестве и любым способом введения, эффективным для получения требуемого профилактического и/или терапевтического эффекта. Оптимальный фармацевтический состав может варьироваться в зависимости от способа введения и требуемой дозы. Такие составы могут влиять на физическое состояние, стабильность, скорость высвобождения in vivo и скорость выведения in vivo вводимого активного ингредиента.

Фармацевтические композиции настоящего изобретения могут быть составлены в стандартной дозовой форме для легкости введения и однородности дозы. Выражение "стандартная дозовая форма" в настоящем изобретении обозначает физически дискретную единицу из по меньшей мере одного пептида изобретения (или по меньшей мере одного его производного или его конъюгата) и по меньшей мере одного фармацевтически приемлемого носителя или наполнителя. Однако следует иметь в виду, что общая суточная доза композиции должна определяться лечащим врачом в рамках здравого медицинского суждения.

Лекарственные формы.

Препараты для инъекций, к примеру стерильные водные или масляные суспензии для инъекций, могут быть составлены по известным в данной области правилам, с использованием подходящих диспергирующих или смачивающих веществ и суспендирующих веществ. Стерильные препараты для инъекций также могут представлять собой стерильные растворы для инъекций, суспензии или эмульсии в нетоксичном парентерально приемлемом разбавителе или растворителе, к примеру, в виде раствора в 2,3-бутандиоле. В число приемлемых носителей и растворителей, которые можно использовать, входят вода, раствор Рингера по U.S.P. и изотонический раствор хлористого натрия. Кроме того, обычно используются стерильные нелетучие масла в виде раствора или суспендирующей среды. Для этой цели можно использовать любое мягкое нелетучее масло, включая синтетические моно- и диглицериды. Также при получении составов для инъекций можно использовать такие жирные кислоты, как олеиновая кислота. Стерильные жидкие носители применимы в композициях типа стерильных жидких форм для парентерального введения.

Формы для инъекций можно стерилизировать, к примеру, фильтрованием через задерживающий бактерии фильтр или включением стерилизующих средств в форме стерильных твердых композиций, которые можно растворить или диспергировать в стерильной воде или другой стерильной среде для инъекций перед использованием. Жидкие фармацевтические композиции, представляющие собой стерильные растворы или суспензии, можно вводить, к примеру, посредством внутривенной, внутримышечной, внутрибрюшинной или подкожной инъекции. Инъекции можно делать за один раз или путем постепенного вливания. Там, где это необходимо или желательно, композиция может включать местный анестетик для облегчения боли в месте инъекции.

Для продления эффекта активного ингредиента зачастую требуется замедлить всасывание ингредиента при подкожной или внутримышечной инъекции. Замедление всасывания вводимого парентерально активного ингредиента может осуществляться путем растворения или суспендирования ингредиента в масляном носителе. Депо-формы для инъекций получают путем формирования микроинкапсулированного матрикса активного ингредиента в биоразлагаемых полимерах, таких как полилактид-полигликолид. В зависимости от соотношения активного ингредиента к полимеру и природы конкретного используемого полимера можно контролировать скорость высвобождения ингредиента. Примеры других биоразлагаемых полимеров включают полиортоэфиры и полиангидриды. Депо-формы для инъекций также можно получить путем заключения активного ингредиента в такие липосомы или микроэмульсии, которые совместимы с тканями организма.

Жидкие дозовые формы для перорального введения включают, без ограничения, фармацевтически приемлемые эмульсии, микроэмульсии, растворы, суспензии, сиропы, эликсиры и композиции под давлением. Наряду с активным ингредиентом жидкие дозовые формы могут содержать инертные разбавители, широко используемые в данной области, такие, к примеру, как вода или другой растворитель, такие солюбилизирующие вещества и эмульгаторы, как этиловый спирт, изопропиловый спирт, этилкарбонат, этилацетат, бензиловый спирт, бензилбензоат, пропиленгликоль, 1,3-бутиленгликоль, диметилформамид, масла (в частности, хлопковое, арахисовое, кукурузное, зародышное, оливковое, касторовое и кунжутное масло), глицерин, тетрагидрофурфуриловый спирт, полиэтиленгликоли и сложные эфиры жирных кислот и сорбитана и их смеси. Помимо инертных разбавителей, пероральные композиции также могут включать такие вспомогательные вещества, как смачивающие вещества, суспендирующие вещества, консерванты, подсластители, ароматизаторы и отдушки, загустители, красители, регуляторы вязкости, стабилизаторы или осморегуляторы. Примеры подходящих жидких носителей для перорального введения включают воду (потенциально содержащую вышеприведенные добавки, например, производные целлюлозы, как-то раствор натриевой карбоксиметилцеллюлозы), спирты (включая одноатомные спирты и многоатомные спирты типа гликолей) и их производные, а также масла (например, фракционированное кокосовое масло или арахисовое масло). Для композиций под давлением жидким носителем может быть галогенированный углеводород или другой фармацевтически приемлемый вытеснитель (сжатый газ).

Твердые дозовые формы для перорального введения включают, к примеру, капсулы, таблетки, пилюли, порошки и гранулы. В таких твердых дозовых формах пептиды изобретения (либо их производные или их конъюгаты) могут быть смешаны по меньшей мере с одним инертным, физиологически приемлемым наполнителем или носителем типа цитрата натрия или дикальцийфосфата и одним или несколькими: (a) наполнителями или разбавителями, такими как крахмал, лактоза, сахароза, глюкоза, маннитол и кремниевая кислота; (b) связывающими веществами, такими, к примеру, как карбоксиметилцеллюлоза, альгинаты, желатин, поливинилпирролидон, сахароза и гуммиарабик; (c) увлажнителями типа глицерина; (d) дезинтегрирующими веществами, такими как агар-агар, карбонат кальция, картофельный крахмал или крахмал тапиоки, альгиновая кислота, некоторые силикаты и карбонат натрия; (e) замедляющими растворение веществами типа парафина; (f) ускоряющими всасывание типа четвертичных аммониевых соединений; (g) смачивающими веществами, такими, к примеру, как цетиловый спирт и моностеарат глицерина; (h) абсорбентами типа каолина и бентонита; и (i) смазывающими веществами, такими как тальк, стеарат кальция, стеарат магния, твердые полиэтиленгликоли, лаурилсульфат натрия, и их смесями. Другими наполнителями, пригодными для твердых композиций, являются поверхностно-активные вещества, такие как неионные и анионные поверхностно-активные вещества. Типичные примеры поверхностно-активных веществ включают, без ограничения, полоксамер 188, безалкония хлорид, стеарат кальция, цетостеариловый спирт, эмульгирующий воск цетомакрогол, сложные эфиры сорбитана, коллоидная двуокись кремния, фосфаты, додецилсульфат натрия, силикат магния-алюминия и триэтаноламин. В случае капсул, таблеток и пилюль дозовые формы также могут содержать буферные вещества.

Твердые композиции подобного типа также могут применяться в качестве наполнителей в мягких и твердых желатиновых капсулах с использованием таких наполнителей, как лактоза или молочный сахар, а также высокомолекулярные полиэтиленгликоли и др. Твердые дозовые формы таблеток, драже, капсул, пилюль и гранул также можно приготовить с покрытиями и оболочками, такими как энтеросолюбильные покрытия, покрытия для контролиремого высвобождения и другие покрытия, хорошо известные в области фармацевтики. Они необязательно могут включать контрастные вещества, а также могут представлять собой такие композиции, которые высвобождают активные ингредиенты только или предпочтительно в определенной части желудочно-кишечного тракта, необязательно замедленным образом. Примеры композиций для заливки, которые можно использовать, включают полимерные субстанции и воски.

В некоторых воплощениях может потребоваться введение антиапоптозного пептида изобретения (либо его производного или его конъюгата) локально в область, требующую обработки (например, миокард). Это может осуществляться, к примеру, но без ограничения, путем местной инфузии во время чрескожной коронарной ангиопластики или во время коронарного шунтирования.

Для топического введения фармацевтическая композиция предпочтительно составляется в виде геля, мази, лосьона или крема, которые могут включать носители, такие как вода, глицерин, спирт, пропиленгликоль, жирные спирты, триглицериды, эфиры жирных кислот или минеральное масло. Другие топические носители включают вазелиновое масло, изопропилпальмитат, полиэтиленгликоль, этанол (95%), полиоксиэтиленмонолаурат (5%) в воде или лаурилсульфат натрия (5%) в воде. При необходимости можно добавить и другие материалы, как-то: антиоксиданты, увлажнители, стабилизаторы вязкости и подобные вещества.

Кроме того, в некоторых случаях предусматривается, что композиции по изобретению могут находиться внутри трансдермальных устройств, помещаемых на, в или под кожу. Такие устройства включают пластыри, импланты и инъекции, которые высвобождают активный ингредиент по пассивному или активному механизму высвобождения. Трансдермальное введение включает все введения через поверхность тела и внутренние оболочки организма, включая эпителиальные и слизистые ткани. Такое введение может осуществляться с использованием представленных композиций в лосьонах, кремах, пенах, пластырях, суспензиях, растворах и свечах.

Материалы и методы получения различных лекарственных форм известны в данной области и могут быть адаптированы для практического применения настоящего изобретения. Подходящие лекарственные формы для доставки антител приведены, к примеру, в "Remington's Pharmaceutical Sciences", E.W. Martin, 18th Ed., 1990, Mack Publishing Co.: Easton, PA.

Дополнительные биологически активные средства.

В некоторых воплощениях пептид изобретения является единственным активным ингредиентом в фармацевтической композиции настоящего изобретения. В других воплощениях фармацевтическая композиция дополнительно содержит одно или несколько биологически активных средств. Примеры подходящих биологически активных средств включают, без ограничения, антиапоптозные средства, противовоспалительные средства, иммуномодуляторные средства, анальгетики, противомикробные средства, антибактериальные средства, антибиотики, антиоксиданты, антисептики и их комбинации.

В некоторых воплощениях дополнительные биологически активные средства выбираются из группы, состоящей из циклоспорина A, BH4 и их комбинаций.

В таких фармацевтических композициях можно комбинировать антиапоптозный пептид по изобретению (либо его производное или его конъюгат) и дополнительные терапевтические средства в одном или нескольких препаратах для одновременного, раздельного или последовательного введения различных компонентов. Более конкретно, композиция по изобретению может быть составлена таким образом, чтобы пептид (либо его производное или его конъюгат) и эти терапевтические средства можно было вводить одновременно или независимо друг от друга. Например, пептид (либо его производное или его конъюгат) и терапевтическое средство могут быть заключены вместе в одной композиции. С другой стороны, они могут содержаться (например, в различных композициях и/или контейнерах) и вводиться по отдельности.

ПРИМЕРЫ

В следующих примерах описаны некоторые предпочтительные способы практического применения настоящего изобретения. Однако следует иметь в виду, что эти примеры представлены только в целях иллюстрации и не должны ограничивать объем изобретения.

Синтез мембраносвязанных наборов инвертированных пептидов

Пептиды синтезировали на мембранах из N-модифицированного CAPE (Bhargava et al., Mol. Recognit, 2002, 15: 145) и получали при помощи робота MultiPep SPOT (INTAVIS Bioanalytical Instruments AG, Cologne, Германия). Разработка набора осуществлялась с помощью внутрифирменной программы LISA 1.71. Синтез начинали с определения пятен по стандартной методике [Frank, Tetrahedron, 1992, 48: 9217), с последующей конденсацией раствора Fmoc-цистеина-(Trt)-Opfp (0,3 М) в N-метилпирролидоне (NMP) и Fmoc-аланина-Opfp (двойная конденсация, каждая реакция по 15 мин). После отщепления Fmoc пиперидином в DMF (20%) добавляли 4-гидроксиметилфеноксиуксусную кислоту (НМРА), растворенную в диметилформамиде (DMF, 0,6 М раствор) и активированную EEDQ (1,1 экв.), и образцы наносили непосредственно на мембрану (4 × конденсация, каждая реакция по 15 мин). Мембрану ацетилировали уксусным ангидридом в DMF (2%), промывали DMF (5×3 мин), этанолом (2×3 мин) и диэтиловым эфиром (2×3 мин), а затем высушивали на воздухе. На мембрану наносили растворы Fmoc-аминокислота-OH (0,4 М), активированные 1,1'-карбонилдиимидазолом (CDI, 3 экв.) в DMF (4 × конденсация, каждая реакция по 15 мин). Пролин, тирозин и глутамин активировали с помощью 1,1'-карбонилди(1,2,4-триазола) (CDT). Из пятен удаляли группу Fmoc, а последовательности пептидов завершали по стандартной методике SPOT-синтеза (Frank, Tetrahedron, 1992, 48: 9217) с последующим присоединением N-концевой метки - β-аланина.

Для стандартного SPOT-синтеза использовали Fmoc-aa-Opfp со следующей защитой боковых цепей: E-, D-(OtBu); C,- S-, T-, Y-(tBu); K-, W-(Boc); N-, Q-, H-(Trt); R-(Pbf). Для тиоэфирной циклизации все пептиды подвергали N-ацетилированию с помощью 2,4-динитрофенилового эфира бромуксусной кислоты в DMF (1 М) (двойная конденсация, каждая реакция по 15 мин).

Мембрану промывали DMF (3×3 мин) и дихлорметаном (DCM, 3×3 мин) и высушивали. Для реакции циклизации тритиловую защитную группу боковых цепей цистеина отщепляли трифторуксусной кислотой (TFA, 7%), H2O (2%) в DCM (1×5 мин), а затем TFA (7%), TIBS (3%), H2O (2%) в DCM. Мембрану промывали DCM (3×3 мин), DMF (2×3 мин) и DMF (2×3 мин). Пептиды подвергали циклизации в течение ночи путем обработки 25% водным Cs2CO3/DMF (1:1). Мембрану промывали DMF (2×3 мин), H2O (2×3 мин), этанолом (2×3 мин) и диэтиловым эфиром (2×3 мин), а затем высушивали на воздухе.

Гидролиз и деблокирование боковых цепей осуществляли однократной обработкой TFA (60%), TIBS (3%) и H2O (2%) в DCM в течение 2,5 ч без встряхивания, с последующими стадиями промывки (DCM 3×3 мин, DMF 3×3 мин, этанол 3×3 мин, диэтиловый эфир 2×3 мин), а затем TFA (90%), TIBS (3%) и H2O (2%) в DCM в течение 30 мин без встряхивания. Мембрану промывали DCM (3×3 мин), DMF (3×3 мин), этанолом (2×3 мин), фосфатным буфером (рН 7,4, 0,1 М, 2×3 мин), H2O (2×3 мин), этанолом (2×3 мин) и диэтиловым эфиром (2×3 мин), а затем высушивали на воздухе.

Разработка и получение фрагментов по изобретению

Первичную последовательность белка DAXX (SEQ ID NO: 1) нарезали на перекрывающиеся 15-мерные пептиды (со сдвигом в 3 аминокислоты), и все пептиды (243 пептида) синтезировали на целлюлозной мембране методом SPOT-синтеза, как описано выше. Библиотеку пептидов инкубировали с His-теговым внутриклеточным участком Fas-рецептора (Sigma). Взаимодействие между Fas и пептидами определяли при помощи сэндвича анти-His(мышь) / против мыши с HRP, а сигналы проявляли на Lumilmager (Roche), как показано на фиг.1A. Было обнаружено, что пятно №211 (SEQ ID NO: 2) проявляет наибольшую интенсивность сигнала, а пятна №№209, 210 и 212 (SEQ ID NO: 3, SEQ ID NO: 4 и SEQ ID NO: 7, соответственно) включают минимальную последовательность эпитопа (KSRKEKLKQT).

Тем не менее, анализ длины последовательностей 15-меров KSRKEKKQTGSGPLG (пятно №211, SEQ ID NO: 2) и SGPPCKKSRKEKKQT (пятно №209, SEQ ID NO: 3) показал, что невозможно произвольно укоротить эти последовательности до минимального эпитопа, приведенного на фиг.1. Методом SPOT-синтеза, представленным выше, анализировали влияние длины пептида путем укорочения данных последовательностей с N-конца, C-конца и в обоих направлениях (фиг.2A). Последовательности пептидов, проявляющих самые высокие интенсивности сигнала, приведены на фиг.2B.

Делали совмещенную комбинацию из дающего наибольшую интенсивность сигнала DAXXp-211 и DAXXp-209, которая соответствует 16-мерному пептиду (KKSRKEKKQTGSGPLG), именуемому пептидом DAXX или DAXXp (SEQ ID NO: 5). Было установлено, что DAXXp обладает существенной антиапоптозной активностью in vitro и in vivo.

Можно удлинить пептид с C-конца в соответствии с тем, что доминантный негативный белок (DAXX-DN) [Roubille et al., Circulation 2007, 116: 2709-2717] охватывает область от пептида DAXXp-211 до C-концевого участка белка DAXX (фиг.1B).

Применение при AMI

Петиды DAXXp, конъюгированные с CPPs или нет, тестировали на предмет антиапоптозной активности на первичных кардиомиоцитах и на их способность уменьшить размер инфаркта у мышей на хирургической модели I/R после системного введения.

Оценка in vitro

На первом этапе измеряли захват клетками пептидов, перечисленных в табл.1, на первичной клеточной культуре кардиомиоцитов мыши методом проточной цитометрии (FACS - с CF-меченными пептидами), и установили отсутствие цитотоксичности.

Таблица 1
Пептиды CPP и конъюгаты CPP-DAXXp, использовавшиеся в этом исследовании
Название Последовательность А.к.
Tat GRKKRRQRRRPPQ-NH2 13
(RXR)4 (RXR)4-NH2 12
Bpep RXRRBRRXRRBRXB-NH2 14
Pip2b (RXR)3-IHILFQNrRMKWHK-NH2 23
Tat-DAXXp GRKKRRQRRRPPQ-KKSRKEKKQTGSGPLG-NH2 (=SEQ ID NO: 58) 29
Tat-ncDAXXp GRKKRRQRRRPPQ-AKLYVYINELCTVLK-NH2 (ncDAXXp=SEQ ID NO: 13) 29
Tat-scrDAXXp GRKKRRQRRRPPQ-KKGRKQSGESLGTPKK-NH2 29
(RXR)4-DAXXp (RXR)4-KKSRKEKKQTGSGPLG-NH2 28
Bpep-DAXXp RXRRBRRXRRBRXB-KKSRKEKKQTGSGPLG-NH2 30
Pip2b-DAXXp (RXR)3-IHILFQNrRMKWHK-KKSRKEKKQTGSGPLG-NH2 39
DAXXp KKSRKEKKQTGSGPLG-NH2 (SEQ ID NO: 5) 16
Tat-DAXXp 13 GRKKRRQRRRPPQ-RKEKKQTGSGPLG-NH2 (DAXXp13=SEQ ID NO: 14) 26
mDAXXp KRFRKEKKQLGSGLLG-NH2 (SEQ ID NO: 15) 16
scrDAXXp KKGRKQSGESLGTPKK-NH2 (SEQ ID NO: 16) 16
Tat-mDAXXp GRKKRRQRRRPPQ-KRFRKEKKQLGSGLLG-NH2 (SEQ ID NO: 61) 29
Pip2b-mDaXXp (RXR)3-IHILFQNrRMKWHK-KRFRKEKKQLGSGLLG-NH2 39
X = аминогексановая кислота, B = β-аланин, r=D-аргинин; для измерения методом FACS пептиды метили по N-концам (5,6)-карбоксифлуоресцеином (CF); все пептиды подвергали C-концевому амидированию. scr = смешанный вариант DAXXp; mDAXXp - мышиный гомолог DAXXp человека

Другие производные CPP-DAXXp, которые тоже изучали, представлены ниже в табл.2.

Таблица 2
Дополнительные производные CPP-DAXXp
Название Последовательность
Tat-DAXXp GRKKRRQRRRPPQ-KKSRKEKKQTGSGPLG-NH2 (SEQ ID NO: 58)
Tat-DAXXp-209 GRKKRRQRRRPPQ-SGPPCKKSRKEKKQT-NH2
Tat-DAXXp-210 GRKKRRQRRRPPQ-PCKKSRKEKKQTGSG-NH2
Tat-DAXXp-211 GRKKRRQRRRPPQ-KSRKEKKQTGSGPLG-NH2
Tat-DAXXp-212 GRKKRRQRRRPPQ-KEKKQTGSGPLGNSY-NH2
Tat-DAXXp GRKKRRQRRRPPQ-KKSRKEKKQTGSGPLG-NH2
Tat-DAXXp-15 GRKKRRQRRRPPQ-KSRKEKKQTGSGPLG-NH2
=Tat-DAXXp-211
Tat-DAXXp-14 GRKKRRQRRRPPQ-SRKEKKQTGSGPLG-NH2
Tat-DAXXp-13 GRKKRRQRRRPPQ-RKEKKQTGSGPLG-NH2
Tat-DAXXp-9 GRKKRRQRRRPPQ-KSRKEKKQT-NH2

Кроме того, проверяли возможное взаимодействие фрагментов с внутриклеточным участком рецептора Fas путем измерения сродства связывания (Kd) методом поверхностного плазмонного резонанса (SPR) (Biacore Life Science, Швеция). Значения сродства связывания самого фрагмента и его конъюгатов с CPPs приведены в табл.3.

Таблица 3
Значения сродства связывания (Kd в мкМ) использованных конструкций
Название Последовательность Kd±SD [мкМ]
DAXXp KKSRKEKKQTGSGPLG-NH2 333±62
mDAXXp KRFRKEKKQLGSGLLG-NH2 252±64
scrDAXXp KKGRKQSGESLGTPKK-NH2 >6000
Tat-DAXXp GRKKRRQRRRPPQ-KKSRKEKKQTGSGPLG-NH2 13±9
Tat-scrDAXXp GRKKRRQRRRPPQ-KKGRKQSGESLGTPKK-NH2 н/о
Tat-DAXXp13 GRKKRRQRRRPPQ-RKEKKQTGSGPLG-NH2 н/о
Pip2b-DAXXp (RXR)3-IHILFQNrRMKWHK-KKSRKEKKQTGSGPLG-NH2 0,7±0,2

Все эксперименты проводили на приборе Biacore. Для каждого условия приведено среднее значение из трех независимых опытов и соответствующее стандартное отклонение.

После этого оценивали способность этих пептидов ингибировать апоптоз, индуцированный стауроспорином. Апоптоз определяли с помощью набора Cell Death detection ELISAPLUS kit (Roche) по измерению фрагментации ДНК.

В большинстве публикаций антиапоптозные пептиды, которые сейчас доступны, вводятся за 3-4 ч перед индуцированном апоптоза, что плохо сочетается с клиническим применением. По этой причине использовавшаяся в настоящем изобретении методика включает введение пептидов вместе со стауроспорином. На фиг.5B четко видно снижение фрагментации ДНК в первичных кардиомиоцитах на 44% при использовании Tat-DAXXp и на 55% при использовании Pip2b-DAXXp соответственно. Этого не наблюдалось при использовании одного лишь CPP или отрицательных контролей Tat-scrDAXXp или Tat-ncDAXXp. Степень улучшения рассчитывали согласно указаниям поставщиков (фрагментация ДНК в обработанных клетках/фрагментация ДНК в необработанных клетках). Для лучшего сравнения результатов фрагментацию ДНК (которую отражает степень улучшения) выражали относительно обработанных стауроспорином клеток (=100%).

Антиапоптозные эффекты пептидов также анализировали на мышиных клетках NG118-15 (модель для нейрональных клеток) (фиг.5D), на мышиных клетках C2C12 (модель для мышечных клеток) (фиг.5A) и на крысиных клетках H9c2 (модель для сердечных клеток) (фиг.5C). Наибольшее снижение фрагментации ДНК наблюдалось при использовании Bpep-DAXXp на NG118-15 (снижение на 66%), при использовании Tat-DAXXp на C2C12 (снижение на 24%) и при использовании Pip2b-DAXXp на H9c2 (снижение на 31%). Это четко показывает важность оптимального выбора CPP для соответствующего применения или биологического контекста.

Кроме того, определяли связывающий эпитоп белка FADD (SEQ ID NO: 8), как описано выше для эпитопа DAXX (подробности см. выше). Как видно из фиг.8A, пятно №11, соответствующее пептиду FADDp15 (VGKRKLERVQSGLDL; SEQ ID NO: 9), обладало наибольшей интенсивностью сигнала, а пятна №№10 и 12 (SEQ ID NO: 10 и SEQ ID NO: 11) имели такую же минимальную последовательность эпитопа, что и FADDp15.

Таблица 4
Последовательности производных белка FADD, конъюгированных с CPP-пептидом Tat
Tat-FADDp GRKKRRQRRRPPQ-KRKLERVQS-NH2 (=SEQ ID NO: 59)
Tat-FADDp15 GRKKRRQRRRPPQ-VGKRKLERVQSGLDL-NH2 (=SEQ ID NO: 60)

С помощью урезания библиотеки пептидов по длине определяли минимальный фрагмент FADDp15, который соответствует FADDp (SEQ ID NO: 12; KRKLERVQS) (см. фиг.8B). В кардиомиоцитах апоптоз снижался на 35% при использовании конъюгата Tat-FADDp и на 57% при использовании Tat-FADDp-15 (фиг.9).

Оценка in vivo

На втором этапе изучали кардиопротекторные эффекты DAXXp на модели ишемии миокарда с реперфузией in vivo. Острую ишемию миокарда и реперфузию проводили на мышах C57B16, которых подвергали обратимой закупорке коронарных сосудов на хирургической модели. Самцов мышей (22-28 г) анестезировали и подвергали легочной вентиляции через трахеотомическую трубку с помощью дыхательного аппарата Harvard. Температуру тела поддерживали между 36,8°C и 37,0°C с помощью терморегулируемого хирургического столика. Вскрывали грудную клетку посредством левосторонней торакотомии и обратимо пережимали левую коронарную артерию хирургической петлей. Мышей случайным образом распределяли по двум различным методикам хирургической ишемии миокарда с реперфузией (фиг.11). По окончании реперфузии артерию снова пережимали, вводили краситель фталоцианиновый синий в полость левого желудочка и давали ему пройти через неишемические участки миокарда. Для определения эффекта DAXXp на размер инфаркта миокарда пептиды вводили внутривенно (хвостовая вена) за 5 мин до реперфузии по методике хирургической ишемии с реперфузией. Контрольные группы получали пептид Tat или Pip2b (для CPP самих по себе). Была выбрана доза в 1 мг/кг (мкМ диапазон), но тестировали и ответы на 0,1 и 10 мг/кг.

По окончании реперфузии мышей снова анестезировали, коронарную артерию окончательно пережимали, вводили синий краситель, извлекали левые желудочки и проводили измерения размера инфаркта (методом TTC, Schwartz et al., J Thromb. Thromb., 2000; 10: 181-187) или фрагментации ДНК (набор Cell Death detection ELISAPLUS kit, Roche Diagnostics) для изучения кардиопротекторных эффектов на повреждения при ишемии-реперфузии. Полученные результаты представлены на фиг.12-15.

При внутривенном введении Tat-DAXXp (1 мг/кг) in vivo размер инфаркта после 1-часовой реперфузии уменьшался на 53,4% по сравнению с одним лишь пептидом Tat (p<0,01) (площадь зоны риска была соизмерима между группами; p=н.з., см. фиг.12A). Кардиопротекторное действие коррелировало с резким снижением специфической фрагментации ДНК - отличительным признаком апоптоза - в левых желудочках у получавших Tat-DAXXp мышей по сравнению с получавшими Tat мышами (см. фиг.12B). Кардиопротекторное действие не наблюдалось при введении Pip2b-DAXXp или одного лишь CPP либо отрицательного контроля Tat-scrDAXXp (данные не приводятся).

На фиг.13 представлена зависимость доза-эффект при введении Tat-DAXXp в дозах 0,1, 1 и 10 мг/кг, из которой видно, что максимальный эффект достигается при дозе в 1 мг/кг. При введении одного лишь DAXXp (10 мг/кг) (без CPP) он предохранял миокард путем уменьшения как размера инфаркта, так и фрагментации ДНК в такой же степени, как и Tat-DAXXp.

Кардиопротекторные эффекты Tat-DAXXp сохранялись при увеличении продолжительности реперфузии с 1 часа до 24 ч (см. фиг.14 и 15).

Конфокальная микроскопия показала, что CF-Tat-DAXXp (1 мг/кг) локализуется как в цитозоле, так и в ядре кардиомиоцитов левого желудочка (фиг.16).

Предварительные результаты, полученные при исследовании in vivo на модели трансплантации почек (у крыс), показали, что Tat-DAXXp (1 мг/кг) может предохранять от ишемических-реперфузионных повреждений и при других клинических применениях.

По всей настоящей заявке в различных ссылках описан уровень техники в той области, к которой относится изобретение. Содержание этих ссылок тем самым включено путем ссылки в настоящее описание.

1. Пептид, состоящий из:
- фрагмента из 16, 17, 18, 19, 20, 21, 22, 23 или 24 последовательных аминокислотных остатков белка DAXX последовательности SEQ ID NO: 1, причем данный фрагмент включает аминокислотную последовательность, приведенную в SEQ ID NO: 5, при этом данный пептид способен ингибировать апоптоз клеток.

2. Пептид по п. 1, при этом данный пептид является фрагментом белка DAXX и состоит из аминокислотной последовательности, приведенной в SEQ ID NO: 5 или в любой из SEQ ID NOs: 17-44.

3. Пептидомиметик пептида по п. 1, где указанный пептидомиметик имеет аминокислотную последовательность, которая по меньшей мере на 85% идентична аминокислотной последовательности указанного пептида, где указанный пептидомимиметик способен ингибировать апоптоз.

4. Конъюгат, включающий пептид по п. 1, где указанный пептид химически связан с проникающим в клетки пептидом посредством линкера, где указанный конъюгат способен ингибировать апоптоз клеток.

5. Конъюгат по п. 4, где проникающий в клетки пептид выбран из группы, состоящей из Tat, RXR, Врер и Pip2b.

6. Конъюгат по п. 5, при этом данный конъюгат состоит из аминокислотной последовательности, приведенной в SEQ ID NO: 58 или SEQ IQ NO: 61.

7. Конъюгат, включающий пептидомиметик по п. 3, где указанный пептидомиметик химически связан с проникающим в клетки пептидом посредством линкера, где указанный конъюгат способен ингибировать апоптоз клеток.

8. Конъюгат по п. 7, где проникающий в клетки пептид выбран из группы, состоящей из Tat, RXR, Врер и Pip2b.

9. Фармацевтическая композиция для применения в лечении заболевания или состояния, связанных с апоптозом, содержащая эффективное количество по меньшей мере одного пептида по п. 1 и по меньшей мере один фармацевтически приемлемый носитель или наполнитель и, необязательно, дополнительное биологически активное средство.

10. Фармацевтическая композиция для применения в лечении заболевания или состояния, связанных с апоптозом, содержащая эффективное количество по меньшей мере одного пептидомиметика по п. 3 и по меньшей мере один фармацевтически приемлемый носитель или наполнитель и, необязательно, дополнительное биологически активное средство.

11. Фармацевтическая композиция для применения в лечении заболевания или состояния, связанных с апоптозом, содержащая эффективное количество по меньшей мере одного конъюгата по п. 4 и по меньшей мере один фармацевтически приемлемый носитель или наполнитель и, необязательно, дополнительное биологически активное средство.

12. Фармацевтическая композиция для применения в лечении заболевания или состояния, связанных с апоптозом, содержащая эффективное количество по меньшей мере одного конъюгата по п. 7 и по меньшей мере один фармацевтически приемлемый носитель или наполнитель и, необязательно, дополнительное биологически активное средство.

13. Фармацевтическая композиция по любому из пп. 9-12, где заболевание или состояние, связанные с апоптозом, выбраны из острого инфаркта миокарда (AMI), церебрального инфаркта, трансплантации органов, операциях на сердце, острого нарушения кровообращения, реперфузионного повреждения и ишемии.

14. Фармацевтическая композиция по п. 13, где заболевание или состояние, связанные с апоптозом, является ишемией, выбранной из группы, включающей сердечную ишемию, почечную ишемию, ишемический колит, брыжеечную ишемию, ишемию головного мозга, ишемию конечностей или ишемию кожи.

15. Фармацевтическая композиция по любому из пп. 9-12, при этом данное по меньшей мере одно дополнительное биологически активное средство выбрано из группы, состоящей из циклоспорина А, ВН4 и их комбинаций.

16. Способ лечения заболевания или состояния, связанных с апоптозом, у субъекта, который включает стадии:
- введения данному субъекту эффективного количества по меньшей мере одного пептида по п. 1; и
- необязательного введения указанному субъекту дополнительного биологически активного средства.

17. Способ лечения заболевания или состояния, связанных с апоптозом, у субъекта, который включает стадии:
- введения данному субъекту эффективного количества по меньшей мере одного пептидомиметика по п. 3; и
- необязательного введения указанному субъекту дополнительного биологически активного средства.

18. Способ лечения заболевания или состояния, связанных с апоптозом, у субъекта, который включает стадии:
- введения данному субъекту эффективного количества по меньшей мере одного конъюгата по п. 4; и
- необязательного введения указанному субъекту дополнительного биологически активного средства.

19. Способ лечения заболевания или состояния, связанных с апоптозом, у субъекта, который включает стадии:
- введения данному субъекту эффективного количества по меньшей мере одного конъюгата по п. 7; и
- необязательного введения указанному субъекту дополнительного биологически активного средства.

20. Способ по любому из пп. 16-19, где по меньшей мере одно дополнительное биологически активное средство выбрано из группы, состоящей из циклоспорина А, ВН4 и их комбинаций.

21. Способ по любому из пп. 16-19, при этом заболевание, связанное с апоптозом, выбрано из группы, состоящей из острого инфаркта миокарда (AMI), церебрального инфаркта, трансплантации органов, операций на сердце, острых нарушений кровообращения, реперфузионного повреждения и ишемии.

22. Способ по п. 21, где заболевание или состояние, связанные с апоптозом, является ишемией выбранной из группы, включающей сердечную ишемию, почечную ишемию, ишемический колит, брыжеечную ишемию, ишемию головного мозга, ишемию конечностей или ишемию кожи.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению модифицированного vWF, и может быть использовано в медицине для лечения гемофилии.

Настоящее изобретение относится к области биотехнологии, конкретно к сконструированным полипептидам со связывающей сывороточный альбумин аффинностью, и может быть использовано в медицине.

Изобретение касается способа получения рекомбинантного белка SAV-RGD, где SAV - мономер стрептавидина, RGD - меланома-адресующий олигопептид, имеющий аминокислотную последовательность Ser-Arg-Ala-Gly-Ala-Asp-Gly-Phe-Pro-Gly-Cys-Arg-Gly-Asp-Cys-Ser-Gln-Glu.

Изобретение относится к области генной инженерии, конкретно к получению натрийуретического пептида C-типа (CNP), и может быть использовано в медицине. Получают пептид структуры PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37), который используют для лечения дегенеративных костных патологий, отвечающих на CNP.

Изобретение относится к области биотехнологии, конкретно к химерным полипептидам фактора роста фибробластов (FGF), и может быть использовано в медицине для лечения ожирения, диабета, высокого содержания глюкозы в крови, метаболического синдрома и гиперхолестеринемии.

Изобретение относится к области медицины и касается противогриппозной вакцины широкого спектра действия против птичьего гриппа А человека. Охарактеризованная вакцина содержит эктодомен белка М2, молекулярный адъювант и буферный раствор, взятые в эффективных количествах.

Представленная группа изобретений касается вирусоподобной частицы и способов ее использования и получения. Предложенная вирусоподобная частица, по существу, не содержащая нуклеиновую кислоту вируса, сформирована из слитого белка, включающего белок оболочки растительного вируса и белок-мишень.

Настоящее изобретение относится к области иммунологии. Предложено антитело и его антигенсвязывающий фрагмент, способные связываться с дельта-подобным лигандом 4 (DLL4) человека, в том числе в форме меченого антитела или его антигенсвязывающего фрагмента, конструкции с константным доменом иммуноглобулина, конъюгата с терапевтическим или цитотоксическим средством и в кристаллизованной форме.

Изобретение относится к области биотехнологии, конкретно к конъюгатам Apo A с терапевтическими полипептидами, и может быть использовано в медицине. Получают конъюгат, содержащий молекулу Apo A-I или ее функционально-эквивалентный вариант, такой как Apo А-IV или Аро A-V, ковалентно связанную с представляющим терапевтический интерес полипептидом, выбранным из интерферона, ингибитора TGF-бета Р144 или Р17, IL-15, кардиотрофина-1, порфобилиногендеаминазы, инсулина и фактора VII.

Изобретения относятся к области биотехнологии. Предложены: варианты моноклонального антитела против VEGF или его антигенсвязывающего фрагмента, которые характеризуются тем, что содержат 6 CDR и при этом возможно замену Т51А в CDR-L2, а также имеют одну или комбинацию замен по сравнению с антителом бевацизумабом, а именно: 1.

Группа изобретений относится к биотехнологии. Предложены способ производства лактоферрина, фракция, содержащая лактоферрин, и ее применения.

Настоящее изобретение относится к биохимии, в частности к применению антигенной композиции, включающей антигенный пептид, происходящий из амилоидного белка или амилоидоподобного белка для лечения заболевания, состояния или расстройства, которое вызвано или связано с указанным белком, в популяции пациентов, страдающих от недостаточности Т-клеток при индукции иммунного ответа.

Изобретение относится к области биохимии, в частности к способам получения гликозилированного конъюгата молекулы с повторяющимся мотивом для связывания с антителом, включающим стадии: 1) получение клеток; 2) культивирование клеток; 3) выделение гликозилированного конъюгата молекулы с повторяющимся мотивом из клеток; 4) необязательную очистку выделенного гликозилированного конъюгата молекулы с повторяющимся мотивом.

Изобретение относится к биотехнологии, а именно к способу очистки G-CSF (гранулоцитарный колониестимулирующий фактор) в последовательности очистки, применяющей хроматографию.

Представленная группа изобретений относится к области биотехнологии и касается способов сбора функциональных клеток (варианты). Охарактеризованные решения заключаются в имплантации имплантируемой медицинской емкости под кожу на срок не более двух недель, где популяция клеток мобилизована в емкость с помощью любого из белков HMGB1, HMGB2, HMGB3, S100A8, S100A9 или гиалуроновой кислоты или смеси любых двух или более из указанных.

Изобретение относится к новым молекулам-ингибиторам JNK, способам получения антител к указанным молекулам-ингибиторам JNK, а также к соответствующим антителам и клеткам, продуцирующим указанные антитела.

Изобретение относится к биохимии. Описаны способы определения наличия или метастазов опухоли, скрининга наличия опухоли среди популяции высокого риска, прогноза для пациента, имеющего опухоль, определения эффективности хирургического вмешательства, радиационной терапии или химиотерапии.

Изобретение относится к области биотехнологии, конкретно к получению вариантов плазминогена и плазмина, содержащих одну или несколько точковых мутаций в каталитическом домене, которые снижают или предотвращают аутокаталитическую потерю протеазной активности плазмина, и может быть использовано в медицине.

Изобретение относится к области иммунологии и медицины. Предложено пептидное производное для выработки в организме специфических антител, взаимодействующих с изоформой 2 фактора элонгации трансляции 1A (eEF1A2), но не взаимодействующих с изоформой 1 фактора элонгации трансляции 1A (eEF1A1), содержащее фрагмент аминокислотной последовательности eEF1A2 с 330 по 343 положения.

Настоящее изобретение относится к области биотехнологии. Предложено терапевтическое антитело и терапевтический фрагмент антитела для повышения продукции тромбоцитов, включающие пептид-миметик тромбопоэтина (ТРО), содержащий последовательность IEGPTLRQWLAARA и встроенный как дополнение к С-концу константной области легкой цепи и/или в положении менее 20 аминокислот ниже С-конца шарнирной области тяжелой цепи.

Изобретение относится к области медицины, а именно к применению 2-метилен-1,3-динитроксипропана в качестве противоишемического средства. 1 ил., 5 табл. .
Наверх